1T2QH

The crystal structure of an nna7 fab that recognizes an n-type blood group antigen
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
217
Chain Sequence
EVQLLEESGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCARNRGYSYAMDSWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab NNA7 Heavy Chain
publication title Crystal Structure and Mutational Analysis of an Antibody that Recognizes an N-type Blood Group Antigen
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 217
sequence length 221
ec nomenclature
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t2qH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t2qH01
5ILTL 5EBLA 2CSPA 2V6HA 4XP4L 4ENED 2HVJA 3QDHA 2APWA 4L8SB 3VXMB 4JG1L 5SWSB 3LMJH 4GAJH 3CVHA 2V2XA 2XFXA 3L9RB 3LN4A 5DD1H 3SQOL 3VI3F 5E00B 4X4ZA 1I7TA 1F4XH 3DBXA 5BZWA 5I18H 5FYJD 1MRDH 3D0VA 1EEYA 4F9LA 3OX8B 4YHPB 3D85A 1DANU 3I3BA 5D96B 5DJCB 3TZVD 4DFIA 3SKOA 4FP8H 3MOQA 4TQEL 1IGFL 2FYYA 2O5ZL 2P43B 4K2UH 4QKXB 4KV5E 4M9PA 2PF6A 1OP5K 5ESAB 1CBVH 2O61B 1HH6A 2UYLA 4C4KO 3IJSB 2YHGA 4X6CF 3RBSA 4QTHB 2LU4A 4X99A 5IESH 3PABA 4L9LC 5EOCH 4U1IA 1N26A 2CLVA 3SGJC 6FABL 3VGEA 2VLRB 3S9DB 3N85L 1CT8B 4W4OA 3VA2C 4HKXA 2W60B 5EU4A 1ZT1B 4AEEA 2R4RH 2I5YH 1IEBB 4HKBA 2C4XA 2UY6A 3ARDD 3BPNC 1MLBA 1BD2D 2XN9A 2CDFA 4I77H 1G9NH 4MX7A 3MO1B 1F3JB 4ODBD 4W6WB 2DQHL 1XCTB 3VE0A 5EWIL 3EYSH 5GGTA 2M1KA 2PO6C 2YPKB 4NT6A 3ARVA 3PQYD 2IFFL 1WC7A 1M71B 4P2QE 5C09B 4Y16A 1JP5A 2X09A 2KPNA 1U3YA 1J0YA 2Q76B 2VLKD 1T5WB 1QSEB 2Q1EA 1IE5A 5IT2H 1WBXA 1JHLH 4S0SD 5HI5D 5HHQB 4ONFH 4CJ0A 4Y4FC 3GEWB 2BXZA 1IGJA 3FOLB 3U0WL 2AJ3B 3JTTA 1JGLL 5E70A 4GXUN 3H9SE 2HJFB 4P5MB 4MDJB 2N56A 5FM8A 4KK8C 5IBUB 5IQ9A 1HZHL 5F9WC 4YXKL 4RA3A 35C8H 1TMCB 1IAOB 3FQNA 1VFAB 4ZUTB 4B0MM 4N8PA 4LVHB 5TQ0H 4HKJB 4OQTL 1CLOL 2CLZA 1AQKL 1LE5B 3H8NA 1JZ4A 4X6BB 1TLKA 5HGDA 5EBMB 2E3VA 4FQLL 4GXVH 4IHOA 4G8FA 3KPPB 1D9KC 2QR0A 1C16B 4J4PA 4PJ5B 1GGCL 3TM6A 3NTCL 2NY2D 4NKQB 1NGPH 3CSPA 1E28A 2FGZA 3FMGH 3LKPB 4R96A 1VA9A 4X5XB 3UROR 1I9RH 1XEDA 3H7LA 4KDVA 5HY9A 4ZMAT 1K4DA 5FKPA 2AJUL 4N8CL 3DXAB 3C2AL 2VZTA 1E6OH 1YUHA 3HC3H 1OWWA 3HUJA 1MPAL 4GQPH 2VZOA 4HAFA 4A6YB 1JTTA 1MFCH 2DTSA 3SKJL 1G7LA 1U9KA 4O02H 1MAJA 1U95B 1UWGH 3S36L 4CN6A 3NCMA 2GCYB 1NCAH 2B1AH 3IDIA 3HR5B 2AV7A 2FRGP 4POYA 3I02B 4LDEB 4LIQL 5C2UB 1FYTA 1I8IA 4GMTL 4CVWA 3OXRA 4NQCA 5JW4N 4OZIE 4WFGE 2A6IB 4HX1A 1FP5A 4FS0A 3GKWL 4P2CG 2HWZL 1TVBA 1OF2B 2F19L 4CVUA 3QXDA 5IOPB 3FT3A 3CIQA 3X11B 3MLXL 1X5ZA 3BDBA 3D25B 2J8HA 1R3IL 1JNNH 1YDPB 3MODL 1P84K 2H9GB 4QHMB 1W8OA 2P24A 3T08A 5J11C 1S9VA 3BZEA 3KYOA 5INCA 2QKIB 2R15A 5L8KB 3KHQA 3QJFB 1N6QH 1OQXA 3VDBA 1PEWA 1NCTA 1T1XB 3G9VA 3H7BB 3FN3A 5FCUH 4YDJB 4HEME 1FNAA 4HSQA 5JNYB 1W0VB 3EDFA 3T0EE 2NXZD 5HGHB 4GG6A 1MHEA 1I1AA 1ADQH 2CO7B 4H1LH 1U8IB 4MB5A 1CDYA 1JWMA 5DRNA 3EJJX 2MTPA 1NCCH 1Y18B 2KZ1B 3G6AB 3BD4A 3IDGB 4YDVA 1MFAH 2WMPA 1OAQH 4EBQH 5AD0A 2ZCKL 1J5OH 5HVWA 4RNRB 2AGJL 3ZTNH 3SEPA 1A6AA 3ARFA 3U4EA 1GGYA 3UTPE 3AS2A 1T1ZA 3FL7A 1BFVH 4OIIL 5GGVH 4Y0GA 3HE6C 2J8UB 5KVFH 1OAKH 1UB6B 2MOVA 5IMMB 5I0DA 1X5AA 1BF8A 3QFDB 5C0CD 1FLTX 5DMIL 5DQJA 3P9WB 1NAML 3TWCL 1O7SA 5I16B 4WFEE 3VXPB 3BMWA 1KJ2B 1QD0A 4KQ4L 1TJIL 4R7DB 5I1KH 3QPXL 5DJ8A 1YN6B 4DTGL 2BRRL 3NIFE 3K4DA 5DUBB 1BZQK 1SJXA 4Y1AE 2BJMH 2FEEI 4MYWB 3S35H 1PZ5B 2ICWJ 1SYVB 3GSXB 3PWNA 5IW1A 2V9TA 2FH6A 1AP2B 4G7YH 4X4XB 1QBML 1F6AB 5FO9B 2AJVL 4RBPH 2CUMA 5DZOA 4PRHD 5ISZE 2E27L 4KC3B 1FDLL 4OJFH 5ITFB 5F7UA 5F7KC 3OWEA 1J0JA 1ZWIB 4QF1B 4R26L 4JPIA 2J4WH 3TA3B 1F42A 1BQLH 4NKDB 2OR8A 4CVZA 3BIAX 1ZLVH 3BUYB 3V79C 3EHBD 3Q6FB 1J1PH 4XCCL 1NMCC 4OGYH 3JV6A 2C1OA 1FZMA 2NY0B 3HB3C 4C83B 4JZJC 2BCKA 4OM1H 3MLTA 2R2HB 2WUCH 3N1PC 3CX5J 2DAVA 5F1IB 1ORSA 4QNPF 2BNRD 2OP4H 3O9WB 4PRBB 5FB8B 1ZLSL 4RMQA 5F7EH 5L7XH 4X9FA 3EYQD 5ALCH 3X3GH 4IIQB 4Y4HA 2IPUG 5CKGA 4HMDA 3IKCB 1OWRM 3ZYIA 4BJLA 3KPRE 4LGRB 3S7GA 1RI8A 1IGCL 1KBGL 5E99L 3GSUA 2F5BL 4XGZA 1TPXC 5IB1A 4LRIA 3MRKA 1DQJA 4HPYH 4ERSL 3CXDH 1JV5B 3DURB 3ZKXB 2FEEL 4J12A 4QCIA 2DICA 5JOPD 4XPAL 4XNQB 4XNUH 5J57B 4BKLB 4Z7UE 3D3VE 1TJHH 4GG8B 5JDSB 4P4KB 1EFXB 5T5FH 4P2OD 2HT4D 5HYJB 2BVTA 1RZKH 1YQ2A 5I8KH 5IBLC 1CDIA 5D7KD 4Q9RL 2Q8AH 1MVUA 3WBDA 3WJLA 4E41D 1F00I 1S5IL 4LAJH 3TNNA 3I84A 3QRGH 3HPLB 5F70A 3WDIA 4NKIH 5I8OL 4J6RL 5H35B 3B83A 2ZSVB 5FYJU 3VD5A 4S0TD 2E7BA 1OSPH 1RK0A 3FRPA 5FK9B 2RIKA 5TE4H 4JANA 3CU7A 3ULSB 4LSUL 3SKUD 2I24N 3PGCB 2YA2A 1FPTH 4NZTL 4KGLA 3QUYB 4PJBA 3V8OA 1JGDA 2Q6WA 1T83A 3D6GA 2X4SA 3CDCA 3L3HB 4Z7OF 1FCCA 1UFUA 4UV7L 5DJ0B 4XP5H 4P3WA 3FB6A 3BSZH 3AROA 3RIFK 5C08B 2GI7A 5EC2B 4M43L 1IC4H 4MAUH 1ONQA 3WIHA 4GSDH 4LLYA 3SDCD 1PSKL 5E7BA 4XPGL 5B8CC 2B20A 4QRRD 1IQDA 5ACZB 3MRLA 4XHJD 2Q7YB 5FGSA 1QRNE 4GKSB 4QRPD 5T1KB 4M7ZC 1MF2L 5CGTA 1B4JH 1IZKA 4HLJA 3F58L 1I1FA 5HYIA 3OKLB 4EI5A 2SEBB 1MJJB 3MRBA 1JPTL 4TRPH 5FAAA 2AEPH 3T0BA 5FEBA 4LSPL 3KPMB 5EBLB 4YEFA 2QSCH 2HVJB 1DJSA 2XQYK 5I8EB 3SE9L 3CVHB 2V2XB 3WNLA 1UH4A 4BZ2L 3LN4B 1NCWL 3T0DA 3HAEA 2VLJE 1MCJA 3CPLA 4H25A 1QKZH 1MCQA 4P3DA 3IDXH 4WW2C 1I7TB 5TFSH 3DBXB 1CGUA 1GGUA 5BZWB 3TO4A 3D0VB 1EEYB 5B3JF 5L2KD 3D85B 4G9DA 4PGBA 4HUWA 5K93A 2VDQH 3KLHC 3SKOB 5CEZE 3GSNL 4GLRH 3KPLA 4OZGA 2FYYB 4PGEB 5T33L 5CKAA 4HCRA 3VI3E 2NY7L 2K9UA 4QOKA 1U3HD 3QBTB 1YMMA 1IC7H 2DF3A 4OLVL 4BFIA 2Z31D 1M7XA 1HH6B 4AIZA 2HFGH 3BE1L 2BNQD 3QQNA 4FABH 1OL0A 4X99B 2HJKA 1E4KC 1NEZG 1JRHI 3NZHL 3PABB 1Z5LA 4U1IB 1QSVA 3KYMA 1RUQL 3BP6A 2CLVB 1NH6A 2YBRA 1DDHA 4WDIB 3HRPA 1F4YL 2FX7H 5B21A 4IRZL 2LV4A 1SBSH 4JO4L 4LSTL 1EK3A 4J7RA 5CZVL 4YE4L 4HKXB 5SX5H 3G5ZA 4HV8A 5EU4B 1Q9OA 3GHEH 1B0RA 4HKBB 4JPVH 4GRMA 1MLBB 2XN9B 2CDFB 4MX7B 3KHOA 2VUOA 1S8DA 3C6LD 1I75A 2KKQA 3VE0B 1MHPL 1IGTA 1CGVA 3EUUA 4NT6B 3G6DH 5C8JA 1T66D 5CHNA 1WC7B 4Y16B 4RCAA 5ERWA 1CDHA 4L5FL 2R8SH 1YNLH 3LRGA 2KQMA 5IROA 5ADPH 2QQKH 4FOMA 2ADFH 3U79A 1WBXB 1G9MH 5IHUH 3DSNA 1LD9A 1A6VL 2OLDA 1IGJB 3OZ9L 1XGYH 4PS4H 1QP1A 3JTTB 5C0EB 3SBWA 1VSCA 1WCBA 3WNKA 3TFKC 1BZ9A 1T7ZA 5IQ9B 3QG6A 3H3PL 3MJ6A 1U41A 3FQNB 4JKPH 2GJZA 1JRHL 4D3CH 1C8PA 1MRCH 4GRWF 4EQ3A 5MEQA 4HF5L 4PLJD 5EH1A 1INDH 2YXFA 5LBSL 3WDHA 2CLZB 1QSFE 43CAA 2AXGA 5DGRA 3STLA 1HHHA 4OTXH 2VDPH 5HGDB 4PRAA 4PLKD 4RQQA 1XH3A 3BKMH 4IHOB 5GZND 4G8FB 1CFVH 3DGGA 2BVOA 2QR0B 3QDAA 1DBMH 3GSOA 4HJ0D 3QCUH 5SX4H 1A7PL 5FYLH 4AIOA 4XX1G 4R96B 1FZOB 1RIUL 3EO0A 4DN3H 2PXYD 4OD3H 5HY9B 3GMNA 1K4DB 5HI3D 5FKPB 3KPSA 1FFOA 3ARUA 1IILE 3LEVL 1OAXH 4UU9A 3U83A 4MS8D 1YUHB 2BY3A 3D87B 1KUMA 3HUJB 3IAQA 1N5YL 5A1AA 4YHLL 1S7VA 5DFTA 1G7LB 2UWEF 3RVXC 3GSQA 4BSJA 3K74B 4H8WL 2NY1B 3WNMA 5KSBF 3FN0H 3SDDA 3PHSA 3VXOA 3DUSA 2DM3A 1JUFA 3IDIB 1BD2E 2AV7B 4WUKH 2OQJA 4U3XA 5FOBB 4QWWC 2VKXA 1NGXA 4ZSOE 1FYTB 1I8IB 1JFQL 3OXRB 4NQCB 2RBLA 3CSGA 1T2XA 5GRUL 3SN6N 5JQHC 5IBTH 4HBCH 2A83B 5C92A 4HX1B 4P2RE 1NCUA 3ESUF 4EUPH 4LU5L 4JFFA 3MLWL 1TVBB 2FIKA 4ELKA 2CK0L 2P8MA 4PBWD 1T3FA 2VLKE 3QXDB 3VG0H 3T0WA 3FT3B 4S2SA 4K7FA 3KJ4C 4IEFB 2BZDA 5I19L 2P24B 1W72B 1S9VB 2QBWA 3BZEB 1S7TA 3A6CL 3GJEA 3KYOB 1J8HA 5INCB 5E2VL 1X3DA 2VDRH 1ORQA 3MUZ1 3VXUD 2XZZA 1U8MA 1YQVH 1U93A 4PJ7E 1V05A 4GG6B 1MHEB 1I1AB 3LHPH 3AU1B 1JWMB 5DRNB 4MJ5A 3AREC 4GRLC 4XRCA 2X70A 3LH2L 1J0ZA 4M93C 1ZV5A 4KDWA 3ULVH 5DR5L 4YDVB 1HYRC 2EKJA 4L9LA 5K9QG 5HHMD 5DK0A 4KUZL 2Y36L 3SGJA 1C5CL 4PJXF 4YFLF 1NSNH 1A6AB 3ARFB 1L7TH 4JFDE 1T1ZB 2DMKA 4XPHH 4UQ2A 1F02I 1NUDA 5I1IH 2AI0L 4XP6H 4HS8H 4YXHH 3QAZC 1R5VA 2RJMA 5EIQA 4NCDA 4OQTA 2IFGA 3MLPA 3U4BH 1MFDL 3VA6A 4X83A 4UDTA 5DJ8B 1Y6MR 3OKNA 3MUHL 2DQUH 1TVDA 3AAZA 2GK0A 2AEQH 2DDQH 3WKML 2IQ9L 4TUKH 1AXTL 2COQA 4I3SL 2NY4D 1LQSR 5E1HB 5EFIA 4LVOC 5I15H 2KH2B 3PWNB 3QIWC 2DYPA 4KTDL 4IJ3C 5IW1B 3B6SA 1M1SA 1VADA 2AJXL 4WHYG 3ME0A 5EPMA 4ETQA 2DI8A 3WIIL 1QR1A 4Y4FA 4ODTH 3D39A 4KGJA 4CVZB 4GQ9H 4JPIB 1S9XA 4NQXA 4NCC1 2JLLA 5E2WL 2QADD 2RGSA 3DHJA 2C4FT 3SKMA 3EO9L 4KKLD 1HKFA 4M6NL 3JV6B 1KXTB 2C1OB 2DJUA 1FJ1A 1FZMB 3P0VH 1R3JA 4WI9A 2BCKB 3MLTB 3U9PH 5ITBH 2RCSH 1ORSB 4ORGA 4JRYA 4PIRF 3U7AA 4HIHA 1X4ZA 4Y4HB 4RMWA 2CPCA 1SEQH 5MENA 3WHE1 2E9IA 4X4YA 4PJAA 4QHKI 4QNPE 1JE6A 4OLEA 4FQXA 3CVIH 1MFBL 4XGZB 3TJEL 4HS3A 5IB1B 3KPNA 4NN7B 4D9LL 2AERT 4GW4A 3MRKB 1DQJB 2P45B 1ZSDB 4CDGC 4FQHA 1SJEA 4QCIB 1S7SA 5ICXA 1EHLL 1IAKA 2PETA 5BV7H 3VXRE 2B4CL 4XNXH 5C0CE 3DUHA 3K8MA 1CGXA 2WINA 4KJPC 1ZLUK 4Y2DD 2FX8H 3QWOA 3HI5L 3O4OC 3RTQD 1QQDA 2DB8A 2ZUXA 4UT6L 4L3EE 5E08L 1MVUB 2J88L 4RFOH 3TZVC 2J6EH 3BKYH 3TNNB 1KOAA 2H6PA 1DLFL 4MJIA 2IQAA 1XF4A 2EH8L 3VG9B 5HYSG 1RK0B 3BD5A 1D6VL 4PRHE 2NZIA 3TBWA 1F58L 1KB9J 2BX5A 2R0WH 4ZUWA 5LGHH 2JJTC 4RX4D 3F7VA 4PJBB 4BZ1H 1JGDB 2Q6WB 2X4SB 1FO0L 3BHBA 5HHVL 3KAAA 2IPKA 4Z77B 4GKNA 3FB6B 1MJ8H 5J0BA 5TQ2L 1NLDL 1ONQB 1Z3GH 3T3PF 1W0YT 2LAGB 4LLYB 1KN4L 1RPQA 4U6TA 5FYJL 2E7LC 1IQDB 5DVNA 3MRLB 1A0QL 4Z7OE 4S1RH 2N4IA 4NN5B 2QQNH 4EXPX 1I1FB 2W9EH 4GKOA 3TT3L 3MV7D 3EOTH 4EI5B 1CL7L 3MRBB 3EBAA 3HE6A 3WFCL 3W0WD 1PX4A 2Q86A 2X4UA 4HFUL 3VRJA 3PGFH 1ZHNA 5F7LB 5L6YH 5HI5C 2V2TA 3I2CL 5JHDD 4S1QL 2JB5H 3KR3H 3HAEB 3CPLB 5F88A 4H25B 2ERJB 4P3DB 5LQBL 2YD7A 2EZ0C 3EYUL 2FSEA 2LQRA 3V4VH 3TO4B 1KPVA 1DEEA 4XNYL 1I3UA 4G5ZH 2EDWA 3QG7L 1K85A 4G9DB 4PGBB 4F8TA 2DQEH 1QO3A 1FFNA 3KLAA 2DQGH 1MREL 1OP3K 3JUYA 1HEZA 3DTXA 3MJ7A 3UTTD 3V2AR 4R8WH 4S11A 5I1EL 4OZGB 3KPLB 5FUOH 5T1MA 1OTSD 3ZYJA 5IB4B 1FGNL 3RHWF 4QOKB 4M7LH 2GSIB 4E41E 1YMMB 1OM3L 1A6WH 3VD3A 4YQXL 4ZO7A 4BFIB 1Z0NA 4OQ1A 1XGUA 4AIZB 5B3JE 4FN0A 3R1GH 2HJKB 5F9OH 5DMKA 3L5HA 1V7NL 3I85A 1Z5LB 4JZJA 3KYMB 3W9DA 3BP6B 3CFBA 2YBRB 4OT1H 1DDHB 5C6PB 2VYRE 2Y06H 5E6ZA 3B5TA 2P1YA 2EDXA 2XTJD 2GAZA 3RU8L 4G6FD 3QYCA 4HV8B 3HNSH 1IC5H 4JO2H 4Z95H 1B0RB 4L1DA 4XWGL 3LZFH 2FIRT 4XBEL 4KKCD 1IVLA 4GRMB 4F57L 4OZFG 3JVGC 2R0KH 3VMPA 3O6MH 1AI1L 2HA1A 1S8DB 3CVHH 1IGTB 5BS0D 5C8JB 5CHNB 2I9LA 4QRPE 3GB7A 4JR9H 3AC0A 5ERWB 4FQCL 1SBBA 5IVXA 1HE7A 1WCQA 1N8ZA 1EEUA 2IGFH 1LD9B 5HDOA 1MFNA 2LAAA 4Y5VA 1D5IL 2M26A 1PYWA 1MCOH 5I1GL 1WCBB 3NCBB 1BZ9B 3O2DA 1YEFH 3O8XD 4RGNC 3QG6B 2HLFC 1Q0YL 2GJZB 5H2BA 1VGEH 5MEQB 1AXSA 4QY8A 2OTPA 3KLSA 5FM5O 2NXZC 43CAB 2AXGB 4PBVC 4UILH 3STLB 4RGMC 1HHHB 4DVBA 1JVKA 4PRAB 4RQQB 4G42A 1OP5H 5CJ5A 3DGGB 2BVOB 2CMRH 4OF5A 1JHKL 3GI9L 4GRWE 3GSOB 1ZA3B 4OSUL 3TN0C 5BVJB 4LLMA 1I85A 2OS7A 2VISA 3EO0B 5GGTH 1KCRH 3GMNB 1FFOB 4LBEA 5BVPL 3J7HA 5HJ3A 4UU9B 1EBAA 3PHQA 3BAEL 2FL5A 1WWBX 5E2UH 4J3TA 4UDUA 2ZUTA 1T6WA 2YS4A 4XH2A 4JQIL 3GSNA 4MHHG 1A3RH 2FDBP 1I9JH 1LDPH 1S7VB 3S96A 1DVFC 3GSQB 4F37F 4NQEE 3OGOE 2WWKO 3SDDB 3VXOB 3DUSB 4PRNA 1JUFB 5EB9A 5C2BH 2YA0A 2OQJB 4JRWA 1Z9OA 4TPRH 2EDHA 4OZIA 1I7UA 1SEBA 1NGXB 2VDOL 4OCWH 5B39G 4KFZC 4HS6B 3BEVA 4WEBH 3DWTA 3MV9A 4Q9QH 2XZQH 4OD1L 1AGCA 4JFFB 5KSBE 1RULH 2FIKB 3IAPA 3FONA 4ELKB 2P8MB 1T3FB 4TSAH 5FKAA 4WW2A 4FFYH 2PYED 4S2SB 3MGTA 4K7FB 5J1SC 4M1GL 4Y19D 3EHBC 3GKZA 3S34H 3BN3B 2WWMC 4ZFGL 4CU6A 4BFEA 1H15A 5FGCE 3RAJL 3GJEB 2F53E 1J8HB 2R29H 4MD0A 2X1OA 2V7NA 4ZD3H 1IFHL 1ORQB 4AENA 4KJYA 3GM8A 3V8CA 1NMAL 1U8MB 1U93B 3U46A 4JY5L 3G9AB 3ZL4H 2BOCA 3EYQC 1CD0A 1WIPA 3S5LG 2GITA 4KMQA 1A9EA 4MJ5B 3LDBC 4HWZA 2X70B 3T1FA 2EE3A 5KAQG 1S3KH 5FDWA 4NNPH 3G04A 1U8KA 4L9LB 3VGBA 4KHXH 3MRGA 1I8KA 1U92A 1NUGA 4U1MA 3TYGL 3SGDH 4DAGH 5JORA 4UQ2B 3ZDZE 3MRRA 2WWKT 3CZJA 4FFZL 3GBLA 4LKCA 3EO1A 4UBDD 4LSSH 5F6IC 1R5VB 3BPNB 4KTEL 1XF5A 5FM4A 2VAJA 1PLGH 4LHJB 1FHGA 2IC2A 3WE6A 4PJXE 4Y1AA 3WEXA 4FZEH 2NCMA 2PO6B 4UDTB 1T0NA 3CD4A 2HT4C 3OKNB 5AZ2H 3RBGA 3AAZB 1DCLA 3CFIC 3ZZ1A 1MCWM 1E4WL 1OW0C 1INEH 1BGXL 2EICA 3SDYL 5EFIB 3DIFA 3DJ9A 5D1XD 5I1DA 5IFHH 4OCYL 4LLUA 2DYPB 5T3ZE 3B6SB 1VADB 3ILQD 4M7KH 5EPMB 1RAMA 4ETQB 1LHZA 3GMPA 3ARGD 1KJMA 1QR1B 4Y4FB 3D39B 1TJGL 3GHBH 4NGHH 3OSKA 1S9XB 4NQXB 2JJUA 4QO1A 3QNZA 2FO1A 3N1MC 2DBLL 2F54B 2P5EA 3SKMB 3JZ7A 2EKSA 5F9WB 1FJ1B 1R3JB 1TQBC 3RUGA 3GMMA 1QFUL 4XXDA 5AWNL 3VU2A 4ORGB 4Z7WA 1G1CA 1ZEAH 1KJ3H 4MA7H 1IARB 4JRYB 3MTRA 4OLXL 4K94C 3SDCC 2HG5B 3KPRA 5MENB 4QHNA 1WEJH 4G6KH 4XHJC 5TF1H 4JG0H 3HZKA 4X4YB 1FH5L 4PJAB 4WV1C 4ZO6A 5BMFL 2DS4A 5C0DA 4CDHA 1HIMH 5DC0A 4LEOA 2OXGA 2R56L 3KDMA 3MOBL 3NFNA 1QEWA 1DANT 3VXSA 4HS3B 4OB5L 3KPNB 3TESA 4NZJA 4YIQA 1Q9KA 3TA3D 4FQHB 1SJEB 3UYRH 3DX8A 3D0LB 1S7SB 5ICXB 1H8NA 5C70A 1IAKB 4JVPA 1JPST 1V3LA 3TJHD 3IT8D 3O6FD 2QSQA 3QR2A 3HI6L 1KIRA 1H8SA 3QWOB 4M6OH 4LGSB 5DRZA 1QQDB 3PWPD 3FQTA 3QUZA 1Y6KR 1QPPA 2R1WA 5KJRL 4K94L 1URLA 1PBYA 2OMNA 4MJIB 2ENYA 2IQAB 1XF4B 3JTSA 5KS9A 1ACYL 3BISA 3KYAA 1U3HC 1PX3A 1VDGA 2E9BA 5DHVH 2J8UF 3B2VL 3ULUH 2Z31C 7FABH 4JFYA 2Y6SD 3TBWB 5IR1A 2FWOA 4OLWL 5FYKH 1F6FB 3PUCA 5T3XD 1YMHA 4ZUWB 5E6ID 3TBYA 3F7VB 1GGBL 5J11B 4G6MH 3BHBB 5LKNA 1Q1JH 4MNGE 1P7HL 2IPKB 4LVEA 2BY2A 4FNLL 5F72S 4GKNB 3RVUD 5F3BA 3DYPA 1EJOL 1JMXA 5D71H 1UWEL 2OI9C 1WFTA 1EFXD 4GO6B 1YEKH 1QRNA 1E4XH 4XPBH 3AREA 4GRLA 2D9CA 2UV3A 4JGUA 3P11L 3C6LC 2IEPA 4LPXA 4WI6A 5AEAA 5KSAD 3VFSA 3CFEB 4MA8L 1T66C 1OAZH 2VXVH 1DZBA 3K1KC 3T3PE 4X7FC 5DURB 1FNGA 3HE6B 2X4QA 1YEJH 2Q86B 2X4UB 3BP4A 5GQBA 1CE1L 4UT9H 3VRJB 1DP0A 4YDLC 3C09C 1ZHNB 4LFHD 2VLJA 3SO3C 2XZCH 4ZXBD 1JIBA 5B4MC 5ADOL 2V2TB 3QUYD 2AQ3A 2R1XA 4TSCH 5F88B 2HT2D 4PB9H 1WK0A 1UCBH 2FSEB 5J3HD 1HH9A 2K7PA 3LS4L 4LMQE 3M8OL 1KPVB 1DEEB 4G7VH 3P3YA 4IMLA 5KVGL 1V8HA 1BVZA 1QO3B 1FFNB 4RMTA 1DFBL 3KLAB 3QIWA 3JV5A 1HEZB 3DTXB 3MJ7B 4I18C 4PY8J 2HFTA 5T1MB 1QBLL 3O6KL 4PLJC 4JLRA 4WWKC 5T1KD 1L7IL 1EAPA 1XGUB 1BVLA 2D03L 1A7NL 1N3NA 5E24E 5GZNC 2CK2A 2YK1H 4Z7QF 2Y7QA 1MOEA 1NMCB 2QQLL 4YFLI 4JAMA 5DMKB 4EI6B 5DT1H 5LCVL 4HJ0C 3MUJA 4JZJB 1RUKH 4ODHH 3NMEA 2I07A 3W9DB 2JB6A 3U82B 2DQDH 5IJVA 1RIHL 1JZ7A 2A0LD 5DO2C 2GAZB 4U6HA 5C6TH 4MS8C 4QEGA 5E2TL 4ORZC 1G6RH 1UZ8A 3CMOH 3NACL 3L3OA 3O2WH 3K7UA 2DM4A 1U2HA 1KTLA 3D85D 3KPOA 2EXWD 4JHBA 1CLZL 1OTTD 3FN9A 1TITA 2VIRA 1BWMA 4G8GA 3LKQA 1S7RA 3HAEH 4JPWH 5DQDL 5JR1H 2ZNXA 1SYSA 2EDJA 4OCRH 4LHUG 2WUBL 2I9LB 5FV1L 2APXA 4Q0XH 3GB7B 3MZTA 2EE2A 3IRZA 4P49A 1FO0A 4WO4A 3K2UH 3Q2CA 1TTFA 4XC1H 4XBGA 5EZLA 5IVXB 4JO3L 2WZPD 1N8ZB 3DVFA 1Q94A 2VL5A 2GJ6D 1KTKE 4BK5A 3W0WE 3L1OL 4K71C 5TF0A 3MXVH 2EXYD 2JE8A 2FGWH 4Y5VB 4HT1L 9CGTA 5FUCE 1OARL 1PYWB 3ES6A 5F7NC 5JHDE 3R8QA 1GOFA 5I1JH 1FIGL 25C8H 2W07A 1P6AB 1CLCA 1LEKA 1LEIB 1BAFL 3DPBA 3TZVA 3LRHA 2XZAH 5H2BB 4ZFZA 1G9EA 3RWHA 2YPLE 5DEZA 1EGJH 1AXSB 4R2GC 3SDAD 4QGYA 4YK4C 3IS0X 3RY6A 5I1HL 3I3DA 4NP4H 4WFFD 3BKJH 4M4PA 3UTTE 5SWQA 4DVBB 3PP3K 2VABA 2OJZL 3WLWD 1NGQL 3MLYL 3Q5YA 2AW2A 2BY1A 4G42B 1L9NA 2JJTA 3OJ2C 2VXSH 3EGSA 3MJ9H 3HR6A 1A7QL 2M8XA 3ZHDA 3VGFA 4LLMB 1FVCA 2VISB 2IG2L 1BQHG 4LBEB 5HJ3B 4HIEA 3FHAA 3PHQB 3HA0A 2E6QA 2FL5B 4FQQA 4UDUB 1Y6NR 1NJ9A 3HZYA 4XH2B 3GSNB 3ARDA 1MI5D 3CDGA 2E7LA 3ORJA 4ZG1A 4G43A 5KTEL 2HN7A 4M7ZB 2QHRH 4QYOA 4PRNB 5E0QA 3H9YA 3PQYA 1I7UB 3EIFA 1SEBB 2NY4C 4KXZI 1DUZA 3QHFH 4OCMC 3BEVB 2Y5TA 4IRSD 3MV9B 1NFIA 2A74A 1YC7A 2VLKA 5D7JC 1TTUA 2FJGA 1HQ4A 4TULL 5AG8A 1LNUA 1AGCB 4KU1A 2NXYD 1FRGH 4J4PD 4NJAL 3MLRL 1QYGH 1R0AL 5FKAB 5E5RB 4PRID 4WW2B 1AGBA 1RJCA 1N0XH 4C57C 2DIAA 3MGTB 2QADC 1RK1A 4KKLC 2DLIA 1H15B 2O93L 2YD1A 5I8CA 4MD0B 2V7NB 1TCRA 4PJ7A 5GS0D 2VLRE 4AENB 4KJYB 4N8VA 1NC2D 3U46B 4CMHC 4K55A 2BOCB 1P4LA 5EO9A 4MHHI 2GITB 1A9EB 1K6QL 4Y4KD 3T1FB 3EDDA 5FDWB 2WQ8A 4TQEH 3G04B 3LPWA 1FYTD 2E6JA 4UV4L 1U8KB 4JM4L 3MRGB 1I8KB 4OCLC 1U92B 3QQ3A 5C09E 4LMQI 4KHTL 4U1MB 1LGVA 1NPUA 3VCLA 1I8MA 5JORB 2NW3A 1ZVHA 3VFGL 1KC5H 1QSEE 3MRRB 4NC1E 4N1CA 4QRTA 2ID5A 4LKCB 3EO1B 3MACH 1XGRA 2GIYA 3RPIA 3JVGA 1XF5B 3PWJA 6FABH 3WE6B 1OGAD 4Y1AB 5JIIA 1DQML 3GMLA 3N85H 5I30H 2YMXL 4LSVL 4XAWL 4J3XA 3BO8A 3WL9A 1T0NB 4Y2DC 3ILPA 3DVGA 3GBMH 4U3CA 3RTQC 3WO4C 1XAUA 3DIFB 4V2BA 1MUJA 4R0LA 4LLUB 2ZZUT 4U7KA 3B9KD 2DQHH 2EE9A 3AS3A 5IB5B 5EWIH 2XY1A 1U6AL 4M62L 1J86A 1KJMB 1S5HA 3P40A 1CQYA 5HVFB 5EOQH 2W0KA 4YNYA 4MA1C 1B2WL 5TPWL 5D70L 3NFSL 3QNZB 1DBAH 1MCPL 2DM2A 2P5EB 3HUJF 4PJ5E 1GCFA 2AP2A 1FCGA 2CRMA 2EKSB 5ACLA 3QDMB 1KFAH 4XVJL 4Y19E 3RUGB 1EAJA 3GMMB 4XXDB 3U0WH 1DBBH 5DSCA 1JGLH 4OLUL 3K1DA 4Z7WB 3KVQA 4GW1A 2GKIA 4G3YH 1IL1A 4KK5D 1J1XL 4JJHA 1HZHH 1KENL 3KLDA 2A6JA 5GIRA 4L4TD 2DTML 3KPRB 1IKFL 1FC2D 3VFTA 4QHNB 4OFPA 4AEHH 3HZKB 2PN5A 1PKQA 3UAJD 5C0DB 1AQKH 1AJ7L 4LEOB 1SY6L 3KDMB 1QEWB 3VXSB 3GJFA 4FQLH 1YEIL 2XNAA 3ARXA 4YIQB 1LK3L 1Q9KB 1GGCH 4P59H 3NTCH 3DX8B 2MFNA 4HUMB 4DGVL 5C0CA 5FUCC 1EMTH 1O0VA 4EDWL 4BFBD 1DVFA 1PKOA 2X4OA 3IFPA 4GG6F 5LXGL 4RZCA 2AJUH 1IKNC 3A6BL 2X41A 3AMKA 4AYFA 2H32B 4ZPTA 1FG2A 4K3EL 3NCYS 5DRZB 4NO0D 3FQTB 3QUZB 3WXVL 5DWUL 3ZSTA 2R1WB 4NIKB 4JHAL 4JFHD 3SKJH 3QB7C 3CFCL 4GMSL 5CBEB 1K9TA 4JCLA 3FQUA 1VPOL 3RVWD 4OGAC 2AS5M 4LVNC 3SOBH 2LVCA 3S36H 2KL6A 3UTSD 4PRHA 1LILA 4LEXL 3JTSB 5KS9B 4N90D 5DD0L 2AJSH 1T22A 4LIQH 4G8EA 4PGJA 5IR1B 2FWOB 1YMHB 3KJ4B 3TBYB 3UBXG 1JWUA 1J8KA 4P48A 2HWZH 5D1ZC 4F3FA 2F19H 3RY5A 4HUKB 1BJMA 1UM5L 2J8UE 2BNRA 2XTJC 5F3BB 4JFZL 4X4ME 3DI2B 3MODH 4YAQA 2AABH 3VWKC 1FSKC 2BC4A 4ZUUA 1QRNB 2FB4L 4BELD 4ZYKA 5FECB 5K59F 5C9JA 2LU7A 3WO3B 3AREB 3IFNL 4KKCC 1CI5A 4GRLB 4DKEL 2UZXB 4M93B 1QZ1A 3TEUA 4LOUC 4LPYA 3VFSB 1CGSL 3UCRA 2BVQB 2DD8L 1T21A 3NAAH 5A3ID 4XCYA 1RJLA 2D7NA 1FNGB 4J8RA 1CD1A 2X4QB 3BP4B 1YEHL 4CNIA 3C2SA 3MRFA 3V7AE 3QAZB 1MQKL 3PNWA 4P5TC 2EECA 4KZDH 4CW1A 4KI5F 4R4NC 3ULUF 3RX7A 1N4XH 4OIIH 4M8QA 2YKLH 3DRQA 1HH9B 5IVOA 2Q20A 1VFMA 1WVZA 2DMCA 4MJ4A 1OW0A 3O8XC 4IMLB 4LHQB 1X5KA 1ZLUH 1J87A 2P5WD 1NAMH 4I8DA 4LVOB 3QIWB 4IJ3B 2GYSA 2ZWLT 4MB4A 5IEKA 4KQ4H 1TJIH 3QPXH 1RZIA 1RURH 4DTGH 2ICEB 3H9HA 3JWOC 1FVEA 1DBJH 4I9WD 3ABZA 4JLRB 1L4IA 1ZOXA 1EAPB 1OTUC 4TSBH 1NUNB 1N3NB 4P2YA 2FJHA 4LK4A 2Y7QB 4RFNC 2AJVH 2DQCL 2NY5C 4ZUSA 3INUL 4JAMB 2GTWA 2WNGA 3C8HA 5T3XE 5HDQL 2X1PA 2I07B 2JB6B 5IJVB 4R26H 2Z8RA 3K2MC 4U6HB 3CX2A 1UZ8B 3SDCA 2R23A 3EOBA 3GK8H 5KOMC 1BOYA 1KCVL 2M2DA 2DI9A 4QRRA 1Z2KA 2CIIA 3M1BA 1KGCD 4JRXD 1KTLB 3KPOB 1IAIL 2AXFA 1GL4B 4QRPA 2VIRB 4WV1A 5HYJE 5HHNA 4G8GB 2V9QA 2NYYC 1S7RB 3LKQB 2C7UA 3QHZL 3KJ6H 1EX0A 4K7PL 3JWOL 5E7FA 1A5FL 4QOKD 4PJBF 1C08A 2RQ8A 1FO0B 4XBGB 5EZLB 3DOSA 3QWQB 1I9IL 1NL0L 1Q94B 2VL5B 2ZJSL 3ALPA 3PWUA 4RMRA 2NY5L 2CKNA 5E99H 3GI8H 3SDXE 2F5BH 1S7QA 1AHWC 6CGTA 3BRFA 3ES6B 3O4OB 1IGIL 4NNXA 5C0JB 5GRJL 3FB7A 3QXAB 4WTWA 5L2KA 5AAMA 3X3FL 4MNHA 1LEKB 4XPAH 2FH8A 3MA9H 1V3JA 1H3XA 3TZVB 5T1DL 1I8LA 1ZANL 4ZFZB 4MWFA 1RUPL 4TUJA 3PHOA 5C08E 4PUBL 4K8RD 1U3HA 1OP3H 3W11C 1MJUL 1U91A 2Z31A 5SWQB 5F7FA 3WNPA 2D2OA 2F5AL 2VABB 5L8LB 5F9DC 2Z8SA 2BNQA 1S5IH 1JGEA 5EU3A 2WANA 3EGSB 3HPJA 5BRZD 2VE6A 2UY7A 5I8OH 3S3SA 3DYOA 3K81A 1CIUA 3O6LH 1FVCB 3W82A 3UYOD 2IH1A 4HIEB 4Q6IC 4NZTH 2FR4B 4FQQB 1FBIL 3CZFA 1KTDA 1C7TA 3BKCL 4UBDC 3HZYB 4LCUA 3ARDB 1P1ZA 3CDGB 4OZGF 3E3QE 2HN7B 5C7XH 4ALAL 1IT9L 3LN9A 3C6LA 4QYOB 4HD9A 3S4SG 3PQYB 5GS2D 1P7QA 4NUGH 1OB1A 3VFUA 4KK6C 1DUZB 1CR9H 4TUOA 5D1XC 2Y5TB 1NFIB 2A74B 3B3IA 2EDOA 1MF2H 2FJGB 4LPCA 1HQ4B 3ILQC 1LNUB 3F58H 1RQ5A 1DR9A 3ARGC 3EFFA 4O9HL 2P7TA 1KV3A 2WIMA 3TBSA 1AGBB 3O0RH 2GJ6E 1JPTH 2R0ZL 4POZC 1UENA 1RK1B 2VXQH 3RJDA 3S37L 4HPOL 2C3XA 4LSPH 3LS5H 4G9FB 4HUNB 5I8CB 2D7TL 4Y2OA 4MVBD 5F9AC 1TCRB 5HXMA 4PJ7B 4BZ2H 3KGRA 3MYZA 4ZOCA 4I18A 3MGAA 4N8VB 3W5MA 3GUTA 1MFEH 1FE8H 3H42H 4WWKA 1P4LB 1Q0XH 2FECI 4IDLA 1HN1A 1NAKH 2XN9E 3DARA 4N0UA 2DJSA 2YD6A 4TVSa 2LE9A 2PTUA 1YJDL 4ZFFA 3QNYA 1GIGH 2NY7H 2EDNA 3QQ3B 3WYRA 4QHUA 1I8MB 4JFFD 3MRDA 3VCLB 5BCAA 2NW3B 1J05A 4H1LG 4LCIL 3U6RA 1YNKH 1VB9A 4QXGL 4WRLA 2ZUVA 4QRTB 4AMKH 2ED9A 2E7MA 1RUQH 1XGRB 3RPIB 1W0WA 3O6FC 3PWJB 4IRZH 1DUYA 4JO4H 4LSTH 3GMLB 1U42A 3OJMB 4GS7C 3JV4A 5CZVH 3BO8B 4YE4H 3WL9B 3ILPB 3DVGB 5IKCA 1XF2A 2R9HC 3AVEA 4OCXL 1FNEA 2I60H 4NYLA 2VDNL 1KJ2L 4OFIA 3S3PA 2OK0L 1MUJB 4R0LB 2DN7A 1QFWH 4TVPD 1R24A 4NHUA 3UC0H 4XVTL 3RIAK 5EZIL 1T03L 5EIIA 4HAGA 1S5HB 3L3DA 4WTXA 2MSPA 5JW5A 2X10A 2IAND 4YNYB 3FQWA 4HDIA 1RUMH 2LU3A 2Y6SC 2O5XL 1JGUH 5GRWA 5E6IC 3QWRD 1O7VA 4RGNB 3SPVA 3TT1L 3B2UC 1A6VH 3OZ9H 4XMKL 4N9OB 5DSCB 2AV1A 3MV8D 4I0CC 3VXUA 3FFCD 2A9ML 3ZKSD 4GW1B 3RVUC 2GUOA 1F90H 4LSQH 5A16A 2NXZB 1IL1B 1MWAH 5IUSA 1CK0L 3HUJE 2KDGA 4M6MH 4RGMB 1MY7A 3PXJA 2PO6D 2A6JB 1C7SA 5GIRB 3U0PA 1J9CT 5C0FA 1XIWD 3IJHB 1UEMA 5D4QA 3VFTB 1JRHH 5TDOA 4L4JA 2ORBL 4Y8AA 4HF5H 2VB5A 1PKQB 4H88H 4KY1H 1DQDL 5KSAC 4ELME 1WWWX 1GAFL 1T1YA 4PB0H 4NZRL 1FYTE 1KN2H 3P0YH 3GJFB 2XNAB 4NQCE 4OZFA 3EFDH 4X8XA 3T2NL 2VZ1A 3WFDL 3BESR 4GAGL 2IPTL 4ZXBC 1A7PH 2F54D 2OXHA 1S7UA 1MCSA 5GGQH 3PF2A 4KK8D 1DVFB 3CNKA 3O3AA 2X4OB 2X4TA 3IFPB 5DVKA 2HT2C 2JK5B 1ZTXL 1V3KA 1M7DA 4RZCB 2BFVH 5J3HC 4ZPTB 1FG2B 4PREA 1NCBL 1UXSA 3EW3B 1N59A 1N5YH 1FZKA 2R0LH 1GHFH 3IRPX 1IGML 1RHFA 1HKLL 1J1OL 4JRYD 2XKUA 1EXUA 3ZKQD 2CRZA 1T2JA 5L0QC 3FQUB 5D7JA 4H8WH 3O45A 4HWNA 4UIKH 4PRHB 3MRJB 4GG6E 1D9KD 4DFHA 1CYGA 4IMKC 4ZAKD 1JK8A 1T22B 4G8EB 2QTEA 3DYMA 3ZHKA 3CLEH 4U33A 5I1CL 5GRUH 2E5EA 1K2DA 3UEZA 1JWUB 4HZLA 5EBWA 2NY3D 2CK0H 4F3FB 2OR9L 3U7WH 3NH7L 4X80H 2A0LC 2BNRB 1OAUL 4CKVX 3VXTA 3V5DA 1AY1H 1NEUA 4YAQB 1OCWL 3BP7A 2ZG2A 5BOPA 2BC4B 3A6CH 4ZUUB 4ZYKB 3OKEA 5C9JB 3LDBB 5DUMH 2APFA 3CK0H 3WSQL 1QLRA 4URTB 2EXWC 2UZYB 2Y07L 4ZTPL 2GQHA 4F80A 3SGKC 4JDVA 4DN4L 1JI2A 2VQTA 3ALXA 3P9LA 4DK3A 3T2OA 4ZO8A 4KKBC 1G7IA 5K59E 4XCYB 1RJLB 4J8RB 3ULVD 1CD1B 3LH2H 4S1SL 3DLQR 5DR5H 4CNIB 5J9PA 1TZHA 5DFVD 4YPJA 4KUZH 2Y36H 3MREB 5F6IB 4CW1B 2Y5EA 1CZ8L 3GBNL 5JW4M 5EG6C 3RHWK 4Y2DA 5L2JA 3WFBL 1C5DA 2BSRA 3DRQB 5B39A 3RTQA 4CVXA 5JW4R 1FAIL 5CIPA 2AQ2A 5F1NA 1CXIA 1FNFA 4PJAF 3S6CA 5I73C 1MHHB 5K9JL 1SQ2N 4XAKE 4KI5E 5IEKB 1SY6A 5JPMA 1NBYA 2ED7A 1RZIB 3SDAC 3H9HB 1FVEB 4JFHE 4K3HA 1A1OA 4M9OA 4JB9L 4I3SH 4M4RA 3LPGA 1HWHB 5L88H 2JELL 3WLWC 4OZ4A 4KTDH 3W2DL 2FJHB 3PG2A 5I66A 4RX4A 5DURD 4CMMA 4ZUSB 1M4KA 2AJXH 2GTWB 3HE6D 2K3TA 1TQBB 3UJTL 2MHAA 4U2ZA 4DZ8A 4LASL 1V5JA 5JMRA 1KELL 3RVTD 1J18A 1T7XA 3TO2A 2O5YL 4N0CD 2K7QA 5F89A 4KKAD 3HKFA 4WVRA 3LQZA 3SDCB 2R23B 3EOBB 4FTVD 4EOWH 4RRPA 4I0PD 4LF3A 4QRRB 4EKXA 2CIIB 3M1BB 4NDMA 1GSMA 2AXFB 2X9XA 4QRPB 1Z6JT 3SKNA 4WV1B 4YH6A 2C7UB 3IAGC 3REWA 1CF8L 1B0GA 3MV7A 5E8PB 4G6JL 2EO1A 3M45A 5CEZH 1C08B 4CJ1A 1UYWH 2HKFL 3VI4F 4LLQA 4IRSC 1BBDL 3OJVC 2NXYC 1MFBH 1S7QB 3LSOA 1PG7L 4F58L 1IKNA 1MCDA 4D9LH 4NSKA 3EOAA 4PJBE 3MLUL 4NNXB 3FB7B 5L2KB 2FZ3A 1JZ6A 4MNHB 1MRFH 3CFDA 3WD5L 3AS1A 2PUQT 2GHWB 5JIKA 5GS0C 2Z0BA 2B4CH 1CTOA 1JN6A 4MWFB 4TUJB 1REIA 3PHOB 4KRPC 1WTGT 1IBGL 4NO2A 5CMAA 4X9HA 3HI5H 1U3HB 3O2VL 4ODSH 3MLSL 1FLRH 3C08L 1U91B 2Z31B 3RZCD 4XCEA 2BNQB 3V4PH 2AXHA 1JGEB 3T65B 5EU3B 4Y4KC 1ZVYA 3UPCA 3MOAH 3PJSA 4I2XA 1DLFH 3HPJB 4RGOH 5ALBL 2VE6B 2EH8H 5D1ZA 2XWBA 4FMKA 1LK2A 4XI5C 1D6VH 4F37K 1U8PA 3QXVA 2IH1B 2QSVA 2IBBA 1EV2E 3BFOA 1IQWL 2KUTA 3VWKA 2A9NL 2OI9B 3CZFB 5FA3A 1KTDB 1FO0H 5HHVH 1P4IL 3JV0A 3VFPA 4LCUB 1P1ZB 3LMJL 4GAJL 5A2KH 1HWGB 1FGVL 2H1PH 3C6LB 5DD1L 2HLAA 5FFLA 5GS0L 5TQ2H 5BS0A 1WJ3A 2C26A 4Y5XC 4C56D 1P7QB 2UZIH 5I18L 4JRXE 1BJ1H 1E6JH 1MNUL 1OB1B 4JN1H 4U0RC 3VFUB 1MH5A 3KS0H 1G9NC 5IMOA 4TUOB 5ESAA 4OZGE 2G5RA 1U8LA 3TVMD 3B3IB 4YDLB 3C09B 3HG1D 4QOKE 3TT3H 2ICES 1UADC 4K2UL 3MLZH 3EFFB 2P7TB 3TBSB 4R4BA 4W4NA 4PJ8D 1WWAX 3VRIA 4M48L 2XPGA 2P49B 3UPRA 4OKVB 5ETUA 5IBUG 3O8XA 5IESL 2VN7A 1EH9A 3NCEB 5F97E 1UKSA 5LGKA 4S1QH 2P8LA 4EUPG 4I18B 1GZPB 5LQBH 4QXUH 4IM8A 1W72L 4QLRA 2FJFA 4W70A 4KK5C 2IAMD 3GUTB 5JOFA 4KUCD 4WWKB 4XNYH 2XICA 5IVXF 4DGIH 2I5YL 5H94A 5J8OA 4N0UB 3MCG1 4U4BA 4UUJA 4I77L 1G9NL 2XOTA 3PP3H 4ZFFB 3QNYB 3IU3A 4JFOB 1FGNH 1ZXQA 4P5KA 1OM3H 3EYSL 2ICWI 4XWOC 2H2PD 1PG7W 2OMBA 2J3SA 4QHUB 5E6YA 3MRDB 3IDYC 1J05B 4WTZG 3U6RB 3M17B 2JIXD 1V7NH 1OHQA 2YD8A 3WLBA 4D9RD 1W2KT 1R3HA 5IT2L 1JHLL 4LLWA 4ZOEA 4YXLH 1M6OA 1W0WB 2EC9U 1DUYB 3RU8H 2DLGA 1WQVT 2DQIH 3VWJD 1CQKA 1XF2B 5IGXL 5E5MA 4NYLB 4JQXC 4F57H 4NM8H 1Q38A 5FDYA 1B0WA 2C3GA 5HPOA 3RVWC 1AI1H 1II4E 1R24B 3D69A 4NHUB 4P9ML 4CBPA 1NFKA 5EIIB 4K71B 3L3DB 1QPXA 3D2UD 4M3KB 4D0BA 5JW5B 3FQWB 1AHWA 2PYEA 1CGYA 4HDIB 1LMKA 4QTIL 3LKPA 5IMLA 3ELAT 2GSGA 4Y19A 3DETD 2A6KA 1QBBA 3S36X 2BNUA 1N7ML 3IF1A 3UP1A 3SPVB 3RDTD 1KULA 5CWSA 5E03A 4Z0BL 2YR3A 1RD6A 2EYTA 5DDHA 4PP2A 2LABA 2AV1B 3VXUB 2ZUUA 4R2GB 4YK4B 3U7YL 2GUOB 4JZOA 5A16B 1GRWA 5IB2A 2IBZY 4OF8A 3QUML 4U1KA 2H3NA 3EYFA 3WFEH 3KWWA 5C0FB 4CRPA 2BDNL 5TDOB 1F97A 4F8QA 1T5XA 5A2IH 2ATKA 4O02L 1UWGL 5HHMB 4WW2F 1NCAL 3O41A 2B1AL 1T1YB 1K8IA 1OAYH 3NCFB 5CEYA 5DC9B 5A3IC 4JN2A 2OTWA 4OZFB 1MAML 4NRXA 1JHKH 3X11A 1ZLWK 4JFFE 3D25A 4OSUH 1U8JA 5JOEA 1S7UB 1KIQA 3CDYA 4LHUA 3O3AB 4KVCH 2AK1H 2X4TB 3QDMD 1M7DB 1X5XA 3BAEH 4KVNL 4PREB 1E27A 1UXSB 2VSDA 1J8HE 1N59B 1FZKB 4JQIH 2NY4B 1T2QL 5D1XA 1EXUB 1N6QL 5FCUL 1AC6A 5D7JB 3V0WH 1K5NA 3O45B 1X6LA 3TPKA 4NOBA 3G6AA 3ARGA 5JA8B 1JK8B 5TE6L 1U3ZA 1WT5C 2VDOH 2QADB 4JFED 4QXWA 4TOYL 4F33A 1KB5L 1N6UA 4KJWC 4AEIH 3VXSD 1K2DB 2IANE 3BQUC 5I74C 4HZLB 5EBWB 2VJXA 1J5OL 4YHIA 2CKBH 5CSBA 3ZTNL 1K3ZA 2W92A 2D0HA 5GGVL 4M6AA 3VXTB 2VL4A 3CXHK 3NPSC 3V5DB 4CMHB 5KVFL 1KJ2A 2DKSA 3BP7B 2E8YA 1KG0A 5EC1A 3BRDA 3OKEB 1H3UA 4NQDD 5GSRA 3DHMA 5FGBC 1I3RA 1IFHH 2NW2A 1QLRB 4QWWD 1KEGH 1PZ5A 5J56B 5CGMA 4JDVB 2PNDA 3NGBC 1CLYL 3DUUA 5I1KL 4JY5H 4X4XA 5FO9A 3P9LB 4OM0H 3HNTL 4MB3A 2CXKA 1X5JA 4AJ0A 1G7IB 3S35L 4X7EC 3E6HA 4OF3A 3O81A 4G7YL 2NTFA 3RUGF 5J9PB 1TZHB 4XP1L 3D39E 4Z7WF 2X4RA 4JDZB 3O6FA 2VN4A 1K3IA 2F54E 4U1LA 4Y2DB 5L2JB 5B39B 1C5DB 2BSRB 5EZOH 5IG7A 3RTQB 2YEZA 5DMJB 4CVXB 1B6UA 3WO4B 3L7FA 3PWPA 4PRBA 2YUVA 5CIPB 2ZNWA 1TNNA 5F1NB 4I4WA 4KTEH 1DQLL 3VW3H 4OM1L 1H3PH 1LO3L 3JUZA 4YHZL 5JPMB 3ARED 1NBYB 2ESVD 5GHWL 2OP4L 3VFOA 4JRYE 4K8RC 3KXFD 4HH8A 1A1OB 5F7EL 1E4WH 2DI7A 4GJTB 3X3GL 1BGXH 4MA1B 2UUDK 3L3KA 1CVSC 3SDYH 1FFRA 4OZ4B 1JHTA 2J12B 1CU4H 5E6IA 2BSSB 4PJAE 4HH9A 1NCNA 4CMMB 5I66B 5B38G 4JZNA 4O00A 1BQSA 4PGDA 2MHAB 4DZ8B 5SWZD 4PJCA 3TO2B 4BKLA 3K3QA 2DBLH 3TH2T 4MNQA 5F89B 1JCKA 3TPUA 4HPYL 3LQZB 3WHXA 3LKNA 1R3LA 5GS1C 4ZNEA 1QFUH 4XNUL 4LF3B 3E2HC 4RFEA 4XVSL 4NDMB 5KS9F 3SKNB 1DBKH 3CLFH 3V95A 4N0YL 5T5FL 5KSAA 3REWB 4LP4A 5CAYB 4HIXL 1B0GB 1LWRA 3MV7B 4GKZA 4K8RL 2WLYA 4OFKA 2Q8AL 4LLQB 2ARJA 4MJIE 4YWGL 3SDXA 4WI2A 1FH5H 4ZOBA 4EIZC 4ZXBA 5BMFH 4NKMA 4I3RL 2DM7A 3L6FA 5KW9H 2V5RA 1OSPL 4P9HL 1VGKA 3LSOB 3IVKA 1QHPA 4NSKB 3EOAB 4BSVA 3IDJA 1H8OA 4MMXC 2HRPL 5A43C 2D0FA 1FPTL 3LV3A 2FZ3B 4ODWA 3CFDB 4GLRI 2IALA 4O2FA 4HWUA 4MVBC 2HAZA 4QRUA 4LVNB 1JN6B 4XP5L 1HK6A 3HI6H 4MJ2A 5GRVL 4NO2B 1X4XA 5CMAB 3BN9D 4IMKA 4RIRA 2G5BA 1RIVH 4MAUL 4G8GD 4IOFD 4PJDB 4GSDL 2V2WA 4XCEB 1J0IA 3UJJH 3PJSB 4I2XB 5FV2A 3O3UN 2ENSA 1B4JL 1ACYH 3FOMA 5D1ZB 1MCWW 2XWBB 3OAUL 3R0MA 2VMFA 1LK2B 3B2VH 4DKFH 5I8EA 2XTJB 1U8PB 3LRSB 4OLWH 1I7ZB 4TRPL 5FA4A 4G6FB 4E5XA 4OI8A 3VWKB 5DJXA 1FSKB 1HCVA 2AEPL 4KJPD 2PTTA 5FA3B 1EDQA 5D1QD 4U2YA 1UM4L 3TIEB 1UG9A 2DIJA 3VFPB 2XACC 4K23H 3SGKA 1BBJB 2HLAB 5FO7A 5BS0B 3BDYH 5TFSL 1G0DA 4IOSD 4PGEA 1NMBH 1QHOA 4OUUA 4HJGA 1MH5B 3IJYA 5IMOB 2VDQL 1U8LB 1FIEA 2AK4A 1D5BA 4L29A 4H5SA 3OR7A 5F96L 2GJ6A 1AO7D 1BEYL 2EIZA 5MERA 1IC7L 4GBXD 4R4BB 1X5YA 3VRIB 2XPGB 4H0IA 4ONGL 3ARBD 4WDIA 4BSWA 3UPRB 1CE1H 4FABL 1G9MC 4GRWH 5ETUB 3N9GH 5EORH 3O8XB 4JHWH 3LAFA 4CL7A 1D6EA 2P8LB 4ZS7H 3IXAB 2FX7L 4KK9D 4WEUD 1SBSL 1U8QA 3SDAA 2XQBL 3G5VA 1KEMH 2FJFB 1RUAL 4XCNA 3M8OH 5JOFB 5KVEL 4JY6A 1RZFH 2VXUL 1BM3H 1QFHA 3GHEL 4JPVL 5H94B 1DFBH 2PKDA 4UUJB 1XIWC 5SX4I 4AG4H 4DUXA 1ERNA 3O3EA 1DSFH 3IU3B 1QBLH 1YNTA 4I5BA 4P5KB 4TVPL 2FATH 3BXNA 4FFVD 5GJTH 4UIMA 4L8DB 3G6DL 5C0BD 4HWBL 5IQ7L 2D03H 5KVMC 1A7NH 4XP9L 5IVXE 1ULVA 5C0EA 1YNLL 2CO6B 2EZ0D 2QQKL 3ZO0A 3WLBB 2ADFL 1JZ3A 1R3HB 4YHMH 1G9ML 2Q7NA 4LLWB 1HNGA 5D5MA 3SE8H 1MI5A 4F2MA 1M6OB 4MAYD 4G9FD 5ENWA 5DTFA 4K7PY 4WEMB 4PS4L 5JXED 1DE4A 4C4KT 3NABL 2X5PA 4M7JH 5E5MB 3THMH 3OAZK 2OL3H 4JKPL 5K33A 4IRSA 1CLZH 3D69B 1MRCL 5CLTA 1H5BA 1INDL 4ZAKC 4D0BB 2DOCA 2WUBH 4PRIA 3FT4A 3P4MA 5HBBA 1AHWB 2PYEB 4UINH 2VDPL 5IMLB 1FZOA 1XGPA 3BKML 2GSGB 4Y19B 3SHSA 2A6KB 4JO3H 2BNUB 1XF3A 3IF1B 4JM2C 2YD3A 3RNKA 2NY3C 3P2TA 3L1OH 5CWSB 5DHYA 2DQTL 2EYTB 5DDHB 5HDBF 4PP2B 4HT1H 1QTYT 1RFDL 1NC2A 3DRTA 4JZOB 2NX5D 5IB2B 1OAXL 3DV6A 1TFHA 4F7TA 3BJLA 4U1KB 3H3KA 2H3NB 3EYFB 1F11A 5EOCJ 3KWWB 4NO5B 1ZK9A 5FOBA 4Y4KA 4ELMA 1T5XB 2WQRA 2ATKB 5E5UB 4Z6AT 5J1AA 1B90A 2R4SL 5I1HH 3O41B 4RWHA 5JUEH 2A83A 1K8IB 4ZODA 5CEYB 2HT3D 2ZUQC 1NGQH 2A77L 5T3ZH 3ULVC 4JN2B 2OTWB 3W81A 3MV9E 4Q6IB 5HHXH 4NRXB 5ACMA 1A7QH 4PJ7F 3UZEA 4OBSA 3I9GL 1U8JB 5DFVC 1KIQB 2XWTA 3B8SA 3T4AA 4LHUB 4RGND 1W72A 2IG2H 3QZWA 2V7HA 2R1YA 1X5HA 4O51A 2ZCLL 2CGRL 1OGAA 2HLFD 2X6MA 4NWUH 5DVLA 4A2MA 4JDTL 1MLCA 4ZTOL 1E27B 1FNSH 1PFCA 1X4YA 4NCC2 3GSWA 1ZT4A 5D1XB 5KTEH 5L8JB 4HXBL 3RWIA 3AU1A 3B9KA 1K5NB 1ES0A 4EXKA 1YQVL 3LEXA 3ARGB 4JO1H 5HPMA 4YO0A 4MZ2A 3KPQA 3LHPL 3TN0D 4X8JA 4N5UA 2CDGA 2W1NA 43C9A 4DW2H 4F33B 2FBJL 1FC1A 2AJYH 1P9MC 2ZCHH 5C0RH 4OFDA 2GT9A 4ODXA 3ULVL 4TULH 5E94A 4JHZA 3AB0C 3T8XA 4YHIB 1R0AH 3GIVA 1YY9D 5AZEH 1AGEB 3RVTC 1NSNL 1A3QA 2CDEA 3MRIA 4P4RA 1L7TL 1ODAA 4N0CC 5LVEA 4XPHL 1DVFD 5JIHA 3MUGA 4KKAC 3TCLA 5I75B 5I1IL 1KG0B 5EC1B 5GSRB 4X6DA 1MCIA 2A1WH 4YXHL 1I3RB 4L4TA 1DLHA 4I0PC 2NW2B 1R5IA 1BQHB 3PL6D 1GZQA 3U4BL 4PRPD 2I25N 1VEMA 3DUUB 1GGIL 2DQUL 3BZDA 1P2CA 2L7UA 1AGDA 2AEQL 2DDQL 5DMYA 5J06A 4L1HA 1N6VA 5DLMH 3E6HB 5JLZA 5ABDE 2NTFB 5LGJA 4HLZH 2MMXA 4JM4H 1JTPA 4NPYA 2WWMD 4HZAA 2X4RB 4ODTL 3O6FB 2AXJA 2ICWA 2YWYA 4M5YL 4YUEL 3QUMA 3QP3A 2C3HA 2P5EE 1HINH 4U1LB 1XT5A 5IG7B 1WISA 2YEZB 1BMGA 4NO0A 3QDME 3L7FB 3PWPB 4N68A 4KXZH 5DJDA 4JQXA 3RUGE 5BV7C 1KYOJ 3P0VL 4I4WB 4Z7WE 3WUWG 2RCSL 3VGHA 1DQMH 5JO5A 2YMXH 4LSVH 3UTSA 5T1LD 3VFOB 4BQ6A 4NKOA 4MXWL 3QUXD 3FRPG 1KSRA 3UZQA 3RZCC 4UMGA 4LQFH 3L3KB 4RDQG 1QBAA 5DZNA 1JHTB 1A7BA 4PV8A 5E6IB 2G60L 2EDQA 4HH9B 1IAIM 5FF6A 3BGFC 4MJ6A 1U6AH 4AM0A 3BRGC 4JZNB 5EDXA 4MQSB 4JFEE 5D8JL 5LWYH 2HJLA 1ZSDA 4PGDB 3CVIL 3VXSE 4PJCB 1JYNA 5JQ6L 1F2QA 3LIZL 3LPFA 5EUOA 5TPWH 5D70H 3NFSH 4B53A 1MCPH 2H41A 1G0XA 4MNQB 5H37H 1IEHA 3TPUB 1R5WA 1Z9SA 3UTZA 3WHXB 3LKNB 1R3LB 1JI1A 1XGTA 4XVJH 1UA6L 1YEEL 4PYHA 5FYKU 4RFEB 3GO1H 4OLUH 5BV7L 4XNXL 3D1MC 4AQ1B 4ONHA 4H1LA 4DUWA 5CFHA 5KSAB 3G08A 1KB5A 2DRUA 4GKZB 2DTMH 1IKFH 3MRCB 2FHBA 1JZ2A 1RSFA 2ARJB 4RFOL 1UXWA 2HFFA 3TVMC 3SDXB 2J6EL 4BQ8A 5KS9E 4ZXBB 4NKMB 4WW1A 1AJ7H 5GXBB 1BFSA 2JF1A 3L6FB 3T0AA 3HAEG 4U1NA 4Y89A 1VGKB 4PJ8C 4FQPA 1YEIH 3U9UA 3V4UH 1XFPA 3IVKB 4XPFH 1PQZA 4WUUD 4BSVB 3IDJB 4JGMA 3FO1A 4Q97A 1LK3H 2B2XH 2R0WL 4Z77A 1EIBA 5LGHL 3LV3B 4ODWB 4M5ZH 2IALB 3BVNA 4O2FB 2P5WA 5DD6A 4D0DA 4FXGA 4EDWH 1JF5A 4QRUB 5L0QB 4PPTA 5DRXA 4J23A 3RWGA 3O2DL 4OV5A 1MJ8L 4K3EH 2IAMC 2XQYG 4RIRB 2G5BB 1FV1A 1Z3GL 1WT5A 3WXVH 5DWUH 2ESVE 2V2WB 1T04A 1ZT7B 4M1DH 4JHAH 5CILL 2Z35A 3CFCH 3GZKA 4S1RL 4D9QE 5BZDA 2LTQC 4LEXH 4CUCA 2QQNL 3FOMB 1MCLA 3L5JA 3BIBX 2H2PC 2V5TA 1L6XA 3EOTL 5DJZA 5FA4B 4E5XB 3QQ9D 2D3VA 3ESVF 5DJXB 2WP3O 2VSCA 3PGFL 2PTTB 5J4MA 3NN8A 1F3DH 1FL5B 5FGBA 1KLUA 3K4AA 1S7XA 4LSDA 5L6YL 1HILA 5F9JA 4WY7L 1UM5H 3KR3L 1HCFX 2AVGA 2GW5A 4JRXA 1WLHA 4BK4A 4NJ9L 4JFZH 5FO7B 3L5IA 4NWTH 1GJIA 3U1SH 5GS3A 3VWJC 3V4VL 3ZKMD 4OUUB 3LQAH 5IB4A 4HJGB 3IJYB 2GSIA 2IH3A 3IFNH 4Z76A 4XNMA 4DWHA 5CJQL 2AK4B 1D5BB 1G6VK 4H5SB 4L29B 3OR7B 5EU7C 3VMNA 4R8WL 4U6YA 2GJ6B 4G80A 2EIZB 2V17L 4M7LL 5MERB 1VFOA 1A6WL 4IS6A 1MCEA 2FO4A 4BSWB 3DETC 4OLZL 1WAAE 2IJ0C 3GRWH 1MQKH 5F9OL 3RDTC 4YDKH 4F15B 4L3AA 4YR6A 1D6EB 3MZGB 1A22B 3X14A 4OT1L 4LARH 1L0XA 2Y06L 1LO4L 5BO1L 2AQ1A 1U8QB 3SDAB 1JPSL 3G5VB 4XCNB 1HNFA 3W9EA 4WHCA 1T7WA 4JY6B 3MR9A 2ZOLA 2JJVA 5GRVK 1GOGA 5MHSD 3LZFL 1P7QD 3RI5F 1DL7L 4OGXH 4DZBA 3O3EB 1JTOA 1A2YA 4G8GE 3O6ML 5E9DD 4LAQH 2BXYA 5BRZA 1KT2A 1YNTB 4I5BB 3FO9B 1GC1H 1FYHB 1D5XA 1I1CA 3BXNB 4UIMB 3U0TA 2OJEA 5B4MD 1MCRA 4JR9L 4R4FH 4LPVA 3IETA 1SHMA 4L4VA 1MQ8A 2WBJD 4K3JH 3INUH 1S9WA 5GS1A 1ED3A 1QFOA 3VFRA 4F2MB 5HDQH 5D5MB 1MI5B 2GTZA 2IGFL 3FQRA 1UJ3C 3S8WA 1QG3A 5ENWB 3RP1A 5DTFB 3ARPA 3E6FA 1NLBH 1KCSH 5FYJE 1LP9A 1A1MA 1DE4B 1ROWA 4DVRH 3H2WA 4WCYH 1MCOL 3UMTA 1VESA 1LO0H 3QCTL 1KCVH 4ODVH 2YRLA 5F7HA 4WWKD 4IRSB 5F8RC 1VGEL 2P47B 4XMPH 3QHZH 1H5BB 4LCWD 2NXYB 4PRIB 2VC2L 1ZA3A 3FT4B 1A5FH 2VQ1A 3P4MB 5BVJA 3WKNA 1OPGH 1AO7E 3MC0A 4F7MA 3BZ4B 1XGPB 2QSTA 5DO2D 1NL0H 1XF3B 2ZJSH 3RNKB 5DHYB 1Y0LB 1FN4B 5GZOD 4KRPB 1VFUA 1KCRL 2CD0A 1NC2B 3DRTB 5D9SA 2EDBA 1IGIH 1YN7A 3DV6B 5TH2A 4F7TB 4NFCA 2DWEA 1F11B 5E2UL 5T1DH 5ICYA 2YUWA 1A3RL 3HI1A 2HTLC 4Y4KB 4ELMB 1RUPH 2MPAH 2YUXA 1T89C 1VCAA 2W9DH 5HDBE 5BXFA 5J1AB 3PQYE 4Q9CA 4HS6A 1MJUH 3NCYP 2YXMA 2F5AH 4IDJL 4Z0XA 3IFOA 2EDFA 4YHOH 1JYXA 4OCWL 5H8DA 4P2QD 4Q9QL 2XZQL 2ITCA 2XWTB 3T4AB 3QZWB 2V7HB 2R1YB 4TSAL 4O51B 1OGAB 1D5MA 4M02A 1QLFA 1CD8A 4ZO9A 4G9FE 4PV9A 4Y5XB 1MLCB 2F58L 4R6UA 3S34L 4JQVC 4R2GD 4U0RB 3QT2A 2X40A 3BKCH 4F7CA 5T5NG 5LJYH 5J13C 4FZ8L 2R29L 3ETBF 1ZT4B 3GSWB 3UO1L 3HTLX 4KRNA 3I50H 3RWIB 4ALAH 3B9KB 1IT9H 3ZDZF 1ES0B 2APTA 1GYAA 4O4YL 4HWBA 3VGAC 3LEXB 5HPMB 4YO0B 4A6YH 3QEQB 2IANA 3KPQB 3FCTA 4X8JB 5CJOL 2A38A 4N1EA 2CDGB 43C9B 1K8DA 1A7OL 3QWRA 4ODXB 2GT9B 3MXWH 1S3KL 4NNPL 5E94B 2VZUA 3KYNA 3T8XB 4KHXL 2VR9A 4O9HH 3GIVB 2VOTA 1AE6L 3MV8A 3TCXA 3FFCA 2CDEB 3MRIB 4P4RB 4HIJA 3QIUD 5DUPH 3S37H 5ID1A 4FQ2L 3MUGB 3TCLB 4O58L 2L4OA 2ZOKA 2PO6A 1JBJA 4X6DB 5DA4A 5F3HA 4PJGE 2NX5E 1N64L 1EO8H 4L4TB 1XIWA 5GGRA 2NLJA 1DLHB 2VR4A 3CH1A 1R5IB 3RRQA 1PLGL 2APBA 1GZQB 4FQIH 5D7JD 3SCMC 1PY9A 1P2CB 1AGDB 2XRAL 2ZP0T 2HTKD 3BT2L 4ZS6D 4PY8I 3IDYB 1A21A 1INEL 5JLZB 3ECBA 3C60D 1YJDH 2WK2A 5LGJB 4PG2C 2F54A 4LNRA 4KWUA 4NPYB 2VXTL 1ZLWH 2ICWB 3GHBL 3RIAF 3LY6A 3QUMB 1ZA6A 4CN1A 3TBTA 4RGNE 2PW1A 2GY5A 4NO0B 2PR4H 5DJDB 3DVNA 3T77A 2AEIT 3H9ZA 1NKOA 3ZYOA 2L0DA 2HG5A 5JO5B 3RKDC 3OV6A 3UTSB 1D9KA 4WJ5A 1ZEAL 3BN9C 4ZAKA 4NKOB 4ACPA 5DRWA 3FAXA 2OR7A 4IOFC 3RZWA 3VFMA 1KJ2H 1TTGA 4KRMB 3MRMA 4EUPA 4PV8B 2YD5A 1WEJL 5TF1L 5FF6B 5IVNA 2D4DA 1PKQE 4JM2A 4JG0L 4XVTH 3STZA 4MJ6B 5GSVA 4AM0B 1T03H 1TZGL 4UTBH 2HJLB 1YYLL 1AKJD 1UM6H 3O3DA 3D0LA 5EUOB 2V5MA 4Y4HC 4NC2B 3N1FC 2CLRA 1E4XI 1OOAA 4RA0C 1I3VA 1R5WB 2ADIB 3HE7C 1CL7I 3PDGA 3UTZB 5D1QC 3UTPD 1U3JA 1XGTB 3ISWA 3FZUD 2A9MH 2NMSA 1MHCA 1QNZH 4ONHB 5F44A 4H1LB 4NN7C 4WTZA 3FT2A 3G08B 4U3HA 1KB5B 4M6OL 1OP9A 4PRPE 1KB9K 4MCZA 1UXWB 2HFFB 2WAHA 1EFQA 3MNVA 5I1AA 4GFTB 4WW1B 5HVHC 3D48R 2HH0L 1GAFH 1C5BL 4GBXC 4U1NB 1FFPA 2PW2A 3LEYH 4HXAH 3U9UB 5BJTA 1PQZB 5ISZD 3ARBC 1FORL 1IJ9A 3FO1B 3T2NH 2W59A 2EH7L 3WFDH 4W68A 1KIPA 3LCYA 4NBYB 3TIDA 3QFJA 5T3XH 4NN6C 4JPKH 3BVNB 1Q1JL 4HJJH 2P5WB 5DD6B 5GGSA 4FXGB 4D0DB 3BI9X 2X89D 4O2CA 2BNRE 4MXVF 1ZTXH 2YZ1A 3NA9L 4KK9C 3DX9A 5DRXB 3ZDXF 3RWGB 5AYUH 3AY4C 4OV5B 1INQA 2HRLA 1FV1B 4YGAB 1YEKL 4HUXA 1E4XL 3BUTA 1HKLH 1J1OH 1T04B 4KJQC 4XPBL 4XX1E 3CFEA 2Z35B 5I9QC 2EC9T 4W6YB 2Z4QA 5I74B 4Z7VA 3ZKND 3P4OA 5BZDB 2UUDH 5SV3A 3ZT7A 1OY3B 3P73A 1KJVA 4FFVC 5D2NC 5GGVY 3O11A 1OAZL 2VXVL 2VITA 5DJZB 2F15A 3NPSB 3CSYA 3GGWA 4UT9L 4X6FA 1NCDL 5JOPE 3NN8B 4FTVA 2E7HA 3OG4B 1KLUB 1S7XB 3X12A 2OR9H 1BLNA 4I0PA 1HILB 4MAYC 5F9JB 4JRXB 1A14L 2B5IC 4TSCL 1BIHA 5JXEC 3NGBB 3P30L 3VGDA 5KZCD 1L0YA 2YOCA 4OGAD 2Q8BH 2NPLX 1F4AA 4WHDA 4M61A 3L5WA 1HSAA 5D7KE 3EDEA 3D3VD 4WNQA 4G7VL 2IH3B 5F1SA 4Z76B 4UB0H 1JZ5A 4XNMB 2Z92A 2Y07H 2X2YA 3R4DA 5C9KA 1YYMH 1KCKA 4U6YB 4DN4H 1SM3H 4HK3N 4RMSA 4G80B 1A8JH 3QI9D 3AS0A 4MD4A 2BRQA 2W91A 4H26A 3TO4C 4EI6A 4IS6B 3MMEA 12E8H 2BP3A 5D1ZD 2VWEC 1IRAY 5DXWA 3GMOA 3SQBA 4BA8A 2FO4B 2MWCA 1UVQA 4OIBA 2YK1L 4ZQKA 3WCYA 2V5YA 4KKNA 2CRYA 4WUUE 5DT1L 4YR6B 3SGEI 1S78D 3VWKD 1A6TB 3V5HA 1RUKL 3X14B 3VFNA 3GBNH 3H0TA 2W0FA 3IGAA 1R3KA 3TV3H 5AG9A 4S1DC 3W9EB 3MR9B 1G6RL 1ITCA 1OVZA 2ZOLB 3HMXL 3DVIA 3QCVL 4LOUD 3RZCA 1PAMA 1V7MH 2J6EA 4JKLA 4QRRE 3EJZD 4U1GC 4APQD 3OQ3B 3O2WL 4DZBB 2FHCA 4HIIA 3QEUA 1A2YB 3N1GC 4RAUA 3A67L 3HHRB 4Z5RA 5BRZB 1KT2B 1G7HA 4Z7NF 4JB9H 3HZVA 1D5XB 4JPWL 5JR1L 1XMWA 3U0TB 15C8H 2OJEB 3BD3A 5DJ2A 3WS3A 2HT3C 4PLOB 5DJAA 3QA3A 5EN2A 4P5TD 5JZ7C 4HMEA 3IETB 4R4ND 4I13B 3W2DH 4L4VB 2B1HL 2VDLL 4XC1L 4J2XA 3KYKL 5FUZL 1S9WB 5GS1B 1ED3B 1IZJA 3VFRB 3UJTH 1GVIA 3VD4A 4FFWC 2GTZB 3E2HB 3FQRB 3JSSA 3MXVL 1KELH 4LSRH 4R90L 1LEIA 2FGWL 1Q8MA 2IBZX 1QA9A 3GSRA 5IFAH 3OF6D 3E6FB 1LP9B 1A1MB 4PJDF 5L2KE 4C56A 3RJQB 4YHKH 5LAXA 2NTSP 2MKLC 25C8L 3DNKA 1U8HA 2EIBA 1OTUD 1I1YA 5GJSH 3TVMA 3DO3A 4WU5A 3CUPA 1YZZA 3HG1A 4G6AD 5DD5L 2OZ4L 5CEZD 4OCSH 3BKJL 1MCFA 2BNQE 2VQ1B 4PJ8A 4FQJL 1BZ7B 1UEYA 2HKFH 4F7MB 5C6WH 1YY8A 1P7KA 2FNBA 4PTUA 1LO2H 4YJZL 1I3GL 1UH3A 3HC4H 4DQOH 1YY9C 2CRIA 1KXQE 4AL8L 1PG7H 1BX2A 1XR9B 4F58H 3RWDA 5B8CA 5D9SB 5E8EA 2PTVA 1YN7B 2IAMA 1B3JA 5TH2B 2DWEB 3DI3B 2NYYD 5FHAL 5B38A 4AEFA 3WD5H 2C3WA 2I26N 3MUY1 5ICYB 1CXFA 4FG6D 3HI1B 4OF6A 3V6OC 4DOHB 1IBGH 2FLRT 4NQSA 3PL6C 5BXFB 2H26A 5F6HI 4UZGA 1VERA 2QHRL 4O5LH 3O2VH 4J1UA 4BYHA 3E1F1 3MCLL 4Z0XB 3IFOB 4WI7A 2JIXA 5IWLC 4UT7L 4OKDA 3IFLH 5ALBH 4R97C 2ITCB 3QULA 1EO7A 1TIUA 1DQTA 4X7SH 1GPOH 1MJ7H 4OF0A 1N0XL 1D5MB 1HOCA 1QLFB 5JTWA 1IQWH 2IMNA 1U0QA 4PV9B 3I75A 1YEDB 3VWJA 2X7LA 1P4IH 4F7CB 3RL1A 2DLFH 5BW7C 3W11D 4PGCA 3VDCA 1FGVH 1U8NA 5GS0H 3NCCB 3OAZH 1E4KA 4PR5A 4PY7A 1UACL 4XC3L 3D2UA 1MNUH 2FX9H 1RZGA 3QUXC 4YBLC 2IANB 4N0UE 3FCTB 3MV11 4K3GA 3GMRA 5EU6A 4YFDB 3VXNA 1RVFL 3MNWA 4LCWE 1K8DB 2OTUA 4JFQA 4LRNL 4NFDA 3K80A 1QSFD 3BPOC 4DGYL 5BOZG 5ICZA 3WFHA 3RDTA 3KYNB 4X9IA 3RA7L 3P4LA 4M48H 3MV8B 2O26U 3FFCB 4HIJB 5E8NA 2HFEA 4LHUD 4OLYL 5ID1B 1KC5L 3F8UB 4D8PA 1JPGA 5FGRA 3UTQA 1WZ1L 2ZOKB 5F3HB 4GW5A 1XIWB 3MACL 3P77A 5GGRB 2NLJB 4OZHB 2CH8A 3CH1B 5GPRA 3WS6C 4KK6D 1WBZA 4JKMA 1EA9C 5I30L 1W72H 5DK3A 3ARZA 5I2IA 2E9JA 3GBML 4UNVA 5IB5A 3EJYD 2J5LC 1A6UL 3GSVA 3ECBB 5IEHA 1HHIA 4POZD 4TTDD 5CSZA 1FL3A 4LNRB 4U7SA 5JW3L 1HHJA 1HI6A 1UJ3A 5K9QI 5GGUA 2OCFD 5EOQL 1NDMA 3QDMA 4P2RD 1ZA6B 1C1EH 2ATPA 1DBAL 1WGOA 4XXCC 3TBTB 2PW1B 2X4NA 2X05A 3LKSA 1PY4A 5EZJA 5JIPA 3DVNB 4P3CH 4XPTH 1KFAL 3T77B 3ZHLA 5GGRY 3VXUE 1DBBL 1BF2A 4OBRA 1D9KB 4WJ5B 5JDJA 4M7LT 4G3YL 4ZAKB 2AKRA 3OKOA 5IGXH 5DRWB 3DMMC 3Q6GL 5F93C 2VH5L 5DEFA 3VFMB 1PJ9A 4JFEA 5EOTA 1YPZA 2VZSA 3MRMB 4EUPB 1HYSD 3Q5OA 3K46A 4P9MH 5HHME 4JM2B 4AEHL 3STZB 5GSVB 3LKRA 5EA0H 2NY3B 4XB7A 3EDJA 4X0KB 3O3DB 5J6HA 3QIBD 4QTIH 2CLRB 3FO0H 5HD8D 4N5ED 1S9KC 2QLVB 5C0AA 3ZT5A 3QQ9C 1BWWA 3FB5A 3OKDA 1N7MH 4P59L 4V1DD 3X17A 1CFQA 4NQDA 1EERB 4JFDD 4XMLL 4Z0BH 2H32A 4FQXC 1EMTL 2R9HD 5M7QA 1T89A 5HTSA 1MHCB 3U7YH 5E95B 5CBEA 5TDPA 1CG9A 3RFZC 3FT2B 3QUMH 5KOVC 2QQQA 3QH3A 3ZKMC 2ZUQB 1EJ6A 1Z0MA 4KMTH 2IBGA 2F8XC 1UCTA 2BDNH 4MCZB 2DQFA 3MNVB 3SOBL 5I1AB 1ACZA 4NM4H 2AJSL 3BEWA 3B2UD 4P99A 3BYYA 3QEGL 1FFPB 3GNMH 2PW2B 3C8KA 3V6FA 1G84A 5BJTB 1MAMH 1EVTC 5D72L 1HSBA 4RISH 3Q48A 4JQVA 1KIPB 3TIDB 3QFJB 3PDOA 4MNQD 1AH1A 5GGSB 1Q72H 4O2CB 5FECA 2APVA 2ESVA 3DX9B 3D9AH 4TNVK 4KVNH 3KXFA 1INQB 2GJJA 2AABL 4KPHL 4HUXB 1T2QH 4NRZA 1P84J 4PJFA 2BVQA 3TP4A 5J12C 2Z4QB 4Z7VB 3P4OB 3L5XH 3AB0B 5D2LA 4MXVE 1MIEL 3ZDXE 3P73B 4NQVA 1KJVB 5SWZA 4JFXA 5TE6H 3O11B 5L9DL 3NAAL 2VITB 4TOYH 1KB5H 2WBJC 3CSYB 3GGWB 5JHLL 4X6FB 4FTVB 2XI9A 5C71A 5GGSY 3X12B 1BLNB 4I0PB 2RAMA 4KZDL 1N4XL 2X44D 3SCMA 2YKLL 4M61B 3L5WB 1HSAB 3VXRD 1YECL 4WNQB 5DD3L 4R7NA 2ICEA 5DK2A 1F13A 1F6LL 3AXLA 2E9WA 1MCHA 3LVEA 2Z92B 1CFBA 3HCVA 5KG9A 5D7SL 4PG2A 4PJCF 1CLYH 3F12A 3WIHH 4L3ED 1RURL 1DBJL 4MD4B 3HNTH 2R2EB 4H26B 1FVDA 3MMEB 4OUOA 1WAAA 4TSBL 1XCQA 3GMOB 4HQQL 1HQRA 3FJTA 1UVQB 4ZQKB 2XXCB 5AUMA 1JNLL 2ZPKL 4XP1H 3MROA 5CZXC 5BV7B 3JWDH 4K7PX 2Y9RT 4FQ1H 3V52L 3V5HB 1RJYA 3V5KA 5GZOC 1OLZA 5ANME 3VFNB 3BX7C 3H0TB 2W0FB 3UJIH 3IGAB 3ZE1F 4YHYC 1R3KB 4YFEA 5TE7L 3QXTA 3QO0A 1CICD 3RZCB 2YSSA 3GK8L 3SDXF 3L95A 1EHNA 1DQLH 5C0ND 4HFWA 1LO3H 3MJ8A 5CUSL 4HIIB 3QEUB 1TPXB 4RAUB 4KKBD 3BGFB 4YHZH 1XF1A 4Z5RB 5GHWH 4RWYH 5DHVA 2OM5A 1G7HB 2AK4D 1F4HA 3MV7E 3HZVB 3KJ6L 3WS3B 4HULB 5DJ2B 3AFLA 5DJAB 3QA3B 2FBOJ 5EN2B 1F8TL 5CS7A 5KVDL 4HCRH 4P57A 4LCCC 3HE7A 4B5EA 4DUVA 1AGFA 5D1QA 5C07D 4OD2A 3HMWL 1TDQA 3CDFA 5C0JA 3WUZA 3D5OF 3QXAA 4Z7NE 3GI8L 3DX6A 3BH8A 1QA9B 2CIKA 3GSRB 4AZ8A 4UAOC 2YC1A 2IPUK 5DEGA 1NC4D 1RZJH 4YPGA 4C56B 5LAXB 1M05A 1U8HB 3MA9L 4XVSH 5ID0A 5E8DH 4NHCH 3S88H 1I1YB 3TVMB 5FCSH 5MP6H 1KLFA 4Y5VC 4N0YH 4WU5B 3CUPB 3HG1B 2XT1B 3LOWA 1AO7A 4Y88A 4HIXH 3FRUA 1JGVH 4PJDE 4GBXA 4K8RH 1NBVH 4PJ8B 4QRQA 3C5ZD 2WLZA 4KQ3H 2JCCA 2XYCA 3ARBA 4I2XE 5D7LB 4YWGH 3PV6B 1YY8B 1P7KB 4I3GA 3WUWA 3BPLC 1GOHA 2VR5A 4PTUB 4MA3A 4I3RH 2NR6C 1D5ZA 4PJHA 2FR4A 4M00A 3QISA 3O6LL 2XTJE 4P9HH 4K9EC 1F4WL 1BX2B 3RWDB 4N8VG 1AD0B 5B8CB 3AY4A 2HRPH 5E8EB 4U31A 3QIUC 2IAMB 4PJIA 4X7DC 4AK1A 5I71C 5B38B 4U6VH 4MQXD 4UOJA 1P4BL 2VDKH 3SJVA 5JXAL 3VH8G 5F7DA 1I85C 3GM0A 1MAKA 5C7XL 2Z93A 2HKHL 2LTQB 4NQSB 4OIAA 5EUKA 2H26B