1T2KD

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
61
structure length
61
Chain Sequence
KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 31-MER
publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 27
structure length 61
sequence length 61
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1t2kD00
1J2JB 1CZQA 3HE4B 3P32A 2E42A 3NXSA 4XE5B 3L36A 3T97A 4AUWA 1A02F 5AVRB 2WPRA 4DZOA 4EOTA 2Z5HA 1GK4A 3LIEA 4AYCA 3TK1A 1S9KD 3A2AA 1GU5A 5APSA 2Z5IA 5AW0B 2XV5A 3O8ZA 1HUCA 1T2KC 1H88A 1GZLA 4I6MC 2YO3A 5CMZA 5AVXB 3A5TA 4GKGA 2Q7CA 3UIAA 2WWWA 5AW9B 5AVSB 1H89A 2P7JA 5APWA 3V4QA 3LIDA 4AQRD 1OXZA 1SLQA 5APYA 2JJLA 4JYCA 5AVQB 3OAKA 1GU4A 1NWQA 3B8EB 4JYBA 1H8AA 2QM7A 3V5BA 1GK6A 1G2CB 2Q5UA 5AVVB 1CI6B 2W27A 2R3CA 3VMXA 1GTWA 1DH3A 5AVTB 5AVUB 3VN0A 2E43A 4C46A 1JUNA 3P8MC 2YO2A 4GT1A 1A02J 5AW1B 3V4WA 3HE5A 1FAVA 2P2UA 2QM8A 1KQLA 3M06A 5AW6B 3M9BA 3NMDA 2ZFCA 1T2KD 1CI6A 1FOSF 2Q3IA 2R5BA 3L37A 1X8YA 3MD0A 3P7KA 5APTA 3M9HA 2WT7A 2R5DA 2H7HA 4KHXA 2BASA 2R32A 3VYIA 3HE5B 1FOSE 1NAFA 3TYYA 1OWAA 5AW8B 2W6AA 2WPQA 4B86A 5AW2B 2WT7B 1YYCA 3TNUA 3A3YB 4LC1A 4C7NB 1SP4A 2WTYA 3KQGA 5AW7B 1HJBA 1GD2E 2KP8A 5AW5B 1CSBA 1MUUA 2XU6A 2C9NY 2ZXEB 3M0DA 3MGNA 2YNYA 1JNMA 4RESB 3VMZA 4M3LA 5AVYB 5AW4B 2XZRA 3IR9A 4C7NA 4HYTB 5AVZB 3TNUB 1HWTC 3SWFA 1HBWA 5APVA 5AW3B 3VMYA 1MV8A 2VRSA 3HE4A 5APQA 3I5CA 1S9KE 3L35A 3KDPB 3NFQA 2N9BA 3VTPC 3M91A 3NTNA 4I2LC 2WPSA 3M0AA 3HTKA 1MFZA 3A7OA 5APXA 5APUA 2P67A 2C9LY 1IO4A 2IPPA 5AVWB
chains in the Genus database with same CATH superfamily
1SQPJ 1AA0A 2P10A 3CWBE 1NU1K 1KFNA 1GK4A 1SQQE 3LIEA 2KSEA 1S72P 1EC5A 2N1TA 3Q5PA 2XV5A 3TGUE 3PJSK 1RE3C 3FX0A 1WMKA 1SQVK 1MKMA 2BEZF 2YO3A 1RF1C 5APWA 1KB9H 1NTME 4PV1D 3O6QB 1M57D 2QJPC 3B5NC 1NTKE 2IFNA 1K05A 3V2NA 3MIWA 4JYBA 3H1HE 4WY4C 1DD4A 1N7LA 1X9VA 3TSIA 2BCCJ 5H2FH 1A02J 4D6TE 3AEFC 3FGAD 5GTHH 5KLVJ 2QE7H 3P8CD 1NAYA 2PP6A 3MTUE 3RK3E 1NAFA 3JSVC 3B5ND 1YJ9P 1YYCA 4WY4D 1HJBA 1WT6A 4L73A 5AW5B 5KJ7C 2KLVA 3VMZA 3V2RA 1VL2A 1U7JA 2ZAEB 4EDFA 2KNCA 1PP9E 1OW8A 1CW5A 3MUDC 2XZRA 2Y0EA 2YMKA 2QJKC 1HWTC 1XTGB 1VQ6P 4I7ZB 3A7OA 1S3JA 1ZRTD 3W68A 2L91A 2OYIA 2KS1B 3WU2H 4YXDC 3L70J 4DZOA 5KJ7D 1LNQA 3CXHI 3R4YA 1L0ND 3M0DC 1IFPA 1KQSO 1KD1Q 5KAFE 2HYNA 1RQVA 2FYNB 2LR2A 2B88A 5AVVB 5L8RJ 3CPWO 1K9MQ 1L4AC 2QIWA 1SFCA 1R8EA 3NMDA 2M8RA 2QEXP 4KT0J 1DEBA 4KHXA 3D70A 1NU1E 2NZ2A 1SQXJ 1RH5B 3A0HE 3QWOC 1PGOA 1SQVE 3ZDMA 3WUUA 1JNMA 1KZUB 1L4AD 2GUVA 5AVYB 1IZNB 2YXRB 5KTBA 5BU8B 1OZHA 2J58A 3NFQA 3AE6C 2W90A 1XTCC 3MHVA 2MJZA 1L0NG 1SS1A 3N7NA 1RF1A 1KMIZ 1KQGB 2KLUA 1T8ZA 2PGDA 4XA4A 1JY2P 1Q82Q 1LTJB 3A0BH 3L71J 2WSCJ 1QGKB 1W5CE 4PJ0H 1PIXA 4YPCA 3H1KD 2AXTE 3V6IA 2I8DA 3BCCD 5DJTB 3E1RA 2A06E 2M5AB 1H8AA 1GK6A 2ZXXA 1YJNP 2WQYC 1OMIA 1GTWA 5AVTB 4CPGA 3BRTB 3CCJP 2YO2A 3HE5A 2HPCA 2E5YA 1PFIA 3M9HA 4DT0A 3FWLA 4U3FD 4XFJA 3W67A 1L0LK 1S5LH 4C7NB 4H44B 3Q2YA 4PD4I 5AW7B 1MUUA 3VP9A 4JQ0D 2FFDC 1H0TA 1N7SB 3L71E 4WVZA 1SVFA 2OTJP 3GF7A 1KB9I 3KHUA 1AQTA 5B5EH 2FYUJ 3H1KG 3CCQP 3RL0C 3BCCG 3KXDA 1BCCJ 1VQKP 1FZEA 1T2KC 3IF4A 1Y8AA 1R5LA 1PPJD 2ZYDA 2WWWA 5AVSB 2IDBA 4AQRD 3BVHA 4HH2A 1DD3A 3TDKA 3H1LJ 2QRXA 4R4LA 2K9JB 4BRYA 4U3FG 4YXWH 3D6ZA 3RL0D 2IBZD 2JDIH 3L75J 2FYNC 1J1DC 1QEXA 1AQ5A 1NJIQ 2E74B 2QM8A 5TISH 3M06A 4JBZA 1T2KD 1K04A 1USDA 3PP5A 5K5GB 2OQQA 2YIUC 2K9YA 1KFMA 3CC7P 1FZBA 2N1TC 1KYOI 1GL2B 4ZKPA 1PV3A 2WTYA 2A45G 1HJ0A 3GF3A 5AW4B 1JY2O 2UWJE 2GM4A 3PRJA 2OARA 3L74J 2YKQA 3KDPB 1J1EC 1LTSC 5H2FE 1SQBK 3VTPC 5E79E 1PPJG 2N1TD 1YHQP 2KSJA 1YITP 3H1LE 1N2DC 3RL0g 1URQC 2IBZG 3O6QA 3H1IG 1L0LE 3CD6P 3T97B 3C9IA 1LTJC 3AEAC 4Y99B 1AVYA 4GKGA 1NOHA 4NPDA 1KV4A 1HF9A 3C1LA 1GMJA 3CCVP 3L73J 1OXZA 3CWBD 3RK2D 3VMAA 5AVQB 1LTAC 1GW3A 1SQQD 1JY3N 1DIPA 1Q2NA 1VQ9P 3TGUD 2Q1KA 1OVVA 1VQ4P 1SQPK 1URQD 3H1IE 3V4WA 4N78E 2IYPA 3RK3C 3ABVC 1NTMD 2OYIC 1FOSF 2Q3IA 4WBAA 1NTKD 2R3SA 3MD0A 3H1HD 4DJGA 2NRGA 1JTHB 3AEEC 4D6TD 1KN7A 3HD7B 1BGYE 2QJYC 3I56P 3CX5I 1PGJA 3RK3D 1LT1A 2LKMA 1AVOA 3B4SA 5B66H 1S9KE 2KS1A 3V2PA 3CCLP 3M0AA 3S9OA 3EFFK 3H1JJ 5C39A 3CCUP 1NKZB 1SFCC 5KLVK 2C9LY 2ZT9B 5AVWB 1CZQA 4HB1A 3CWBG 1PP9D 1P84E 1SQQG 2WPRA 3OW2O 4LGDE 4EOTA 3TGUG 3TK1A 1M1JB 1Q86Q 1VF5B 2B9BA 3VP8A 2O3JA 2Q7CA 1NTMG 1BE3J 3G3ZA 1KQFB 1FZCB 1NTKG 1OVUA 1OVRA 3H1HG 2HLOA 1ZXGA 1SFCD 2H88C 4PD4H 3AE5C 1ZR4A 4D6TG 1FU1A 3CCRP 3N4XA 1SQBE 1GW4A 2E76B 4EIJA 2PFXA 4RO0A 1VQMP 4PJ0E 1HH0A 1IJDB 1EZVE 1VQLP 3G9RA 2ZXEB 1PP9G 1RQUA 3SWKA 2WZ7A 1NU1D 1JOCA 3MP7B 1URQA 2VRSA 3I5CA 2E5TA 3HUSB 4H0LB 3JCUH 3NTNA 1BE3E 1SQVD 1LTTC 1SQPE 1LTJA 3VOPA 1J2JB 1LGHB 4UB6H 4ASVA 1SQXK 4HJGH 2Z5HA 4UB8H 2AEMA 3RGUA 3IAOA 2M5AA 1NYHA 1KYOH 1VPCA 3LIDA 1PGPA 1Z56A 2Q5UA 4U7JA 1FS0E 2OYHC 2W6JH 1DH3A 2BCCE 1U7MA 3CCSP 3FXDA 3PH0A 2D2CC 1YQ4C 4Y28J 2FYZA 1OIPA 1T6AA 1ZMEC 4OWFA 1NO4A 4LLHA 5KLVE 1CI6A 4L75A 2H89C 3SFEC 4WB4A 2A06D 2RN0A 1NU1G 1YQ3C 2HFED 1QLED 1N7SA 1SQVG 3USSA 2GA1A 1JCDA 2D2CD 2ZVOB 1EDKA 2K88A 1QL2A 2OTLP 2HG5D 4OGQC 3MZWB 2IZ0A 1JEKA 2WMMA 3M91A 2CPSA 5TISE 4R4MA 1GDTA 1LT9B 2JWAA 4H13C 5CJ0A 2YKPA 3NXSA 3L70E 3GHGB 2E75C 1L0NJ 2O1KA 3L71D 2HODB 3A2AA 1GU5A 1JCCA 1R5SA 1EXIA 2YKOA 4OGQD 2K9JA 3CXHE 5AVXB 2I1JA 3H25A 3Q3DA 3OA7A 1H89A 2A06G 3AE2C 5APYA 1MFTA 4H13D 1G2CB 2E75D 2FYUK 3CX5H 2E43A 2FXOA 4GT1A 4DOJA 2KIKA 2R5BA 4O9BA 2KYVA 2YMYA 2H7HA 2POHA 1SQXE 5GTIH 1VQNP 1LJ2A 1KILB 2NPSB 3KQGA 1CSBA 2C9NY 3MGNA 3U1AA 1IFJA 1N73B 3L71G 3TNUB 2B87A 3AEGC 1D7MA 3LW5J 2FXPA 1EXJA 1OFCX 4GOFA 5APUA 3CC4P 4H0LC 2IPPA 3HE4B 3T97A 3H1KJ 3HTKB 4KJMA 3BCCJ 2M3EA 4IFFA 3GW6A 2ZYAA 5APSA 1WRGA 2OYHA 1JMMA 2M3BA 2JO1A 1VQ7P 5AW9B 3H1LD 4I7ZC 1RF0A 1KORA 5B66E 1HGZA 4K35A 1AV1A 1L0LD 4U3FJ 5BVZA 3VN0A 3GMAA 1NHLA 3WMM0 2Q3EA 1JTHA 2MKVA 3QH9A 4OVNF 1M7LA 1X8YA 5APTA 1W2EA 4PV1B 5KLIB 1E79H 1BSNA 5KAFH 3AE7C 1UIXA 1YI2P 4ZNCA 1OW7A 3H1ID 1JY3P 2A45I 4N78D 4LC1A 1NTZJ 2YNYA 3CCEP 4PD4E 5EFWB 4TLFA 2IFMA 4HYTB 1OW6A 3II6A 5AW3B 4JF7A 1VQ8P 2B89A 2FYUE 2QJPB 3B5NB 1MFZA 2Y9YA 3B71A 1KB9E 1BGYD 3H1LG 4WY4B 3IN6A 1M1JA 2QSIA 1FDMA 1A02F 5AVRB 1BCCE 2IBZI 3PTZA 1IC2A 1S9KD 3H32B 1ZV8A 1L0LG 2W83C 2RH0A 2LXBA 5GTHE 1DX7A 1IFDA 3A5TA 4W7ZA 4WWIA 1P84D 1AJYA 1FJKA 1VQPP 1FZFA 2WSFH 2J5UA 1ZP0C 1LTIC 1NGMB 3L75E 3BRVB 3I55P 4C46A 3P8MC 3CLQA 1NTZE 2P2UA 2QJKB 1Y9BA 1X22A 2AXTH 4UB8E 2JKVA 3KZIH 1IFNA 1QVFO 1OX3A 5DJUB 1HGVA 2WPQA 4IFMA 2L5GB 1SQBD 1M1KQ 5CBNA 1KYOE 1BGYG 2IX7C 3WU2E 3HUSA 1QX8A 4EI2A 1BSHA 4M3LA 3L74E 1T3JA 3PLNA 3CL3D 1EZVD 3BATA 1L2PA 3L36A 1IK9A 4H44C 1S1CX 1L4AB 3CWBJ 2K3RA 3GG2A 1MZ9A 1SQQJ 2KXPB 3FWNA 1N7SC 1M90Q 1BE3D 1Q90D 3TGUJ 3L72J 4C7RA 1SQPD 3L73E 2P7JA 2ZVNB 3Q1MA 1NTMJ 4JYCA 3AEDC 1GU4A 1N86A 1NTKJ 1YBKA 3C8VA 1LTGC 2Y0CA 3KYQA 3AECC 3H1HJ 5TJHA 3SSUA 2R3CA 1SQBG 3LW5H 4H44D 4MN4C 1JY3O 2WSSH 4D6TJ 2ZFCA 1N7SD 2ZJSE 1FZAA 2CPBA 3AEBC 3VYIA 3M9QA 2WSEH 3TYYA 1EZVG 4A7PA 2BCCD 5CCGC 2K37A 4NPFX 1S2EA 2G8YA 2WT7B 3A3YB 2DW3A 2KZIA 3WUTA 5KLVD 2QA4P 2XKMA 5BU5A 2IZ1A 1PGQA 1HVVA 2E74C 3A0BE 1LT9A 1PP9J 2O01H 5APVA 3CX5E 1MV8A 3KPEA 5APQA 3GHGA 3L35A 3L72E 1BE3G 5KAIH 3H1JE 3WUVA 1SQPG 1YTZT 2HODA 3V2QA 4IOIH 4IFDK 1NWQA 1GL2C 3D71A 5CCGD 5GTIE 4AUWA 1RE4A 4K3AA 1KILE 2Z5IA 3R2PA 2ZYGA 4HKZH 1IFMA 3RBXA 1H88A 1KTMA 2E74D 1BDDA 1G2CA 2KOGA 3L70D 5E79H 1S4XA 1G1IA 2V7QJ 4NPEA 2JJLA 2A45H 3H6PA 3HRNA 1GL2D 2BCCG 4QMAA 1S5LE 1ZN5A 1FJPA 3CXHD 4GDOA 3CCMP 1QL1A 2FFDB 2C0XA 3GLMA 5KLVG 1NH4A 1FAVA 1L0NK 2KZJA 1S5LX 2W6BA 5CCHA 1KILA 3L37A 1DEEG 3P7KA 1U57A 4Y99C 2NPSA 1PL5A 2R32A 1NU1J 3EQ2A 3RL0B 1N73A 5B5EE 1VQOP 3TNUA 1SP4A 1LP1B 3L4FA 2O01N 1GD2E 2QVAA 2O1JA 1SQVJ 4RJTA 2I1KA 1RF0C 1SQXD 3F5HA 3AE1C 1LWUB 5AVZB 4C7NA 3HE4A 1FZGA 2N9BA 4Z1MH 4I2LC 3HTKA 3ITKA 4GOEA 2KB7P 1JB0J 3L70G 1PZQA 2E42A 1YIJP 1JO5A 2BEQD 2WPVB 2WSFJ 4W7YA 3HD7C 1J1DB 2WVRA 5KKZB 1UIIA 1YTZI 3O8ZA 2PAJA 1W2BO 4IL6H 2YIUB 3S1KA 2N1TB 3V4QA 2FXMA 3CI9A 1EDJA 3B8EB 2XNXA 2ZT9C 3P8CE 1P84H 4RKUJ 1FE6A 2W27A 2XNDH 5CCGA 1JUNA 3HD7D 2YXQB 1KQLA 1ZLLA 5AW6B 1M1JC 1VF5C 3U59A 1SQXG 1J1EB 2KI7B 2JEEA 2M0BA 1FC2C 2BASA 3RK2B 1FZCC 1JM0A 1FOSE 1USEA 1RE3A 2P58A 1T3UA 2ZT9D 1EDLA 4L74A 2V4HA 1ZRTE 3G71P 1URQB 2JR8A 3Q5RA 3CMEP 1GL2A 3B5NA 4N3YB 3AE4C 2E76C 1HBWA 1Q81Q 4WY4A 3E7KA 1VF5D 3OJAB 2C0WA 2KNCB 5M1BA 3RBZA 1ZW0A 3CMAP 3H32A 1IO4A 3EFGA 1L0NE 3KZIE 1IFIA 4PD4D 2XDJA 4ZKUA 1HTLC 3F89A 3RK3B 1FDOA 1K73Q 1X0TA 2FYUD 2OYIB 1GZLA 2OTKE 2E76D 1NTZK 4I6MC 1KB9D 1K8AQ 2LXCB 3HUSC 3IFMA 5KJ7A 1BCCD 4N6JA 1YJWP 3MUDA 2RMZA 2QM7A 3V5BA 2WSEJ 1Q7YQ 2OGUA 1CI6B 2QJYB 4EYYQ 2CK3H 2GUSA 5AW1B 3FXEA 2AXCA 3BASA 1EDIA 1TU3F 2O01J 4H0LD 3L75D 1SFCB 2OYOA 1OWAA 5AW8B 2W6AA 4B86A 2FY8A 5AW2B 3SFDC 1NTZD 1JY2N 2Z4EA 2KP8A 2XU6A 3M0DA 2IYOA 4TT3H 4RESB 2V7QH 3TF5A 1EQ7A 3IR9A 2KUBA 1Y47A 3G6EP 3VMYA 3HD7A 2H8PD 4GODA 2FYUG 5CBOA 2AEFA 1LWUC 1FDIA 1KYOD 2FKWB 2G3AA 1L4AA 1RY3A 3H1KE 1BCCG 3BCCE 2AEJA 3L74D 2Y9ZA 4AYCA 3AE9C 1RF1B 3JC22 3A0HH 1M56D 4DCKA 1L0LJ 5CMZA 5KKZC 2SPZA 1JMBA 3K5BA 3AE3C 1SLQA 1BDCA 2QG4A 3G4SP 1LT9C 4ASWA 3L75G 5KAIE 2JWDA 3GHGC 4U3FE 1FZCA 3D6YA 1NTZG 1G1JA 3L73D 1FBMA 3H1IJ 2W8ZA 3CXHH 3M9BA 1IK7A 4GIFA 3E1IA 1RE4C 2WT7A 1SQQK 2R5DA 3HE5B 3JCUE 2FBWC 1VQ5P 4JPZB 3CC2P 2HPCB 1M8OB 3RK2C 2B87B 4UB6E 3PHLA 1NTMK 4W80A 3U1CA 1ZOYC 1NTKK 2RKLA 1BGYJ 4OH8B 3L74G 2WITA 3SWFA 4BWNA 2ITAA 1ZR2A 2Q6QA 2WPSA 1H0TB 5APXA 1P84I 5CCHC 1VDFA 2P67A 3EWKA 2Y0DA 1KILC 1PPJE 3P32A 4XE5B 2OYHB 2NPSC 1NKNA 2D2CB 3CX5D 3L72D 5AW0B 3H1JD 1HUCA 2K1AA 1N73C 2IBZE 1NVOA 2JP3A 2R44A 3L73G 2KK7A 2N9YB 2HR3A 3UIAA 1X79B 1E5WA 1AFOA 2FFDA 3OAKA 5CCHD 4ZMDA 1KILD 3AE8C 4YTPC 2Q9IA 1RHZB 3SWYA 2NPSD 3VMXA 2WSCH 5AVUB 4BRYB 2J59M 1SQBJ 4OGQB 5CHXA 4BXLA 1QVGO 2P1JA 1LP1A 2PRRA 1EZVI 3Q5SA 4I1LA 4IL6E 4H13B 2E75B 5CJ4A 1LWUA 4IL6X 4L76A 3L72G 1N8RQ 2H43A 3H1JG 4PV1C 5KLIC 1LTBC 3S4RA 1KC8Q
chains in the Genus database with same CATH topology
3HE4B 2E42A 2KSJA 1JO5A 3T97A 1N2DC 1NU1K 3HTKB 1KFNA 1URQC 1GK4A 4W7YA 3LIEA 3HD7C 1J1DB 4IFFA 2N1TA 1YTZI 5APSA 1WRGA 2XV5A 3O8ZA 2OYHA 1RE3C 1JMMA 2PAJA 3C9IA 1SQVK 1LTJC 2YO3A 4Y99B 1RF1C 4GKGA 2M3BA 1NOHA 5AW9B 5APWA 2N1TB 3V4QA 1OXZA 2FXMA 3B5NC 3RK2D 2IFNA 3CI9A 1RF0A 5AVQB 1LTAC 1GW3A 3V2NA 1JY3N 1HGZA 3B8EB 2XNXA 3MIWA 3P8CE 4JYBA 4WY4C 1N7LA 2W27A 1X9VA 3TSIA 5BVZA 3VN0A 5CCGA 1SQPK 1NHLA 3WMM0 1JUNA 1URQD 1A02J 3HD7D 1JTHA 3V4WA 4N78E 1KQLA 1ZLLA 3RK3C 5AW6B 1M1JC 2OYIC 1FOSF 2Q3IA 4WBAA 3U59A 1M7LA 1X8YA 3MD0A 1J1EB 5APTA 1W2EA 3P8CD 2JEEA 2PP6A 2BASA 3RK2B 1JTHB 3MTUE 1FZCC 1FOSE 1NAFA 3B5ND 1RE3A 1JY3P 1T3UA 2A45I 1YYCA 4N78D 4LC1A 4WY4D 1HJBA 1WT6A 5AW5B 1URQB 3HD7B 5KJ7C 2YNYA 2KLVA 3VMZA 3V2RA 1GL2A 1CW5A 3B5NA 2IFMA 2XZRA 4N3YB 4HYTB 1HWTC 3RK3D 3II6A 5AW3B 1HBWA 1XTGB 2LKMA 4JF7A 4WY4A 1S9KE 3OJAB 2C0WA 3V2PA 3M0AA 3B5NB 1MFZA 3A7OA 1NKZB 1SFCC 5KLVK 3H32A 2C9LY 1IO4A 3EFGA 5AVWB 1CZQA 4WY4B 1IFIA 1M1JA 2OYIA 1FDMA 1A02F 2XDJA 5AVRB 2WPRA 4LGDE 4DZOA 4EOTA 4ZKUA 1IC2A 1HTLC 3TK1A 5KJ7D 3H32B 1S9KD 1ZV8A 3RK3B 1M1JB 2OYIB 1GZLA 1DX7A 1NTZK 1IFDA 4I6MC 3A5TA 3VP8A 4W7ZA 2Q7CA 3HUSC 3G3ZA 3M0DC 3IFMA 1FZCB 5KJ7A 1FJKA 2HLOA 4N6JA 1SFCD 2HYNA 3MUDA 2WSFH 1FZFA 2QM7A 3V5BA 1LTIC 5AVVB 1CI6B 3BRVB 1ZR4A 1FU1A 1L4AC 3N4XA 4C46A 2GUSA 3P8MC 3CLQA 5AW1B 1GW4A 2P2UA 1SFCA 3NMDA 2M8RA 3BASA 1IFNA 1DEBA 4KHXA 4EIJA 1SFCB 1HGVA 1OWAA 5AW8B 2W6AA 2WPQA 1HH0A 1IJDB 4IFMA 2L5GB 4B86A 5AW2B 1JY2N 2Z4EA 2IX7C 2KP8A 2XU6A 2ZXEB 3HUSA 3M0DA 1JNMA 4RESB 1KZUB 1L4AD 2WZ7A 4M3LA 1EQ7A 2GUVA 5AVYB 3IR9A 5KTBA 1JOCA 5BU8B 3VMYA 1URQA 2VRSA 1T3JA 3HD7A 2H8PD 2J58A 3CL3D 3I5CA 3HUSB 3BATA 3NFQA 1XTCC 3NTNA 1LWUC 2FKWB 1L4AA 2MJZA 1LTTC 3N7NA 1LTJA 3VOPA 1RF1A 1RY3A 1J2JB 1LGHB 3L36A 1IK9A 1SQXK 1T8ZA 4XA4A 1JY2P 1L4AB 2Z5HA 4AYCA 1LTJB 1RF1B 1MZ9A 1N7SC 4C7RA 5CMZA 2P7JA 1VPCA 3LIDA 1SLQA 1Z56A 4JYCA 1LT9C 1GU4A 1N86A 1H8AA 1GK6A 1LTGC 2Q5UA 3GHGC 3KYQA 2OYHC 1FZCA 2R3CA 3LW5H 1GTWA 1DH3A 5AVTB 3BRTB 2FYZA 1JY3O 2YO2A 1G1JA 1FBMA 3HE5A 1NO4A 4LLHA 3M9BA 2ZFCA 1CI6A 1N7SD 4GIFA 3E1IA 4WB4A 2HPCA 1RE4C 1PFIA 2WT7A 3M9HA 1SQQK 2R5DA 1FZAA 2CPBA 3VYIA 3HE5B 3M9QA 2WSEH 2HFED 3TYYA 1L0LK 5CCGC 2HPCB 3RK2C 1N7SA 2WT7B 3A3YB 4C7NB 5AW7B 1MUUA 1NTMK 4W80A 3U1CA 1NTKK 1JCDA 3VP9A 2XKMA 4OH8B 5BU5A 2FFDC 2WITA 1HVVA 1N7SB 1QL2A 2HG5D 1LT9A 2O01H 3SWFA 5APVA 3KPEA 1MV8A 1SVFA 5APQA 3GHGA 3L35A 1ZR2A 3M91A 2CPSA 2WPSA 1YTZT 1GDTA 5APXA 2HODA 3V2QA 5CCHC 1LT9B 1VDFA 2P67A 4IFDK 5CJ0A 1NWQA 1KILC 3P32A 1GL2C 2YKPA 3RL0C 5CCGD 3NXSA 4XE5B 3GHGB 2OYHB 2NPSC 4AUWA 1NKNA 1RE4A 2O1KA 2HODB 3A2AA 1GU5A 1JCCA 1FZEA 2Z5IA 5AW0B 3R2PA 1HUCA 1N73C 1T2KC 1IFMA 1H88A 2YKOA 5AVXB 1G2CA 2KOGA 2I1JA 3UIAA 1X79B 2WWWA 3OA7A 5AVSB 1H89A 1G1IA 4AQRD 3BVHA 4HH2A 5APYA 1E5WA 1AFOA 2JJLA 2FFDA 3OAKA 2A45H 5CCHD 3H6PA 3HRNA 1G2CB 1KILD 1GL2D 2Q9IA 3RL0D 2FYUK 3SWYA 2NPSD 1ZN5A 3VMXA 2WSCH 5AVUB 1FJPA 2E43A 1QL1A 1J1DC 4GT1A 2FFDB 2C0XA 1NH4A 1AQ5A 1FAVA 1L0NK 2J59M 2QM8A 2W6BA 3M06A 5CCHA 4DOJA 1T2KD 1KILA 2R5BA 3L37A 4O9BA 5CHXA 3PP5A 3P7KA 2P1JA 2KYVA 4Y99C 2NPSA 2YMYA 2H7HA 2POHA 2R32A 1KFMA 1FZBA 2N1TC 4I1LA 3EQ2A 1KILB 1GL2B 3RL0B 1N73A 2NPSB 4ZKPA 3TNUA 1LWUA 5CJ4A 1SP4A 2WTYA 3KQGA 3L4FA 2A45G 1GD2E 1CSBA 2C9NY 2O1JA 3MGNA 2I1KA 1RF0C 3U1AA 1IFJA 1N73B 5AW4B 4C7NA 3TNUB 1JY2O 1LWUB 5AVZB 2GM4A 2H43A 3HE4A 1FZGA 2OARA 2YKQA 3KDPB 1J1EC 1LTSC 2N9BA 1SQBK 3VTPC 4I2LC 3HTKA 1LTBC 2KB7P 2N1TD 5APUA 2IPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J2J B;  1CZQ A;  3HE4 B;  3P32 A;  2E42 A;  3NXS A;  4XE5 B;  3L36 A;  3T97 A;  4AUW A;  1A02 F;  5AVR B;  2WPR A;  4DZO A;  4EOT A;  2Z5H A;  1GK4 A;  3LIE A;  4AYC A;  3TK1 A;  1S9K D;  3A2A A;  1GU5 A;  5APS A;  2Z5I A;  5AW0 B;  2XV5 A;  3O8Z A;  1HUC A;  1T2K C;  1H88 A;  1GZL A;  4I6M C;  2YO3 A;  5CMZ A;  5AVX B;  3A5T A;  4GKG A;  2Q7C A;  3UIA A;  2WWW A;  5AW9 B;  5AVS B;  1H89 A;  2P7J A;  5APW A;  3V4Q A;  3LID A;  4AQR D;  1OXZ A;  1SLQ A;  5APY A;  2JJL A;  4JYC A;  5AVQ B;  3OAK A;  1GU4 A;  1NWQ A;  3B8E B;  4JYB A;  1H8A A;  2QM7 A;  3V5B A;  1GK6 A;  1G2C B;  2Q5U A;  5AVV B;  1CI6 B;  2W27 A;  2R3C A;  3VMX A;  1GTW A;  1DH3 A;  5AVT B;  5AVU B;  3VN0 A;  2E43 A;  4C46 A;  1JUN A;  3P8M C;  2YO2 A;  4GT1 A;  1A02 J;  5AW1 B;  3V4W A;  3HE5 A;  1FAV A;  2P2U A;  2QM8 A;  1KQL A;  3M06 A;  5AW6 B;  3M9B A;  3NMD A;  2ZFC A;  1T2K D;  1CI6 A;  1FOS F;  2Q3I A;  2R5B A;  3L37 A;  1X8Y A;  3MD0 A;  3P7K A;  5APT A;  3M9H A;  2WT7 A;  2R5D A;  2H7H A;  4KHX A;  2BAS A;  2R32 A;  3VYI A;  3HE5 B;  1FOS E;  1NAF A;  3TYY A;  1OWA A;  5AW8 B;  2W6A A;  2WPQ A;  4B86 A;  5AW2 B;  2WT7 B;  1YYC A;  3TNU A;  3A3Y B;  4LC1 A;  4C7N B;  1SP4 A;  2WTY A;  3KQG A;  5AW7 B;  1HJB A;  1GD2 E;  2KP8 A;  5AW5 B;  1CSB A;  1MUU A;  2XU6 A;  2C9N Y;  2ZXE B;  3M0D A;  3MGN A;  2YNY A;  1JNM A;  4RES B;  3VMZ A;  4M3L A;  5AVY B;  5AW4 B;  2XZR A;  3IR9 A;  4C7N A;  4HYT B;  5AVZ B;  3TNU B;  1HWT C;  3SWF A;  1HBW A;  5APV A;  5AW3 B;  3VMY A;  1MV8 A;  2VRS A;  3HE4 A;  5APQ A;  3I5C A;  1S9K E;  3L35 A;  3KDP B;  3NFQ A;  2N9B A;  3VTP C;  3M91 A;  3NTN A;  4I2L C;  2WPS A;  3M0A A;  3HTK A;  1MFZ A;  3A7O A;  5APX A;  5APU A;  2P67 A;  2C9L Y;  1IO4 A;  2IPP A;  5AVW B; 
#chains in the Genus database with same CATH topology
 1SQP J;  1AA0 A;  2P10 A;  3CWB E;  1NU1 K;  1KFN A;  1GK4 A;  1SQQ E;  3LIE A;  2KSE A;  1S72 P;  1EC5 A;  2N1T A;  3Q5P A;  2XV5 A;  3TGU E;  3PJS K;  1RE3 C;  3FX0 A;  1WMK A;  1SQV K;  1MKM A;  2BEZ F;  2YO3 A;  1RF1 C;  5APW A;  1KB9 H;  1NTM E;  4PV1 D;  3O6Q B;  1M57 D;  2QJP C;  3B5N C;  1NTK E;  2IFN A;  1K05 A;  3V2N A;  3MIW A;  4JYB A;  3H1H E;  4WY4 C;  1DD4 A;  1N7L A;  1X9V A;  3TSI A;  2BCC J;  5H2F H;  1A02 J;  4D6T E;  3AEF C;  3FGA D;  5GTH H;  5KLV J;  2QE7 H;  3P8C D;  1NAY A;  2PP6 A;  3MTU E;  3RK3 E;  1NAF A;  3JSV C;  3B5N D;  1YJ9 P;  1YYC A;  4WY4 D;  1HJB A;  1WT6 A;  4L73 A;  5AW5 B;  5KJ7 C;  2KLV A;  3VMZ A;  3V2R A;  1VL2 A;  1U7J A;  2ZAE B;  4EDF A;  2KNC A;  1PP9 E;  1OW8 A;  1CW5 A;  3MUD C;  2XZR A;  2Y0E A;  2YMK A;  2QJK C;  1HWT C;  1XTG B;  1VQ6 P;  4I7Z B;  3A7O A;  1S3J A;  1ZRT D;  3W68 A;  2L91 A;  2OYI A;  2KS1 B;  3WU2 H;  4YXD C;  3L70 J;  4DZO A;  5KJ7 D;  1LNQ A;  3CXH I;  3R4Y A;  1L0N D;  3M0D C;  1IFP A;  1KQS O;  1KD1 Q;  5KAF E;  2HYN A;  1RQV A;  2FYN B;  2LR2 A;  2B88 A;  5AVV B;  5L8R J;  3CPW O;  1K9M Q;  1L4A C;  2QIW A;  1SFC A;  1R8E A;  3NMD A;  2M8R A;  2QEX P;  4KT0 J;  1DEB A;  4KHX A;  3D70 A;  1NU1 E;  2NZ2 A;  1SQX J;  1RH5 B;  3A0H E;  3QWO C;  1PGO A;  1SQV E;  3ZDM A;  3WUU A;  1JNM A;  1KZU B;  1L4A D;  2GUV A;  5AVY B;  1IZN B;  2YXR B;  5KTB A;  5BU8 B;  1OZH A;  2J58 A;  3NFQ A;  3AE6 C;  2W90 A;  1XTC C;  3MHV A;  2MJZ A;  1L0N G;  1SS1 A;  3N7N A;  1RF1 A;  1KMI Z;  1KQG B;  2KLU A;  1T8Z A;  2PGD A;  4XA4 A;  1JY2 P;  1Q82 Q;  1LTJ B;  3A0B H;  3L71 J;  2WSC J;  1QGK B;  1W5C E;  4PJ0 H;  1PIX A;  4YPC A;  3H1K D;  2AXT E;  3V6I A;  2I8D A;  3BCC D;  5DJT B;  3E1R A;  2A06 E;  2M5A B;  1H8A A;  1GK6 A;  2ZXX A;  1YJN P;  2WQY C;  1OMI A;  1GTW A;  5AVT B;  4CPG A;  3BRT B;  3CCJ P;  2YO2 A;  3HE5 A;  2HPC A;  2E5Y A;  1PFI A;  3M9H A;  4DT0 A;  3FWL A;  4U3F D;  4XFJ A;  3W67 A;  1L0L K;  1S5L H;  4C7N B;  4H44 B;  3Q2Y A;  4PD4 I;  5AW7 B;  1MUU A;  3VP9 A;  4JQ0 D;  2FFD C;  1H0T A;  1N7S B;  3L71 E;  4WVZ A;  1SVF A;  2OTJ P;  3GF7 A;  1KB9 I;  3KHU A;  1AQT A;  5B5E H;  2FYU J;  3H1K G;  3CCQ P;  3RL0 C;  3BCC G;  3KXD A;  1BCC J;  1VQK P;  1FZE A;  1T2K C;  3IF4 A;  1Y8A A;  1R5L A;  1PPJ D;  2ZYD A;  2WWW A;  5AVS B;  2IDB A;  4AQR D;  3BVH A;  4HH2 A;  1DD3 A;  3TDK A;  3H1L J;  2QRX A;  4R4L A;  2K9J B;  4BRY A;  4U3F G;  4YXW H;  3D6Z A;  3RL0 D;  2IBZ D;  2JDI H;  3L75 J;  2FYN C;  1J1D C;  1QEX A;  1AQ5 A;  1NJI Q;  2E74 B;  2QM8 A;  5TIS H;  3M06 A;  4JBZ A;  1T2K D;  1K04 A;  1USD A;  3PP5 A;  5K5G B;  2OQQ A;  2YIU C;  2K9Y A;  1KFM A;  3CC7 P;  1FZB A;  2N1T C;  1KYO I;  1GL2 B;  4ZKP A;  1PV3 A;  2WTY A;  2A45 G;  1HJ0 A;  3GF3 A;  5AW4 B;  1JY2 O;  2UWJ E;  2GM4 A;  3PRJ A;  2OAR A;  3L74 J;  2YKQ A;  3KDP B;  1J1E C;  1LTS C;  5H2F E;  1SQB K;  3VTP C;  5E79 E;  1PPJ G;  2N1T D;  1YHQ P;  2KSJ A;  1YIT P;  3H1L E;  1N2D C;  3RL0 g;  1URQ C;  2IBZ G;  3O6Q A;  3H1I G;  1L0L E;  3CD6 P;  3T97 B;  3C9I A;  1LTJ C;  3AEA C;  4Y99 B;  1AVY A;  4GKG A;  1NOH A;  4NPD A;  1KV4 A;  1HF9 A;  3C1L A;  1GMJ A;  3CCV P;  3L73 J;  1OXZ A;  3CWB D;  3RK2 D;  3VMA A;  5AVQ B;  1LTA C;  1GW3 A;  1SQQ D;  1JY3 N;  1DIP A;  1Q2N A;  1VQ9 P;  3TGU D;  2Q1K A;  1OVV A;  1VQ4 P;  1SQP K;  1URQ D;  3H1I E;  3V4W A;  4N78 E;  2IYP A;  3RK3 C;  3ABV C;  1NTM D;  2OYI C;  1FOS F;  2Q3I A;  4WBA A;  1NTK D;  2R3S A;  3MD0 A;  3H1H D;  4DJG A;  2NRG A;  1JTH B;  3AEE C;  4D6T D;  1KN7 A;  3HD7 B;  1BGY E;  2QJY C;  3I56 P;  3CX5 I;  1PGJ A;  3RK3 D;  1LT1 A;  2LKM A;  1AVO A;  3B4S A;  5B66 H;  1S9K E;  2KS1 A;  3V2P A;  3CCL P;  3M0A A;  3S9O A;  3EFF K;  3H1J J;  5C39 A;  3CCU P;  1NKZ B;  1SFC C;  5KLV K;  2C9L Y;  2ZT9 B;  5AVW B;  1CZQ A;  4HB1 A;  3CWB G;  1PP9 D;  1P84 E;  1SQQ G;  2WPR A;  3OW2 O;  4LGD E;  4EOT A;  3TGU G;  3TK1 A;  1M1J B;  1Q86 Q;  1VF5 B;  2B9B A;  3VP8 A;  2O3J A;  2Q7C A;  1NTM G;  1BE3 J;  3G3Z A;  1KQF B;  1FZC B;  1NTK G;  1OVU A;  1OVR A;  3H1H G;  2HLO A;  1ZXG A;  1SFC D;  2H88 C;  4PD4 H;  3AE5 C;  1ZR4 A;  4D6T G;  1FU1 A;  3CCR P;  3N4X A;  1SQB E;  1GW4 A;  2E76 B;  4EIJ A;  2PFX A;  4RO0 A;  1VQM P;  4PJ0 E;  1HH0 A;  1IJD B;  1EZV E;  1VQL P;  3G9R A;  2ZXE B;  1PP9 G;  1RQU A;  3SWK A;  2WZ7 A;  1NU1 D;  1JOC A;  3MP7 B;  1URQ A;  2VRS A;  3I5C A;  2E5T A;  3HUS B;  4H0L B;  3JCU H;  3NTN A;  1BE3 E;  1SQV D;  1LTT C;  1SQP E;  1LTJ A;  3VOP A;  1J2J B;  1LGH B;  4UB6 H;  4ASV A;  1SQX K;  4HJG H;  2Z5H A;  4UB8 H;  2AEM A;  3RGU A;  3IAO A;  2M5A A;  1NYH A;  1KYO H;  1VPC A;  3LID A;  1PGP A;  1Z56 A;  2Q5U A;  4U7J A;  1FS0 E;  2OYH C;  2W6J H;  1DH3 A;  2BCC E;  1U7M A;  3CCS P;  3FXD A;  3PH0 A;  2D2C C;  1YQ4 C;  4Y28 J;  2FYZ A;  1OIP A;  1T6A A;  1ZME C;  4OWF A;  1NO4 A;  4LLH A;  5KLV E;  1CI6 A;  4L75 A;  2H89 C;  3SFE C;  4WB4 A;  2A06 D;  2RN0 A;  1NU1 G;  1YQ3 C;  2HFE D;  1QLE D;  1N7S A;  1SQV G;  3USS A;  2GA1 A;  1JCD A;  2D2C D;  2ZVO B;  1EDK A;  2K88 A;  1QL2 A;  2OTL P;  2HG5 D;  4OGQ C;  3MZW B;  2IZ0 A;  1JEK A;  2WMM A;  3M91 A;  2CPS A;  5TIS E;  4R4M A;  1GDT A;  1LT9 B;  2JWA A;  4H13 C;  5CJ0 A;  2YKP A;  3NXS A;  3L70 E;  3GHG B;  2E75 C;  1L0N J;  2O1K A;  3L71 D;  2HOD B;  3A2A A;  1GU5 A;  1JCC A;  1R5S A;  1EXI A;  2YKO A;  4OGQ D;  2K9J A;  3CXH E;  5AVX B;  2I1J A;  3H25 A;  3Q3D A;  3OA7 A;  1H89 A;  2A06 G;  3AE2 C;  5APY A;  1MFT A;  4H13 D;  1G2C B;  2E75 D;  2FYU K;  3CX5 H;  2E43 A;  2FXO A;  4GT1 A;  4DOJ A;  2KIK A;  2R5B A;  4O9B A;  2KYV A;  2YMY A;  2H7H A;  2POH A;  1SQX E;  5GTI H;  1VQN P;  1LJ2 A;  1KIL B;  2NPS B;  3KQG A;  1CSB A;  2C9N Y;  3MGN A;  3U1A A;  1IFJ A;  1N73 B;  3L71 G;  3TNU B;  2B87 A;  3AEG C;  1D7M A;  3LW5 J;  2FXP A;  1EXJ A;  1OFC X;  4GOF A;  5APU A;  3CC4 P;  4H0L C;  2IPP A;  3HE4 B;  3T97 A;  3H1K J;  3HTK B;  4KJM A;  3BCC J;  2M3E A;  4IFF A;  3GW6 A;  2ZYA A;  5APS A;  1WRG A;  2OYH A;  1JMM A;  2M3B A;  2JO1 A;  1VQ7 P;  5AW9 B;  3H1L D;  4I7Z C;  1RF0 A;  1KOR A;  5B66 E;  1HGZ A;  4K35 A;  1AV1 A;  1L0L D;  4U3F J;  5BVZ A;  3VN0 A;  3GMA A;  1NHL A;  3WMM 0;  2Q3E A;  1JTH A;  2MKV A;  3QH9 A;  4OVN F;  1M7L A;  1X8Y A;  5APT A;  1W2E A;  4PV1 B;  5KLI B;  1E79 H;  1BSN A;  5KAF H;  3AE7 C;  1UIX A;  1YI2 P;  4ZNC A;  1OW7 A;  3H1I D;  1JY3 P;  2A45 I;  4N78 D;  4LC1 A;  1NTZ J;  2YNY A;  3CCE P;  4PD4 E;  5EFW B;  4TLF A;  2IFM A;  4HYT B;  1OW6 A;  3II6 A;  5AW3 B;  4JF7 A;  1VQ8 P;  2B89 A;  2FYU E;  2QJP B;  3B5N B;  1MFZ A;  2Y9Y A;  3B71 A;  1KB9 E;  1BGY D;  3H1L G;  4WY4 B;  3IN6 A;  1M1J A;  2QSI A;  1FDM A;  1A02 F;  5AVR B;  1BCC E;  2IBZ I;  3PTZ A;  1IC2 A;  1S9K D;  3H32 B;  1ZV8 A;  1L0L G;  2W83 C;  2RH0 A;  2LXB A;  5GTH E;  1DX7 A;  1IFD A;  3A5T A;  4W7Z A;  4WWI A;  1P84 D;  1AJY A;  1FJK A;  1VQP P;  1FZF A;  2WSF H;  2J5U A;  1ZP0 C;  1LTI C;  1NGM B;  3L75 E;  3BRV B;  3I55 P;  4C46 A;  3P8M C;  3CLQ A;  1NTZ E;  2P2U A;  2QJK B;  1Y9B A;  1X22 A;  2AXT H;  4UB8 E;  2JKV A;  3KZI H;  1IFN A;  1QVF O;  1OX3 A;  5DJU B;  1HGV A;  2WPQ A;  4IFM A;  2L5G B;  1SQB D;  1M1K Q;  5CBN A;  1KYO E;  1BGY G;  2IX7 C;  3WU2 E;  3HUS A;  1QX8 A;  4EI2 A;  1BSH A;  4M3L A;  3L74 E;  1T3J A;  3PLN A;  3CL3 D;  1EZV D;  3BAT A;  1L2P A;  3L36 A;  1IK9 A;  4H44 C;  1S1C X;  1L4A B;  3CWB J;  2K3R A;  3GG2 A;  1MZ9 A;  1SQQ J;  2KXP B;  3FWN A;  1N7S C;  1M90 Q;  1BE3 D;  1Q90 D;  3TGU J;  3L72 J;  4C7R A;  1SQP D;  3L73 E;  2P7J A;  2ZVN B;  3Q1M A;  1NTM J;  4JYC A;  3AED C;  1GU4 A;  1N86 A;  1NTK J;  1YBK A;  3C8V A;  1LTG C;  2Y0C A;  3KYQ A;  3AEC C;  3H1H J;  5TJH A;  3SSU A;  2R3C A;  1SQB G;  3LW5 H;  4H44 D;  4MN4 C;  1JY3 O;  2WSS H;  4D6T J;  2ZFC A;  1N7S D;  2ZJS E;  1FZA A;  2CPB A;  3AEB C;  3VYI A;  3M9Q A;  2WSE H;  3TYY A;  1EZV G;  4A7P A;  2BCC D;  5CCG C;  2K37 A;  4NPF X;  1S2E A;  2G8Y A;  2WT7 B;  3A3Y B;  2DW3 A;  2KZI A;  3WUT A;  5KLV D;  2QA4 P;  2XKM A;  5BU5 A;  2IZ1 A;  1PGQ A;  1HVV A;  2E74 C;  3A0B E;  1LT9 A;  1PP9 J;  2O01 H;  5APV A;  3CX5 E;  1MV8 A;  3KPE A;  5APQ A;  3GHG A;  3L35 A;  3L72 E;  1BE3 G;  5KAI H;  3H1J E;  3WUV A;  1SQP G;  1YTZ T;  2HOD A;  3V2Q A;  4IOI H;  4IFD K;  1NWQ A;  1GL2 C;  3D71 A;  5CCG D;  5GTI E;  4AUW A;  1RE4 A;  4K3A A;  1KIL E;  2Z5I A;  3R2P A;  2ZYG A;  4HKZ H;  1IFM A;  3RBX A;  1H88 A;  1KTM A;  2E74 D;  1BDD A;  1G2C A;  2KOG A;  3L70 D;  5E79 H;  1S4X A;  1G1I A;  2V7Q J;  4NPE A;  2JJL A;  2A45 H;  3H6P A;  3HRN A;  1GL2 D;  2BCC G;  4QMA A;  1S5L E;  1ZN5 A;  1FJP A;  3CXH D;  4GDO A;  3CCM P;  1QL1 A;  2FFD B;  2C0X A;  3GLM A;  5KLV G;  1NH4 A;  1FAV A;  1L0N K;  2KZJ A;  1S5L X;  2W6B A;  5CCH A;  1KIL A;  3L37 A;  1DEE G;  3P7K A;  1U57 A;  4Y99 C;  2NPS A;  1PL5 A;  2R32 A;  1NU1 J;  3EQ2 A;  3RL0 B;  1N73 A;  5B5E E;  1VQO P;  3TNU A;  1SP4 A;  1LP1 B;  3L4F A;  2O01 N;  1GD2 E;  2QVA A;  2O1J A;  1SQV J;  4RJT A;  2I1K A;  1RF0 C;  1SQX D;  3F5H A;  3AE1 C;  1LWU B;  5AVZ B;  4C7N A;  3HE4 A;  1FZG A;  2N9B A;  4Z1M H;  4I2L C;  3HTK A;  3ITK A;  4GOE A;  2KB7 P;  1JB0 J;  3L70 G;  1PZQ A;  2E42 A;  1YIJ P;  1JO5 A;  2BEQ D;  2WPV B;  2WSF J;  4W7Y A;  3HD7 C;  1J1D B;  2WVR A;  5KKZ B;  1UII A;  1YTZ I;  3O8Z A;  2PAJ A;  1W2B O;  4IL6 H;  2YIU B;  3S1K A;  2N1T B;  3V4Q A;  2FXM A;  3CI9 A;  1EDJ A;  3B8E B;  2XNX A;  2ZT9 C;  3P8C E;  1P84 H;  4RKU J;  1FE6 A;  2W27 A;  2XND H;  5CCG A;  1JUN A;  3HD7 D;  2YXQ B;  1KQL A;  1ZLL A;  5AW6 B;  1M1J C;  1VF5 C;  3U59 A;  1SQX G;  1J1E B;  2KI7 B;  2JEE A;  2M0B A;  1FC2 C;  2BAS A;  3RK2 B;  1FZC C;  1JM0 A;  1FOS E;  1USE A;  1RE3 A;  2P58 A;  1T3U A;  2ZT9 D;  1EDL A;  4L74 A;  2V4H A;  1ZRT E;  3G71 P;  1URQ B;  2JR8 A;  3Q5R A;  3CME P;  1GL2 A;  3B5N A;  4N3Y B;  3AE4 C;  2E76 C;  1HBW A;  1Q81 Q;  4WY4 A;  3E7K A;  1VF5 D;  3OJA B;  2C0W A;  2KNC B;  5M1B A;  3RBZ A;  1ZW0 A;  3CMA P;  3H32 A;  1IO4 A;  3EFG A;  1L0N E;  3KZI E;  1IFI A;  4PD4 D;  2XDJ A;  4ZKU A;  1HTL C;  3F89 A;  3RK3 B;  1FDO A;  1K73 Q;  1X0T A;  2FYU D;  2OYI B;  1GZL A;  2OTK E;  2E76 D;  1NTZ K;  4I6M C;  1KB9 D;  1K8A Q;  2LXC B;  3HUS C;  3IFM A;  5KJ7 A;  1BCC D;  4N6J A;  1YJW P;  3MUD A;  2RMZ A;  2QM7 A;  3V5B A;  2WSE J;  1Q7Y Q;  2OGU A;  1CI6 B;  2QJY B;  4EYY Q;  2CK3 H;  2GUS A;  5AW1 B;  3FXE A;  2AXC A;  3BAS A;  1EDI A;  1TU3 F;  2O01 J;  4H0L D;  3L75 D;  1SFC B;  2OYO A;  1OWA A;  5AW8 B;  2W6A A;  4B86 A;  2FY8 A;  5AW2 B;  3SFD C;  1NTZ D;  1JY2 N;  2Z4E A;  2KP8 A;  2XU6 A;  3M0D A;  2IYO A;  4TT3 H;  4RES B;  2V7Q H;  3TF5 A;  1EQ7 A;  3IR9 A;  2KUB A;  1Y47 A;  3G6E P;  3VMY A;  3HD7 A;  2H8P D;  4GOD A;  2FYU G;  5CBO A;  2AEF A;  1LWU C;  1FDI A;  1KYO D;  2FKW B;  2G3A A;  1L4A A;  1RY3 A;  3H1K E;  1BCC G;  3BCC E;  2AEJ A;  3L74 D;  2Y9Z A;  4AYC A;  3AE9 C;  1RF1 B;  3JC2 2;  3A0H H;  1M56 D;  4DCK A;  1L0L J;  5CMZ A;  5KKZ C;  2SPZ A;  1JMB A;  3K5B A;  3AE3 C;  1SLQ A;  1BDC A;  2QG4 A;  3G4S P;  1LT9 C;  4ASW A;  3L75 G;  5KAI E;  2JWD A;  3GHG C;  4U3F E;  1FZC A;  3D6Y A;  1NTZ G;  1G1J A;  3L73 D;  1FBM A;  3H1I J;  2W8Z A;  3CXH H;  3M9B A;  1IK7 A;  4GIF A;  3E1I A;  1RE4 C;  2WT7 A;  1SQQ K;  2R5D A;  3HE5 B;  3JCU E;  2FBW C;  1VQ5 P;  4JPZ B;  3CC2 P;  2HPC B;  1M8O B;  3RK2 C;  2B87 B;  4UB6 E;  3PHL A;  1NTM K;  4W80 A;  3U1C A;  1ZOY C;  1NTK K;  2RKL A;  1BGY J;  4OH8 B;  3L74 G;  2WIT A;  3SWF A;  4BWN A;  2ITA A;  1ZR2 A;  2Q6Q A;  2WPS A;  1H0T B;  5APX A;  1P84 I;  5CCH C;  1VDF A;  2P67 A;  3EWK A;  2Y0D A;  1KIL C;  1PPJ E;  3P32 A;  4XE5 B;  2OYH B;  2NPS C;  1NKN A;  2D2C B;  3CX5 D;  3L72 D;  5AW0 B;  3H1J D;  1HUC A;  2K1A A;  1N73 C;  2IBZ E;  1NVO A;  2JP3 A;  2R44 A;  3L73 G;  2KK7 A;  2N9Y B;  2HR3 A;  3UIA A;  1X79 B;  1E5W A;  1AFO A;  2FFD A;  3OAK A;  5CCH D;  4ZMD A;  1KIL D;  3AE8 C;  4YTP C;  2Q9I A;  1RHZ B;  3SWY A;  2NPS D;  3VMX A;  2WSC H;  5AVU B;  4BRY B;  2J59 M;  1SQB J;  4OGQ B;  5CHX A;  4BXL A;  1QVG O;  2P1J A;  1LP1 A;  2PRR A;  1EZV I;  3Q5S A;  4I1L A;  4IL6 E;  4H13 B;  2E75 B;  5CJ4 A;  1LWU A;  4IL6 X;  4L76 A;  3L72 G;  1N8R Q;  2H43 A;  3H1J G;  4PV1 C;  5KLI C;  1LTB C;  3S4R A;  1KC8 Q; 
#chains in the Genus database with same CATH homology
 3HE4 B;  2E42 A;  2KSJ A;  1JO5 A;  3T97 A;  1N2D C;  1NU1 K;  3HTK B;  1KFN A;  1URQ C;  1GK4 A;  4W7Y A;  3LIE A;  3HD7 C;  1J1D B;  4IFF A;  2N1T A;  1YTZ I;  5APS A;  1WRG A;  2XV5 A;  3O8Z A;  2OYH A;  1RE3 C;  1JMM A;  2PAJ A;  3C9I A;  1SQV K;  1LTJ C;  2YO3 A;  4Y99 B;  1RF1 C;  4GKG A;  2M3B A;  1NOH A;  5AW9 B;  5APW A;  2N1T B;  3V4Q A;  1OXZ A;  2FXM A;  3B5N C;  3RK2 D;  2IFN A;  3CI9 A;  1RF0 A;  5AVQ B;  1LTA C;  1GW3 A;  3V2N A;  1JY3 N;  1HGZ A;  3B8E B;  2XNX A;  3MIW A;  3P8C E;  4JYB A;  4WY4 C;  1N7L A;  2W27 A;  1X9V A;  3TSI A;  5BVZ A;  3VN0 A;  5CCG A;  1SQP K;  1NHL A;  3WMM 0;  1JUN A;  1URQ D;  1A02 J;  3HD7 D;  1JTH A;  3V4W A;  4N78 E;  1KQL A;  1ZLL A;  3RK3 C;  5AW6 B;  1M1J C;  2OYI C;  1FOS F;  2Q3I A;  4WBA A;  3U59 A;  1M7L A;  1X8Y A;  3MD0 A;  1J1E B;  5APT A;  1W2E A;  3P8C D;  2JEE A;  2PP6 A;  2BAS A;  3RK2 B;  1JTH B;  3MTU E;  1FZC C;  1FOS E;  1NAF A;  3B5N D;  1RE3 A;  1JY3 P;  1T3U A;  2A45 I;  1YYC A;  4N78 D;  4LC1 A;  4WY4 D;  1HJB A;  1WT6 A;  5AW5 B;  1URQ B;  3HD7 B;  5KJ7 C;  2YNY A;  2KLV A;  3VMZ A;  3V2R A;  1GL2 A;  1CW5 A;  3B5N A;  2IFM A;  2XZR A;  4N3Y B;  4HYT B;  1HWT C;  3RK3 D;  3II6 A;  5AW3 B;  1HBW A;  1XTG B;  2LKM A;  4JF7 A;  4WY4 A;  1S9K E;  3OJA B;  2C0W A;  3V2P A;  3M0A A;  3B5N B;  1MFZ A;  3A7O A;  1NKZ B;  1SFC C;  5KLV K;  3H32 A;  2C9L Y;  1IO4 A;  3EFG A;  5AVW B;  1CZQ A;  4WY4 B;  1IFI A;  1M1J A;  2OYI A;  1FDM A;  1A02 F;  2XDJ A;  5AVR B;  2WPR A;  4LGD E;  4DZO A;  4EOT A;  4ZKU A;  1IC2 A;  1HTL C;  3TK1 A;  5KJ7 D;  3H32 B;  1S9K D;  1ZV8 A;  3RK3 B;  1M1J B;  2OYI B;  1GZL A;  1DX7 A;  1NTZ K;  1IFD A;  4I6M C;  3A5T A;  3VP8 A;  4W7Z A;  2Q7C A;  3HUS C;  3G3Z A;  3M0D C;  3IFM A;  1FZC B;  5KJ7 A;  1FJK A;  2HLO A;  4N6J A;  1SFC D;  2HYN A;  3MUD A;  2WSF H;  1FZF A;  2QM7 A;  3V5B A;  1LTI C;  5AVV B;  1CI6 B;  3BRV B;  1ZR4 A;  1FU1 A;  1L4A C;  3N4X A;  4C46 A;  2GUS A;  3P8M C;  3CLQ A;  5AW1 B;  1GW4 A;  2P2U A;  1SFC A;  3NMD A;  2M8R A;  3BAS A;  1IFN A;  1DEB A;  4KHX A;  4EIJ A;  1SFC B;  1HGV A;  1OWA A;  5AW8 B;  2W6A A;  2WPQ A;  1HH0 A;  1IJD B;  4IFM A;  2L5G B;  4B86 A;  5AW2 B;  1JY2 N;  2Z4E A;  2IX7 C;  2KP8 A;  2XU6 A;  2ZXE B;  3HUS A;  3M0D A;  1JNM A;  4RES B;  1KZU B;  1L4A D;  2WZ7 A;  4M3L A;  1EQ7 A;  2GUV A;  5AVY B;  3IR9 A;  5KTB A;  1JOC A;  5BU8 B;  3VMY A;  1URQ A;  2VRS A;  1T3J A;  3HD7 A;  2H8P D;  2J58 A;  3CL3 D;  3I5C A;  3HUS B;  3BAT A;  3NFQ A;  1XTC C;  3NTN A;  1LWU C;  2FKW B;  1L4A A;  2MJZ A;  1LTT C;  3N7N A;  1LTJ A;  3VOP A;  1RF1 A;  1RY3 A;  1J2J B;  1LGH B;  3L36 A;  1IK9 A;  1SQX K;  1T8Z A;  4XA4 A;  1JY2 P;  1L4A B;  2Z5H A;  4AYC A;  1LTJ B;  1RF1 B;  1MZ9 A;  1N7S C;  4C7R A;  5CMZ A;  2P7J A;  1VPC A;  3LID A;  1SLQ A;  1Z56 A;  4JYC A;  1LT9 C;  1GU4 A;  1N86 A;  1H8A A;  1GK6 A;  1LTG C;  2Q5U A;  3GHG C;  3KYQ A;  2OYH C;  1FZC A;  2R3C A;  3LW5 H;  1GTW A;  1DH3 A;  5AVT B;  3BRT B;  2FYZ A;  1JY3 O;  2YO2 A;  1G1J A;  1FBM A;  3HE5 A;  1NO4 A;  4LLH A;  3M9B A;  2ZFC A;  1CI6 A;  1N7S D;  4GIF A;  3E1I A;  4WB4 A;  2HPC A;  1RE4 C;  1PFI A;  2WT7 A;  3M9H A;  1SQQ K;  2R5D A;  1FZA A;  2CPB A;  3VYI A;  3HE5 B;  3M9Q A;  2WSE H;  2HFE D;  3TYY A;  1L0L K;  5CCG C;  2HPC B;  3RK2 C;  1N7S A;  2WT7 B;  3A3Y B;  4C7N B;  5AW7 B;  1MUU A;  1NTM K;  4W80 A;  3U1C A;  1NTK K;  1JCD A;  3VP9 A;  2XKM A;  4OH8 B;  5BU5 A;  2FFD C;  2WIT A;  1HVV A;  1N7S B;  1QL2 A;  2HG5 D;  1LT9 A;  2O01 H;  3SWF A;  5APV A;  3KPE A;  1MV8 A;  1SVF A;  5APQ A;  3GHG A;  3L35 A;  1ZR2 A;  3M91 A;  2CPS A;  2WPS A;  1YTZ T;  1GDT A;  5APX A;  2HOD A;  3V2Q A;  5CCH C;  1LT9 B;  1VDF A;  2P67 A;  4IFD K;  5CJ0 A;  1NWQ A;  1KIL C;  3P32 A;  1GL2 C;  2YKP A;  3RL0 C;  5CCG D;  3NXS A;  4XE5 B;  3GHG B;  2OYH B;  2NPS C;  4AUW A;  1NKN A;  1RE4 A;  2O1K A;  2HOD B;  3A2A A;  1GU5 A;  1JCC A;  1FZE A;  2Z5I A;  5AW0 B;  3R2P A;  1HUC A;  1N73 C;  1T2K C;  1IFM A;  1H88 A;  2YKO A;  5AVX B;  1G2C A;  2KOG A;  2I1J A;  3UIA A;  1X79 B;  2WWW A;  3OA7 A;  5AVS B;  1H89 A;  1G1I A;  4AQR D;  3BVH A;  4HH2 A;  5APY A;  1E5W A;  1AFO A;  2JJL A;  2FFD A;  3OAK A;  2A45 H;  5CCH D;  3H6P A;  3HRN A;  1G2C B;  1KIL D;  1GL2 D;  2Q9I A;  3RL0 D;  2FYU K;  3SWY A;  2NPS D;  1ZN5 A;  3VMX A;  2WSC H;  5AVU B;  1FJP A;  2E43 A;  1QL1 A;  1J1D C;  4GT1 A;  2FFD B;  2C0X A;  1NH4 A;  1AQ5 A;  1FAV A;  1L0N K;  2J59 M;  2QM8 A;  2W6B A;  3M06 A;  5CCH A;  4DOJ A;  1T2K D;  1KIL A;  2R5B A;  3L37 A;  4O9B A;  5CHX A;  3PP5 A;  3P7K A;  2P1J A;  2KYV A;  4Y99 C;  2NPS A;  2YMY A;  2H7H A;  2POH A;  2R32 A;  1KFM A;  1FZB A;  2N1T C;  4I1L A;  3EQ2 A;  1KIL B;  1GL2 B;  3RL0 B;  1N73 A;  2NPS B;  4ZKP A;  3TNU A;  1LWU A;  5CJ4 A;  1SP4 A;  2WTY A;  3KQG A;  3L4F A;  2A45 G;  1GD2 E;  1CSB A;  2C9N Y;  2O1J A;  3MGN A;  2I1K A;  1RF0 C;  3U1A A;  1IFJ A;  1N73 B;  5AW4 B;  4C7N A;  3TNU B;  1JY2 O;  1LWU B;  5AVZ B;  2GM4 A;  2H43 A;  3HE4 A;  1FZG A;  2OAR A;  2YKQ A;  3KDP B;  1J1E C;  1LTS C;  2N9B A;  1SQB K;  3VTP C;  4I2L C;  3HTK A;  1LTB C;  2KB7 P;  2N1T D;  5APU A;  2IPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...