1T2KD

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
61
structure length
61
Chain Sequence
KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 31-MER
total genus 27
structure length 61
sequence length 61
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1t2kD00
2WPQA 5AW4B 3M0DA 2WT7A 5AW5B 1HBWA 5AVYB 3KQGA 2KP8A 2Q3IA 3NFQA 3OAKA 5APUA 3M9BA 1T2KD 1NWQA 3SWFA 5APSA 3I5CA 4LC1A 2P67A 3VTPC 3VN0A 3P8MC 2WPSA 2P7JA 1IO4A 1S9KE 3HE4B 5AVVB 2XV5A 1CI6B 4XE5B 1T2KC 3P32A 2E43A 3O8ZA 2Z5IA 3VYIA 4JYCA 3V4QA 3HE4A 3M06A 5AVWB 2Q7CA 1S9KD 4DZOA 1H89A 2IPPA 2ZXEB 1FOSF 1G2CB 5CMZA 5AW7B 2YO3A 1HUCA 3HE5B 4JYBA 3TYYA 1FAVA 3A7OA 5APXA 3TNUA 4B86A 1OXZA 2R32A 5AW9B 1DH3A 3M9HA 1CSBA 3HE5A 1A02F 2QM7A 4HYTB 3L36A 5APVA 4AUWA 4RESB 2R5DA 3MGNA 1GTWA 2VRSA 5AW2B 5APWA 1KQLA 2JJLA 3KDPB 4C7NB 3V5BA 4I2LC 4AYCA 2WTYA 5AW0B 2W6AA 3T97A 3M91A 1MV8A 2W27A 5AVRB 2E42A 3V4WA 2Q5UA 2C9NY 3VMZA 2XU6A 3IR9A 5AVQB 1GK6A 2YO2A 3VMXA 1YYCA 3L35A 2WT7B 5APYA 2XZRA 5AVXB 5AW3B 1GZLA 5AVSB 1JNMA 3A3YB 4GT1A 1NAFA 1JUNA 5AW1B 5AVZB 2H7HA 3P7KA 3NMDA 3M0AA 3LIDA 1H8AA 1GU5A 4KHXA 2Z5HA 3TNUB 3NTNA 4C46A 1J2JB 1FOSE 2WWWA 1CZQA 2YNYA 5AW6B 1A02J 2C9LY 1X8YA 2P2UA 3UIAA 4I6MC 1OWAA 2BASA 3MD0A 2R5BA 1MUUA 3B8EB 1SLQA 4C7NA 3A5TA 1HJBA 1HWTC 4GKGA 1GU4A 2N9BA 2QM8A 4EOTA 1GK4A 5APTA 2ZFCA 5AVUB 3NXSA 1SP4A 2R3CA 4M3LA 1H88A 1GD2E 1CI6A 3A2AA 5APQA 2WPRA 3TK1A 3LIEA 3L37A 3VMYA 3HTKA 5AVTB 1MFZA 4AQRD 5AW8B
chains in the Genus database with same CATH superfamily
1Q2NA 2K1AA 3IF4A 2WT7A 1Q82Q 1S3JA 1VQ6P 2E75D 1J1EC 1SQBJ 4ZKUA 2KP8A 3NFQA 3MIWA 5EFWB 1PIXA 3M9BA 1L0NE 4N78E 5GTHH 1J1DC 1OW8A 3I5CA 5APSA 3AEAC 2KNCA 2YMKA 3VN0A 2E75C 3TF5A 5KAFH 3AE7C 2P1JA 1UIXA 3A0HH 1IO4A 1EXJA 1VL2A 2UWJE 2E5TA 3HD7B 2H8PD 3HE4B 1RY3A 1YTZT 2DW3A 2H89C 1OVUA 1T2KC 1QVGO 2Z4EA 2Z5IA 3L74J 3VYIA 1NAYA 1KILC 2QRXA 5AVTB 1G2CA 2OTJP 2CK3H 1FOSF 1K04A 1EZVD 2HODA 1OVVA 3AEFC 1G2CB 2J58A 2FYZA 1LJ2A 1VF5B 3HE5B 2KS1B 4ASWA 4Z1MH 5KTBA 1PGQA 4TT3H 2YKPA 2IBZD 1J1DB 2B89A 1LT9C 1OXZA 4IOIH 3TNUA 1ZR2A 1AQTA 2E75B 1S4XA 3AEBC 1LTAC 3II6A 4WBAA 3VOPA 3BVHA 2IX7C 2A45G 1SQPK 2AEFA 2W6BA 1FC2C 3AE5C 3L73G 3RL0B 3USSA 1BGYD 2IZ1A 5APVA 4D6TJ 2AXCA 3B71A 1VQLP 2B9BA 1KILA 1NHLA 2R5DA 1NTMG 1BSHA 5KJ7D 3H1JG 3T97B 5B5EE 5CCGD 1FZCC 2ZT9D 5K5GB 3CCJP 4JBZA 3V2RA 3SWYA 4U7JA 3CCRP 2OYOA 4CPGA 1LTJB 5KAIH 3RK3C 1LTSC 1AA0A 1FDIA 4YXDC 2MJZA 3V4WA 4NPEA 1RE4C 1N7SA 2AXTE 1NGMB 2C9NY 1M90Q 1LT9B 1LP1B 3H1HJ 3ITKA 1NTME 1YHQP 3D70A 1KB9H 2R44A 2WSFJ 1VQ5P 2OYHA 4H44D 1N86A 5APYA 5AVXB 1SFCC 3CXHE 3L74E 3L73E 1HVVA 1MFTA 1NTMD 2FXPA 4D6TG 1S5LH 5CCHD 1GZLA 5KLVE 4QMAA 1WMKA 3AEGC 3L72G 1KB9I 5KAIE 3A3YB 1NH4A 1NTMK 1IFIA 3L75J 2A06E 1AJYA 1IK9A 1BDDA 3RBZA 4H13D 3AE6C 3G4SP 2FFDC 1VQMP 1QVFO 2NPSB 1VQKP 1SQPD 3H1KD 2OARA 3LW5J 4U3FD 1UIIA 2QE7H 2I1JA 2QJKB 1NVOA 2R3SA 4R4LA 1PZQA 4H44C 2HR3A 1SQQK 2Q1KA 2OYIC 3H1HD 1J2JB 3MP7B 3P8CE 1DD4A 3L71G 2YMYA 2YNYA 2ZXXA 1OFCX 3HUSB 2ZYGA 1A02J 1PPJD 3CPWO 2C9LY 1N7SD 2FYUD 2PP6A 1JEKA 2A06G 4H13B 1KB9E 1RF0C 2WPVB 4I6MC 3KXDA 1EXIA 2BASA 2OGUA 4WVZA 4C7RA 4Y99B 3AE8C 3B8EB 3PTZA 1X22A 2HPCA 1VQ9P 1H0TB 1HWTC 3GLMA 4GKGA 2N9BA 2FFDB 1GU5A 1FZAA 2IFMA 2IZ0A 2E76C 4OH8B 5APTA 2KNCB 1DEBA 3CMEP 2ZT9B 1CW5A 4MN4C 2XNDH 1H88A 2OYIB 1SQVE 2NPSD 1RF1C 2YIUB 1LWUB 3A0HE 4UB8E 3Q5SA 4W7ZA 1IC2A 1LTBC 2KZIA 2A45H 1AV1A 2W8ZA 4DT0A 3FWLA 2M5AA 1SQVD 2WZ7A 5KLVJ 1EDIA 2C0WA 3HRNA 4KJMA 1YBKA 4YXWH 3CCMP 1RHZB 2M5AB 4ZKPA 3H32A 3IN6A 1SVFA 2WPQA 3HD7D 5AW8B 3E1RA 1EQ7A 3W67A 3CC7P 1HGZA 5AW4B 3M0DA 5KAFE 2QG4A 2IYOA 4WY4A 5AW5B 1VQOP 4EYYQ 3OAKA 1J1EB 1LTGC 3QH9A 1T2KD 1NWQA 2J59M 2KSEA 2P67A 4IL6H 2KZJA 2O01J 2WPSA 2ZYDA 3KPEA 1KC8Q 3TGUJ 2E74C 2RN0A 2NRGA 1ZLLA 3MZWB 3G9RA 5CCHA 1LNQA 1SQVJ 2K9JB 2HPCB 4PJ0E 1EDJA 1H0TA 4PD4H 1RH5B 3HD7C 1K05A 1PGOA 3KYQA 3P32A 3Q3DA 2B87A 3CD6P 3V6IA 3H25A 5AVWB 5KKZB 3WUVA 3HD7A 3L75D 1L0NK 2N1TA 2ZXEB 1USDA 5GTHE 3BATA 1NTMJ 1N8RQ 4EI2A 3U1CA 2PRRA 2KB7P 2RMZA 1OIPA 2CPBA 5L8RJ 1HUCA 4JYBA 4WB4A 2CPSA 1SQVK 1FAVA 1BCCD 5AW9B 1L4AA 3E1IA 3V2QA 1KQGB 1W2EA 3M9HA 2ZYAA 1CSBA 3HE5A 1NTKG 1PFIA 3RK2C 1R5LA 1Z56A 3GW6A 3L36A 4BRYB 4D6TE 5KLVG 1SFCB 1U7JA 2BCCG 3V2NA 3CCUP 3L72E 4Y28J 3WUTA 1M1JC 3MGNA 1GTWA 1EDLA 1M8OB 2VRSA 2JWDA 3L75G 1OMIA 1VQNP 1NYHA 5APWA 1KQLA 1L0LE 2HFED 2JJLA 3KDPB 3V5BA 4GDOA 4HH2A 4WWIA 1E5WA 1BE3J 3SWKA 2W6AA 2O1KA 1LP1A 3M91A 5KLVK 4UB6H 3S1KA 1S5LE 3RK3B 2QJKC 1SQXJ 1GL2D 2HLOA 1BCCG 2M8RA 3JCUE 4YPCA 3I56P 2QVAA 2BEQD 2BCCE 3M9QA 3VMZA 4IFDK 1SFCA 1NTZE 2QSIA 3IR9A 1IJDB 1FDMA 3TDKA 1GK6A 2O3JA 3L73D 2JKVA 3HUSC 1MKMA 1YYCA 2G3AA 3L35A 3C8VA 3U59A 1PPJG 5B66H 2KLVA 4H13C 1NTKE 2WT7B 3PH0A 2KLUA 3D6ZA 3L70J 2W83C 3PHLA 3AE3C 1ZW0A 5DJUB 5H2FE 5CCGA 5AVSB 1W2BO 1NTZK 2MKVA 3KZIH 3D71A 3Q1MA 3AE9C 1KFMA 1JY3O 1HH0A 1NAFA 3H1JJ 3N7NA 1JY3P 1N7LA 3V2PA 5CCHC 1Y9BA 3L75E 1YQ4C 1DX7A 1USEA 2I8DA 5TISE 2E76B 2E74D 2K37A 2JEEA 2XNXA 3NMDA 2OYIA 2B87B 1H8AA 1FU1A 2K9YA 2QJYB 2FYUK 3AEEC 3MTUE 4WY4D 1SQBE 3NTNA 3TNUB 1DD3A 1FZGA 1W5CE 3AE1C 3E7KA 4XFJA 1N2DC 1G1JA 1LWUC 1WT6A 2P58A 2YXRB 4DCKA 1YJNP 1CZQA 1FOSE 1X8YA 1KYOH 5E79H 1Y8AA 3L70D 2K88A 5GTIH 2E5YA 1GL2C 4D6TD 2FXOA 1PPJE 1SQBK 1L4AB 2KYVA 3L72D 3SFDC 1JY2O 4PD4D 1FS0E 3L70E 4WY4B 1KB9D 2QEXP 4L74A 1QGKB 3Q5RA 2GM4A 1PP9J 4L75A 1HJBA 2WSFH 5KJ7A 3GHGC 3MUDA 3A0BE 3F89A 2V4HA 4BXLA 3BASA 3L71E 1URQB 1GK4A 5AVUB 5CBNA 2JP3A 1EC5A 2IDBA 3JSVC 1N7SC 2YKQA 3CX5D 3JCUH 3QWOC 1K73Q 1P84D 1R8EA 2E74B 1NTKK 2E76D 1QL2A 4W80A 2W6JH 1SQXG 1S2EA 3GMAA 2A06D 4NPDA 3CX5E 2WPRA 2PAJA 1LTTC 3WU2H 1GL2B 3ZDMA 4EIJA 1OX3A 3TK1A 3CCVP 3CWBD 3LIEA 3L37A 3HTKA 2Y0DA 4WY4C 1RQUA 1MFZA 1BSNA 1ZP0C 2KI7B 2Q6QA 4RO0A 3RL0g 1M56D 2D2CB 1U7MA 4OWFA 1KILE 2LXCB 1MZ9A 4GOFA 1HBWA 2L5GB 4L76A 3U1AA 1BGYJ 1GW4A 1IFJA 1URQC 1IK7A 4EDFA 4R4MA 2K3RA 1K8AQ 2H88C 1PP9D 3OA7A 1FZEA 3P8MC 1RE3C 2FBWC 2P7JA 1URQD 2POHA 3CX5I 3EQ2A 3AEDC 5KLIC 3RBXA 1T3UA 4BRYA 1LGHB 2FY8A 1S9KE 1NKZB 1ZV8A 5AVVB 2BCCD 1IFPA 2V7QJ 4XE5B 3CCLP 3OJAB 3CWBG 2E43A 3L73J 3O8ZA 1L0LG 1P84H 1QL1A 3HE4A 3M06A 1S9KD 3CI9A 1NU1K 2IPPA 3Q2YA 1KILB 5CHXA 1SFCD 4PD4E 3GF7A 3N4XA 2L91A 1SQPE 4U3FE 3WMM0 3CCSP 1VQ4P 5CMZA 2YO3A 1JO5A 4IFFA 4GOEA 3TYYA 1RF0A 5APXA 3IAOA 1EZVE 2G8YA 4H0LB 3A0BH 1DH3A 2KS1A 2IYPA 1T8ZA 5KKZC 1M57D 1K9MQ 5BVZA 2FYUE 3M0DC 1A02F 2QM7A 3AE4C 2GUVA 1Q90D 1GW3A 3H1LE 4HYTB 3RK3D 1HTLC 2QJPB 1FBMA 2XDJA 3RL0C 1NKNA 1TU3F 1FZCA 4RESB 4AUWA 4DOJA 1RE3A 4RKUJ 3CL3D 5AW2B 1M1JB 1LTJA 2KSJA 3W68A 1JY3N 1AQ5A 4C7NB 1EZVG 2KOGA 1JCDA 4I2LC 4AYCA 3TGUE 1DEEG 1OW6A 4JF7A 5CJ4A 4PV1C 1MV8A 1SQBG 1LT9A 1LTJC 2W27A 1ZR4A 1BE3D 2E42A 1SQPG 2QJYC 4U3FG 2IBZG 1VPCA 1Q86Q 1HJ0A 1VQ8P 1KMIZ 1SQXK 2BEZF 3FGAD 1JB0J 2HG5D 2XU6A 3H1IJ 4H0LC 4OGQC 1RE4A 1NTKD 5CJ0A 3CC2P 2J5UA 1T6AA 2YO2A 2OQQA 3MHVA 4ZMDA 1QLED 4L73A 2FYUJ 4BWNA 2FYUG 2QJPC 2SPZA 2M3EA 2XZRA 1AVYA 2ZVNB 5H2FH 3SFEC 1L4AC 3H1JD 3S9OA 2QIWA 2ZJSE 2W90A 1XTCC 1JUNA 1BCCE 1NOHA 5AW1B 1YI2P 3SSUA 3G6EP 1R5SA 1NTZG 1SQBD 1L4AD 3P7KA 3M0AA 1LTIC 3LIDA 1SQQJ 3CLQA 4HKZH 4KHXA 3LW5H 1NTKJ 3G3ZA 1FE6A 1KN7A 2YXQB 1FDOA 4N6JA 4RJTA 3H1LJ 3K5BA 1GL2A 2GA1A 5AW6B 3UIAA 2AEMA 3OW2O 2Q3EA 1KQSO 3KHUA 1JTHB 4I7ZB 1LWUA 4Y99C 3D6YA 4H0LD 1NU1D 3KZIE 4JPZB 3MD0A 1D7MA 3AE2C 1KYOI 2NPSA 1YIJP 1T3JA 1SLQA 3L72J 3BCCJ 2D2CC 1IFNA 1NTZD 1X79B 1NU1E 3PRJA 5B66E 1GU4A 2QM8A 2M3BA 3RK2D 1N73C 2HYNA 3B5ND 3BRTB 3GG2A 2IBZI 2JO1A 3H1IE 2ZT9C 3NXSA 3PP5A 3L71J 1YITP 1ZN5A 1RF1B 1GDTA 2AXTH 1Y47A 1G1IA 1X9VA 2D2CD 3H1HG 4M3LA 3BCCE 1GD2E 2WSCH 1SQQG 3CWBJ 3Q5PA 3FXEA 3L70G 1SQPJ 1IFDA 2LR2A 4U3FJ 1SS1A 4ZNCA 2YKOA 4LGDE 4PD4I 2PGDA 3B5NB 4PJ0H 1L0LD 5C39A 2HODB 3EFGA 4OVNF 3WUUA 3FX0A 4AQRD 4K35A 2JR8A 2LKMA 3GHGA 4GIFA 3CCQP 1EZVI 1L0ND 4N78D 1S5LX 5AVYB 3KQGA 1YTZI 3H32B 2Q3IA 1SQQE 3FWNA 5APUA 1Q7YQ 1PGJA 2KIKA 3WU2E 1VDFA 1SQXE 1KILD 4LC1A 2FYNB 2JDIH 3VTPC 3CCEP 3MUDC 3H1LG 1URQA 1JM0A 1AFOA 2WITA 3H1IG 4HJGH 1DIPA 1NJIQ 1PGPA 2FKWB 1PL5A 3P8CD 2H43A 3VMAA 5KLIB 2XV5A 1CI6B 3O6QB 3CX5H 4OGQD 3RGUA 1M1JA 4JYCA 3V4QA 2FXMA 1H89A 2Q7CA 4DZOA 1ZRTE 3H6PA 3TGUG 4IFMA 1L2PA 1YJ9P 3L74D 1JMBA 4W7YA 3H1KJ 4PV1B 5AW7B 3H1JE 3CMAP 4YTPC 3R2PA 3F5HA 1VQPP 5TJHA 4O9BA 5BU5A 3A7OA 4B86A 4DJGA 1PP9G 2WSEH 5CCGC 2R32A 3H1LD 2FYNC 3RK3E 4OGQB 2OTLP 4LLHA 1FJPA 1WRGA 2O1JA 3O6QA 1NO4A 3CWBE 1BDCA 3B4SA 1IZNB 3HUSA 5KJ7C 3RK2B 3PLNA 3VP9A 5GTIE 2Y0EA 3S4RA 5E79E 1KD1Q 3TGUD 2WQYC 3JC22 1OVRA 5CBOA 2XKMA 4N3YB 3L74G 1PP9E 1KZUB 2KK7A 5DJTB 4ASVA 1OW7A 2WSCJ 5AW0B 2WTYA 3T97A 2N9YB 2WSEJ 4UB8H 2KUBA 4I1LA 5AVRB 1VF5C 5BU8B 4EOTA 3EFFK 1FZBA 1X0TA 2Q5UA 3ABVC 4NPFX 5TISH 1GMJA 3GF3A 2QA4P 3CXHI 1ZOYC 2PFXA 3I55P 2N1TB 5AVQB 1IFMA 1XTGB 3C1LA 3CXHD 3VMXA 1BGYG 1LT1A 5KLVD 2B88A 1KYOE 1FZFA 2BCCJ 2WVRA 2Y9YA 3C9IA 3CXHH 5M1BA 5AW3B 1N73A 2V7QH 3B5NA 2JWAA 1JNMA 3VP8A 4JQ0D 1FZCB 1KYOD 2FFDA 4A7PA 4GT1A 1YQ3C 2IBZE 3FXDA 3H1KE 2KXPB 1ZRTD 5AVZB 1VQ7P 2H7HA 1QX8A 1L0LJ 2M0BA 2ZAEB 2C0XA 2WSSH 1BE3G 3H1HE 1HGVA 4H44B 1BGYE 2ZVOB 1KQFB 3BCCG 2Z5HA 1JCCA 1P84I 4HB1A 4C46A 1JTHA 4KT0J 2WWWA 2OYHC 2N1TC 1KORA 1SQQD 5B5EH 2P2UA 4PV1D 2WMMA 2IFNA 3R4YA 3CC4P 1SQXD 1OZHA 1S1CX 2Q9IA 1VF5D 1SQVG 1JY2N 1OWAA 3B5NC 1AVOA 2RH0A 4TLFA 1ZXGA 1EDKA 2OTKE 1U57A 4I7ZC 4XA4A 2R5BA 1KV4A 1BE3E 2O01H 3TSIA 1JMMA 1MUUA 3GHGB 4C7NA 3SWFA 3A5TA 1YJWP 1QEXA 4UB6E 1ZMEC 3RL0D 1L0NG 1NU1J 2AEJA 1RQVA 2LXBA 1KFNA 1Q81Q 3HTKB 1FJKA 1P84E 3H1KG 1NTZJ 2GUSA 2NPSC 2O01N 2ZFCA 1SP4A 1N7SB 3AECC 3BCCD 1N73B 3EWKA 2R3CA 2I1KA 1M7LA 2ITAA 2YIUC 3IFMA 3L71D 4IL6X 3BRVB 1CI6A 2NZ2A 3H1ID 3G71P 2OYHB 2K9JA 1E79H 2A45I 2Y9ZA 1BCCJ 4K3AA 3A2AA 3L4FA 3PJSK 4IL6E 5APQA 1RF1A 2RKLA 2Y0CA 1M1KQ 1HF9A 1S72P 1L0NJ 1NU1G 1JY2P 1JOCA 1PV3A 3VMYA 1L0LK 1KTMA 2N1TD 4GODA 2P10A
chains in the Genus database with same CATH topology
2WT7A 1J1EC 4ZKUA 2KP8A 3NFQA 3MIWA 3M9BA 4N78E 3SWFA 1J1DC 3I5CA 5APSA 3VN0A 2P1JA 1IO4A 3HD7B 2H8PD 3HE4B 1RY3A 1YTZT 1T2KC 2Z4EA 2Z5IA 3VYIA 1KILC 5AVTB 1G2CA 1FOSF 2HODA 1G2CB 2J58A 2FYZA 3HE5B 5KTBA 2YKPA 3TNUA 1J1DB 1LT9C 1OXZA 1ZR2A 3II6A 1LTAC 4WBAA 3VOPA 3BVHA 2IX7C 2A45G 1SQPK 2W6BA 3RL0B 5APVA 1KILA 1NHLA 2R5DA 5KJ7D 1FZCC 5CCGD 3V2RA 3SWYA 1LTJB 3RK3C 1LTSC 2MJZA 3V4WA 1RE4C 1N7SA 2C9NY 1LT9B 2OYHA 1N86A 5APYA 5AVXB 1SFCC 1HVVA 5CCHD 1GZLA 3A3YB 1NH4A 1NTMK 1IFIA 1IK9A 2FFDC 2NPSB 2OARA 2I1JA 1SQQK 2OYIC 1J2JB 3P8CE 2YMYA 2YNYA 1A02J 3HUSB 2C9LY 1N7SD 2PP6A 1RF0C 4I6MC 2BASA 4C7RA 4Y99B 3B8EB 2HPCA 1HWTC 4GKGA 2N9BA 2FFDB 1FZAA 2IFMA 4OH8B 5APTA 1DEBA 1CW5A 1H88A 2OYIB 1RF1C 2NPSD 1LWUB 4W7ZA 1IC2A 1LTBC 2A45H 2WZ7A 2C0WA 3HRNA 4ZKPA 3H32A 5AW8B 1SVFA 2WPQA 3HD7D 1EQ7A 1HGZA 5AW4B 3M0DA 4WY4A 5AW5B 3OAKA 1J1EB 1LTGC 1T2KD 1NWQA 2J59M 2P67A 2WPSA 3KPEA 5CCHA 1ZLLA 2HPCB 3HD7C 3KYQA 3P32A 5AVWB 3HD7A 1L0NK 2N1TA 2ZXEB 3BATA 3U1CA 2KB7P 2CPBA 1HUCA 4JYBA 4WB4A 2CPSA 1SQVK 1FAVA 5AW9B 1L4AA 3E1IA 3V2QA 1W2EA 3M9HA 1CSBA 3HE5A 1PFIA 3RK2C 1Z56A 3L36A 1SFCB 3V2NA 1M1JC 3MGNA 1GTWA 2VRSA 5APWA 1KQLA 2HFED 2JJLA 3KDPB 3V5BA 4HH2A 1E5WA 2W6AA 2O1KA 3M91A 5KLVK 3RK3B 2M8RA 1GL2D 2HLOA 4IFDK 3VMZA 3M9QA 1SFCA 1FDMA 3IR9A 1IJDB 1GK6A 3HUSC 1YYCA 3L35A 3U59A 2WT7B 2KLVA 5CCGA 5AVSB 1NTZK 1KFMA 1JY3O 1HH0A 1NAFA 3N7NA 5CCHC 1JY3P 1N7LA 3V2PA 1DX7A 3NMDA 2XNXA 2JEEA 2OYIA 1H8AA 1FU1A 3MTUE 4WY4D 2FYUK 3TNUB 1GU5A 1FZGA 3NTNA 1N2DC 1G1JA 1LWUC 1WT6A 1FOSE 1CZQA 1X8YA 1GL2C 1SQBK 1L4AB 2KYVA 1JY2O 4WY4B 2GM4A 1HJBA 2WSFH 5KJ7A 3GHGC 3MUDA 3BASA 1URQB 1GK4A 5AVUB 1N7SC 2YKQA 1NTKK 1QL2A 4W80A 2WPRA 2PAJA 1LTTC 1GL2B 4EIJA 3TK1A 3LIEA 3L37A 3HTKA 4WY4C 1MFZA 1HBWA 1MZ9A 2L5GB 3U1AA 1GW4A 1IFJA 1URQC 3OA7A 1FZEA 3P8MC 1RE3C 2P7JA 3EQ2A 1URQD 2POHA 1T3UA 1LGHB 1S9KE 1NKZB 1ZV8A 5AVVB 4XE5B 3OJAB 2E43A 3O8ZA 1QL1A 3HE4A 3M06A 1S9KD 3CI9A 1NU1K 2IPPA 1KILB 5CHXA 1SFCD 3N4XA 3WMM0 5CMZA 2YO3A 1JO5A 4IFFA 3TYYA 1RF0A 5APXA 1DH3A 1T8ZA 5BVZA 3M0DC 1A02F 2QM7A 2GUVA 3RK3D 1GW3A 4HYTB 1HTLC 2XDJA 1FBMA 3RL0C 1NKNA 1FZCA 4AUWA 4RESB 4DOJA 1RE3A 3CL3D 5AW2B 1M1JB 1LTJA 2KSJA 1AQ5A 1JY3N 4C7NB 2KOGA 4I2LC 1JCDA 4AYCA 4JF7A 5CJ4A 1MV8A 1LT9A 1LTJC 2W27A 1ZR4A 2E42A 1VPCA 1SQXK 2HG5D 2XU6A 5CJ0A 1RE4A 2YO2A 2XZRA 1L4AC 1XTCC 1JUNA 1NOHA 5AW1B 1L4AD 3P7KA 3M0AA 1LTIC 3LIDA 3CLQA 4KHXA 3LW5H 3G3ZA 4N6JA 1GL2A 5AW6B 3UIAA 1JTHB 1LWUA 4Y99C 3MD0A 2NPSA 1T3JA 1SLQA 1IFNA 1X79B 1GU4A 2QM8A 2M3BA 3RK2D 1N73C 2HYNA 3B5ND 3BRTB 3NXSA 3PP5A 1ZN5A 1RF1B 4M3LA 1G1IA 1X9VA 1GD2E 2WSCH 1IFDA 2YKOA 4LGDE 3B5NB 2HODB 3EFGA 4AQRD 2LKMA 3GHGA 4GIFA 4N78D 5AVYB 3KQGA 1YTZI 3H32B 2Q3IA 5APUA 1VDFA 4LC1A 1KILD 3VTPC 1URQA 1AFOA 2WITA 2FKWB 3P8CD 2H43A 2XV5A 1CI6B 1M1JA 4JYCA 3V4QA 2FXMA 1H89A 2Q7CA 4DZOA 3H6PA 4IFMA 4W7YA 5AW7B 3R2PA 4O9BA 5BU5A 3A7OA 4B86A 2WSEH 5CCGC 1FJPA 2R32A 4LLHA 1WRGA 2O1JA 1NO4A 3HUSA 5KJ7C 3RK2B 3VP9A 2XKMA 4N3YB 1KZUB 2WTYA 5AW0B 3T97A 5AVRB 5BU8B 4I1LA 1FZBA 2Q5UA 2N1TB 5AVQB 1IFMA 1XTGB 3VMXA 1FZFA 3C9IA 5AW3B 1N73A 3B5NA 1JNMA 3VP8A 1FZCB 2FFDA 4GT1A 5AVZB 2H7HA 2C0XA 1HGVA 2Z5HA 1JCCA 4C46A 1JTHA 2WWWA 2OYHC 2N1TC 2P2UA 2IFNA 2Q9IA 1JY2N 1OWAA 3B5NC 4XA4A 2R5BA 2O01H 3TSIA 1JMMA 1MUUA 3GHGB 4C7NA 3A5TA 3RL0D 1KFNA 3HTKB 1FJKA 4EOTA 2GUSA 2NPSC 2ZFCA 1SP4A 1N7SB 1N73B 2R3CA 2I1KA 1M7LA 3IFMA 3BRVB 1CI6A 1GDTA 2OYHB 2A45I 3A2AA 3L4FA 1RF1A 5APQA 1JY2P 1JOCA 3VMYA 1L0LK 2N1TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPQ A;  5AW4 B;  3M0D A;  2WT7 A;  5AW5 B;  1HBW A;  5AVY B;  3KQG A;  2KP8 A;  2Q3I A;  3NFQ A;  3OAK A;  5APU A;  3M9B A;  1T2K D;  1NWQ A;  3SWF A;  5APS A;  3I5C A;  4LC1 A;  2P67 A;  3VTP C;  3VN0 A;  3P8M C;  2WPS A;  2P7J A;  1IO4 A;  1S9K E;  3HE4 B;  5AVV B;  2XV5 A;  1CI6 B;  4XE5 B;  1T2K C;  3P32 A;  2E43 A;  3O8Z A;  2Z5I A;  3VYI A;  4JYC A;  3V4Q A;  3HE4 A;  3M06 A;  5AVW B;  2Q7C A;  1S9K D;  4DZO A;  1H89 A;  2IPP A;  2ZXE B;  1FOS F;  1G2C B;  5CMZ A;  5AW7 B;  2YO3 A;  1HUC A;  3HE5 B;  4JYB A;  3TYY A;  1FAV A;  3A7O A;  5APX A;  3TNU A;  4B86 A;  1OXZ A;  2R32 A;  5AW9 B;  1DH3 A;  3M9H A;  1CSB A;  3HE5 A;  1A02 F;  2QM7 A;  4HYT B;  3L36 A;  5APV A;  4AUW A;  4RES B;  2R5D A;  3MGN A;  1GTW A;  2VRS A;  5AW2 B;  5APW A;  1KQL A;  2JJL A;  3KDP B;  4C7N B;  3V5B A;  4I2L C;  4AYC A;  2WTY A;  5AW0 B;  2W6A A;  3T97 A;  3M91 A;  1MV8 A;  2W27 A;  5AVR B;  2E42 A;  3V4W A;  2Q5U A;  2C9N Y;  3VMZ A;  2XU6 A;  3IR9 A;  5AVQ B;  1GK6 A;  2YO2 A;  3VMX A;  1YYC A;  3L35 A;  2WT7 B;  5APY A;  2XZR A;  5AVX B;  5AW3 B;  1GZL A;  5AVS B;  1JNM A;  3A3Y B;  4GT1 A;  1NAF A;  1JUN A;  5AW1 B;  5AVZ B;  2H7H A;  3P7K A;  3NMD A;  3M0A A;  3LID A;  1H8A A;  1GU5 A;  4KHX A;  2Z5H A;  3TNU B;  3NTN A;  4C46 A;  1J2J B;  1FOS E;  2WWW A;  1CZQ A;  2YNY A;  5AW6 B;  1A02 J;  2C9L Y;  1X8Y A;  2P2U A;  3UIA A;  4I6M C;  1OWA A;  2BAS A;  3MD0 A;  2R5B A;  1MUU A;  3B8E B;  1SLQ A;  4C7N A;  3A5T A;  1HJB A;  1HWT C;  4GKG A;  1GU4 A;  2N9B A;  2QM8 A;  4EOT A;  1GK4 A;  5APT A;  2ZFC A;  5AVU B;  3NXS A;  1SP4 A;  2R3C A;  4M3L A;  1H88 A;  1GD2 E;  1CI6 A;  3A2A A;  5APQ A;  2WPR A;  3TK1 A;  3LIE A;  3L37 A;  3VMY A;  3HTK A;  5AVT B;  1MFZ A;  4AQR D;  5AW8 B; 
#chains in the Genus database with same CATH topology
 1Q2N A;  2K1A A;  3IF4 A;  2WT7 A;  1Q82 Q;  1S3J A;  1VQ6 P;  2E75 D;  1J1E C;  1SQB J;  4ZKU A;  2KP8 A;  3NFQ A;  3MIW A;  5EFW B;  1PIX A;  3M9B A;  1L0N E;  4N78 E;  5GTH H;  1J1D C;  1OW8 A;  3I5C A;  5APS A;  3AEA C;  2KNC A;  2YMK A;  3VN0 A;  2E75 C;  3TF5 A;  5KAF H;  3AE7 C;  2P1J A;  1UIX A;  3A0H H;  1IO4 A;  1EXJ A;  1VL2 A;  2UWJ E;  2E5T A;  3HD7 B;  2H8P D;  3HE4 B;  1RY3 A;  1YTZ T;  2DW3 A;  2H89 C;  1OVU A;  1T2K C;  1QVG O;  2Z4E A;  2Z5I A;  3L74 J;  3VYI A;  1NAY A;  1KIL C;  2QRX A;  5AVT B;  1G2C A;  2OTJ P;  2CK3 H;  1FOS F;  1K04 A;  1EZV D;  2HOD A;  1OVV A;  3AEF C;  1G2C B;  2J58 A;  2FYZ A;  1LJ2 A;  1VF5 B;  3HE5 B;  2KS1 B;  4ASW A;  4Z1M H;  5KTB A;  1PGQ A;  4TT3 H;  2YKP A;  2IBZ D;  1J1D B;  2B89 A;  1LT9 C;  1OXZ A;  4IOI H;  3TNU A;  1ZR2 A;  1AQT A;  2E75 B;  1S4X A;  3AEB C;  1LTA C;  3II6 A;  4WBA A;  3VOP A;  3BVH A;  2IX7 C;  2A45 G;  1SQP K;  2AEF A;  2W6B A;  1FC2 C;  3AE5 C;  3L73 G;  3RL0 B;  3USS A;  1BGY D;  2IZ1 A;  5APV A;  4D6T J;  2AXC A;  3B71 A;  1VQL P;  2B9B A;  1KIL A;  1NHL A;  2R5D A;  1NTM G;  1BSH A;  5KJ7 D;  3H1J G;  3T97 B;  5B5E E;  5CCG D;  1FZC C;  2ZT9 D;  5K5G B;  3CCJ P;  4JBZ A;  3V2R A;  3SWY A;  4U7J A;  3CCR P;  2OYO A;  4CPG A;  1LTJ B;  5KAI H;  3RK3 C;  1LTS C;  1AA0 A;  1FDI A;  4YXD C;  2MJZ A;  3V4W A;  4NPE A;  1RE4 C;  1N7S A;  2AXT E;  1NGM B;  2C9N Y;  1M90 Q;  1LT9 B;  1LP1 B;  3H1H J;  3ITK A;  1NTM E;  1YHQ P;  3D70 A;  1KB9 H;  2R44 A;  2WSF J;  1VQ5 P;  2OYH A;  4H44 D;  1N86 A;  5APY A;  5AVX B;  1SFC C;  3CXH E;  3L74 E;  3L73 E;  1HVV A;  1MFT A;  1NTM D;  2FXP A;  4D6T G;  1S5L H;  5CCH D;  1GZL A;  5KLV E;  4QMA A;  1WMK A;  3AEG C;  3L72 G;  1KB9 I;  5KAI E;  3A3Y B;  1NH4 A;  1NTM K;  1IFI A;  3L75 J;  2A06 E;  1AJY A;  1IK9 A;  1BDD A;  3RBZ A;  4H13 D;  3AE6 C;  3G4S P;  2FFD C;  1VQM P;  1QVF O;  2NPS B;  1VQK P;  1SQP D;  3H1K D;  2OAR A;  3LW5 J;  4U3F D;  1UII A;  2QE7 H;  2I1J A;  2QJK B;  1NVO A;  2R3S A;  4R4L A;  1PZQ A;  4H44 C;  2HR3 A;  1SQQ K;  2Q1K A;  2OYI C;  3H1H D;  1J2J B;  3MP7 B;  3P8C E;  1DD4 A;  3L71 G;  2YMY A;  2YNY A;  2ZXX A;  1OFC X;  3HUS B;  2ZYG A;  1A02 J;  1PPJ D;  3CPW O;  2C9L Y;  1N7S D;  2FYU D;  2PP6 A;  1JEK A;  2A06 G;  4H13 B;  1KB9 E;  1RF0 C;  2WPV B;  4I6M C;  3KXD A;  1EXI A;  2BAS A;  2OGU A;  4WVZ A;  4C7R A;  4Y99 B;  3AE8 C;  3B8E B;  3PTZ A;  1X22 A;  2HPC A;  1VQ9 P;  1H0T B;  1HWT C;  3GLM A;  4GKG A;  2N9B A;  2FFD B;  1GU5 A;  1FZA A;  2IFM A;  2IZ0 A;  2E76 C;  4OH8 B;  5APT A;  2KNC B;  1DEB A;  3CME P;  2ZT9 B;  1CW5 A;  4MN4 C;  2XND H;  1H88 A;  2OYI B;  1SQV E;  2NPS D;  1RF1 C;  2YIU B;  1LWU B;  3A0H E;  4UB8 E;  3Q5S A;  4W7Z A;  1IC2 A;  1LTB C;  2KZI A;  2A45 H;  1AV1 A;  2W8Z A;  4DT0 A;  3FWL A;  2M5A A;  1SQV D;  2WZ7 A;  5KLV J;  1EDI A;  2C0W A;  3HRN A;  4KJM A;  1YBK A;  4YXW H;  3CCM P;  1RHZ B;  2M5A B;  4ZKP A;  3H32 A;  3IN6 A;  1SVF A;  2WPQ A;  3HD7 D;  5AW8 B;  3E1R A;  1EQ7 A;  3W67 A;  3CC7 P;  1HGZ A;  5AW4 B;  3M0D A;  5KAF E;  2QG4 A;  2IYO A;  4WY4 A;  5AW5 B;  1VQO P;  4EYY Q;  3OAK A;  1J1E B;  1LTG C;  3QH9 A;  1T2K D;  1NWQ A;  2J59 M;  2KSE A;  2P67 A;  4IL6 H;  2KZJ A;  2O01 J;  2WPS A;  2ZYD A;  3KPE A;  1KC8 Q;  3TGU J;  2E74 C;  2RN0 A;  2NRG A;  1ZLL A;  3MZW B;  3G9R A;  5CCH A;  1LNQ A;  1SQV J;  2K9J B;  2HPC B;  4PJ0 E;  1EDJ A;  1H0T A;  4PD4 H;  1RH5 B;  3HD7 C;  1K05 A;  1PGO A;  3KYQ A;  3P32 A;  3Q3D A;  2B87 A;  3CD6 P;  3V6I A;  3H25 A;  5AVW B;  5KKZ B;  3WUV A;  3HD7 A;  3L75 D;  1L0N K;  2N1T A;  2ZXE B;  1USD A;  5GTH E;  3BAT A;  1NTM J;  1N8R Q;  4EI2 A;  3U1C A;  2PRR A;  2KB7 P;  2RMZ A;  1OIP A;  2CPB A;  5L8R J;  1HUC A;  4JYB A;  4WB4 A;  2CPS A;  1SQV K;  1FAV A;  1BCC D;  5AW9 B;  1L4A A;  3E1I A;  3V2Q A;  1KQG B;  1W2E A;  3M9H A;  2ZYA A;  1CSB A;  3HE5 A;  1NTK G;  1PFI A;  3RK2 C;  1R5L A;  1Z56 A;  3GW6 A;  3L36 A;  4BRY B;  4D6T E;  5KLV G;  1SFC B;  1U7J A;  2BCC G;  3V2N A;  3CCU P;  3L72 E;  4Y28 J;  3WUT A;  1M1J C;  3MGN A;  1GTW A;  1EDL A;  1M8O B;  2VRS A;  2JWD A;  3L75 G;  1OMI A;  1VQN P;  1NYH A;  5APW A;  1KQL A;  1L0L E;  2HFE D;  2JJL A;  3KDP B;  3V5B A;  4GDO A;  4HH2 A;  4WWI A;  1E5W A;  1BE3 J;  3SWK A;  2W6A A;  2O1K A;  1LP1 A;  3M91 A;  5KLV K;  4UB6 H;  3S1K A;  1S5L E;  3RK3 B;  2QJK C;  1SQX J;  1GL2 D;  2HLO A;  1BCC G;  2M8R A;  3JCU E;  4YPC A;  3I56 P;  2QVA A;  2BEQ D;  2BCC E;  3M9Q A;  3VMZ A;  4IFD K;  1SFC A;  1NTZ E;  2QSI A;  3IR9 A;  1IJD B;  1FDM A;  3TDK A;  1GK6 A;  2O3J A;  3L73 D;  2JKV A;  3HUS C;  1MKM A;  1YYC A;  2G3A A;  3L35 A;  3C8V A;  3U59 A;  1PPJ G;  5B66 H;  2KLV A;  4H13 C;  1NTK E;  2WT7 B;  3PH0 A;  2KLU A;  3D6Z A;  3L70 J;  2W83 C;  3PHL A;  3AE3 C;  1ZW0 A;  5DJU B;  5H2F E;  5CCG A;  5AVS B;  1W2B O;  1NTZ K;  2MKV A;  3KZI H;  3D71 A;  3Q1M A;  3AE9 C;  1KFM A;  1JY3 O;  1HH0 A;  1NAF A;  3H1J J;  3N7N A;  1JY3 P;  1N7L A;  3V2P A;  5CCH C;  1Y9B A;  3L75 E;  1YQ4 C;  1DX7 A;  1USE A;  2I8D A;  5TIS E;  2E76 B;  2E74 D;  2K37 A;  2JEE A;  2XNX A;  3NMD A;  2OYI A;  2B87 B;  1H8A A;  1FU1 A;  2K9Y A;  2QJY B;  2FYU K;  3AEE C;  3MTU E;  4WY4 D;  1SQB E;  3NTN A;  3TNU B;  1DD3 A;  1FZG A;  1W5C E;  3AE1 C;  3E7K A;  4XFJ A;  1N2D C;  1G1J A;  1LWU C;  1WT6 A;  2P58 A;  2YXR B;  4DCK A;  1YJN P;  1CZQ A;  1FOS E;  1X8Y A;  1KYO H;  5E79 H;  1Y8A A;  3L70 D;  2K88 A;  5GTI H;  2E5Y A;  1GL2 C;  4D6T D;  2FXO A;  1PPJ E;  1SQB K;  1L4A B;  2KYV A;  3L72 D;  3SFD C;  1JY2 O;  4PD4 D;  1FS0 E;  3L70 E;  4WY4 B;  1KB9 D;  2QEX P;  4L74 A;  1QGK B;  3Q5R A;  2GM4 A;  1PP9 J;  4L75 A;  1HJB A;  2WSF H;  5KJ7 A;  3GHG C;  3MUD A;  3A0B E;  3F89 A;  2V4H A;  4BXL A;  3BAS A;  3L71 E;  1URQ B;  1GK4 A;  5AVU B;  5CBN A;  2JP3 A;  1EC5 A;  2IDB A;  3JSV C;  1N7S C;  2YKQ A;  3CX5 D;  3JCU H;  3QWO C;  1K73 Q;  1P84 D;  1R8E A;  2E74 B;  1NTK K;  2E76 D;  1QL2 A;  4W80 A;  2W6J H;  1SQX G;  1S2E A;  3GMA A;  2A06 D;  4NPD A;  3CX5 E;  2WPR A;  2PAJ A;  1LTT C;  3WU2 H;  1GL2 B;  3ZDM A;  4EIJ A;  1OX3 A;  3TK1 A;  3CCV P;  3CWB D;  3LIE A;  3L37 A;  3HTK A;  2Y0D A;  4WY4 C;  1RQU A;  1MFZ A;  1BSN A;  1ZP0 C;  2KI7 B;  2Q6Q A;  4RO0 A;  3RL0 g;  1M56 D;  2D2C B;  1U7M A;  4OWF A;  1KIL E;  2LXC B;  1MZ9 A;  4GOF A;  1HBW A;  2L5G B;  4L76 A;  3U1A A;  1BGY J;  1GW4 A;  1IFJ A;  1URQ C;  1IK7 A;  4EDF A;  4R4M A;  2K3R A;  1K8A Q;  2H88 C;  1PP9 D;  3OA7 A;  1FZE A;  3P8M C;  1RE3 C;  2FBW C;  2P7J A;  1URQ D;  2POH A;  3CX5 I;  3EQ2 A;  3AED C;  5KLI C;  3RBX A;  1T3U A;  4BRY A;  1LGH B;  2FY8 A;  1S9K E;  1NKZ B;  1ZV8 A;  5AVV B;  2BCC D;  1IFP A;  2V7Q J;  4XE5 B;  3CCL P;  3OJA B;  3CWB G;  2E43 A;  3L73 J;  3O8Z A;  1L0L G;  1P84 H;  1QL1 A;  3HE4 A;  3M06 A;  1S9K D;  3CI9 A;  1NU1 K;  2IPP A;  3Q2Y A;  1KIL B;  5CHX A;  1SFC D;  4PD4 E;  3GF7 A;  3N4X A;  2L91 A;  1SQP E;  4U3F E;  3WMM 0;  3CCS P;  1VQ4 P;  5CMZ A;  2YO3 A;  1JO5 A;  4IFF A;  4GOE A;  3TYY A;  1RF0 A;  5APX A;  3IAO A;  1EZV E;  2G8Y A;  4H0L B;  3A0B H;  1DH3 A;  2KS1 A;  2IYP A;  1T8Z A;  5KKZ C;  1M57 D;  1K9M Q;  5BVZ A;  2FYU E;  3M0D C;  1A02 F;  2QM7 A;  3AE4 C;  2GUV A;  1Q90 D;  1GW3 A;  3H1L E;  4HYT B;  3RK3 D;  1HTL C;  2QJP B;  1FBM A;  2XDJ A;  3RL0 C;  1NKN A;  1TU3 F;  1FZC A;  4RES B;  4AUW A;  4DOJ A;  1RE3 A;  4RKU J;  3CL3 D;  5AW2 B;  1M1J B;  1LTJ A;  2KSJ A;  3W68 A;  1JY3 N;  1AQ5 A;  4C7N B;  1EZV G;  2KOG A;  1JCD A;  4I2L C;  4AYC A;  3TGU E;  1DEE G;  1OW6 A;  4JF7 A;  5CJ4 A;  4PV1 C;  1MV8 A;  1SQB G;  1LT9 A;  1LTJ C;  2W27 A;  1ZR4 A;  1BE3 D;  2E42 A;  1SQP G;  2QJY C;  4U3F G;  2IBZ G;  1VPC A;  1Q86 Q;  1HJ0 A;  1VQ8 P;  1KMI Z;  1SQX K;  2BEZ F;  3FGA D;  1JB0 J;  2HG5 D;  2XU6 A;  3H1I J;  4H0L C;  4OGQ C;  1RE4 A;  1NTK D;  5CJ0 A;  3CC2 P;  2J5U A;  1T6A A;  2YO2 A;  2OQQ A;  3MHV A;  4ZMD A;  1QLE D;  4L73 A;  2FYU J;  4BWN A;  2FYU G;  2QJP C;  2SPZ A;  2M3E A;  2XZR A;  1AVY A;  2ZVN B;  5H2F H;  3SFE C;  1L4A C;  3H1J D;  3S9O A;  2QIW A;  2ZJS E;  2W90 A;  1XTC C;  1JUN A;  1BCC E;  1NOH A;  5AW1 B;  1YI2 P;  3SSU A;  3G6E P;  1R5S A;  1NTZ G;  1SQB D;  1L4A D;  3P7K A;  3M0A A;  1LTI C;  3LID A;  1SQQ J;  3CLQ A;  4HKZ H;  4KHX A;  3LW5 H;  1NTK J;  3G3Z A;  1FE6 A;  1KN7 A;  2YXQ B;  1FDO A;  4N6J A;  4RJT A;  3H1L J;  3K5B A;  1GL2 A;  2GA1 A;  5AW6 B;  3UIA A;  2AEM A;  3OW2 O;  2Q3E A;  1KQS O;  3KHU A;  1JTH B;  4I7Z B;  1LWU A;  4Y99 C;  3D6Y A;  4H0L D;  1NU1 D;  3KZI E;  4JPZ B;  3MD0 A;  1D7M A;  3AE2 C;  1KYO I;  2NPS A;  1YIJ P;  1T3J A;  1SLQ A;  3L72 J;  3BCC J;  2D2C C;  1IFN A;  1NTZ D;  1X79 B;  1NU1 E;  3PRJ A;  5B66 E;  1GU4 A;  2QM8 A;  2M3B A;  3RK2 D;  1N73 C;  2HYN A;  3B5N D;  3BRT B;  3GG2 A;  2IBZ I;  2JO1 A;  3H1I E;  2ZT9 C;  3NXS A;  3PP5 A;  3L71 J;  1YIT P;  1ZN5 A;  1RF1 B;  1GDT A;  2AXT H;  1Y47 A;  1G1I A;  1X9V A;  2D2C D;  3H1H G;  4M3L A;  3BCC E;  1GD2 E;  2WSC H;  1SQQ G;  3CWB J;  3Q5P A;  3FXE A;  3L70 G;  1SQP J;  1IFD A;  2LR2 A;  4U3F J;  1SS1 A;  4ZNC A;  2YKO A;  4LGD E;  4PD4 I;  2PGD A;  3B5N B;  4PJ0 H;  1L0L D;  5C39 A;  2HOD B;  3EFG A;  4OVN F;  3WUU A;  3FX0 A;  4AQR D;  4K35 A;  2JR8 A;  2LKM A;  3GHG A;  4GIF A;  3CCQ P;  1EZV I;  1L0N D;  4N78 D;  1S5L X;  5AVY B;  3KQG A;  1YTZ I;  3H32 B;  2Q3I A;  1SQQ E;  3FWN A;  5APU A;  1Q7Y Q;  1PGJ A;  2KIK A;  3WU2 E;  1VDF A;  1SQX E;  1KIL D;  4LC1 A;  2FYN B;  2JDI H;  3VTP C;  3CCE P;  3MUD C;  3H1L G;  1URQ A;  1JM0 A;  1AFO A;  2WIT A;  3H1I G;  4HJG H;  1DIP A;  1NJI Q;  1PGP A;  2FKW B;  1PL5 A;  3P8C D;  2H43 A;  3VMA A;  5KLI B;  2XV5 A;  1CI6 B;  3O6Q B;  3CX5 H;  4OGQ D;  3RGU A;  1M1J A;  4JYC A;  3V4Q A;  2FXM A;  1H89 A;  2Q7C A;  4DZO A;  1ZRT E;  3H6P A;  3TGU G;  4IFM A;  1L2P A;  1YJ9 P;  3L74 D;  1JMB A;  4W7Y A;  3H1K J;  4PV1 B;  5AW7 B;  3H1J E;  3CMA P;  4YTP C;  3R2P A;  3F5H A;  1VQP P;  5TJH A;  4O9B A;  5BU5 A;  3A7O A;  4B86 A;  4DJG A;  1PP9 G;  2WSE H;  5CCG C;  2R32 A;  3H1L D;  2FYN C;  3RK3 E;  4OGQ B;  2OTL P;  4LLH A;  1FJP A;  1WRG A;  2O1J A;  3O6Q A;  1NO4 A;  3CWB E;  1BDC A;  3B4S A;  1IZN B;  3HUS A;  5KJ7 C;  3RK2 B;  3PLN A;  3VP9 A;  5GTI E;  2Y0E A;  3S4R A;  5E79 E;  1KD1 Q;  3TGU D;  2WQY C;  3JC2 2;  1OVR A;  5CBO A;  2XKM A;  4N3Y B;  3L74 G;  1PP9 E;  1KZU B;  2KK7 A;  5DJT B;  4ASV A;  1OW7 A;  2WSC J;  5AW0 B;  2WTY A;  3T97 A;  2N9Y B;  2WSE J;  4UB8 H;  2KUB A;  4I1L A;  5AVR B;  1VF5 C;  5BU8 B;  4EOT A;  3EFF K;  1FZB A;  1X0T A;  2Q5U A;  3ABV C;  4NPF X;  5TIS H;  1GMJ A;  3GF3 A;  2QA4 P;  3CXH I;  1ZOY C;  2PFX A;  3I55 P;  2N1T B;  5AVQ B;  1IFM A;  1XTG B;  3C1L A;  3CXH D;  3VMX A;  1BGY G;  1LT1 A;  5KLV D;  2B88 A;  1KYO E;  1FZF A;  2BCC J;  2WVR A;  2Y9Y A;  3C9I A;  3CXH H;  5M1B A;  5AW3 B;  1N73 A;  2V7Q H;  3B5N A;  2JWA A;  1JNM A;  3VP8 A;  4JQ0 D;  1FZC B;  1KYO D;  2FFD A;  4A7P A;  4GT1 A;  1YQ3 C;  2IBZ E;  3FXD A;  3H1K E;  2KXP B;  1ZRT D;  5AVZ B;  1VQ7 P;  2H7H A;  1QX8 A;  1L0L J;  2M0B A;  2ZAE B;  2C0X A;  2WSS H;  1BE3 G;  3H1H E;  1HGV A;  4H44 B;  1BGY E;  2ZVO B;  1KQF B;  3BCC G;  2Z5H A;  1JCC A;  1P84 I;  4HB1 A;  4C46 A;  1JTH A;  4KT0 J;  2WWW A;  2OYH C;  2N1T C;  1KOR A;  1SQQ D;  5B5E H;  2P2U A;  4PV1 D;  2WMM A;  2IFN A;  3R4Y A;  3CC4 P;  1SQX D;  1OZH A;  1S1C X;  2Q9I A;  1VF5 D;  1SQV G;  1JY2 N;  1OWA A;  3B5N C;  1AVO A;  2RH0 A;  4TLF A;  1ZXG A;  1EDK A;  2OTK E;  1U57 A;  4I7Z C;  4XA4 A;  2R5B A;  1KV4 A;  1BE3 E;  2O01 H;  3TSI A;  1JMM A;  1MUU A;  3GHG B;  4C7N A;  3SWF A;  3A5T A;  1YJW P;  1QEX A;  4UB6 E;  1ZME C;  3RL0 D;  1L0N G;  1NU1 J;  2AEJ A;  1RQV A;  2LXB A;  1KFN A;  1Q81 Q;  3HTK B;  1FJK A;  1P84 E;  3H1K G;  1NTZ J;  2GUS A;  2NPS C;  2O01 N;  2ZFC A;  1SP4 A;  1N7S B;  3AEC C;  3BCC D;  1N73 B;  3EWK A;  2R3C A;  2I1K A;  1M7L A;  2ITA A;  2YIU C;  3IFM A;  3L71 D;  4IL6 X;  3BRV B;  1CI6 A;  2NZ2 A;  3H1I D;  3G71 P;  2OYH B;  2K9J A;  1E79 H;  2A45 I;  2Y9Z A;  1BCC J;  4K3A A;  3A2A A;  3L4F A;  3PJS K;  4IL6 E;  5APQ A;  1RF1 A;  2RKL A;  2Y0C A;  1M1K Q;  1HF9 A;  1S72 P;  1L0N J;  1NU1 G;  1JY2 P;  1JOC A;  1PV3 A;  3VMY A;  1L0L K;  1KTM A;  2N1T D;  4GOD A;  2P10 A; 
#chains in the Genus database with same CATH homology
 2WT7 A;  1J1E C;  4ZKU A;  2KP8 A;  3NFQ A;  3MIW A;  3M9B A;  4N78 E;  3SWF A;  1J1D C;  3I5C A;  5APS A;  3VN0 A;  2P1J A;  1IO4 A;  3HD7 B;  2H8P D;  3HE4 B;  1RY3 A;  1YTZ T;  1T2K C;  2Z4E A;  2Z5I A;  3VYI A;  1KIL C;  5AVT B;  1G2C A;  1FOS F;  2HOD A;  1G2C B;  2J58 A;  2FYZ A;  3HE5 B;  5KTB A;  2YKP A;  3TNU A;  1J1D B;  1LT9 C;  1OXZ A;  1ZR2 A;  3II6 A;  1LTA C;  4WBA A;  3VOP A;  3BVH A;  2IX7 C;  2A45 G;  1SQP K;  2W6B A;  3RL0 B;  5APV A;  1KIL A;  1NHL A;  2R5D A;  5KJ7 D;  1FZC C;  5CCG D;  3V2R A;  3SWY A;  1LTJ B;  3RK3 C;  1LTS C;  2MJZ A;  3V4W A;  1RE4 C;  1N7S A;  2C9N Y;  1LT9 B;  2OYH A;  1N86 A;  5APY A;  5AVX B;  1SFC C;  1HVV A;  5CCH D;  1GZL A;  3A3Y B;  1NH4 A;  1NTM K;  1IFI A;  1IK9 A;  2FFD C;  2NPS B;  2OAR A;  2I1J A;  1SQQ K;  2OYI C;  1J2J B;  3P8C E;  2YMY A;  2YNY A;  1A02 J;  3HUS B;  2C9L Y;  1N7S D;  2PP6 A;  1RF0 C;  4I6M C;  2BAS A;  4C7R A;  4Y99 B;  3B8E B;  2HPC A;  1HWT C;  4GKG A;  2N9B A;  2FFD B;  1FZA A;  2IFM A;  4OH8 B;  5APT A;  1DEB A;  1CW5 A;  1H88 A;  2OYI B;  1RF1 C;  2NPS D;  1LWU B;  4W7Z A;  1IC2 A;  1LTB C;  2A45 H;  2WZ7 A;  2C0W A;  3HRN A;  4ZKP A;  3H32 A;  5AW8 B;  1SVF A;  2WPQ A;  3HD7 D;  1EQ7 A;  1HGZ A;  5AW4 B;  3M0D A;  4WY4 A;  5AW5 B;  3OAK A;  1J1E B;  1LTG C;  1T2K D;  1NWQ A;  2J59 M;  2P67 A;  2WPS A;  3KPE A;  5CCH A;  1ZLL A;  2HPC B;  3HD7 C;  3KYQ A;  3P32 A;  5AVW B;  3HD7 A;  1L0N K;  2N1T A;  2ZXE B;  3BAT A;  3U1C A;  2KB7 P;  2CPB A;  1HUC A;  4JYB A;  4WB4 A;  2CPS A;  1SQV K;  1FAV A;  5AW9 B;  1L4A A;  3E1I A;  3V2Q A;  1W2E A;  3M9H A;  1CSB A;  3HE5 A;  1PFI A;  3RK2 C;  1Z56 A;  3L36 A;  1SFC B;  3V2N A;  1M1J C;  3MGN A;  1GTW A;  2VRS A;  5APW A;  1KQL A;  2HFE D;  2JJL A;  3KDP B;  3V5B A;  4HH2 A;  1E5W A;  2W6A A;  2O1K A;  3M91 A;  5KLV K;  3RK3 B;  2M8R A;  1GL2 D;  2HLO A;  4IFD K;  3VMZ A;  3M9Q A;  1SFC A;  1FDM A;  3IR9 A;  1IJD B;  1GK6 A;  3HUS C;  1YYC A;  3L35 A;  3U59 A;  2WT7 B;  2KLV A;  5CCG A;  5AVS B;  1NTZ K;  1KFM A;  1JY3 O;  1HH0 A;  1NAF A;  3N7N A;  5CCH C;  1JY3 P;  1N7L A;  3V2P A;  1DX7 A;  3NMD A;  2XNX A;  2JEE A;  2OYI A;  1H8A A;  1FU1 A;  3MTU E;  4WY4 D;  2FYU K;  3TNU B;  1GU5 A;  1FZG A;  3NTN A;  1N2D C;  1G1J A;  1LWU C;  1WT6 A;  1FOS E;  1CZQ A;  1X8Y A;  1GL2 C;  1SQB K;  1L4A B;  2KYV A;  1JY2 O;  4WY4 B;  2GM4 A;  1HJB A;  2WSF H;  5KJ7 A;  3GHG C;  3MUD A;  3BAS A;  1URQ B;  1GK4 A;  5AVU B;  1N7S C;  2YKQ A;  1NTK K;  1QL2 A;  4W80 A;  2WPR A;  2PAJ A;  1LTT C;  1GL2 B;  4EIJ A;  3TK1 A;  3LIE A;  3L37 A;  3HTK A;  4WY4 C;  1MFZ A;  1HBW A;  1MZ9 A;  2L5G B;  3U1A A;  1GW4 A;  1IFJ A;  1URQ C;  3OA7 A;  1FZE A;  3P8M C;  1RE3 C;  2P7J A;  3EQ2 A;  1URQ D;  2POH A;  1T3U A;  1LGH B;  1S9K E;  1NKZ B;  1ZV8 A;  5AVV B;  4XE5 B;  3OJA B;  2E43 A;  3O8Z A;  1QL1 A;  3HE4 A;  3M06 A;  1S9K D;  3CI9 A;  1NU1 K;  2IPP A;  1KIL B;  5CHX A;  1SFC D;  3N4X A;  3WMM 0;  5CMZ A;  2YO3 A;  1JO5 A;  4IFF A;  3TYY A;  1RF0 A;  5APX A;  1DH3 A;  1T8Z A;  5BVZ A;  3M0D C;  1A02 F;  2QM7 A;  2GUV A;  3RK3 D;  1GW3 A;  4HYT B;  1HTL C;  2XDJ A;  1FBM A;  3RL0 C;  1NKN A;  1FZC A;  4AUW A;  4RES B;  4DOJ A;  1RE3 A;  3CL3 D;  5AW2 B;  1M1J B;  1LTJ A;  2KSJ A;  1AQ5 A;  1JY3 N;  4C7N B;  2KOG A;  4I2L C;  1JCD A;  4AYC A;  4JF7 A;  5CJ4 A;  1MV8 A;  1LT9 A;  1LTJ C;  2W27 A;  1ZR4 A;  2E42 A;  1VPC A;  1SQX K;  2HG5 D;  2XU6 A;  5CJ0 A;  1RE4 A;  2YO2 A;  2XZR A;  1L4A C;  1XTC C;  1JUN A;  1NOH A;  5AW1 B;  1L4A D;  3P7K A;  3M0A A;  1LTI C;  3LID A;  3CLQ A;  4KHX A;  3LW5 H;  3G3Z A;  4N6J A;  1GL2 A;  5AW6 B;  3UIA A;  1JTH B;  1LWU A;  4Y99 C;  3MD0 A;  2NPS A;  1T3J A;  1SLQ A;  1IFN A;  1X79 B;  1GU4 A;  2QM8 A;  2M3B A;  3RK2 D;  1N73 C;  2HYN A;  3B5N D;  3BRT B;  3NXS A;  3PP5 A;  1ZN5 A;  1RF1 B;  4M3L A;  1G1I A;  1X9V A;  1GD2 E;  2WSC H;  1IFD A;  2YKO A;  4LGD E;  3B5N B;  2HOD B;  3EFG A;  4AQR D;  2LKM A;  3GHG A;  4GIF A;  4N78 D;  5AVY B;  3KQG A;  1YTZ I;  3H32 B;  2Q3I A;  5APU A;  1VDF A;  4LC1 A;  1KIL D;  3VTP C;  1URQ A;  1AFO A;  2WIT A;  2FKW B;  3P8C D;  2H43 A;  2XV5 A;  1CI6 B;  1M1J A;  4JYC A;  3V4Q A;  2FXM A;  1H89 A;  2Q7C A;  4DZO A;  3H6P A;  4IFM A;  4W7Y A;  5AW7 B;  3R2P A;  4O9B A;  5BU5 A;  3A7O A;  4B86 A;  2WSE H;  5CCG C;  1FJP A;  2R32 A;  4LLH A;  1WRG A;  2O1J A;  1NO4 A;  3HUS A;  5KJ7 C;  3RK2 B;  3VP9 A;  2XKM A;  4N3Y B;  1KZU B;  2WTY A;  5AW0 B;  3T97 A;  5AVR B;  5BU8 B;  4I1L A;  1FZB A;  2Q5U A;  2N1T B;  5AVQ B;  1IFM A;  1XTG B;  3VMX A;  1FZF A;  3C9I A;  5AW3 B;  1N73 A;  3B5N A;  1JNM A;  3VP8 A;  1FZC B;  2FFD A;  4GT1 A;  5AVZ B;  2H7H A;  2C0X A;  1HGV A;  2Z5H A;  1JCC A;  4C46 A;  1JTH A;  2WWW A;  2OYH C;  2N1T C;  2P2U A;  2IFN A;  2Q9I A;  1JY2 N;  1OWA A;  3B5N C;  4XA4 A;  2R5B A;  2O01 H;  3TSI A;  1JMM A;  1MUU A;  3GHG B;  4C7N A;  3A5T A;  3RL0 D;  1KFN A;  3HTK B;  1FJK A;  4EOT A;  2GUS A;  2NPS C;  2ZFC A;  1SP4 A;  1N7S B;  1N73 B;  2R3C A;  2I1K A;  1M7L A;  3IFM A;  3BRV B;  1CI6 A;  1GDT A;  2OYH B;  2A45 I;  3A2A A;  3L4F A;  1RF1 A;  5APQ A;  1JY2 P;  1JOC A;  3VMY A;  1L0L K;  2N1T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...