1T2KD

Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
61
structure length
61
Chain Sequence
KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 31-MER
publication title Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 27
structure length 61
sequence length 61
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2004-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1t2kD00
3P32A 3M91A 3NTNA 3NMDA 4AYCA 4DZOA 5APVA 3L35A 5APWA 3M06A 2P2UA 4KHXA 3IR9A 4XE5B 4AUWA 2Z5HA 2R5DA 1JUNA 4GT1A 1CZQA 2QM7A 3VMYA 3NXSA 5APXA 2WPSA 3V5BA 1S9KE 1GTWA 3HE4B 1FOSE 2P7JA 3HE5B 2BASA 4I6MC 5AW7B 2WT7B 3M0DA 1YYCA 3MGNA 4EOTA 1JNMA 3HE4A 1T2KD 1FAVA 3VMXA 3L37A 2WPQA 1FOSF 3P8MC 2E43A 2WT7A 1MV8A 2IPPA 3A7OA 3TYYA 3HTKA 3V4QA 1NAFA 3P7KA 4C7NB 2QM8A 2R32A 3OAKA 2KP8A 3M9BA 3A2AA 2Z5IA 1H89A 2Q3IA 4C7NA 2WPRA 5AW8B 1MUUA 5AVYB 2C9LY 1CI6B 4B86A 3O8ZA 4LC1A 1J2JB 1T2KC 4GKGA 1GZLA 5AVQB 3VN0A 1NWQA 5AVSB 1CSBA 2P67A 4M3LA 1CI6A 5AW2B 3A5TA 5AVUB 5APTA 3V4WA 3KQGA 2W6AA 1G2CB 1A02F 5AW5B 2WWWA 5APYA 2YO2A 5AW1B 5AVRB 1GU5A 5AW4B 5APSA 3TK1A 1S9KD 2R5BA 5APUA 2H7HA 1GD2E 5AVZB 2JJLA 3VTPC 2Q7CA 1SLQA 3VMZA 4I2LC 4RESB 3TNUA 3KDPB 1HUCA 2Q5UA 4C46A 3LIDA 1KQLA 5CMZA 3UIAA 2W27A 1HBWA 5AW9B 2E42A 3M9HA 1IO4A 5AW3B 5AVVB 1OWAA 4AQRD 3T97A 3I5CA 3B8EB 3LIEA 2YNYA 1OXZA 3MD0A 3NFQA 1GU4A 2ZXEB 5AVXB 1MFZA 1A02J 1HJBA 1H8AA 1HWTC 1SP4A 5AVTB 3TNUB 5AW0B 3VYIA 5AVWB 1GK6A 2XV5A 2XZRA 2WTYA 3A3YB 4JYCA 5APQA 2N9BA 2R3CA 3L36A 1X8YA 1GK4A 2YO3A 1H88A 2C9NY 2ZFCA 3SWFA 5AW6B 4JYBA 4HYTB 2XU6A 3M0AA 3HE5A 2VRSA 1DH3A
chains in the Genus database with same CATH superfamily
1LTIC 1OW8A 3F5HA 3L4FA 3TF5A 3L71E 1M90Q 4DT0A 3IAOA 2FXMA 1ZRTD 3CX5I 3L75G 1RY3A 4D6TJ 1YYCA 1JNMA 1GL2C 3H6PA 3GMAA 3KHUA 3PRJA 1VF5B 1X0TA 1GL2D 3H32A 1T6AA 4C7NA 4WY4A 2WQYC 1GDTA 2B89A 3C1LA 1T8ZA 5CCGC 4DCKA 5H2FH 2OTKE 3TGUD 2YKOA 5M1BA 3RK3B 1ZXGA 1DX7A 1KILD 2QJKC 1E79H 3L73J 1EC5A 3R4YA 3CWBJ 5GTIH 3IN6A 5KJ7D 2IDBA 4GOEA 3FXDA 2WSSH 4ASVA 3MD0A 3QH9A 1SFCA 5AVXB 3CC2P 1SP4A 2ZT9D 4U3FJ 4EI2A 2JR8A 1FDOA 4WVZA 2LKMA 3SWFA 2KLUA 3H1JJ 1QGKB 4TLFA 2N1TA 1AJYA 1RF0A 3H1HG 5APVA 3G71P 2CK3H 3PP5A 4NPEA 1YTZT 2OYHA 1VQLP 2FFDC 1SQXD 2BASA 2WSCJ 1T2KD 4IL6E 3TYYA 1N7SC 3K5BA 3HTKA 4C7NB 1T3JA 4WY4B 3AE6C 1K8AQ 3H1LD 5AW8B 1BSNA 2WMMA 3CXHD 4ZKUA 2IBZI 3WU2E 5AVSB 1JEKA 1SQQD 2YXQB 5AW2B 5KKZB 5CHXA 1NTMD 1VQKP 2K37A 2XNXA 2W6AA 1USDA 3U1AA 1FS0E 1M1KQ 3VMZA 1BCCE 1JY2O 3KDPB 2E75D 1KTMA 3M9HA 1IO4A 4AQRD 4Y99C 4IFDK 1RHZB 4R4MA 1AV1A 2FYNC 2IYOA 1YJNP 2Q1KA 3JC22 1GK6A 1L0LE 4W7YA 1KD1Q 4O9BA 1BSHA 1U57A 1K04A 1LGHB 1FC2C 3H25A 2XU6A 1FZBA 2KK7A 4H13B 1WT6A 3HD7B 2OYHB 2YKQA 1BCCG 1LTGC 2W6JH 4KHXA 2O01H 4EYYQ 2LR2A 2M3EA 3B5NA 1VF5D 1AFOA 1SQBD 2BCCE 2J59M 1JO5A 3WMM0 3M0DA 1N8RQ 3MGNA 3HTKB 3WUUA 1M56D 3L37A 3VOPA 1DEBA 1BDCA 2IPPA 1L0LG 1EXIA 2GA1A 2WPRA 4IL6H 1MUUA 2HG5D 3GHGC 4GKGA 4GODA 1PPJE 4YTPC 1VQ7P 1RE3A 3WU2H 2H89C 2FYUE 1LTBC 5AW4B 3CCJP 3CCVP 2SPZA 1GD2E 5AVZB 2BCCG 1HUCA 2Q5UA 5KAFE 2OQQA 1QL1A 1BGYE 2QJPB 2FXOA 2ITAA 1OXZA 1IFNA 1KMIZ 2KNCA 2KYVA 4K3AA 1RF1C 4XA4A 1GW3A 2OYIA 1HJBA 1HWTC 2J58A 3D6ZA 5AVTB 1PGJA 4GIFA 1PV3A 1JY3N 3RK2B 2N9BA 1PPJG 1IFDA 1Q90D 1URQA 3L74G 3BCCG 3L72E 3H1KE 4DZOA 3B5NB 3LW5J 1OFCX 2ZXXA 1Y8AA 1BGYG 2O1KA 3IF4A 3HE5B 2FYUK 1H0TA 2GUVA 2Y9ZA 3VP9A 1HJ0A 1KV4A 5KLVG 3GF3A 1G1JA 1NVOA 1L4AB 1ZR4A 1YTZI 3L72G 3H1KG 2AEJA 1XTCC 1SQXJ 4BXLA 2XKMA 2Y0CA 3V4WA 1S5LX 3AEDC 1YQ4C 2FKWB 2QIWA 1NU1J 2CPBA 1KB9E 1S9KD 3H1LJ 2D2CC 3L73D 1PP9D 4U7JA 1S72P 1LTJC 1SQQJ 4N78E 1X22A 3OA7A 5AW9B 1JY3P 1NTMJ 3CWBD 2KNCB 1S3JA 2PP6A 3AE1C 1KQFB 2OYIB 4OGQB 1KYOD 3L70G 1VQMP 1YQ3C 2L5GB 2I1JA 3CX5E 1OVVA 1URQB 5B66E 5APQA 3HD7D 1EDLA 3L75D 3I55P 4U3FD 2FFDA 1FZEA 1L0NG 4DJGA 2KZIA 4I7ZB 2VRSA 3ITKA 3H1JD 1NH4A 1KQGB 2QRXA 3E7KA 1FZFA 1N7SA 3M9QA 2V7QJ 3AE3C 1JUNA 1GTWA 1FZGA 5TJHA 1VQ5P 1QL2A 1SQBK 3BATA 1SQVG 4IOIH 4PD4D 3CXHI 1NAFA 4KT0J 1K73Q 1UIIA 2M8RA 2G3AA 1JMMA 1AVYA 2KP8A 5CJ0A 2YIUC 2PGDA 4PV1C 4JQ0D 1GZLA 1SQBJ 2QA4P 2A45H 2Q6QA 5APTA 2KI7B 1Q86Q 2WWWA 1ZOYC 1FZCC 2YO2A 4D6TE 1KORA 5H2FE 2KZJA 1FDMA 4WB4A 5B5EH 2W83C 2XNDH 2RKLA 3H1HD 1U7MA 3Q5RA 3KZIH 3HUSA 3N4XA 2IZ0A 4A7PA 1ZP0C 4JF7A 2R3CA 3WUTA 2FFDB 2HYNA 4Y28J 3B5ND 4JYBA 5B66H 2WSEH 1N7SB 5TISE 1LT9C 3M91A 1N2DC 3L35A 2IBZE 1D7MA 3EQ2A 2HR3A 3V6IA 1EDJA 1YIJP 2YKPA 3GHGA 2RN0A 2B9BA 1L4AD 4UB6H 1N7LA 1KZUB 1FDIA 1R8EA 1DIPA 2E43A 1VQOP 4YPCA 3AEAC 3P7KA 1UIXA 2C0WA 1LTSC 3JSVC 2P58A 1DD4A 2IBZG 1LWUC 3RL0B 1FJPA 4TT3H 4OGQD 3FWNA 1JOCA 4C46A 1JB0J 1HGZA 1ZLLA 1KILC 1OWAA 1Y47A 3I5CA 1BE3D 1FJKA 2IX7C 3E1IA 3HUSB 3L71G 1MKMA 1PP9J 2W90A 4BRYA 5KJ7C 5KAIH 1QX8A 3II6A 2P10A 2YO3A 2O01N 3MZWB 1X79B 1EZVD 3D6YA 2ZT9C 1N73C 1SVFA 1RE4C 2WZ7A 3L75J 1JY3O 2YMYA 2NRGA 3FGAD 1M7LA 4H0LB 5TISH 1EXJA 4JPZB 1J1DC 4WBAA 3S4RA 2JDIH 2P7JA 1SS1A 3AE9C 2KSJA 3G6EP 4EOTA 2KLVA 2R44A 1NTZD 2FXPA 3MP7B 1VL2A 2E74C 3OAKA 3F89A 3C8VA 2BCCD 4N3YB 2E74D 1T2KC 1LTJA 2WITA 3CLQA 4W7ZA 3AE7C 3H1IE 3VP8A 3D71A 2CPSA 1A02F 1VQ6P 2BEQD 3H32B 5CCHC 4OVNF 1MFTA 1NU1D 5KLIB 1NTKD 3L74D 3BCCD 5CCHD 3LIDA 2JKVA 1LTTC 1KYOI 2WSCH 4PD4H 3T97A 1HF9A 4NPFX 1IFJA 1OMIA 1ZRTE 1P84D 1Q2NA 2IFNA 4BRYB 1VQ8P 2ZXEB 1A02J 2NZ2A 2IZ1A 2E75C 4UB8H 3BRTB 3V2RA 3ABVC 3H1IG 3IFMA 2O3JA 2K88A 3H1HJ 3SFEC 1IC2A 4HYTB 3RBZA 3CMAP 5KLVD 1SFCB 2KIKA 1AA0A 1S5LE 2L91A 4HB1A 3RBXA 3TGUE 2AXCA 5BU8B 1IFMA 2PFXA 1KILE 4QMAA 3CCMP 1S1CX 1FOSE 4PD4I 2UWJE 2N1TB 3MTUE 1FAVA 2WT7A 2QM8A 1FZCA 3MIWA 1RQUA 1VF5C 3E1RA 1LTJB 1IJDB 3RL0D 4M3LA 1AQTA 3CC7P 2WPVB 4RKUJ 2HODA 4PJ0E 2QJYB 1KFNA 3L70D 3TGUG 3RK3C 5APSA 1LP1A 2JP3A 3RK3D 4I1LA 1L0ND 5CMZA 3T97B 3AECC 3CPWO 1NYHA 3Q5SA 2NPSA 1NAYA 1M8OB 2E76B 1SQXE 3QWOC 3CCSP 2KXPB 3AEBC 5AW0B 2E5YA 2RMZA 3A0BE 2OARA 2G8YA 1H88A 1OVRA 3G3ZA 4H44B 3H1LE 3AEEC 1BE3J 1SQVD 2QSIA 3CXHE 1M1JC 2M0BA 1OX3A 1DH3A 1BCCJ 1SQQE 3O6QA 1NTME 3EFGA 2P2UA 2JO1A 4XE5B 2HFED 5DJTB 1JTHA 3B71A 5APXA 1S5LH 3GLMA 2WT7B 2FYUG 1L0LJ 2PAJA 1NTZK 3P8CD 2LXBA 1GL2A 3CCRP 1LWUA 4WY4C 3O8ZA 4WY4D 2HODB 1CSBA 5CCGA 1YJ9P 1NTZJ 4L74A 1AQ5A 5KKZC 1SQXK 1IFPA 1KILA 2KUBA 2WSFJ 2BCCJ 2Y0DA 3LW5H 2QG4A 1NU1K 4PJ0H 3CMEP 1NTKK 5KJ7A 3TNUA 3GW6A 2W8ZA 1KQLA 2NPSB 1LTAC 1ZW0A 1SQQK 3HRNA 1OW6A 1X9VA 1NTMK 3S1KA 2WSFH 1SQBE 5B5EE 1SQPD 2ZYDA 1NTKJ 3L74J 4ASWA 1SFCD 2A06D 1LT1A 3BCCJ 1VQNP 2XZRA 2ZVOB 1EZVI 2J5UA 3KZIE 1RF0C 3KPEA 3O6QB 5E79H 3A0BH 2A45G 3NMDA 4AYCA 4H13C 2N1TD 1IFIA 3HD7C 2OYHC 1S2EA 3CXHH 1BGYJ 1JTHB 3AE2C 3IR9A 1JY2N 1CZQA 4H13D 4XFJA 3FX0A 1BDDA 3N7NA 1QVFO 1P84H 5KLVJ 1GL2B 1JCDA 3V4QA 1M57D 3L72J 2Q9IA 2FYZA 3H1KJ 4UB6E 5AVYB 1J1EC 1H0TB 3MUDC 3JCUH 5AVUB 3L71D 2QJKB 1ZN5A 5AVRB 1DD3A 5GTHH 2ZAEB 4BWNA 2V7QH 2JJLA 2KSEA 3A0HE 2C0XA 4RESB 1Q7YQ 1YJWP 1P84I 1L0NK 2Y9YA 1HBWA 4C7RA 1FU1A 4N6JA 2QJPC 3PHLA 3L70J 1GMJA 3CD6P 3NFQA 4H44D 2K9JA 2POHA 2K1AA 1H8AA 3VYIA 1L0NJ 3EFFK 3RK2C 3AE4C 2JEEA 1YBKA 1OVUA 3AE8C 4L76A 3V2QA 4OH8B 2QEXP 3RK2D 5KAIE 5KTBA 2Y0EA 3B5NC 2R5DA 1QVGO 2AXTH 2WPSA 1S9KE 3M0DC 1SQVJ 3L73E 3USSA 2OTJP 1G1IA 4D6TG 1MV8A 3A7OA 3SFDC 3CWBE 1L4AC 1KYOE 1PGQA 1ZR2A 1E5WA 1Q81Q 3KXDA 3VN0A 2P67A 1DEEG 4CPGA 3L75E 1K9MQ 3KQGA 1KQSO 2N9YB 4U3FE 5AW1B 3RGUA 5K5GB 2H88C 4L73A 3H1JE 1QEXA 2HPCA 1PGPA 3L73G 3AEGC 4WWIA 1FBMA 2OTLP 3OJAB 4Y99B 3CWBG 3A0HH 1M1JA 2K9JB 2OYIC 3PH0A 4OGQC 2FYNB 1SQPK 1RF1A 3EWKA 1URQC 3CC4P 4PD4E 3L36A 2QVAA 5AW6B 1URQD 2OGUA 4U3FG 2MKVA 1NKNA 3C9IA 4I7ZC 4UB8E 1SQPJ 3P32A 3H1JG 1BCCD 1HVVA 3W68A 4GT1A 1EDIA 5BVZA 2ZJSE 4I6MC 3CCLP 5CCGD 4JBZA 2K3RA 2IYPA 3P8MC 1IK7A 1L0LD 4HH2A 2K9YA 3H1HE 3GHGB 1QLED 5AVQB 2GUSA 2KOGA 3U1CA 1KYOH 2Z4EA 5AW5B 2HPCB 2R5BA 1G2CA 5APUA 3U59A 2H7HA 4R4LA 2ZYGA 4HJGH 2YXRB 5CBOA 3BVHA 1M1JB 3ZDMA 3Q1MA 1W2EA 3L71J 3G4SP 3LIEA 1VDFA 3GG2A 1RF1B 3G9RA 3D70A 3TSIA 2E5TA 3HD7A 1PPJD 3PLNA 1Q82Q 2FYUD 3W67A 4Z1MH 3CCUP 3AEFC 1YITP 1NO4A 1R5LA 4W80A 3KYQA 2KS1A 4AUWA 1EDKA 1N7SD 1BGYD 2QM7A 2I8DA 4MN4C 1K05A 1S4XA 1YI2P 1JMBA 5C39A 3MUDA 4L75A 3VMXA 2HLOA 4EIJA 3PTZA 1HH0A 1JM0A 1BE3E 3M9BA 3Q5PA 3OW2O 3L72D 3H1KD 2MJZA 4B86A 4LC1A 3CCEP 1NWQA 1EQ7A 2H8PD 3GF7A 1NOHA 2YMKA 1XTGB 1GW4A 2OYOA 1VQ9P 2IFMA 1G2CB 1GU5A 3RL0C 5BU5A 2BEZF 3TK1A 2D2CB 1CW5A 1EZVE 2O01J 3VTPC 2B88A 2AEFA 3UIAA 2W27A 1LNQA 1KN7A 5AVVB 3B8EB 1BE3G 3HUSC 4GOFA 2RH0A 2O1JA 4K35A 3Q2YA 1NTZE 3H1IJ 1YHQP 1RQVA 2I1KA 4OWFA 1X8YA 2PRRA 1PIXA 1PZQA 1KB9D 4YXDC 1HTLC 2AEMA 3HE5A 2KS1B 5EFWB 1EZVG 5DJUB 1OZHA 5APWA 1NKZB 1LT9A 4N78D 3S9OA 1L4AA 2JWAA 5E79E 1J1EB 3PJSK 3VMYA 4H0LC 4LLHA 1NJIQ 1NU1E 1NTKE 1KC8Q 3L74E 3BCCE 3CX5D 4H0LD 1NTZG 1FOSF 1L0LK 2WVRA 2R32A 3A2AA 2YIUB 1W5CE 1P84E 4PV1B 2H43A 1J2JB 3TGUJ 1SQXG 2FBWC 1FZCB 1IZNB 4DOJA 4ZNCA 5CJ4A 2B87A 1PFIA 5KLVE 3JCUE 2QE7H 1NU1G 5KLIC 1NTKG 2Q3EA 3H1LG 2LXCB 1WRGA 3VMAA 2E42A 4IL6X 1SQQG 3AE5C 5GTHE 2YNYA 3Q3DA 1NTMG 5L8RJ 1GU4A 1LP1B 1N86A 4JYCA 3B4SA 1GK4A 1LJ2A 2M5AA 4D6TD 2KB7P 1LT9B 1SFCC 2V4HA 4RO0A 3NTNA 2XDJA 5CBNA 3M06A 1N73A 3L70E 3BASA 1RE4A 3BRVB 2DW3A 1L2PA 2FYUJ 3NXSA 3V5BA 1ZMEC 3CL3D 3R2PA 3RK3E 5AW7B 1AVOA 2N1TC 3HE4A 1OW7A 1L0NE 4IFFA 2AXTE 5KLVK 1PL5A 3I56P 3CCQP 2Z5IA 1H89A 2R3SA 1VQ4P 2GM4A 1KFMA 4NPDA 4IFMA 2D2CD 1CI6A 1USEA 1ZV8A 2M3BA 3A5TA 2IBZD 1SQBG 1JCCA 2QJYC 1LWUB 2ZVNB 2B87B 5KAFH 1U7JA 1PGOA 5APYA 1SQVE 4HKZH 5CCHA 4I2LC 1KILB 3V2NA 1T3UA 5AW3B 4YXWH 4KJMA 1MZ9A 2E76C 1Z56A 3WUVA 3MHVA 3TNUB 2JWDA 3P8CE 2FY8A 5AVWB 2WTYA 3A3YB 2E76D 2M5AB 3RL0g 1W2BO 2C9NY 2ZFCA 3FWLA 4H44C 1VPCA 3M0AA 2ZT9B 1N73B 1NHLA 1FZAA 1TU3F 1NGMB 3SSUA 1HGVA 2Z5HA 1J1DB 1IK9A 3SWYA 3HE4B 4GDOA 1JY2P 4PV1D 1SQVK 1RH5B 2WPQA 2E74B 4LGDE 2Q3IA 2C9LY 1CI6B 1KB9H 1SQPE 4RJTA 2A06E 1PP9E 3TDKA 3FXEA 3SWKA 1Y9BA 2WSEJ 5GTIE 2Q7CA 1SLQA 2A45I 3V2PA 2P1JA 3CX5H 1VQPP 2NPSC 1RE3C 2W6BA 2NPSD 1MFZA 4ZKPA 1WMKA 1SQPG 1FE6A 2E75B 2XV5A 1KB9I 2A06G 1PP9G 1R5SA 3H1ID 2ZYAA 3CI9A 4ZMDA 4EDFA 1OIPA
chains in the Genus database with same CATH topology
1LTIC 1NH4A 1NO4A 1FZFA 1N7SA 4W80A 3EFGA 3KYQA 2P2UA 3M9QA 3L4FA 4XE5B 4AUWA 2HFED 1N7SD 1JUNA 2FXMA 2QM7A 1JTHA 5APXA 1GTWA 1FZGA 1RY3A 1QL2A 1SQBK 2WT7B 1YYCA 3BATA 3MUDA 1JNMA 1GL2C 2PAJA 3VMXA 1NTZK 3H6PA 3P8CD 2HLOA 4EIJA 1GL2A 1NAFA 1HH0A 2M8RA 1JMMA 1LWUA 4WY4C 2KP8A 3M9BA 5CJ0A 1GL2D 3H32A 4C7NA 4WY4A 1GDTA 2MJZA 4B86A 3O8ZA 4LC1A 1T8ZA 5CCGC 4WY4D 1GZLA 2HODB 1NWQA 1CSBA 2A45H 1EQ7A 2H8PD 5CCGA 1AQ5A 1NOHA 1SQXK 1XTGB 5APTA 1KILA 2YKOA 1GW4A 3RK3B 2IFMA 1G2CB 1DX7A 1KILD 2WWWA 1FZCC 2YO2A 1GU5A 3RL0C 5BU5A 3TK1A 1CW5A 3LW5H 1NU1K 3VTPC 1FDMA 1NTKK 4WB4A 5KJ7A 3TNUA 1KQLA 3UIAA 2W27A 5KJ7D 2NPSB 1LTAC 1SQQK 3HRNA 5AVVB 3B8EB 1X9VA 1NTMK 3MD0A 2WSFH 3HUSC 2O1JA 1SFCA 5AVXB 3HUSA 1SP4A 3N4XA 1SFCD 2XZRA 4JF7A 2I1KA 2R3CA 2FFDB 1X8YA 2HYNA 3B5ND 2LKMA 3SWFA 1HTLC 1RF0C 4JYBA 3KPEA 3HE5A 2WSEH 2N1TA 1N7SB 1RF0A 2A45G 1LT9C 3M91A 3NMDA 4AYCA 5APVA 2N1TD 1IFIA 1N2DC 3HD7C 3L35A 3PP5A 5APWA 2OYHC 1YTZT 1NKZB 1LT9A 4N78D 1JTHB 3IR9A 3EQ2A 2OYHA 1JY2N 1CZQA 1L4AA 1J1EB 3VMYA 4LLHA 2YKPA 3GHGA 2FFDC 1L4AD 3N7NA 1N7LA 2BASA 1GL2B 1KZUB 1T2KD 1JCDA 1FOSF 2E43A 3TYYA 1N7SC 3V4QA 3HTKA 3P7KA 1L0LK 4C7NB 1T3JA 4WY4B 2Q9IA 2FYZA 2R32A 3A2AA 5AW8B 5AVYB 2C0WA 2H43A 4ZKUA 1J2JB 1LTSC 1J1EC 5AVSB 5AW2B 5CHXA 5AVUB 2XNXA 2W6AA 3U1AA 1FZCB 1LWUC 4DOJA 3RL0B 1ZN5A 5AVRB 5CJ4A 1FJPA 1PFIA 2JJLA 1JOCA 2C0XA 4RESB 3VMZA 1JY2O 3KDPB 4C46A 1HGZA 1L0NK 1HBWA 1WRGA 1ZLLA 2E42A 1KILC 3M9HA 1IO4A 4C7RA 1FU1A 4N6JA 1OWAA 4AQRD 3I5CA 4Y99C 4IFDK 2YNYA 1FJKA 2IX7C 3E1IA 3HUSB 3NFQA 1GU4A 2POHA 1H8AA 1N86A 3VYIA 5KJ7C 1GK6A 4JYCA 4W7YA 4O9BA 3RK2C 3II6A 1GK4A 2YO3A 1LGHB 2JEEA 3V2QA 4OH8B 2XU6A 3RK2D 1X79B 1FZBA 2KB7P 1LT9B 1SFCC 5KTBA 1N73C 1SVFA 3NTNA 1WT6A 3HD7B 2OYHB 2XDJA 2YKQA 3M06A 1RE4C 1N73A 1LTGC 4KHXA 2O01H 3B5NC 2WZ7A 2R5DA 3BASA 1RE4A 3BRVB 1JY3O 2YMYA 1M7LA 1J1DC 3B5NA 3NXSA 2WPSA 3V5BA 1S9KE 4WBAA 3M0DC 1AFOA 3CL3D 2P7JA 3R2PA 2J59M 1JO5A 2KSJA 5AW7B 2N1TC 3M0DA 3WMM0 3MGNA 3HTKB 4EOTA 2KLVA 3HE4A 3L37A 1G1IA 3VOPA 4IFFA 1DEBA 1MV8A 2IPPA 3A7OA 5KLVK 3OAKA 2Z5IA 1H89A 4N3YB 2GM4A 1L4AC 1KFMA 2WPRA 1MUUA 2HG5D 3GHGC 1ZR2A 1T2KC 1E5WA 1LTJA 4GKGA 4IFMA 2WITA 3VN0A 2P67A 1CI6A 3CLQA 1ZV8A 2M3BA 3A5TA 4W7ZA 3KQGA 3VP8A 1JCCA 1RE3A 2CPSA 1LWUB 1A02F 5APYA 3H32B 5CCHC 1LTBC 5AW1B 5AW4B 5CCHA 1GD2E 5AVZB 2HPCA 4I2LC 5CCHD 1HUCA 2Q5UA 3LIDA 1FBMA 1KILB 1LTTC 1QL1A 3OJAB 1T3UA 2WSCH 5AW3B 3V2NA 4Y99B 3T97A 1MZ9A 1IFJA 1M1JA 1OXZA 1IFNA 2OYIC 2IFNA 2KYVA 1Z56A 1RF1C 2ZXEB 1A02J 4XA4A 1GW3A 2OYIA 1SQPK 1HJBA 1HWTC 2J58A 1RF1A 5AVTB 3TNUB 3P8CE 4GIFA 1URQC 5AVWB 1JY3N 2WTYA 3A3YB 3RK2B 3BRTB 2N9BA 3L36A 1IFDA 3V2RA 1URQA 2C9NY 2ZFCA 3IFMA 5AW6B 1URQD 1IC2A 1VPCA 4HYTB 3M0AA 1NKNA 3C9IA 1SFCB 1N73B 3P32A 1NHLA 4DZOA 1FZAA 1HVVA 3B5NB 5BU8B 1HGVA 2Z5HA 1IFMA 4GT1A 1J1DB 2O1KA 5BVZA 1IK9A 3SWYA 3HE4B 1FOSE 3HE5B 2N1TB 1JY2P 2FYUK 4I6MC 2GUVA 3MTUE 3VP9A 1SQVK 5CCGD 1FAVA 2WPQA 3P8MC 2WT7A 4HH2A 2QM8A 4LGDE 1G1JA 1FZCA 3MIWA 1L4AB 2Q3IA 1LTJB 1ZR4A 1YTZI 3GHGB 2C9LY 1CI6B 1IJDB 3RL0D 1XTCC 5AVQB 2GUSA 4M3LA 2KOGA 3U1CA 2XKMA 2HODA 3V4WA 1KFNA 2FKWB 3RK3C 2Z4EA 5AW5B 2CPBA 2HPCB 5APSA 1S9KD 2R5BA 1G2CA 5APUA 3U59A 2H7HA 3RK3D 4I1LA 1SLQA 2Q7CA 1LTJC 2A45I 3V2PA 4N78E 2P1JA 5CMZA 3OA7A 5AW9B 1JY3P 3BVHA 1M1JB 2NPSC 1RE3C 2PP6A 1W2EA 2W6BA 2NPSA 1VDFA 3LIEA 2OYIB 1RF1B 2NPSD 1MFZA 4ZKPA 3TSIA 2L5GB 2I1JA 3HD7A 1URQB 5AW0B 2XV5A 5APQA 3HD7D 2OARA 1H88A 3G3ZA 2FFDA 1FZEA 3CI9A 1M1JC 2VRSA 1DH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P32 A;  3M91 A;  3NTN A;  3NMD A;  4AYC A;  4DZO A;  5APV A;  3L35 A;  5APW A;  3M06 A;  2P2U A;  4KHX A;  3IR9 A;  4XE5 B;  4AUW A;  2Z5H A;  2R5D A;  1JUN A;  4GT1 A;  1CZQ A;  2QM7 A;  3VMY A;  3NXS A;  5APX A;  2WPS A;  3V5B A;  1S9K E;  1GTW A;  3HE4 B;  1FOS E;  2P7J A;  3HE5 B;  2BAS A;  4I6M C;  5AW7 B;  2WT7 B;  3M0D A;  1YYC A;  3MGN A;  4EOT A;  1JNM A;  3HE4 A;  1T2K D;  1FAV A;  3VMX A;  3L37 A;  2WPQ A;  1FOS F;  3P8M C;  2E43 A;  2WT7 A;  1MV8 A;  2IPP A;  3A7O A;  3TYY A;  3HTK A;  3V4Q A;  1NAF A;  3P7K A;  4C7N B;  2QM8 A;  2R32 A;  3OAK A;  2KP8 A;  3M9B A;  3A2A A;  2Z5I A;  1H89 A;  2Q3I A;  4C7N A;  2WPR A;  5AW8 B;  1MUU A;  5AVY B;  2C9L Y;  1CI6 B;  4B86 A;  3O8Z A;  4LC1 A;  1J2J B;  1T2K C;  4GKG A;  1GZL A;  5AVQ B;  3VN0 A;  1NWQ A;  5AVS B;  1CSB A;  2P67 A;  4M3L A;  1CI6 A;  5AW2 B;  3A5T A;  5AVU B;  5APT A;  3V4W A;  3KQG A;  2W6A A;  1G2C B;  1A02 F;  5AW5 B;  2WWW A;  5APY A;  2YO2 A;  5AW1 B;  5AVR B;  1GU5 A;  5AW4 B;  5APS A;  3TK1 A;  1S9K D;  2R5B A;  5APU A;  2H7H A;  1GD2 E;  5AVZ B;  2JJL A;  3VTP C;  2Q7C A;  1SLQ A;  3VMZ A;  4I2L C;  4RES B;  3TNU A;  3KDP B;  1HUC A;  2Q5U A;  4C46 A;  3LID A;  1KQL A;  5CMZ A;  3UIA A;  2W27 A;  1HBW A;  5AW9 B;  2E42 A;  3M9H A;  1IO4 A;  5AW3 B;  5AVV B;  1OWA A;  4AQR D;  3T97 A;  3I5C A;  3B8E B;  3LIE A;  2YNY A;  1OXZ A;  3MD0 A;  3NFQ A;  1GU4 A;  2ZXE B;  5AVX B;  1MFZ A;  1A02 J;  1HJB A;  1H8A A;  1HWT C;  1SP4 A;  5AVT B;  3TNU B;  5AW0 B;  3VYI A;  5AVW B;  1GK6 A;  2XV5 A;  2XZR A;  2WTY A;  3A3Y B;  4JYC A;  5APQ A;  2N9B A;  2R3C A;  3L36 A;  1X8Y A;  1GK4 A;  2YO3 A;  1H88 A;  2C9N Y;  2ZFC A;  3SWF A;  5AW6 B;  4JYB A;  4HYT B;  2XU6 A;  3M0A A;  3HE5 A;  2VRS A;  1DH3 A; 
#chains in the Genus database with same CATH topology
 1LTI C;  1OW8 A;  3F5H A;  3L4F A;  3TF5 A;  3L71 E;  1M90 Q;  4DT0 A;  3IAO A;  2FXM A;  1ZRT D;  3CX5 I;  3L75 G;  1RY3 A;  4D6T J;  1YYC A;  1JNM A;  1GL2 C;  3H6P A;  3GMA A;  3KHU A;  3PRJ A;  1VF5 B;  1X0T A;  1GL2 D;  3H32 A;  1T6A A;  4C7N A;  4WY4 A;  2WQY C;  1GDT A;  2B89 A;  3C1L A;  1T8Z A;  5CCG C;  4DCK A;  5H2F H;  2OTK E;  3TGU D;  2YKO A;  5M1B A;  3RK3 B;  1ZXG A;  1DX7 A;  1KIL D;  2QJK C;  1E79 H;  3L73 J;  1EC5 A;  3R4Y A;  3CWB J;  5GTI H;  3IN6 A;  5KJ7 D;  2IDB A;  4GOE A;  3FXD A;  2WSS H;  4ASV A;  3MD0 A;  3QH9 A;  1SFC A;  5AVX B;  3CC2 P;  1SP4 A;  2ZT9 D;  4U3F J;  4EI2 A;  2JR8 A;  1FDO A;  4WVZ A;  2LKM A;  3SWF A;  2KLU A;  3H1J J;  1QGK B;  4TLF A;  2N1T A;  1AJY A;  1RF0 A;  3H1H G;  5APV A;  3G71 P;  2CK3 H;  3PP5 A;  4NPE A;  1YTZ T;  2OYH A;  1VQL P;  2FFD C;  1SQX D;  2BAS A;  2WSC J;  1T2K D;  4IL6 E;  3TYY A;  1N7S C;  3K5B A;  3HTK A;  4C7N B;  1T3J A;  4WY4 B;  3AE6 C;  1K8A Q;  3H1L D;  5AW8 B;  1BSN A;  2WMM A;  3CXH D;  4ZKU A;  2IBZ I;  3WU2 E;  5AVS B;  1JEK A;  1SQQ D;  2YXQ B;  5AW2 B;  5KKZ B;  5CHX A;  1NTM D;  1VQK P;  2K37 A;  2XNX A;  2W6A A;  1USD A;  3U1A A;  1FS0 E;  1M1K Q;  3VMZ A;  1BCC E;  1JY2 O;  3KDP B;  2E75 D;  1KTM A;  3M9H A;  1IO4 A;  4AQR D;  4Y99 C;  4IFD K;  1RHZ B;  4R4M A;  1AV1 A;  2FYN C;  2IYO A;  1YJN P;  2Q1K A;  3JC2 2;  1GK6 A;  1L0L E;  4W7Y A;  1KD1 Q;  4O9B A;  1BSH A;  1U57 A;  1K04 A;  1LGH B;  1FC2 C;  3H25 A;  2XU6 A;  1FZB A;  2KK7 A;  4H13 B;  1WT6 A;  3HD7 B;  2OYH B;  2YKQ A;  1BCC G;  1LTG C;  2W6J H;  4KHX A;  2O01 H;  4EYY Q;  2LR2 A;  2M3E A;  3B5N A;  1VF5 D;  1AFO A;  1SQB D;  2BCC E;  2J59 M;  1JO5 A;  3WMM 0;  3M0D A;  1N8R Q;  3MGN A;  3HTK B;  3WUU A;  1M56 D;  3L37 A;  3VOP A;  1DEB A;  1BDC A;  2IPP A;  1L0L G;  1EXI A;  2GA1 A;  2WPR A;  4IL6 H;  1MUU A;  2HG5 D;  3GHG C;  4GKG A;  4GOD A;  1PPJ E;  4YTP C;  1VQ7 P;  1RE3 A;  3WU2 H;  2H89 C;  2FYU E;  1LTB C;  5AW4 B;  3CCJ P;  3CCV P;  2SPZ A;  1GD2 E;  5AVZ B;  2BCC G;  1HUC A;  2Q5U A;  5KAF E;  2OQQ A;  1QL1 A;  1BGY E;  2QJP B;  2FXO A;  2ITA A;  1OXZ A;  1IFN A;  1KMI Z;  2KNC A;  2KYV A;  4K3A A;  1RF1 C;  4XA4 A;  1GW3 A;  2OYI A;  1HJB A;  1HWT C;  2J58 A;  3D6Z A;  5AVT B;  1PGJ A;  4GIF A;  1PV3 A;  1JY3 N;  3RK2 B;  2N9B A;  1PPJ G;  1IFD A;  1Q90 D;  1URQ A;  3L74 G;  3BCC G;  3L72 E;  3H1K E;  4DZO A;  3B5N B;  3LW5 J;  1OFC X;  2ZXX A;  1Y8A A;  1BGY G;  2O1K A;  3IF4 A;  3HE5 B;  2FYU K;  1H0T A;  2GUV A;  2Y9Z A;  3VP9 A;  1HJ0 A;  1KV4 A;  5KLV G;  3GF3 A;  1G1J A;  1NVO A;  1L4A B;  1ZR4 A;  1YTZ I;  3L72 G;  3H1K G;  2AEJ A;  1XTC C;  1SQX J;  4BXL A;  2XKM A;  2Y0C A;  3V4W A;  1S5L X;  3AED C;  1YQ4 C;  2FKW B;  2QIW A;  1NU1 J;  2CPB A;  1KB9 E;  1S9K D;  3H1L J;  2D2C C;  3L73 D;  1PP9 D;  4U7J A;  1S72 P;  1LTJ C;  1SQQ J;  4N78 E;  1X22 A;  3OA7 A;  5AW9 B;  1JY3 P;  1NTM J;  3CWB D;  2KNC B;  1S3J A;  2PP6 A;  3AE1 C;  1KQF B;  2OYI B;  4OGQ B;  1KYO D;  3L70 G;  1VQM P;  1YQ3 C;  2L5G B;  2I1J A;  3CX5 E;  1OVV A;  1URQ B;  5B66 E;  5APQ A;  3HD7 D;  1EDL A;  3L75 D;  3I55 P;  4U3F D;  2FFD A;  1FZE A;  1L0N G;  4DJG A;  2KZI A;  4I7Z B;  2VRS A;  3ITK A;  3H1J D;  1NH4 A;  1KQG B;  2QRX A;  3E7K A;  1FZF A;  1N7S A;  3M9Q A;  2V7Q J;  3AE3 C;  1JUN A;  1GTW A;  1FZG A;  5TJH A;  1VQ5 P;  1QL2 A;  1SQB K;  3BAT A;  1SQV G;  4IOI H;  4PD4 D;  3CXH I;  1NAF A;  4KT0 J;  1K73 Q;  1UII A;  2M8R A;  2G3A A;  1JMM A;  1AVY A;  2KP8 A;  5CJ0 A;  2YIU C;  2PGD A;  4PV1 C;  4JQ0 D;  1GZL A;  1SQB J;  2QA4 P;  2A45 H;  2Q6Q A;  5APT A;  2KI7 B;  1Q86 Q;  2WWW A;  1ZOY C;  1FZC C;  2YO2 A;  4D6T E;  1KOR A;  5H2F E;  2KZJ A;  1FDM A;  4WB4 A;  5B5E H;  2W83 C;  2XND H;  2RKL A;  3H1H D;  1U7M A;  3Q5R A;  3KZI H;  3HUS A;  3N4X A;  2IZ0 A;  4A7P A;  1ZP0 C;  4JF7 A;  2R3C A;  3WUT A;  2FFD B;  2HYN A;  4Y28 J;  3B5N D;  4JYB A;  5B66 H;  2WSE H;  1N7S B;  5TIS E;  1LT9 C;  3M91 A;  1N2D C;  3L35 A;  2IBZ E;  1D7M A;  3EQ2 A;  2HR3 A;  3V6I A;  1EDJ A;  1YIJ P;  2YKP A;  3GHG A;  2RN0 A;  2B9B A;  1L4A D;  4UB6 H;  1N7L A;  1KZU B;  1FDI A;  1R8E A;  1DIP A;  2E43 A;  1VQO P;  4YPC A;  3AEA C;  3P7K A;  1UIX A;  2C0W A;  1LTS C;  3JSV C;  2P58 A;  1DD4 A;  2IBZ G;  1LWU C;  3RL0 B;  1FJP A;  4TT3 H;  4OGQ D;  3FWN A;  1JOC A;  4C46 A;  1JB0 J;  1HGZ A;  1ZLL A;  1KIL C;  1OWA A;  1Y47 A;  3I5C A;  1BE3 D;  1FJK A;  2IX7 C;  3E1I A;  3HUS B;  3L71 G;  1MKM A;  1PP9 J;  2W90 A;  4BRY A;  5KJ7 C;  5KAI H;  1QX8 A;  3II6 A;  2P10 A;  2YO3 A;  2O01 N;  3MZW B;  1X79 B;  1EZV D;  3D6Y A;  2ZT9 C;  1N73 C;  1SVF A;  1RE4 C;  2WZ7 A;  3L75 J;  1JY3 O;  2YMY A;  2NRG A;  3FGA D;  1M7L A;  4H0L B;  5TIS H;  1EXJ A;  4JPZ B;  1J1D C;  4WBA A;  3S4R A;  2JDI H;  2P7J A;  1SS1 A;  3AE9 C;  2KSJ A;  3G6E P;  4EOT A;  2KLV A;  2R44 A;  1NTZ D;  2FXP A;  3MP7 B;  1VL2 A;  2E74 C;  3OAK A;  3F89 A;  3C8V A;  2BCC D;  4N3Y B;  2E74 D;  1T2K C;  1LTJ A;  2WIT A;  3CLQ A;  4W7Z A;  3AE7 C;  3H1I E;  3VP8 A;  3D71 A;  2CPS A;  1A02 F;  1VQ6 P;  2BEQ D;  3H32 B;  5CCH C;  4OVN F;  1MFT A;  1NU1 D;  5KLI B;  1NTK D;  3L74 D;  3BCC D;  5CCH D;  3LID A;  2JKV A;  1LTT C;  1KYO I;  2WSC H;  4PD4 H;  3T97 A;  1HF9 A;  4NPF X;  1IFJ A;  1OMI A;  1ZRT E;  1P84 D;  1Q2N A;  2IFN A;  4BRY B;  1VQ8 P;  2ZXE B;  1A02 J;  2NZ2 A;  2IZ1 A;  2E75 C;  4UB8 H;  3BRT B;  3V2R A;  3ABV C;  3H1I G;  3IFM A;  2O3J A;  2K88 A;  3H1H J;  3SFE C;  1IC2 A;  4HYT B;  3RBZ A;  3CMA P;  5KLV D;  1SFC B;  2KIK A;  1AA0 A;  1S5L E;  2L91 A;  4HB1 A;  3RBX A;  3TGU E;  2AXC A;  5BU8 B;  1IFM A;  2PFX A;  1KIL E;  4QMA A;  3CCM P;  1S1C X;  1FOS E;  4PD4 I;  2UWJ E;  2N1T B;  3MTU E;  1FAV A;  2WT7 A;  2QM8 A;  1FZC A;  3MIW A;  1RQU A;  1VF5 C;  3E1R A;  1LTJ B;  1IJD B;  3RL0 D;  4M3L A;  1AQT A;  3CC7 P;  2WPV B;  4RKU J;  2HOD A;  4PJ0 E;  2QJY B;  1KFN A;  3L70 D;  3TGU G;  3RK3 C;  5APS A;  1LP1 A;  2JP3 A;  3RK3 D;  4I1L A;  1L0N D;  5CMZ A;  3T97 B;  3AEC C;  3CPW O;  1NYH A;  3Q5S A;  2NPS A;  1NAY A;  1M8O B;  2E76 B;  1SQX E;  3QWO C;  3CCS P;  2KXP B;  3AEB C;  5AW0 B;  2E5Y A;  2RMZ A;  3A0B E;  2OAR A;  2G8Y A;  1H88 A;  1OVR A;  3G3Z A;  4H44 B;  3H1L E;  3AEE C;  1BE3 J;  1SQV D;  2QSI A;  3CXH E;  1M1J C;  2M0B A;  1OX3 A;  1DH3 A;  1BCC J;  1SQQ E;  3O6Q A;  1NTM E;  3EFG A;  2P2U A;  2JO1 A;  4XE5 B;  2HFE D;  5DJT B;  1JTH A;  3B71 A;  5APX A;  1S5L H;  3GLM A;  2WT7 B;  2FYU G;  1L0L J;  2PAJ A;  1NTZ K;  3P8C D;  2LXB A;  1GL2 A;  3CCR P;  1LWU A;  4WY4 C;  3O8Z A;  4WY4 D;  2HOD B;  1CSB A;  5CCG A;  1YJ9 P;  1NTZ J;  4L74 A;  1AQ5 A;  5KKZ C;  1SQX K;  1IFP A;  1KIL A;  2KUB A;  2WSF J;  2BCC J;  2Y0D A;  3LW5 H;  2QG4 A;  1NU1 K;  4PJ0 H;  3CME P;  1NTK K;  5KJ7 A;  3TNU A;  3GW6 A;  2W8Z A;  1KQL A;  2NPS B;  1LTA C;  1ZW0 A;  1SQQ K;  3HRN A;  1OW6 A;  1X9V A;  1NTM K;  3S1K A;  2WSF H;  1SQB E;  5B5E E;  1SQP D;  2ZYD A;  1NTK J;  3L74 J;  4ASW A;  1SFC D;  2A06 D;  1LT1 A;  3BCC J;  1VQN P;  2XZR A;  2ZVO B;  1EZV I;  2J5U A;  3KZI E;  1RF0 C;  3KPE A;  3O6Q B;  5E79 H;  3A0B H;  2A45 G;  3NMD A;  4AYC A;  4H13 C;  2N1T D;  1IFI A;  3HD7 C;  2OYH C;  1S2E A;  3CXH H;  1BGY J;  1JTH B;  3AE2 C;  3IR9 A;  1JY2 N;  1CZQ A;  4H13 D;  4XFJ A;  3FX0 A;  1BDD A;  3N7N A;  1QVF O;  1P84 H;  5KLV J;  1GL2 B;  1JCD A;  3V4Q A;  1M57 D;  3L72 J;  2Q9I A;  2FYZ A;  3H1K J;  4UB6 E;  5AVY B;  1J1E C;  1H0T B;  3MUD C;  3JCU H;  5AVU B;  3L71 D;  2QJK B;  1ZN5 A;  5AVR B;  1DD3 A;  5GTH H;  2ZAE B;  4BWN A;  2V7Q H;  2JJL A;  2KSE A;  3A0H E;  2C0X A;  4RES B;  1Q7Y Q;  1YJW P;  1P84 I;  1L0N K;  2Y9Y A;  1HBW A;  4C7R A;  1FU1 A;  4N6J A;  2QJP C;  3PHL A;  3L70 J;  1GMJ A;  3CD6 P;  3NFQ A;  4H44 D;  2K9J A;  2POH A;  2K1A A;  1H8A A;  3VYI A;  1L0N J;  3EFF K;  3RK2 C;  3AE4 C;  2JEE A;  1YBK A;  1OVU A;  3AE8 C;  4L76 A;  3V2Q A;  4OH8 B;  2QEX P;  3RK2 D;  5KAI E;  5KTB A;  2Y0E A;  3B5N C;  2R5D A;  1QVG O;  2AXT H;  2WPS A;  1S9K E;  3M0D C;  1SQV J;  3L73 E;  3USS A;  2OTJ P;  1G1I A;  4D6T G;  1MV8 A;  3A7O A;  3SFD C;  3CWB E;  1L4A C;  1KYO E;  1PGQ A;  1ZR2 A;  1E5W A;  1Q81 Q;  3KXD A;  3VN0 A;  2P67 A;  1DEE G;  4CPG A;  3L75 E;  1K9M Q;  3KQG A;  1KQS O;  2N9Y B;  4U3F E;  5AW1 B;  3RGU A;  5K5G B;  2H88 C;  4L73 A;  3H1J E;  1QEX A;  2HPC A;  1PGP A;  3L73 G;  3AEG C;  4WWI A;  1FBM A;  2OTL P;  3OJA B;  4Y99 B;  3CWB G;  3A0H H;  1M1J A;  2K9J B;  2OYI C;  3PH0 A;  4OGQ C;  2FYN B;  1SQP K;  1RF1 A;  3EWK A;  1URQ C;  3CC4 P;  4PD4 E;  3L36 A;  2QVA A;  5AW6 B;  1URQ D;  2OGU A;  4U3F G;  2MKV A;  1NKN A;  3C9I A;  4I7Z C;  4UB8 E;  1SQP J;  3P32 A;  3H1J G;  1BCC D;  1HVV A;  3W68 A;  4GT1 A;  1EDI A;  5BVZ A;  2ZJS E;  4I6M C;  3CCL P;  5CCG D;  4JBZ A;  2K3R A;  2IYP A;  3P8M C;  1IK7 A;  1L0L D;  4HH2 A;  2K9Y A;  3H1H E;  3GHG B;  1QLE D;  5AVQ B;  2GUS A;  2KOG A;  3U1C A;  1KYO H;  2Z4E A;  5AW5 B;  2HPC B;  2R5B A;  1G2C A;  5APU A;  3U59 A;  2H7H A;  4R4L A;  2ZYG A;  4HJG H;  2YXR B;  5CBO A;  3BVH A;  1M1J B;  3ZDM A;  3Q1M A;  1W2E A;  3L71 J;  3G4S P;  3LIE A;  1VDF A;  3GG2 A;  1RF1 B;  3G9R A;  3D70 A;  3TSI A;  2E5T A;  3HD7 A;  1PPJ D;  3PLN A;  1Q82 Q;  2FYU D;  3W67 A;  4Z1M H;  3CCU P;  3AEF C;  1YIT P;  1NO4 A;  1R5L A;  4W80 A;  3KYQ A;  2KS1 A;  4AUW A;  1EDK A;  1N7S D;  1BGY D;  2QM7 A;  2I8D A;  4MN4 C;  1K05 A;  1S4X A;  1YI2 P;  1JMB A;  5C39 A;  3MUD A;  4L75 A;  3VMX A;  2HLO A;  4EIJ A;  3PTZ A;  1HH0 A;  1JM0 A;  1BE3 E;  3M9B A;  3Q5P A;  3OW2 O;  3L72 D;  3H1K D;  2MJZ A;  4B86 A;  4LC1 A;  3CCE P;  1NWQ A;  1EQ7 A;  2H8P D;  3GF7 A;  1NOH A;  2YMK A;  1XTG B;  1GW4 A;  2OYO A;  1VQ9 P;  2IFM A;  1G2C B;  1GU5 A;  3RL0 C;  5BU5 A;  2BEZ F;  3TK1 A;  2D2C B;  1CW5 A;  1EZV E;  2O01 J;  3VTP C;  2B88 A;  2AEF A;  3UIA A;  2W27 A;  1LNQ A;  1KN7 A;  5AVV B;  3B8E B;  1BE3 G;  3HUS C;  4GOF A;  2RH0 A;  2O1J A;  4K35 A;  3Q2Y A;  1NTZ E;  3H1I J;  1YHQ P;  1RQV A;  2I1K A;  4OWF A;  1X8Y A;  2PRR A;  1PIX A;  1PZQ A;  1KB9 D;  4YXD C;  1HTL C;  2AEM A;  3HE5 A;  2KS1 B;  5EFW B;  1EZV G;  5DJU B;  1OZH A;  5APW A;  1NKZ B;  1LT9 A;  4N78 D;  3S9O A;  1L4A A;  2JWA A;  5E79 E;  1J1E B;  3PJS K;  3VMY A;  4H0L C;  4LLH A;  1NJI Q;  1NU1 E;  1NTK E;  1KC8 Q;  3L74 E;  3BCC E;  3CX5 D;  4H0L D;  1NTZ G;  1FOS F;  1L0L K;  2WVR A;  2R32 A;  3A2A A;  2YIU B;  1W5C E;  1P84 E;  4PV1 B;  2H43 A;  1J2J B;  3TGU J;  1SQX G;  2FBW C;  1FZC B;  1IZN B;  4DOJ A;  4ZNC A;  5CJ4 A;  2B87 A;  1PFI A;  5KLV E;  3JCU E;  2QE7 H;  1NU1 G;  5KLI C;  1NTK G;  2Q3E A;  3H1L G;  2LXC B;  1WRG A;  3VMA A;  2E42 A;  4IL6 X;  1SQQ G;  3AE5 C;  5GTH E;  2YNY A;  3Q3D A;  1NTM G;  5L8R J;  1GU4 A;  1LP1 B;  1N86 A;  4JYC A;  3B4S A;  1GK4 A;  1LJ2 A;  2M5A A;  4D6T D;  2KB7 P;  1LT9 B;  1SFC C;  2V4H A;  4RO0 A;  3NTN A;  2XDJ A;  5CBN A;  3M06 A;  1N73 A;  3L70 E;  3BAS A;  1RE4 A;  3BRV B;  2DW3 A;  1L2P A;  2FYU J;  3NXS A;  3V5B A;  1ZME C;  3CL3 D;  3R2P A;  3RK3 E;  5AW7 B;  1AVO A;  2N1T C;  3HE4 A;  1OW7 A;  1L0N E;  4IFF A;  2AXT E;  5KLV K;  1PL5 A;  3I56 P;  3CCQ P;  2Z5I A;  1H89 A;  2R3S A;  1VQ4 P;  2GM4 A;  1KFM A;  4NPD A;  4IFM A;  2D2C D;  1CI6 A;  1USE A;  1ZV8 A;  2M3B A;  3A5T A;  2IBZ D;  1SQB G;  1JCC A;  2QJY C;  1LWU B;  2ZVN B;  2B87 B;  5KAF H;  1U7J A;  1PGO A;  5APY A;  1SQV E;  4HKZ H;  5CCH A;  4I2L C;  1KIL B;  3V2N A;  1T3U A;  5AW3 B;  4YXW H;  4KJM A;  1MZ9 A;  2E76 C;  1Z56 A;  3WUV A;  3MHV A;  3TNU B;  2JWD A;  3P8C E;  2FY8 A;  5AVW B;  2WTY A;  3A3Y B;  2E76 D;  2M5A B;  3RL0 g;  1W2B O;  2C9N Y;  2ZFC A;  3FWL A;  4H44 C;  1VPC A;  3M0A A;  2ZT9 B;  1N73 B;  1NHL A;  1FZA A;  1TU3 F;  1NGM B;  3SSU A;  1HGV A;  2Z5H A;  1J1D B;  1IK9 A;  3SWY A;  3HE4 B;  4GDO A;  1JY2 P;  4PV1 D;  1SQV K;  1RH5 B;  2WPQ A;  2E74 B;  4LGD E;  2Q3I A;  2C9L Y;  1CI6 B;  1KB9 H;  1SQP E;  4RJT A;  2A06 E;  1PP9 E;  3TDK A;  3FXE A;  3SWK A;  1Y9B A;  2WSE J;  5GTI E;  2Q7C A;  1SLQ A;  2A45 I;  3V2P A;  2P1J A;  3CX5 H;  1VQP P;  2NPS C;  1RE3 C;  2W6B A;  2NPS D;  1MFZ A;  4ZKP A;  1WMK A;  1SQP G;  1FE6 A;  2E75 B;  2XV5 A;  1KB9 I;  2A06 G;  1PP9 G;  1R5S A;  3H1I D;  2ZYA A;  3CI9 A;  4ZMD A;  4EDF A;  1OIP A; 
#chains in the Genus database with same CATH homology
 1LTI C;  1NH4 A;  1NO4 A;  1FZF A;  1N7S A;  4W80 A;  3EFG A;  3KYQ A;  2P2U A;  3M9Q A;  3L4F A;  4XE5 B;  4AUW A;  2HFE D;  1N7S D;  1JUN A;  2FXM A;  2QM7 A;  1JTH A;  5APX A;  1GTW A;  1FZG A;  1RY3 A;  1QL2 A;  1SQB K;  2WT7 B;  1YYC A;  3BAT A;  3MUD A;  1JNM A;  1GL2 C;  2PAJ A;  3VMX A;  1NTZ K;  3H6P A;  3P8C D;  2HLO A;  4EIJ A;  1GL2 A;  1NAF A;  1HH0 A;  2M8R A;  1JMM A;  1LWU A;  4WY4 C;  2KP8 A;  3M9B A;  5CJ0 A;  1GL2 D;  3H32 A;  4C7N A;  4WY4 A;  1GDT A;  2MJZ A;  4B86 A;  3O8Z A;  4LC1 A;  1T8Z A;  5CCG C;  4WY4 D;  1GZL A;  2HOD B;  1NWQ A;  1CSB A;  2A45 H;  1EQ7 A;  2H8P D;  5CCG A;  1AQ5 A;  1NOH A;  1SQX K;  1XTG B;  5APT A;  1KIL A;  2YKO A;  1GW4 A;  3RK3 B;  2IFM A;  1G2C B;  1DX7 A;  1KIL D;  2WWW A;  1FZC C;  2YO2 A;  1GU5 A;  3RL0 C;  5BU5 A;  3TK1 A;  1CW5 A;  3LW5 H;  1NU1 K;  3VTP C;  1FDM A;  1NTK K;  4WB4 A;  5KJ7 A;  3TNU A;  1KQL A;  3UIA A;  2W27 A;  5KJ7 D;  2NPS B;  1LTA C;  1SQQ K;  3HRN A;  5AVV B;  3B8E B;  1X9V A;  1NTM K;  3MD0 A;  2WSF H;  3HUS C;  2O1J A;  1SFC A;  5AVX B;  3HUS A;  1SP4 A;  3N4X A;  1SFC D;  2XZR A;  4JF7 A;  2I1K A;  2R3C A;  2FFD B;  1X8Y A;  2HYN A;  3B5N D;  2LKM A;  3SWF A;  1HTL C;  1RF0 C;  4JYB A;  3KPE A;  3HE5 A;  2WSE H;  2N1T A;  1N7S B;  1RF0 A;  2A45 G;  1LT9 C;  3M91 A;  3NMD A;  4AYC A;  5APV A;  2N1T D;  1IFI A;  1N2D C;  3HD7 C;  3L35 A;  3PP5 A;  5APW A;  2OYH C;  1YTZ T;  1NKZ B;  1LT9 A;  4N78 D;  1JTH B;  3IR9 A;  3EQ2 A;  2OYH A;  1JY2 N;  1CZQ A;  1L4A A;  1J1E B;  3VMY A;  4LLH A;  2YKP A;  3GHG A;  2FFD C;  1L4A D;  3N7N A;  1N7L A;  2BAS A;  1GL2 B;  1KZU B;  1T2K D;  1JCD A;  1FOS F;  2E43 A;  3TYY A;  1N7S C;  3V4Q A;  3HTK A;  3P7K A;  1L0L K;  4C7N B;  1T3J A;  4WY4 B;  2Q9I A;  2FYZ A;  2R32 A;  3A2A A;  5AW8 B;  5AVY B;  2C0W A;  2H43 A;  4ZKU A;  1J2J B;  1LTS C;  1J1E C;  5AVS B;  5AW2 B;  5CHX A;  5AVU B;  2XNX A;  2W6A A;  3U1A A;  1FZC B;  1LWU C;  4DOJ A;  3RL0 B;  1ZN5 A;  5AVR B;  5CJ4 A;  1FJP A;  1PFI A;  2JJL A;  1JOC A;  2C0X A;  4RES B;  3VMZ A;  1JY2 O;  3KDP B;  4C46 A;  1HGZ A;  1L0N K;  1HBW A;  1WRG A;  1ZLL A;  2E42 A;  1KIL C;  3M9H A;  1IO4 A;  4C7R A;  1FU1 A;  4N6J A;  1OWA A;  4AQR D;  3I5C A;  4Y99 C;  4IFD K;  2YNY A;  1FJK A;  2IX7 C;  3E1I A;  3HUS B;  3NFQ A;  1GU4 A;  2POH A;  1H8A A;  1N86 A;  3VYI A;  5KJ7 C;  1GK6 A;  4JYC A;  4W7Y A;  4O9B A;  3RK2 C;  3II6 A;  1GK4 A;  2YO3 A;  1LGH B;  2JEE A;  3V2Q A;  4OH8 B;  2XU6 A;  3RK2 D;  1X79 B;  1FZB A;  2KB7 P;  1LT9 B;  1SFC C;  5KTB A;  1N73 C;  1SVF A;  3NTN A;  1WT6 A;  3HD7 B;  2OYH B;  2XDJ A;  2YKQ A;  3M06 A;  1RE4 C;  1N73 A;  1LTG C;  4KHX A;  2O01 H;  3B5N C;  2WZ7 A;  2R5D A;  3BAS A;  1RE4 A;  3BRV B;  1JY3 O;  2YMY A;  1M7L A;  1J1D C;  3B5N A;  3NXS A;  2WPS A;  3V5B A;  1S9K E;  4WBA A;  3M0D C;  1AFO A;  3CL3 D;  2P7J A;  3R2P A;  2J59 M;  1JO5 A;  2KSJ A;  5AW7 B;  2N1T C;  3M0D A;  3WMM 0;  3MGN A;  3HTK B;  4EOT A;  2KLV A;  3HE4 A;  3L37 A;  1G1I A;  3VOP A;  4IFF A;  1DEB A;  1MV8 A;  2IPP A;  3A7O A;  5KLV K;  3OAK A;  2Z5I A;  1H89 A;  4N3Y B;  2GM4 A;  1L4A C;  1KFM A;  2WPR A;  1MUU A;  2HG5 D;  3GHG C;  1ZR2 A;  1T2K C;  1E5W A;  1LTJ A;  4GKG A;  4IFM A;  2WIT A;  3VN0 A;  2P67 A;  1CI6 A;  3CLQ A;  1ZV8 A;  2M3B A;  3A5T A;  4W7Z A;  3KQG A;  3VP8 A;  1JCC A;  1RE3 A;  2CPS A;  1LWU B;  1A02 F;  5APY A;  3H32 B;  5CCH C;  1LTB C;  5AW1 B;  5AW4 B;  5CCH A;  1GD2 E;  5AVZ B;  2HPC A;  4I2L C;  5CCH D;  1HUC A;  2Q5U A;  3LID A;  1FBM A;  1KIL B;  1LTT C;  1QL1 A;  3OJA B;  1T3U A;  2WSC H;  5AW3 B;  3V2N A;  4Y99 B;  3T97 A;  1MZ9 A;  1IFJ A;  1M1J A;  1OXZ A;  1IFN A;  2OYI C;  2IFN A;  2KYV A;  1Z56 A;  1RF1 C;  2ZXE B;  1A02 J;  4XA4 A;  1GW3 A;  2OYI A;  1SQP K;  1HJB A;  1HWT C;  2J58 A;  1RF1 A;  5AVT B;  3TNU B;  3P8C E;  4GIF A;  1URQ C;  5AVW B;  1JY3 N;  2WTY A;  3A3Y B;  3RK2 B;  3BRT B;  2N9B A;  3L36 A;  1IFD A;  3V2R A;  1URQ A;  2C9N Y;  2ZFC A;  3IFM A;  5AW6 B;  1URQ D;  1IC2 A;  1VPC A;  4HYT B;  3M0A A;  1NKN A;  3C9I A;  1SFC B;  1N73 B;  3P32 A;  1NHL A;  4DZO A;  1FZA A;  1HVV A;  3B5N B;  5BU8 B;  1HGV A;  2Z5H A;  1IFM A;  4GT1 A;  1J1D B;  2O1K A;  5BVZ A;  1IK9 A;  3SWY A;  3HE4 B;  1FOS E;  3HE5 B;  2N1T B;  1JY2 P;  2FYU K;  4I6M C;  2GUV A;  3MTU E;  3VP9 A;  1SQV K;  5CCG D;  1FAV A;  2WPQ A;  3P8M C;  2WT7 A;  4HH2 A;  2QM8 A;  4LGD E;  1G1J A;  1FZC A;  3MIW A;  1L4A B;  2Q3I A;  1LTJ B;  1ZR4 A;  1YTZ I;  3GHG B;  2C9L Y;  1CI6 B;  1IJD B;  3RL0 D;  1XTC C;  5AVQ B;  2GUS A;  4M3L A;  2KOG A;  3U1C A;  2XKM A;  2HOD A;  3V4W A;  1KFN A;  2FKW B;  3RK3 C;  2Z4E A;  5AW5 B;  2CPB A;  2HPC B;  5APS A;  1S9K D;  2R5B A;  1G2C A;  5APU A;  3U59 A;  2H7H A;  3RK3 D;  4I1L A;  1SLQ A;  2Q7C A;  1LTJ C;  2A45 I;  3V2P A;  4N78 E;  2P1J A;  5CMZ A;  3OA7 A;  5AW9 B;  1JY3 P;  3BVH A;  1M1J B;  2NPS C;  1RE3 C;  2PP6 A;  1W2E A;  2W6B A;  2NPS A;  1VDF A;  3LIE A;  2OYI B;  1RF1 B;  2NPS D;  1MFZ A;  4ZKP A;  3TSI A;  2L5G B;  2I1J A;  3HD7 A;  1URQ B;  5AW0 B;  2XV5 A;  5APQ A;  3HD7 D;  2OAR A;  1H88 A;  3G3Z A;  2FFD A;  1FZE A;  3CI9 A;  1M1J C;  2VRS A;  1DH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...