1T2QH

The crystal structure of an nna7 fab that recognizes an n-type blood group antigen
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
217
Chain Sequence
b'EVQLLEESGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCARNRGYSYAMDSWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab NNA7 Heavy Chain
publication title Crystal Structure and Mutational Analysis of an Antibody that Recognizes an N-type Blood Group Antigen
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 217
sequence length 221
ec nomenclature
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t2qH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t2qH01
3KJ4C 1W72B 2IJ0C 3K0WA 2W0LA 2Z92A 4N5ED 5F7FA 1MFAL 4WHTA 2E27H 2CO6B 2GY5A 4YEEA 5KVDL 4PRAA 1QO3B 4A2LA 5HYIA 1QPXA 4HJGA 4IRSB 2W60A 3QUZC 2QQQA 2V5SA 2C7UB 1P4BH 5IB5B 1OARH 1LO5B 2A9MH 2VLKE 3PIQA 3RVTC 3QISA 3BW9A 3DUSA 2IBZY 5JPNA 5DQDH 2OL3L 4JREC 1MNUL 2IAND 2XN9D 3DMMB 5DK0A 1ZV5A 4OAWA 2O5ZL 1AD9A 2CXGA 1NSNL 1UA6H 3EAKA 4Y4FC 4L3EB 2ARJA 4NSKB 1RJZA 2ED8A 1DBAH 3C5ZC 1C7TA 4M5YH 2DJSA 1YNTB 4HGWB 5IVZA 2BSTA 3V6OC 1DQJA 3KPNA 1RJYB 3MOBL 3PWNB 1F02I 3EDFA 4Y5VC 1DCLA 1KUMA 4OGXH 4W4OC 3SE3C 1S9VB 5T3XE 3T2NL 4O00A 1WVZA 2X9WA 2BFVL 1EHXA 1JBJA 5FGBC 1DBKH 5EUKB 3KPSD 3QEUB 3IT8D 2DICA 4OZHB 1R3KA 1BM3H 1MJJB 1FV1A 4UBDD 5I71B 4C54A 3DGGA 4HH9B 4AIOA 4Y7MA 2ICCA 3LQZA 4NO5B 1A6AB 1GOHA 4JLRB 3G9VA 3EO1A 1YEEL 1YEIL 4MD4B 4OCWH 3RL1B 1VEOA 1X6LA 2R4RH 5K9KA 4GG6B 4O2EB 1FN4A 1FL5A 3VFNA 1I3GL 5D1QC 2D03H 2C3VA 2B39A 2JIXD 5FA4B 4W81A 4D8PB 3HR6A 4W6WB 5I0DA 2OTUA 4G43A 4LRIA 5C0BA 3SDXB 1MCWW 2Z8VC 5T33L 5IW3A 3LKSB 3PP3K 3VW3H 4S11A 5DQJB 1ADQH 3RY4A 2DM7A 2K1MA 4BSVB 4H0IA 4OGAD 3VXRA 4DTGH 4F58L 2Z31A 3KPPB 4EOWL 4P2QB 1JN6A 1KV3A 5D93C 3QI9D 5E2UL 1T5XB 5J6GA 2D0GA 2YD6A 1G6VK 1AHWB 2IPUK 3U0WH 4J4PC 2HT2D 1MREH 1QEWA 4U1IB 5IOPB 4PJ9D 5DJ2A 4Z7QE 3KLAA 1FG2A 1MWAA 4LDOB 2D31B 3PNWA 4FQXA 2D7TH 3PQYE 2EE3A 2A77H 4H20L 3D2UB 4JM2F 1OOAA 4HIXL 5C3TA 3RGVA 5I17B 3ZL4L 4I0CC 3O81A 3DRTB 4OLYH 1Z3GH 2QKIB 1N64H 4NN7B 5DJYA 5DYOA 5HDOA 3OAZK 1PX3A 4WU7B 4YGAB 4L4JA 5D7IA 5EIIA 3BESR 3PL6D 1S7RA 1V7NL 1ZT1A 2EKJA 5AG8A 5DMKB 3NH7L 5HGDB 4YPJA 5IW6B 3NACL 4O4YL 4GKNA 2D9CA 5D71H 4YR6B 3BJ91 4ZXBD 4KUCF 3C8HA 5ID0B 3QWOB 4LVOB 1E4XI 2ZOKB 3HAEA 3HI5H 4JY6A 2VXTH 1HILB 3AU1B 1G7PA 3ZZ1A 2CIIB 2NR6C 2A6KA 2FEDC 4PRDB 3WD5L 2V9RA 2WBWB 3MV01 4D0BA 1N5YH 1ES0B 3BXNB 1QSFA 5SWSA 15C8H 2VLRA 4QHMA 4K7FB 1QACA 4NPYB 2VB5A 3QUZB 1QSVA 3IKCB 4U1SB 2D4FA 3MO1A 4Q6IA 2ICWI 1DE4A 4UILH 1A1MB 2UV3A 3CCHB 5J13B 1ODAA 3F7QA 2P1YA 4YUEL 3QG7H 5D7KD 4QHLB 1BP3B 2WBJD 3IETB 4FQ1L 2ORBH 3JWOC 5LXGH 3MRCA 1A4JA 2YD9A 3QUKB 1PDKA 4RX4A 4EVNA 1YA5A 2DDQL 4WWKA 1T1ZB 2VDML 3NVQA 4M48L 4U1KA 3BDBA 5F9JB 1ZHKB 5SWZE 3WN5C 3QUYA 4JFDD 2OZ4H 4LPCA 4ZNEE 1KXVC 4FZEL 4GKZA 2AEIT 1IC7H 2H1PL 4QHNB 1OB1B 3DX6B 3HMWH 2DN7A 1NAKH 4XPAL 4GW5A 4FXKB 1IEBA 1MCQA 3L95B 5C0NC 2R4SH 4Q9RL 1MRCH 4PB0L 2I60H 2Z91A 2VUYA 5DD6A 3UZEA 1B0GB 2VDQL 2FECL 3MJGX 3THML 2PUQT 1OTUD 2VXVL 4MZ3A 5L0QC 5TDOB 4LQFH 1TZGL 3GI9H 4LPVA 3VWJD 3WIFB 3NOIA 3TN0A 1NBYB 2ADGA 2FYYA 3GSQB 4NRYB 4ZMAT 2NZIA 1CK0L 2OI9C 4P2CG 3BP7A 4JRYB 2VOTA 1KELL 4KK9D 4XNUH 5LGJB 2HT4C 4AEIH 4QOKB 3D18B 3TIDB 5BOZG 2A83A 3ARBD 1U6AH 4EI5A 1RZIB 5JNYA 3E6FA 3ES6B 3QNXA 5DLML 1SEQH 2DLTA 4G9DB 1EVTC 5GRYA 4AENB 5D1QB 5SWQA 4D0DA 3D3VA 3T1FA 1ZSDB 3UYRH 3F5WB 3QIUD 3QI9C 3SKOA 1JWMA 1VFBB 3SOBL 4I9WE 4B50A 4HK3J 1DANT 1TZHB 1J0YA 4NO3A 2GT9A 5E94A 1I7ZB 4LHJB 1X4YA 1FZMB 5IP4A 2GSIA 1F42A 2NXYC 4S1DC 2YRZA 3WE6B 3V95A 1LWRA 3D85D 4ODBD 5I16B 5JW4N 5ACLA 1JNLL 5I1GL 2XTJE 1FFPB 1YUHB 1SM3H 1KLGA 2B1HL 3L3HA 4LSUH 5GISH 3TZVB 2IMMA 3QEGL 4OZFG 3SBWA 3TFKD 1P6FA 3O9WA 3QEQB 4D0CB 1N6VA 5CGYC 5DUMH 1J1PH 2AI0L 1U8NA 2AJUH 2F54B 1BQHB 4E41A 25C8L 4X9GA 2AK4D 5C0IA 4E42A 5HHXH 2AQ1A 3MXVL 3A6OA 2XA3A 4QYOB 4K23H 1MVUA 5BS0E 1KOAA 2NPLX 4ZAKD 1WWCA 4PJFE 4CU8A 3EOTH 3OGOE 1ND0B 3J8F7 1VADB 4O51A 5JOPD 1LEIB 1MCHA 1P7QB 4IRJC 3H6JA 4TOYL 4H8WL 4UTBL 2C5DC 4GAYB 1C5BL 1NFKA 3VGAC 1WZKA 2BERA 5E9DD 3DX9B 4DVRH 3KG5A 3CSYB 3V4VH 4XVUD 3QUMH 5LAXB 3FOLB 5I2IA 2H2PC 4HUXA 2IANB 2XN9B 3TESA 5I66B 3S88H 4AZ8A 3IDMB 2X6MA 1EJOL 1U8HA 2VISA 1MJUL 3GSWB 1R5VA 2ZCKL 2DMCA 2C3GA 5SX5H 5EO9B 1GGUA 1X5FA 1T6VN 5C6TL 4UDUB 1GHFH 1JFQL 1NCAL 5J0BA 3T0XA 1F11A 4RMVA 5C0BD 3SE9L 2AQ3A 3O3EA 1YJDC 4HC1L 1EO5A 4CW1B 4OTXL 4ZS6D 4OCYL 1S7WB 1FH5H 4KWUA 3LRSA 1RFDH 3VXRD 4FFWD 3KLHC 2Z31D 3WN5B 1ZWIB 3R0NA 1UT9A 3BKCH 5B3NA 3K1KC 3LKPB 4L8CA 1CR9L 3MACL 3T0EA 1XF4B 2IMNA 3D0VB 2NY5H 1U8LB 4MA3B 4NNXB 4TVPD 3SHSA 3F7VA 4YFDB 4L3CB 3ARBC 3TT1L 4OLVL 3RWGB 3B2VL 3LS4L 2FWOB 1LEKA 1DQML 1TJGH 3WO4C 3PWUB 3LEYH 4UOJA 3TJHC 5DJ0A 1RZFH 2HT3D 4X4MA 5HGAA 3MNWB 4UT7H 4ALAL 3GSXB 4OT1L 2JIXB 1DBJH 5L8KB 4NRXA 1WFOA 2ZJSH 4UU9A 3OSKA 5L88H 5B39A 4HWEL 2CDGA 1GGYA 3WXWL 1KENL 4OB5L 4KKLD 1KTLB 3O3DA 2A9NH 1TZIB 5ICYB 3O41A 1Z9LA 3O11B 1GZQB 2QR0A 43CAA 4RGND 3EYQC 3MR9A 3X12A 1KJ2H 3EYFB 3IU3B 4NWUH 4MX7A 3QI9B 1PG7X 1YDPA 1C1EL 4V2CB 2NY1D 1DTUA 1KPVA 1J1OL 1FDLL 4Z7NF 3S9DB 3BDYH 4PJ9B 4X7TA 5C3LD 5IBUB 3CDYA 5FO7B 3FQWA 1QSFD 4HUWA 3IDGB 1IAMA 2NXYB 1KCUH 1JNJA 4H5SB 2EXYC 3IDXL 1RUQH 4U3XA 5HXMA 2Y5TA 3SCMA 3FB8B 2NY7L 3BN3B 1FL6A 5EIVA 1GJIA 3S4SA 2YBRB 5FK9B 1BD2A 1FORL 3QCVH 1KB9J 3C5SB 5LBSH 4QRSB 5ICZB 1M71A 4XMPL 3K4DA 3RTQC 5CJOL 2I26N 4N0UE 5L8JB 3CLFL 4JZNA 4X7CC 2R0KH 4WI3A 3QA3A 3ARFA 3PL6B 2ZG2A 3CFKB 2X89A 3JV5A 4P4KD 3H9ZA 5FKPA 4GAGH 5T3XH 5D1ZD 3QUXC 3QB7C 2IH1B 3QUYD 4OF8A 1FSKC 1YQVH 3AXLB 3X11B 3BH9A 4NGHL 4NFDA 4L9DA 4ZXBB 5F7NC 3QDMA 1OGAE 5LJYH 2WQ8A 3OX8B 3CFDB 2ICWJ 4PJ5E 3ZKXB 5IUSA 2ATPB 3T3PF 4K8RH 3RJQB 5C0AA 1I8MA 2YA1A 5DTFB 3LQMA 3S36L 3ARSA 2AEPL 4P2OA 3ZHDA 5C0DB 2YEZB 3Q1SL 1FLRL 3FMGL 1D5BA 2EIZB 5JMRA 1HSBB 4X0KA 5T1KA 4JFZL 2I5YL 4AQ1B 4XGZA 1A6TB 1ZAGA 2A6DA 2F53B 5I74C 2LE9A 4MVBD 3IU4L 3V5KA 5A16B 1LHZA 4F7TB 3GNML 4Y2DA 3QJHA 1I1YB 1NEZA 2APTA 2ENSA 1AFVH 5DVOA 3U4BL 2G2RB 3ZLQC 3W2DH 4EBQH 4K3DH 1RUMH 1F2QA 3L5JA 2JJTC 5EBMA 3KHQA 4JFYB 2GHWB 2FX8L 3KVQA 1G7MA 2H32H 3W5NA 2BMKA 1QNZL 3KYOB 4YX2H 5K33A 4JFDB 4ZG1A 4WY7L 3D3VD 3BRFA 2HRLA 3VGBA 3KR3H 3KYNB 1QVOB 4OZGE 1N6QH 1XGUB 4HWUA 4FXGA 4LCUA 4JCLA 5DR5L 1VFOA 4S0SD 2H2SD 3V6BR 4Y5XA 4FQQB 4XCYA 4JM4L 4X6CB 1OWRM 2BY0A 5J89A 2HMIC 5L2JA 3I6LE 4EN3C 2R0WH 5ADOL 5JW4Q 4XWOC 3VWJB 4G8GE 4XP5L 2OTWB 3GSVB 1B9ZA 1WWBX 4FTVA 3L3KB 2FJFB 4LK4A 4ONGH 1I3RB 1JRHH 5CMAB 1E28A 2AJVL 5I1LB 3ARBB 3GEWB 3P4NB 5KSAC 3O9WD 3U0PA 4S2SB 3B6SA 3BUYB 1IQWL 4YAQB 4U1GB 1WC7A 1KJMA 2OCFD 3T3MF 2OBGA 5EUOF 3W9DA 4CJ0A 4E41D 3MV11 1U92B 3UTQB 3X14A 2HKHL 4KGJA 4U49A 2X4RA 1YEHL 2Q7NA 4Y5VA 4W4OA 3DGCR 3NAAL 5CD5C 3GGWA 1IGML 3I84A 5JO5A 4WFHD 4G7VH 2NYYD 3IXTB 4ZFOA 4Q0XH 1RZJH 4JO3L 3FAXA 1SEBA 3VFVA 2GYSA 3DETC 1CGXA 5D7LB 5ICXA 2W60B 3QDJA 1QBLL 3ROOB 4HULB 4NQDA 2GITA 4BKLB 3L7FA 2ICEB 4XNMA 1F13A 4JDTH 3VFWA 1AGFA 3D85B 3I75A 5D72H 2XQYK 5F7MC 3T0VA 3DECA 3OWEA 4G8IA 4FNLH 3QHFL 3RWDB 1LGVA 1A6UL 4IOFC 4EUPH 2YA0A 4M6OH 4JQXA 5IFAH 1MRFH 4HKXB 5T5NG 5L2KD 3C6SA 1OD9A 3F6LA 5ID1B 3WL9A 4YXLL 1TQBC 3CDFA 3EUUA 2QJDA 1RJZB 3BP6A 4GUPB 4F37F 4OKVA 2VDNL 2AK4B 3SDAC 1U3JA 1T20A 4F7MB 4RGMB 5E2VL 3RTQB 4LLUA 1XF3A 2NY0C 3KPNB 3QAZC 3DJ9A 3MBED 2OSLB 4ZAKB 1JRHI 3D1MC 5JPMA 3IKKA 2VR4A 4R3SB 2BSRB 3DXAA 3E8UL 4N5UA 1KB5L 1QRNE 3L3GA 3V8CA 4IIQA 3MLVH 1FZKB 1EGJA 2PNDA 5KG9B 4JFHE 5DJDA 1FSKB 2Y6SD 4AG4H 4XHJC 4YBQD 3AB0C 5DVMA 5JXAL 2OR8A 3HZYB 5E9DB 3T0ED 1R3KB 1R3IH 3ULVH 1NAMH 2QQKH 1ZA6A 4JB9H 4ZYKB 5A3ID 4NQSB 1TVHB 3V0WL 3T65B 1XCTA 5ITFA 3W9EB 4MSWB 1JF6A 4CADB 3AS0A 4JVPA 4ZDHA 5K9KB 3C2SA 1A1OB 1FL5B 1NGXA 3VFNB 4P3WA 2UUDK 5EA0H 5HJ3B 3SPVA 3CLEH 4RFOL 4C56A 5TQ2H 1OAXL 3BVNA 2OR9H 4JRXA 3RIAK 3RU8L 5C0BB 4XVJH 2A38A 3GRWL 1XZ0B 1OD7A 3CMOH 4M00A 4ZUUA 3S35L 1HDMA 1L7IH 4NUGH 3FONB 5C08E 1N8ZA 1X5AA 4APQA 3VXRB 2Z31B 2UWEF 2GKIA 1NDMA 1ERNA 1DZBA 5EZLA 1T04A 4YNYA 3MRLA 4P9HH 3I2CL 5M7QA 5DURD 5ILTH 2P8MA 2YMXH 2DQIL 1QEWB 1V8HA 4XRCA 3WUZA 3MNVA 4ODUA 4ZQKB 4S1SL 1MWAB 3DYMA 3V6ZA 1S3KL 2AJ3B 3DRQA 3GBMH 4WV1C 5T5NF 3PNWB 3VXME 3C08L 1PEWA 1ULVA 4EDWH 1FZOB 1M7XA 3KPRE 4L8SA 1KSRA 3DNKA 4EN3B 2ZOLB 1HHKB 3ZTJH 1NGZA 1BOGA 3JV4A 5EBLB 5DVLA 2YPLB 3LEVL 4QTIL 5EPMA 3I6KB 3RWFA 1NC4B 4NKDB 3C09C 5ESAB 3UAJC 2NW3A 1UZ6F 1FNEA 1M05B 3MLSH 3MROA 4LFHD 1NL0L 3OHXA 5F9DC 2VWEE 3IAQA 1I9JL 5F3HB 4KJWD 4J1UA 1H3UA 3RIFK 2XOTA 3SDDC 5MEQA 3ARFD 1SY6A 4W6YB 3E0GA 1UJ3C 5B3JF 2FLRT 3NFPA 2F58H 4ETQB 2WIIA 4RGNB 3VG0H 1X5LA 5ALCH 1WQVT 1R3LB 5E95B 4EI6B 1N2RA 1UH2A 4NOFA 2HYMA 2VLKD 4L1DA 1G6RA 3LZFL 1VKXB 4LLQB 4DAGH 3QDMD 2NY1B 1I1AC 3S5LG 1IE5A 4M61B 2X9XA 3CPLA 1WSST 4HK0A 4DN4L 5DVNA 3U7YL 1F8TH 4D0BB 1GAFL 5C0AD 1RUAH 2J7LA 4UV7H 4KAQH 4DW2L 4QHMB 1NCWL 2F74A 3MLUL 4KDTC 1FIGH 1TJIL 2ZCHL 4U05A 3R0MA 1YY9D 5T1KD 1K6QH 1AO7D 2C4XA 2OK0H 5AZ2L 2R1WA 4TPRL 3DV4A 3O45A 2XY1A 3NIFF 3OR7A 1K3IA 3I9GL 3MLRL 4POUB 5IG7A 4KVCH 3MRCB 3CFJA 4HKJA 3BT2H 5DJ8A 3HI1A 3BGFC 3M07A 4KJQD 1Q94A 4P4KB 2C3HA 5CEYA 3GSRA 2HTLD 5IROC 5D1ZB 1NCCH 3LB6C 4ZUVA 1A22B 3GMOB 3QUYB 2J88H 4GKZB 5I8KL 4P48A 1OGTA 2IPTH 3SDAB 4NJ9H 1HH6B 2YUVA 4U2YA 4M7ZB 1N7ML 4BZ1L 4AIZB 1H8OA 2NY0B 1IEBB 4QTHB 3PP4L 3QAZB 4BK5A 1ZHBB 2VDKH 3ARUA 3DSFH 3EFFA 3NTCH 4TUOB 1J5OL 1FYTE 1KB9K 3CK0H 4WW2B 5GS2D 3G5YB 3MV7E 5DD6B 5F1NA 3NN8A 4YE4H 1L0XA 5IMLA 1I7TA 3L5XL 1A3QA 4LSDA 1LE5B 3WKNA 3OGCB 2ADGB 1CFTA 4FTVD 2GAZA 5JA9A 3ZKMC 1JVKA 3BP7B 1RK0B 3K1DA 2XWTA 5TE4L 1XH3A 2XWBA 4ZTPL 3QHZL 4L8BB 2KL6A 1GIGL 3P40A 2J6EA 4K7PL 5MI0C 1FNLA 3STZA 3TBSA 2R23A 3O3UN 4OGYH 1M7IB 3GHEL 4QRPE 1PLGH 3KJ6H 4XCCH 4KTEL 1IAIH 5HPMA 4ZUSA 1KTDA 5CIPA 3FB5B 2VXQH 5FHBH 4XPTL 3N1GC 2NW2A 3UBXG 2E7LC 5E5MB 2I24N 1F4XH 1BFVL 5FHAL 1UEMA 1KGCD 3NZ8A 1PBYA 4NO3B 5FB8A 4FFZL 4LLYB 1LDPL 4X7SL 4DUXA 1M7DB 4R8WH 1N26A 3QDJD 2BNRB 5GRVL 2ID5A 2IBZX 4NKOB 4NQDD 3BMWA 1G7LA 1EZVY 5AWNH 3DIFA 3VH8A 1AGDB 4U6VH 5HVHC 4JPKL 3PGFH 4RWHA 3FRUA 3H9SA 1KLGB 4UDTA 3FOMA 4DVBA 4LKXA 5D8JL 3QH3B 2EC9T 5HHMB 4P4RA 1DQDL 2V2TB 3CAFA 4JO2H 5GGQL 2WIMA 2DMKA 4AMKL 3SQOL 2IFGA 1PKQB 1A9BB 1YEFH 3EGSA 4PJCA 3VFOA 4U7MA 2PYED 3K4AA 4E41B 1CD1B 5FM8A 1AD0A 4OZFH 1T1XA 3REWA 4QXTB 3JVGC 1TMCB 5FDYA 1FGVL 1A1NB 1FVDB 1LO0H 5GPRA 5GS1C 4MXVE 5I1HH 5EOQH 2B4CH 3GO1L 3DXAD 1IGCL 4Z78B 1NC2D 1UJ3B 4HLZH 2R56H 3I3DA 4LRNH 4O51B 1JGDB 4GMSH 5J6HA 4XNZC 1WAAF 1HHIA 2DQUH 5I30L 1ACYL 3U4AA 3MMEA 1T1YA 1BJ1H 4ZD3L 4TUKH 3CH8A 4MA1C 1RQ5A 2CRMA 1LK3H 2XZCH 4PJ8C 2MJWA 1S7SA 2YPKB 5IFHL 3HUJF 2Y1VA 1XGPB 4HUUB 1IKFL 4PLJC 4HUXB 2FIRT 5L2KB 2PXYC 2HTKC 2BCKA 4NT6A 2X4OA 1BIIB 3IYLW 2VISB 4HEPG 4U0RC 5CUSL 2AV7B 1QKZH 1W0WB 5J11B 1U8JA 2WUCL 1D5IL 1FGNH 4C56D 1U3YA 4JM2D 3ARVA 1MSPA 1LNUA 5FUZL 3C87A 3MBEB 3HZKA 3DBXA 1EAPA 1YEJH 3BGFB 4W6XB 4LCWD 1JTOA 2DQFA 1ED3A 1MY7A 3LRSB 4APQD 1OSZB 4LCCC 2DWEA 5HGHA 1UCBH 1PEZA 4O2CB 3W5MA 4PRIE 4P23D 4AEHL 3BHBA 4KUCD 1XAUA 2XWJB 2A0LD 3TT3H 3U0TA 2P8LA 2X2YA 2VZ3A 2P47B 4K2UL 1ZLSH 2A6IB 4R4BA 1EMTL 5DT1L 2DTML 1T6WA 4NQUA 3GKZA 4XXCC 4GQ9L 4IJ3C 3SKMA 3K3QA 3I6GA 2FBOJ 2LU4A 1DL7H 1HEZB 1L0QA 4X6DA 3FB7B 4G6FB 3HE6A 1KEGH 1MRDH 5IWLC 4YHPA 3ESUF 4F3FB 3IJSA 5KANG 3CVHB 2CDGB 2FD6L 4ONFL 1TCRB 1KFAL 3BWAA 2EZ0D 5CEZD 3O3DB 5MI0B 1S78D 1ZHNA 3M8OL 2QR0B 1J1XL 3D5OF 2ATKA 3X12B 3MR9B 4AEFA 4Y19A 1A6VL 4I3GA 1IILE 4JR9L 4Z7UF 1HSAA 3RBSA 4HW6A 5DURB 3VD9A 1JIBA 5F6HJ 5F7YC 5EO0A 4BK4A 5FGRA 3IB4A 3MV8E 4QXUL 1B4JL 3LS5L 1RAMA 4GBXA 3B9EA 3FQWB 2X05A 4OZIF 4HUWB 2DQGH 4NQVA 1WBXA 3VG9B 3PDOB 3QPQC 3SGDI 1G7IB 1FL6B 3GMNB 4NZJA 5JDSB 1CI5A 5IBLD 2CKNA 4K71C 2QQLH 3UJTH 4EIZC 3QDGE 1RZJC 1EFXA 3V2AR 4GMTH 2AJYL 1MWAL 3EOAB 4TVPL 4XX1E 4LSPH 1AXIB 1FFOA 1KULA 3BPCB 3IJYB 1ORSA 5EZIH 4TTGA 1OTTD 4X80L 1SMOA 4KJYA 5GJSL 4CKVX 4AM0A 4HXBH 3G04A 3RWJB 2VLKB 3U6RA 2RB8A 2E7BA 1C5DB 1TIUA 4NDMA 3MODH 2CO7B 5GS1B 1GOGA 3GMPA 2R9HC 1B2WL 1JHTA 2X40A 4M6NL 4MGXA 5GGVY 1HHGA 4XAWH 5I8EA 3LKOA 2JCCA 4Q7DA 5GS3A 5GZNC 4CNIA 1QLFA 3AM8A 3MA9L 4KRLB 5SX5K 1IZKA 5J57B 4S1RH 4WGWB 1KLFA 3RBGA 3VA2C 5BRZE 4X0KB 5T1KB 1AO7B 2LAAA 2X41A 4XGZB 3HR5B 3TIEA 2XTLA 1ZT4B 2R2EA 5E1HB 3UTTE 5KSAA 5ERWA 1ADQA 2QQNH 4KI1A 3OKKA 4JG0L 4OLZH 1CL7L 2ICWA 2CR3A 2DRUA 3ULVF 1A4KA 1I4FB 2NY3D 5DUBA 1L9MA 5JOFA 4U0RB 2VE6A 1HXYA 1HI6A 4IDJH 2JE8A 3OKOA 5DI8A 3WYRA 2DBJA 4OZIE 5C0RL 1GC1L 4PRPA 1KCLA 2E7CA 5I1IL 3W39B 3PV6A 5FYKD 3SY0B 1WCBA 1YPZE 1MFBL 4K94H 1G84A 4FXGB 5GS0H 1CICA 1MHEA 3D9AL 1FJ1B 3C5JA 4JO4L 4KROD 2EECA 5IKCB 5EU6A 4HMDA 1D3CA 1J18A 5L2JB 1CGSH 1NLDH 5FA3A 2IPKA 3G6DL 4I3SL 5KS9E 4HBCH 1MCNA 4HCRH 1Q9OB 2XZZA 3GBNH 2BVUA 2I9TA 4KKBC 4FTVB 1XCQA 1T0PB 1IJ9A 3GSOA 1JGUH 3ARGC 1CFSA 4L9LC 4WI4A 4GRMB 3VXSA 3D39A 2Q8AH 3BKYH 3AMKA 2F5AH 3U0PB 4D9QD 2QLVB 1BLNA 4ODSH 4PJEF 3L1OH 1X7QB 2O26U 4IJ3B 2VITA 2QSQA 1L7TL 4IBLT 3H9HA 4ORZC 1IT9H 2C4FT 5F96L 4ELMF 2RQ8A 2JJSA 2X4RB 2DQEH 1OAQL 2XTJC 2ZG3A 3QDAA 3GGWB 4AY0A 4PJHA 5JORA 5EO1A 1SEBB 1LO2L 2P44B 3BGMA 4CVUA 1WV7T 1PG7W 5ICXB 4IM8A 1U8IB 3BAEL 4JFQA 3WO3B 3QDJB 1BZ9B 3VFPA 1F6FB 1S5HB 4MD5A 5DFTA 3STBA 1SJHB 3SKUD 4XNMB 2XQBL 5JR1H 3VFWB 3PABB 3JTTB 5LGHH 5EC1A 3RWIA 2EDXA 1ZMYA 3OKDA 5C0GA 1FRGH 3O8XA 1DEEB 2YD1A 3WHE0 4WEBL 5J4MA 4KPHL 4MHHI 2OZ4A 2ERJC 4UUJA 3TA3C 2ZUYA 1KN2L 3O6FC 1HCVA 3C6SB 4WFFD 3VD4A 3VRJB 4OLEA 3SJVA 1KEML 1MJ7H 5ESQA 4ZSOA 1OTTC 3FFCA 2CQVA 1GH7A 2PYEB 5TDPA 3U83A 3H7BB 2XZQL 1MCOH 2IFFH 2O61A 2Y06L 1BBJA 4MYWB 3TWCH 5BV7L 2D7PA 2BNQE 1QFWH 2J8UE 1PVHA 5IMMA 3PV7A 1U0QA 3KPQB 3DXAB 3TBTA 1NC2B 2HJFB 1D6VH 3B83A 3LIZH 1JWSB 12E8H 4IIQB 5ALBH 2W9EL 2X4UB 3O3BA 5DJDB 5IF0A 4LU5L 4Y5YC 1DQLL 1I8KA 3ZDYE 4J6RH 3IFNL 4PGDB 3RY5A 5JQ6L 1GGCH 4J2XA 1VHPA 2BC4A 1L6ZA 3QFJE 4WV1A 2IADB 4WJ5B 4HKZB 5DD3H 1HYSD 3VWKC 5I18L 4ZPTA 1OCWL 3QCUL 5ITFB 4V1DA 5E4EC 4JFED 5F3BA 4X5WA 1CBVH 4G3YH 2XXMB 4MAYC 3FO0L 4NKQB 5K59F 3MRNA 1MCPL 5GZOC 4U0QB 4JFFD 3RAJH 3A6BH 4NJAH 4I48B 3ZKSD 3QEHA 4MDJA 1EUTA 4C56B 2EYRA 4J8RB 5KSBE 3DV6A 4HF5H 3SDDA 1AY1H 3HE6D 4JM2B 3O6ML 5HI3C 3MRJB 5BVJB 4PJIF 4GAJL 2CH8A 4LMQI 3MGOA 4M62L 4PREA 1E27B 1CGTA 3MCLH 4LCWB 2L0DA 4I18A 1MQKH 4APQB 4Y19D 4R96A 4RFNC 3U2SA 2GJZB 3BZDA 4ODVH 5EZLB 1RU9L 2F19L 3M1BB 1JNNH 5BVPH 1JZ7A 1I7RB 4CVWA 4YNYB 3HE7A 3MRLB 4PR5A 1G7QB 2MKLC 2Q7YA 4P23B 1UWEH 3JZ7A 4X7DC 4BQ9A 2EDJA 1S9YB 3BYYA 3QNZA 1QFWI 1A9EA 4KRPD 4GBXD 5M95B 3V6ZB 5LWYH 3PWJA 4Y4KD 2IH3A 1YYLL 2D7NA 1WK0A 3KNBA 3BQUA 4L8SB 1D5ZA 2G5BB 4JGMA 3WNPA 5DVKA 4OCNC 3DWTA 5KSVA 1BOGB 3JV4B 5E6IA 3KWWB 1A5FL 3VFUA 5L9DL 1GCFA 3O2WL 5IB3A 5TQ0L 3PWLB 3EJYC 2NW3B 3CFEB 1YN7B 4G42A 2Z4QA 4HIHB 3X3FL 2MCPL 2DQDH 2XI9A 4M1GL 4MNQA 5C0FA 3IFPA 1H9VA 4ERSH 1D5MA 1MI5A 4JPWL 1Y18B 3GKWH 2MMXA 3EJZC 2CR6A 2WIIB 3TPKA 2PR4L 4ODTH 1N2RB 3QUMA 1Q38A 4X6FA 1IC5H 1NMAL 1NCDL 1G9MH 1G6RB 1ZTXH 2XRAH 4LSSH 1IM9A 2IQ9L 2XTJB 3MV9A 5FM4A 4D9RE 3WDIA 3HFML 2YZ8A 5HYQA 3Q6FB 4JKPH 2YK1H 4IOSD 5I73B 3MRRA 3FZUD 2EDYA 1NCTA 1U93A 2IWGA 2Y9RT 3OXSB 4PJIE 2F74B 1T22A 2CKBH 1V5JA 5EU7E 1QLEH 3WUWG 1H3PH 4JHAL 2P48B 4M1CD 1S8DA 4YGVB 4MS8C 1NCNA 3O4LD 4TNWK 1ZVSA 2VH5L 5DZOA 3RWEA 5EU4A 3G5ZA 4OCRL 3WLBB 2BSSA 2B4CC 2P7TA 1OSPH 1S5IL 2IAMD 2JF1A 2FATL 2X1OA 1JV5A 3HI1B 5HY9A 3LQAC 3ISWA 1ZK9A 3GI8H 4FHBD 4GW4A 3HMXH 4FQCH 1P2CB 2DBLH 2ED7A 4XPHH 4JG1H 4P59L 4XC3H 2E7LA 3NABH 4J3UA 4KKAC 3MFFA 3BEWA 3H7LA 4NNPL 5IGXL 5BW7C 3BE1L 4CVZA 1CICD 1E6OH 2CK0H 3LKQB 2RHEA 2B20A 1CDYA 5EU6D 3GUTA 1K2DB 3HI6L 3UTZA 1BX2A 2YKLL 4J3VA 3AFLA 4ZO7A 4ZFGL 4O02H 3HTLX 4YFEA 3BP4A 1AR2A 2GY7B 3PGDA 1YQ2A 5CZXC 2VXSL 3LN4B 4CGTA 1KJ2A 2NY6D 5DJXB 3WHE1 4JN1H 4OZHE 1XH3B 1FZJA 2XWBB 5T5FL 2NY2D 1Q9LA 3HG1D 4U7KA 5BZWA 2R23B 3JVGA 5IJVA 1G7JA 4AL8H 3VFMA 2AABL 4L5FH 1MF2H 5ETUA 1UWXH 3OR6A 4HLJA 1KTDB 5F1IB 4GG6E 1S9XA 1QBBA 4GW1B 3LKNB 4WU5B 1T0NA 5GRUL 1CXLA 1UVQB 2VDOL 4L4TA 4LVHC 3RWCA 3OPZH 4NQCE 1KCSL 5E08H 2JLLA 4XBPA 5CGMA 4KROB 3D0LA 2ADJB 5JXEA 3UPRB 3SDXE 1XT5A 4FXLA 4RFNB 2Y07H 1OAKL 1U91B 3FQXA 5EFIA 1G7LB 3TV3H 5DRNA 3DIFB 3ECBA 3DUHA 1C8PA 4OF3A 3VE0A 1DUZB 2O5ZH 2PXYA 3C6LA 2BXYA 1HH9A 4P2QE 5KOVC 1EO8H 1NSNH 3FOMB 3FQUB 1TFHA 1OP5K 3IVKA 5CILH 3TNMB 1DVFD 2VDRL 1LVEA 4KK6D 2Q86B 3QIWC 3KPOB 3I50H 1O5DT 4G9FA 4WFED 4F2MA 3WEXA 4U2ZA 3EGSB 3VFOB 2RCSH 1NH6A 3L7EA 5FF6A 5E99H 4HD9A 3T4AA 2NXZD 1OQXA 1AD0B 1CVRA 2I25N 4HIEA 1WFTA 3MOBH 1T1XB 3K8LA 3REWB 1YNKL 3MBXH 4LDLB 2X9YA 2G9HA 3MQIA 5C0EB 3GHBL 3TVMA 3Q5TA 1I8IA 1RUPL 3C9NB 3F7RA 3PUCA 2MSPA 3RL2B 5IIEB 3RDTC 5IVNA 5EZOH 1HIMH 4P3CL 1MLBA 5H94B 1TTFA 5CKGA 1ZLUH 2VIRB 2P5WD 1X4XA 1RI8A 3HLAA 2GIYA 4DEPB 3SDCC 1XEDA 3T4YA 1T1YB 3NCJH 4U7SA 1C5CL 2EE2A 3NA9L 3TBVA 1TVBA 2H32A 1S7SB 2AERT 3L5WB 4ZFOL 1YEIH 4YPGB 4YDVB 4IMLA 4V1DD 5E00A 3SN6N 3JWDC 3ZE2F 5K9OB 2DM2A 4NT6B 4PJAF 4OJFH 2X4OB 5DXWA 2BJML 5I9QC 4RFEA 1QA9A 4PJBF 1TNMA 2YN5A 2XZAL 2VRAA 2X1PA 1CGVA 3RVWD 4PS4L 4FOMA 5T1DH 4L29B 1U8JB 3U7WL 2Z8SA 4F7PA 1C12A 2ZSWA 2WWMC 4QY8A 3L3IB 2HJLB 2XICA 1AP2A 5ABDE 1OGAB 3G9AB 5I76A 2HFTA 2HN7B 1JI2A 1LNUB 4QRTA 4OF5A 4U6YA 2OTPA 4Y89A 1G9NH 2HVJA 3QG6B 2DQFB 5F7WC 4YK4C 5E0QA 5IB2B 3ARPA 5HGHB 3WJJC 3UTSA 2MWCA 3KPMB 5D1XC 4G6AC 35C8H 1ZLWK 1K3ZA 4HXAH 3P11H 3G6JF 1CT8A 2RFXA 4Z18A 4JVWA 9CGTA 5DA4A 2DL2A 3JBG7 3WFDL 2ARJQ 4Z7UA 2HA1A 4CMMA 2WLYA 2R2HA 5GSRA 1FIEA 3B5HA 3LPFA 4JFEB 4YHIB 4HIXH 4R4BB 5GGTH 4PJXF 1EGJL 3BQUD 3GMLA 5ACZA 5IV2A 3GIZL 1F3JB 4IRZH 3SKMB 3QNYA 1NGQH 1NANH 4PV8B 5ANMA 4JFFB 3OAUL 4MQSB 5JTWA 3W81A 3MRPA 4OKDA 4KMQA 2IALB 1LEGA 3P0YL 1FE8L 3ULUE 3HE6B 5GS0C 3PHSA 1MEXL 1BBDL 5T3ZL 4NHUA 4R7DA 4YHPB 4LLWA 2F8VA 2W0KA 5A1AA 2FH6A 1R3JA 4MNQD 3O2VL 4LIQL 1NDGA 2P46B 3RVXD 3BWAB 1MI5D 5KJRL 5GGRY 5IQ7L 4JRYE 5D2NA 5BO1H 1C08B 2HKFL 3HCVA 4QOKE 5DRWB 1DBBH 3QXDA 4EUPA 2MHAB 4G8GB 4PJAE 3BKJL 2G60H 3REVA 2H3NA 1I85C 2VLJA 4HWZA 2FB4H 4PJBE 3MV9D 5EC2A 3KS0J 3MRQB 2GTWA 4XBGA 3JV6A 4KJPC 4LVHB 4F7CA 2VWEC 2EO1A 2XG5A 4KRPB 5SWZA 1DVFC 3P4OA 4GBXB 3RVUD 5A2KH 4G6KL 4Y4KB 2HVKA 5J1AA 4NQVB 1WBXB 5E2JA 5I19H 5C07A 4LLMA 5FYJD 1E4WL 4QCIB 1KIQA 1PY9A 2NNAB 1INDH 4LVNC 3Q6GL 4OUUA 2DYPD 2DDQH 2LU7A 4PY7B 4GG8A 3SO3C 1FFOB 1WWWX 3V6FA 1IGTA 1Z0MA 2EDNA 3L6FA 2E9JA 4FZEH 4RQQB 1KCRH 4A6YB 3EBAA 1CE1H 1IEHA 4XPFL 1NAMA 3MGTB 1T2QH 2VC2L 2XPGA 1AIFB 5HTSA 4AM0B 4Q74A 1FO0H 2QADC 3G04B 3U6RB 1NANI 4PG2A 3QEQE 3VXOB 1FC1A 4TTDC 1AJ7L 1JHTB 2JK5A 5DK2A 2VXVH 1HHGB 4P46C 1SY6L 5CEZL 5H37H 3ROLB 3MNZB 4GRLD 4MD0B 1JHKL 3HRZB 5MEND 2PW2B 4CNIB 1QLFB 4HMCA 4N68A 1WBYA 4L9LA 4M43L 1G6RL 3TO4C 2EXWC 3O4LB 3TIEB 1IM3A 2R2EB 1VGEH 4X5LA 4BSWB 4LGRB 2OX5A 4N0FA 5HI4D 4U6HB 2IAMB 3BIKA 5F6IB 1WT5A 5DUBB 3KDMB 5IB4A 2BXZA 5JOFB 3GSNB 1KXTB 3ALXA 1HI6B 5KVGL 1H3XA 3VXUA 3LMJH 4Q9QL 4EXPX 4JDZA 5DI8B 5JW3L 5DJCA 2XN9E 4PJEA 4PRHA 4XI5C 1ZEAL 4RA3A 4ACPA 4DWHA 3VDBA 3DX8B 3UJIL 5HGBA 5EUOB 1PFCA 2UZIL 4U1LA 3VMNA 3PV6B 1KBGL 1UM6L 1WCBB 4YBLC 1I8LC 3UPCA 4G6ML 4L4TD 1JZ2A 1JGEB 3TNNB 1CICB 2Y4SA 1RUKL 4YDJA 4XNXH 5EU6B 5JXED 4PLKD 3SGJA 2FJGA 1PZ5B 2BVOA 2COQA 2IPKB 1ZE3C 4DKEL 5D1XB 5BS0A 4ENED 1WJ3A 3C6LD 5DZNA 1EAJA 2O5XH 3OZ9H 3EOBB 2KBGA 1CFSB 3MJ9H 3RA7H 3KPSE 4R97C 2NY2B 5HI5C 4G9FD 4X5XB 2VAJA 3FO2A 2Q1EA 4NFCA 1PZUB 3HG1B 3IDJB 1F97A 3QZWG 1XIWC 2VITB 3NCMA 5HHNA 4YXHL 1U2HA 2QTEA 4GRWH 4EQ2A 2YXMA 5FAAA 4M6MH 3GMMB 3BRDA 1B88A 4UB0L 1CDGA 3C60C 5HHPA 3TVMD 4EDXB 3EDEA 1U8QA 2WWKO 3MLYH 3D69A 4QHKI 2W0PA 4I0PA 5DEGB 1R3HB 1H3TA 4UINL 1T21A 1A3RH 1MIEH 4Y1AD 5I1KH 2YA2A 5JORB 1EHNA 2VL4A 3MLXH 1Y6NR 2J6EL 5GRZA 5GSVA 3ZKND 1C5BH 1UEYA 4XZUB 4MLIA 4JFQB 4XP9L 4O58L 1W72H 2Q8BL 1MJ8H 3VFPB 3C2AL 3P73A 4X9IA 5LKNA 3HPLB 3MRGA 2NY4D 3PP3H 5EORH 5FUOH 1Y0LB 1EEQA 4JY5H 3FL7A 5TH2A 3EO0B 3WMSA 1EHLH 5FYKL 5KVEH 5C0JA 3QO1A 2R1YB 5EC1B 5HYJA 3MRDA 4P9ML 5GRWA 4P3DB 3U30C 1Q8MA 2CMRH 5GQBA 1BFTA 4MAYA 3CSGA 1MJUH 2PO6D 3OBAA 1DVFB 1A7OH 1S7UA 3MC0A 3IDUA 4PB9L 1QFOA 4U1JA 1ZGLB 2AJSL 1QBMH 3VXPB 1DBMH 3B9AA 4LASL 2PN5A 3SQBA 2L4OA 4UT6L 3JTSA 2ZUTA 4I4WA 1G9MC 2OP4H 3SE9H 3RNQB 1K8IA 3LVEA 2GTZA 1GGBL 2NXZB 2XNAA 4H88L 2O61B 2PW1B 4OTXH 4UV4L 4Z7VF 4OCYH 3UYOD 1UYWH 5F7LB 2DLFL 5EOCH 3HNVH 1CFNB 3DUUA 3F12A 5IMMB 1T66D 4XNYH 1RURL 1JNHA 1NGWA 2P5WB 3MACH 3MJ6A 4POZC 7FABL 3O3BB 3BUTA 4WDIA 3UTSD 3VXTA 4M8QB 1IC4L 1AGEB 1IAIM 1I8KB 1P4LB 4G5ZL 2DQJH 2UWEB 1OAZL 3PWPA 4Z7WF 2CSPA 1MQ8A 5BXFA 1MCBA 3BN9C 4OLVH 3F7YB 4NZRL 2DQCH 2HJKA 4K9EL 4N0CD 4YZFE 1QFUH 3INUH 4ZPTB 5CCKL 1Y6MR 4V1DB 1SJVA 5F3BB 5CJXC 5TDNA 1CGWA 2Y36L 4G8FA 2XKNA 1UFUA 1QZ1A 4H25A 4OT1H 5KW9L 3T08A 5IHBA 1NCBL 3QO0A 5TE6H 2Q76A 3TO4B 5MERB 4MDJB 3RI5F 1A02N 3HNSH 4OB5H 1RIVL 2L7JA 1LP9F 4RAVB 1KC5L 4S0TD 1FYTB 4PJGA 3MGOB 2JB5L 5IHLB 1JCKA 4OF7A 4LSVL 2VSCA 2H45A 5D7KE 3OKMB 3PHQB 1A6ZA 4ZPVA 5I75C 1EEZA 5HHVL 3Q5YA 4I18B 1GL4B 1MFEH 3VD3A 1ZA3A 3CZJA 1J1OH 4GT7A 3LN5B 3LSOB 5CKAA 5FGSA 1A6WL 4OCXH 1MAKA 2VLJD 4N0UA 1U3HA 2V9TA 4PR5B 4HPYH 3LRGA 4G80B 2MTPA 2X4QB 3MRMA 4J7RA 1U8MA 3BI9X 4YBLB 3RPKA 5B4MC 2P24A 4JFDE 5K9JH 3CZFA 3LH2L 4Z7VE 3S34H 3S37L 2Y25A 1TQCC 4OZFA 5HYSB 3H0TB 2KZ1B 4DCQA 5C07D 1D5ZB 3EO9L 1QR1A 4JAMB 1ZANL 2ZUXA 4P2RA 1X3DA 4XMPH 5I1EL 4JDVB 2W65A 4XVTH 4YXKL 3VFUB 4PJ5A 4X6CE 1CXFA 2OJZL 4F80A 5IB3B 1A0QL 4OD3H 1WZ1L 2YSSB 4U1MA 4FQ2H 2IQAA 2YD2A 4G42B 4KK8D 5EH1A 1IMHC 1FPTL 3O0RL 4I77H 1EVUA 4MNQB 5C0FB 3IFPB 4QRRA 1N3NA 4I3RH 2VLLB 3ZO0A 3ESVF 1DN0A 5B8CA 2X4PB 4J3SA 3ULVD 5D9SA 1XIWB 1D5XA 3MRBB 2C1OB 2E27L 3PJSB 5IHUH 5BW7A 1L4IA 1ZVYA 4ELKB 4LARH 3HAEG 5JHLH 2Q3ZA 1BHGA 1P4BL 1OARL 4XHQA 4HG4J 2A9ML 2MPAH 2VDLH 3DI2B 3Q1SH 3FMGH 1SYVB 1RV6X 3WNKA 1P5VA 1JPFA 1LP9E 1MCLA 3GM0A 3OKNA 4UIMA 4X8JA 4DGYH 4JFZH 2AKRB 4Z76A 4NZTL 1JK8B 1K8DB 3AS2A 2GFBB 5DQDL 5CP3H 4RCAA 4UQ3A 5FYKU 3PXHA 2R0LH 5CJ8A 2YRPA 1ZVSB 3MRFB 3KGRA 1PG7H 4NKIH 1UA6L 3RWEB 5EU4B 1DQQB 5FCUL 2DYPB 3G5ZB 1DANU 1EERB 1DBAL 3DHMA 3PG2A 4KQ4H 1KCKA 3BPNC 5E8NA 4M5YL 3R4DA 1JV5B 4MB5A 2Q6WA 1N6UA 4HIIB 4Q2ZA 1A3LL 4GW4B 3KXFA 3VXUD 4HS6B 5CHNB 4PRHD 4OGXL 2DLEA 1P84J 3MFFB 1AQDA 4PP2A 4F33A 3CFIC 2ZSVB 1DBKL 2AK4E 3LD8C 2AVGA 4GXUN 4GRLB 5IESL 5IVXA 4KI5F 4YHKH 4DUVA 4XP5H 4F9PA 3ABZA 2FDBP 5MENB 3GUTB 3UTZB 3QPXH 3NFNA 5D7JA 4TRPH 4L4VA 3NIGE 1T03H 3QWQB 3T77A 1H0DB 1NBVH 2KDGA 4GOSA 3BX7C 2C9AA 4M03A 4NM4H 4WIQA 1FC2D 4ZFFA 2H6PA 5JOPE 4OCWL 5E5UB 2ED9A 2Y23A 5B38A 3PGDB 2R4RL 4PP1C 1UG9A 4PTUB 2GK0B 4BUGA 4IHOB 3ULUH 1KJ2B 1G0DA 2D03L 3CJJA 1P9MA 5D7IF 5E9DE 3DX7A 1E4XL 2J2ZA 3JUZA 2L7UA 3RX5A 5D2LF 4RNRA 5IJVB 2E3VA 4U3CA 2DIAA 3MUGA 5H2BA 1IGMH 3VW3L 32C2A 5DD0L 1VSCA 3KHOA 4HJJL 1ADQL 1EXUA 3RDTA 1J05B 3MRHA 1X6NA 4I0PD 4H0HB 5AG9A 2RAMA 3V5HB 1MCJA 5E8OB 1OVZA 2HFFB 3NGBC 4HJ0D 4J3XA 1OWWA 4YLQT 3U0WL 1MREL 1MHPL 3HC4H 1HZHH 3P4MA 1ITCA 4RIRB 5C0BE 3P77B 4M7JH 4WI5A 3FQXB 1CFVH 2FGZA 3OKLA 4ZTOH 3MRKB 2D7TL 3VXRE 5C7XH 5HYJD 2A77L 1HH9B 3A67H 1QRNA 3ILQD 4KK8C 1BFOB 3ALWA 4BA8A 4HEME 3DVNA 5GRXG 3TLRA 3FT3A 4OLYL 1B90A 3LEXB 4LHUA 4JKKA 4LSRL 3HUJB 1N64L 3G5XA 1G1YA 5D96C 5K9QG 3WEXB 3B4NA 4TVPE 4LLAA 4LEOB 5BMFH 4HS3A 5MEPA 2QHLA 3CIQA 2LTQC 2ADIB 3IJHB 3MV8B 1A7RH 1J0JA 4Y1AB 5E8EA 1GOFA 3WJJA 1KIPA 3AREA 3U9PH 3HI5L 3UBXB 1AKJA 2VABA 2HH0H 2ICES 3ULSA 3CMGA 2QSTA 2OL3B 3HLAB 2VDPH 5C0CA 1INEH 2NY4B 1N5YL 3U46A 3SE8H 3T4YB 5C86A 4X4YA 3PWPD 3V0VA 3X17A 4RGNE 1IC1A 1TVBB 1X5GA 4EZMA 4UILL 1F5WA 5C08A 2PO6B 4M1DL 4AH2B 4LKCB 3QG7L 3TO2B 3WFHA 2BHUA 3VXNA 5DHYB 4RFEB 1QA9B 2R8SH 1T3FA 3QQ9D 4RFOH 2ORBL 1JUFA 1OAXH 3IXAB 4PJXA 1QSFE 3ZDXF 5L8LB 4JANA 4KVNL 1UACH 5KTEH 5D5MA 3UJJL 1AP2B 4U6XB 1XF5B 1UB5B 3VCLA 4B0MM 1TETH 1ZT7A 2OZ4L 5I76B 4E0RB 4OBSA 3KPRA 4D2NA 1CLCA 1VEMA 5A43C 1A7NL 4HCRA 3DTXA 4HZAA 1K4CA 3HMWL 1NAKL 3WFBH 2HVJB 3WNLA 2R4SL 1MRCL 4PBVC 1R5WA 2JB6A 3JWOH 2DQIH 1H15B 1G0YR 2P43B 1KLUB 2EE6A 1YZZA 2FRGP 3R06A 1I9EA 4PG9B 1U3HD 3BH8A 4EQ3A 3UXFA 3UTTB 1Z5LB 4Z95H 1IAKB 1DSFH 4LQFL 1YNLL 3GI9L 4OM1H 2VAAB 4Z7UB 1HWGB 5J3HC 5FFLA 1LK2A 3V4UH 1F90H 1X5ZA 3LEVH 5AUMB 3NCCB 2AEQH 1MUJB 3MJ8A 3B2UD 3W11D 4XNUL 4AEIL 3PGCA 4N8VA 1ZLVH 1UWXK 1U6AL 1HOCA 4OZIB 5JQHC 1NL0H 1MHHB 5ANMB 4DK6A 1SEQL 3MRPB 3VFRB 1ZXQA 2EDRA 1LEGB 1LO4L 4BFIB 1HNGA 3MSPA 3DO7A 4F57H 1IFHL 5B39G 4FQJH 4R7DB 3UYRL 1NDGB 1SBSH 4QRRD 2GJ6D 1QQDB 4LBEB 3S6CA 3TYGH 4YEFA 4Z5RA 1QG3A 3FT4B 3UP1A 5D2NB 2ITDA 5SX4H 5GGRB 1FNFA 4CN4A 3PDDA 5GIRB 3QWRA 3QXDB 4JHWH 4N8CH 3VXQA 2D9QB 3BP5A 5FV1L 5HD8D 4HFUH 2VLJB 1U58B 4HWZB 4P46A 4P5MB 4TUJB 4Z9KB 1IRAY 4GRWF 4I8DA 5JLZA 1I9IH 2X4SB 3EHBC 4XBGB 4DW2H 4NN6C 4F7CB 2K7PA 2HLFD 1YYMH 1H3WM 1PY4A 3D3VE 3N1FC 1SYSA 4JKWA 1BJMA 1CG9A 5CD3B 3P4OB 4ORGA 1FAIL 1N0XH 4JFXA 5I8CA 4HS8L 4W4NA 2F9BT 1SM3L 2HVKB 1UQSA 3WFEH 4LSUL 5GISL 1A7QH 5C07B 4LLMB 1QSEA 5MP6L 3S4SG 1WBZA 1A8JH 4TULH 2NMSA 2KUTA 1JHLL 1RSFA 2CPCA 3QIBA 2G75A 5DUML 3MV7A 4LFHG 3V7AG 2NLJB 4GG8B 4Q6YA 2AJUL 5IEKA 2J1KA 5HHXL 3KYKL 3V6FB 1IGTB 1ZLUK 2OS7A 1RIHH 5IJKA 4Z8FH 4K23L 3SKNA 4TQEH 5EU7C 1NAMB 3KXFD 4R4ND 5CP7A 4BZ1H 2JJVA 5IHZA 3EOTL 3GJFB 4P57B 1MVFA 5F9WC 3S96A 2BOBA 4IRSC 4FQIL 4LNRA 5J1SC 1WF5A 3TH2T 4E41E 3LV3B 4BH7B 4NRZA 3ARDA 1B3JA 4TSCH 4DVRL 2P45B 7CGTA 4PTTA 1EEYA 2AK1L 4WFHE 5D7JD 4GS7C 5DMGD 5GGUB 5SX4I 4LLDB 1E6JH 3QUML 4L4VD 4XP1H 4M7KL 2H8PA 3S88L 2QSVA 1CXEA 5IVOA 1I1FA 4ZTPH 1NEZG 2M2DA 1T1WA 1YMMA 1UZ8A 3GHEH 1GHFL 3ZDZF 2LV4A 2CLZA 5DRXB 4HG4K 4Z0XA 2LVCA 5IB1B 2R1XA 4JDZB 5HHOD 5L2KE 5DO2C 4PJEB 4PRHB 4NO0A 1HKFA 1FH5L 2DQHH 3C8KA 4KRMB 5FHAH 5IFJA 4U1LB 2UYLB 3RZCA 1ONQA 3QFJB 3LCYA 4ELMB 3RNKA 3BKMH 2NY5L 1DFBH 1NMCB 1YJDH 3FFDA 4K7PY 4CJ1A 3L5IA 4U1NA 3AS1A 5DGQA 1TJGL 4G8EB 2A74B 2D2OA 3LEYL 2R2BA 4AMKH 4ONHB 1FNGA 1P84K 4XVSH 4YDIH 3T0EE 4GFTB 2D4DA 5DA0B 1DBJL 1GSMA 2ZJSL 2AJZA 3B9VA 3FO2B 5L88L 4KMTH 1WEJL 5HHNB 1IGJB 2M8XA 1T4KB 3V52L 4WI6A 1JGVH 2EYTB 1H5BA 5FOBB 5HD8C 5AAMA 1NFDF 1RMFH 2HFGH 1KJ2L 2CKBA 4NWUL 2WUBH 2BVPA 2N4IA 4NC2B 1T21B 2P5EA 2UUDH 2HLFC 4QT5B 4NP4H 2EKSB 4MWFA 3ARED 5GSVB 1AHWC 4AYFA 5HHQB 4GKSA 1MLCA 1AKJD 1R0AH 1E4KC 3BDYL 1BQLH 4ZUTB 4F7EA 2H9GA 4JQIH 2R2CA 5C0CD 5JW4M 1MCEA 1CTOA 4U33A 2GUOA 1QBAA 5TH2B 1FVCA 2VR5A 3ZE1E 1KCUL 3BZ4A 4XBEH 5I1DA 4OZ4A 1RUQL 1S7QA 4NN6B 3HMXA 5C92A 1DP0A 3MCKA 4LLVB 4P5TD 4Z7WA 5CZKA 3QCVL 4U1JB 5LBSL 1U9KA 1RZ8B 5E4IA 1GZPA 4CVXA 3AY4C 3LPGA 5E2TH 4HUVA 1NLBL 4WW1B 3ZYOA 2R0KL 3ZYJA 2GTZB 4WRLA 2DQTH 3MUJA 1KIRB 4GAGL 5T3XL 3OJDA 5DC4B 3PDGA 4R7NA 4OQTH 2X70A 1YQVL 3QJFB 1N4XH 3DUUB 4Y16D 4QWWD 4LVOC 4PJIB 4JZJC 1IGYB 1K4DA 3V7AE 3VFTB 3PE9A 4QNPF 4K8RL 5F9WB 2YXFA 5C09D 4C57C 1VA9A 5DJ6A 3PWPB 3H42H 2AV1A 3EIFA 3FJTA 4K2UH 5ITBH 4UIKH 4HUNB 2HJKB 5J13C 5DDHB 2Z93A 4M5ZH 3QDME 4MDIB 4WNQA 1D9KA 1N5AB 2EDKA 3EDKA 4XNQB 2OJEA 4GS7B 4PPTA 1AFVL 2OQJB 4OFDA 4D3CH 5BZDA 3OMZA 4YIQB 5C0AE 2Q76B 1RUML 1AGCA 5TF0A 5I15H 4YX2L 4QXGH 1S9WA 4R2GD 2GJJA 3VMPA 3M8OH 3NA4A 1AO7E 2OM5A 2AXFA 4B5EA 1LE9B 4UOW1 5FYJU 3KR3L 3DSNA 1RK1A 1DLFH 4BM7A 1A6ZB 5F1KC 2AJXH 2VZ1A 1N6QL 2NZ9D 5KN5B 4N1HB 1ZA3B 3K8KA 2BZDA 3D48R 3DROB 1YN6A 1T80A 3WS3B 5E2WH 5I1JL 3ULUC 2P24B 2R0WL 1HCFX 1G7HA 3VFGH 4BYHA 4KKCC 3FQRA 3NCYP 4IS6A 2VL5A 4ODWA 2J4WH 4ONGL 3MYZA 3LN9A 5T1MA 3RUGA 1QSED 1JRHL 4HWNA 3UYPA 4Q9BA 2DB8A 1KT2B 5DWUL 2W65B 2AJYH 2J12B 4MNGA 4OCMC 3STLA 4OLUH 3QIBD 1YMHA 4NKMA 4JQVC 4QNPE 4NQCB 3GK8L 4J12A 1IQDA 3IRZA 3ZTNH 1QLRA 3VGGA 2BVEA 4FTVE 2GJ6B 3BEVA 5J7CC 2A73A 5EU3A 3N85H 5C8JB 1DN0B 1U8PA 4PGBA 5B8CB 2VQUA 1UADC 4G7VL 3T09A 2A1WH 3OF6D 4M93B 4Q0XL 1RZJL 2AGJL 3RWHA 1QUNA 1CDIA 3X13A 5IEHA 1B2WH 1ETZB 4QRQA 5CAYB 3MRIA 1JJUA 3UTOA 2X10A 5DS8A 1TXKA 4ZUWB 2EICA 4JDTL 4WHYH 4D9LH 3ARDD 1OTSC 4P5TC 4PY8J 2B5IB 1JPFB 4FNLL 4UIMB 2BY3A 3CDGA 3VFSB 3HZMA 4CL7A 4Z76B 3TZVC 5BQ7B 4YO0A 1JPTL 4HHAB 4M6OL 5IFAL 4R0LB 1MRFL 4UQ3B 1KGCE 1YPZA 2ZG1A 1REIA 4JG0H 3WHXA 4HPOH 5K93A 5E8DH 1XGRA 4WI2A 3QDJE 1BIHA 1I7UB 3KYAA 1YMMD 4HT1H 3A6CL 3FHAA 4NQDE 2ZNXA 3AAZA 4RISH 4CU6A 4XCNB 1Z9OA 5KS9A 3MLZL 2YWZA 1T0MA 5D70H 3VU2A 4N5EC 5E1AB 1DDHB 2CUIA 1MFBH 3EYOA 2DWDB 4X98A 3O2DH 5D2LA 4U1HB 1J86A 4PP2B 3RZCD 5GGTA 2QSCL 2PYEE 4AG4L 1BVKB 4PUBH 5ENWA 1YECH 4JZJB 3ULVL 1NAML 2QQKL 5DHVA 1S7VB 1KJ3H 3G08B 3DXAE 1KPUA 3T77B 4OSUL 3V79C 2HG5B 4Y8DC 4ZFFB 5F89B 3WUWB 2C1PB 2FJHA 1XGQB 2DD8H 1X5IA 3QXAA 1CFQA 1F00I 2ITCA 5EZJA 5EA0L 3CLEL 2CK2A 1C16A 5TQ2L 2AXGA 2ZUQB 4PGCB 5FECA 3WIIH 4RNRB 3FKUS 4HIJA 4XVJL 3D25A 1XGTA 1HQ4A 4PRNB 1OAQH 1I1CA 1GVIA 5HBBA 3CMOL 5E6ZA 5HHOB 4X6BA 4DZ8A 32C2B 1L7IL 3JXAA 4NUGL 4JHBA 1CD8A 4DGVL 3IDNA 1EXUB 1LO2H 4NO2B 1MAMH 1UM5H 4ODXA 5DD5H 3BAEH 3TP4A 2P5ED 3H8NA 4PLOB 1N59A 4P9HL 4C56E 4CU7A 5ILTL 2YMXL 1ZHLA 1FG9C 2XQYG 3JUYA 5T1LD 4UBDC 2WAHA 2GSGA 3CC5A 3B9KA 3VH8G 2FX9H 1XR9A 3GBML 4WO4D 4LCWE 4YHMH 4KPHH 4EDWL 4PV9A 3E6HA 4WUUD 2GCYB 3V5DA 4I2XA 1FO0A 1OT2A 1HHJA 2V7NB 1B0RA 3BO8A 4K55A 3MLSL 4ZOAA 4PJAB 4HFWA 1PYWB 1J12A 3GSUA 4PJBB 1NGYA 4Y4HD 4KQ3L 2F58L 4OGAC 4WTZA 5ALCL 3MYJB 2HLAB 1Q72H 4XCEA 1FNHA 2B0SH 1Q1JH 1RHHB 5IMKA 4DAGL 4NUJA 3AREB 3MOAH 3NCYS 2DS4A 2HT2C 5DSCA 1AKJB 4AK1A 5FDWA 2VABB 3FT2A 3IFNH 1M6OA 4PJ9C 2JELH 3BZFA 1F8TL 1BQSA 1FAKT 3TF7C 2DOCA 5C0CB 1RUAL 5CEZE 4UV7L 4H26A 4NNYA 5CBAA 3QCUH 4X4YB 2FO4A 3V0VB 1FIGL 5DJZA 5JHDA 4XXDA 1F6AA 2FZ3A 1OPGH 1K6QL 2OK0L 3G6JB 4P5TB 4R9HA 3F58L 1RJLA 3WFHB 4YDKH 2DKSA 1NEUA 4KVCL 4PJXB 1JL8A 4QLRA 3PL6C 5JW5B 1KB5B 4JANB 1EV2E 2HAZA 4KK5D 1ORQB 1NCCL 3VJ6B 4JE4B 1ZT7B 3TC9A 3NMEA 1IBGH 4JZOB 4L3AA 2J88L 2WK2A 2IPTL 4NJ9L 4Y16B 4HX1A 4ZXBC 2CIKB 3MGAA 1K4CB 2MFNA 1UXSB 4BH8A 1RU9H 2F19H 2BDNH 5GHWH 2BRRH 1CTNA 1GPOH 4QO1A 3L3OA 2VDKL 3QXTA 4HAGA 5GRJH 3DSFL 2CJUH 3NTCL 5DEZA 3F7PC 4YHOH 3ZKXC 2FBJH 3CK0L 3MJ9A 3S97C 3IDIB 3R06B 3O6KH 3U9UA 1W0VA 1LILA 1CD0A 5AD0B 1OLLA 2N1KA 4QRUB 1I9RH 5C09B 4YE4L 3VD7A 5H35B 3E2HC 5C6PB 2X7LA 1FVEB 2ZUWA 3LDBB 1DUYA 1JPGB 5J12B 3TPUB 3CX5J 4X6EB 2V7HA 4MCZA 5I8OH 2WBJC 2ZCLH 1MHCB 5CZVL 4JFPB 1FFNA 4PJCF 2YPVL 1AXTH 1URLA 2DF3A 3LHPH 5TGBA 4OLWH 3FRPA 2F8OA 4OGYL 5D6CA 4N1CA 3DO7B 1PLGL 3KJ6L 1Y6KR 4XCCL 3MOQA 5DEFB 4TSBL 1W72A 5MEOA 4MJ5B 2ZZUT 3U48A 2BNUB 2VXQL 4RMRA 5FHBL 1NMAH 4Z5RB 1QO3A 4HDIA 5DUPL 4E5XB 4XPGH 5F88A 1F4XL 4I0KA 5DC0A 3VXQB 2C7UA 3BP5B 3CVHH 4H1LA 5EG6C 5AYUH 5IB5A 1LO5A 3ARRA 5C2BL 1CGUA 2BVQB 4S1QL 5JUEH 5ELIA 5HDQH 1OTUC 4DN3H 4MJ4A 3VDAA 3RVVD 5EN2B 3VWJC 3KPSB 1U8KB 5AWNL 4R6UA 4U6VL 4ORGB 3PGFL 3DMMA 5I8CB 4JFXB 4JKMA 5FYKE 5F7DA 1OT1A 4UT9H 3ARWA 2KZWA 4KK9C 1T83A 2W92A 4L3EA 4NQEA 1CDBA 4NSKA 4KI5D 4AEEA 3RIAF 4JO2L 4FQXD 1P1ZB 1HINH 2EDBA 4OF6A 3PWVB 4WHCA 4U1GC 2YR3A 4HGWA 4HSQA 4WI7A 2UY6A 4LP4A 3RGVD 1U42A 5IEKB 1RJYA 5FXCH 3QIUC 2WW8A 1MFDH 5LQBH 3P0VH 3S36X 1LO0L 3K80A 4WI9A 1S9VA 3SKNB 4DJMA 5CP7B 1WTLA 5EOQL 4NNPH 4XTRD 2V9QA 1JYXA 2R56L 4D9QE 1DLHB 4LRNL 2PTUA 5EUKA 2FGWH 3QEUA 2BOBB 4GMSL 2OR7A 4OZHA 1TDQA 4PJCE 1BZ7B 4JO1H 2FR4B 1MJJA 4MAUH 2DQUL 2YKLH 5DC9B 4HH9A 5F7UA 3ARDB 4BJLA 4NO5A 4TUKL 1A6AA 4JLRA 2NQCA 2XZCL 1LK3L 3GIVA 4PTTB 2C4FU 5TPWH 3RL1A 3WBDA 2Y7QB 3DYPA 4O2EA 4Y2OA 4MQTB 1XF1A 5SWSD 3TFKC 2VLRD 3N1MC 3HPJB 4M9OA 4X6DF 4KK5C 3RIFF 2PYFA 1QKZL 5FA4A 5IM7B 3KYMB 4C83B 5DMIH 1UZ8B 4D8PA 3I3BA 3TJEH 3AUVA 1FGNL 2B1AH 3LKSA 3BZEB 4RGMC 4RBPH 2CLZB 4YFLI 3M17A 4IMKC 4YHLH 4BSVA 4RAUB 1TCMA 4ZAKC 1LD9B 2E6PA 4RX4D 3KPPA 3NPSB 2Z0BA 1YEJL 3IAPA 4P2QA 4WFFE 3F6IA 4WWKD 3VDCA 2P8PA 1T5XA 1KCSH 2HP4A 3JV0A 2LU3A 5IFJB 3RZCB 4XAKD 1UCBL 1BEYH 1EHAA 4U1IA 4MQXD 4YHNB 5IOPA 5KSUB 1S7TB 1NFDA 4F8QA 4WUKH 5L7XH 4QF1B 1L6XA 1OP3K 3MXWL 4JGUA 5JMOC 1ZLVK 2VXUH 4EEEA 4HV8B 4XVUC 3RPIB 3TT3L 2A6JB 3FB6B 3B9KD 3D2UA 3FFDB 4WWID 1ZLSL 3CU1A 4O9HH 5FCSH 5BJTB 2AXJA 4NYLB 1T7YA 5I17A 3E2HB 43C9A 4OLXH 2QKIA 2R2BB 4ZFZB 3TN0D 1DL7L 4WU7A 1LDSA 1MFCH 4GSDH 2WBJB 1KYOJ 2VKWA 1XF2B 1KEGL 4ZOCA 1MRDL 4LRIC 5DMKA 1BVZA 5HGDA 4EI5D 3GHBH 5IW6A 1QTYT 4ZS6C 4JFEE 1RUPH 1CLOH 4Z7NE 4YR6A 5A2IH 3EYUH 4FFWC 5ID0A 2Z31C 3QWOA 2ZOKA 4P3CH 1CIUA 1HILA 1S7XA 3AU1A 5HDBF 5CP3A 1G9EA 2CIIA 1BAFH 4JFFE 2ADFH 2BVPB 4PRDA 3U4EB 2P5EB 4Z7VB 3NCBB 4GKSB 1ES0A 1MLCB 3TM6A 5IW1A 2JCCF 4G7YL 5T1LB 4K7FA 1BGXH 4NPYA 1V3LA 3QUZA 3IKCA 1MIMH 1YEDB 3CCHA 2GUOB 4WO4B 2DQGL 3MZTA 5I1DB 3VMOA 4OZ4B 5JHDD 1S7QB 3TCXA 4Y19E 4M3JA 4WUUB 4LCIH 3TCLB 2APBA 1AXSB 3IETA 2BJMH 4Z7WB 5ADPH 2HT3C 3QUKA 2XZAH 5ESVB 3UJTL 2YD3A 2UZXB 5TFSH 1GZPB 4CVXB 4Y4FA 4XP6H 4LSPL 1IARB 3SKJL 1JP5A 1ZHKA 3C5ZA 4MXQD 2V6HA 4KKLC 5EZIL 4CDHA 1OB1A 3DX6A 4Y4HB 3V6OA 3QZWB 4N9GB 4RGNC 3T3PE 2FIKB 3HB3D 3L95A 4IOIB 2X70B 1BWWA 4XB7A 3QIUB 1F58H 5INCB 1LP9B 3MODL 2NY1C 3SE3A 2OLDA 1B0GA 1UB6A 1P4IL 2Z92B 3FHQA 4OV6F 2BY2A 1K4DB 4X7FC 4WHTB 4UAOC 4XAWL 5FGBA 4F9LC 2XYCA 4PRAB 3WIFA 4HJGB 3GSQA 4NRYA 3QRGH 2AV1B 2FEEI 4S1RL 5SV3A 3PIQB 3F8UB 3D18A 3S35X 1GC1C 3TIDA 3BW9B 2X5PA 2Z93B 1RZIA 1A47A 3DUSB 2QQNL 3ES6A 5JPNB 1J0KA 4OLZL 2F5BL 1QYGL 5E7FA 5DK0B 4AENA 4OAWB 5F9OL 5D1QA 1YEKH 1BBDH 1AD9B 1F3DJ 3VD5A 5FO8A 4LQ1A 1FBIH 1YEGH 4BZYA 5I1CH 4P4KC 1ZSDA 2ARJB 1VFAA 4QXWA 5D1ZC 3QUYC 4IDJL 4K3EH 1P69B 1TJHH 3O4LE 4M7ZC 4PJHF 3L3DA 5GGSA 5IVZB 2BSTB 1TZHA 2APXA 1TPXB 1T7ZA 1DQJB 3UMTA 1F4WH 2FHFA 4K94L 1FZMA 1FFRA 5B22A 5GS0L 4WW2C 1DR9A 4OV5A 2DI8A 4FFVD 3WE6A 1IEAA 5I16A 5JZ7D 1CGSL 4J4PA 1NLDL 2VZUA 1FFPA 1YUHA 1P7HL 1X5KA 4HBCL 4HCRL 3GBNL 1X5XA 4KZDH 3T3ME 5EUOE 3WKMH 3LY6A 3DMMD 4N90D 4MVBC 4PJDF 4IS6B 2VL5B 5HYSG 5B21A 1JGUL 1FV1B 1Q9KA 3RJDA 1A6PA 5T1MB 4D0CA 3DGGB 4NQED 4L3ED 4LEXL 2Q8AL 3BKYL 3LQZB 4HWBA 1J7VR 2F5AL 3EO1B 2DLIA 1BQHA 2F54A 5EU6E 2YRLA 4MNGB 4ODSL 3D87B 1CQKA 1FN4B 1YMHB 4QYOA 1PX4A 1RIUH 1IT9L 2C3VB 3NIDF 2LQRA 1P6AB 1VPOH 4X9FA 1E0OB 2OTUB 1ND0A 4G43B 6FABH 1VADA 1LEIA 1P7QA 5GJTH 1L9NA 1RZKL 3EYSH 4GAYA 5D4QA 3CX5K 2H2SC 1KJVA 5EWIH 3X13B 4QRQB 4KV5F 3MRIB 5CEZH 1FCCA 3DX9A 3HG1E 1VDGA 4ESKA 2EIDA 1JHKH 1JN6B 1WIOA 2DLHA 2EH8H 1A7BA 5DS8B 3CSYA 5J6GB 5LGHL 5LAXA 3FOLA 4OD1H 1CU4L 2IANA 2XN9A 1FRGL 1G6RH 3CDGB 5DJ2B 3KLAB 2IGFH 4YO0B 1FG2B 1CGYA 1A7PH 4YH6A 3O9WC 5EO9A 4FQXB 4Y88A 3ZE0F 5F6HI 5EBGA 4UDUA 5BCAA 3SCMD 1CYGA 3NZHL 1FQ9C 1BD2D 3RGVB 3AAZB 2AQ2A 5FGCE 1UENA 2IFFL 4NOBA 4CW1A 4PYGA 3TWCL 5DJYB 5DYOB 1S7WA 3UTPD 5LVEA 1OP5H 1QFWL 5D7IB 2NYYC 2PKDA 5EIIB 3AS3A 3N0PB 3WN5A 1W8OA 4OIIL 2WP3T 3Q3GA 5LCVH 3EYOB 1WZLA 1S7RB 2X89D 1ZT1B 4TNVK 5D2LB 1D6VL 1UCTA 3LIZL 4NWTH 1BQUA 3LKPA 12E8L 5ALBL 1JPSH 1X5YA 4WFEE 4ZSOE 1T7XA 1XF4A 5J1TC 3D0VA 4GKNB 3P9MA 4GKOA 1U8LA 5FM5O 1Q0YH 2ZKHH 4J6RL 4NNXA 3H3PH 1GGCL 3HAEB 4JY6B 4K7PX 1G7PB 4FFYH 3RWGA 2A6KB 4DFHA 5DHVB 5DD3L 4UAOB 2N7BA 5CEXA 3NIDE 3PWUA 2CLRA 1AR1D 1KPUB 1QSFB 4KUZH 5SWSB 2VLRB 4P2OD 1CBVL 4G3YL 1KNOA 2P5WE 3MO1B 2ENYA 2FJHB 4Q6IB 1DE4B 3QXUA 5F9AC 4JCMA 3FN0H 5DFVD 5J11C 3RAJL 4NJAL 5A40E 2BY1A 2UWEE 1CDJA 4DQOH 1JYNA 3FN3A 3BPOC 4Y2DD 4HF5L 1KTLA 2AXGB 2CD0A 4NIKB 1NFIA 3O11A 4YHZH 1GZQA 1T2JA 1W2KT 3CVIH 1A4JB 4HIJB 4LSQH 3D25B 3MBEC 1HQ4B 2XKSA 3EYFA 4EVNB 4V1DE 3IU3A 4DZ8B 3MCLL 4WWKB 4FFVC 3QI9A 4U1KB 2AS5M 4EJ1C 3UO1L 1MQKL 2ESVA 3DYOA 2Y6SC 5BVPL 1VACA 4YBQC 1JNNL 3WCYA 2I27N 4J3WA 4XP9H 2Q8BH 1HE7A 4GW5B 3T0EC 1CS6A 3C2AH 1UWEL 1ZHLB 3IDGA 4PJ7F 5FYKH 1RZ7H 3K2UH 4H5SA 3VGFA 5A3IC 1UZ6E 2Z91B 3FB8A 3QRFM 5LWYL 3P3YA 2YBRA 4PGZA 3RVTD 2E8ZA 3IFLL 4Q9CA 5ICZA 5B3JE 5AZEH 3TN0B 4XMLH 4I2XB 5FV2A 2FYYB 2XV6B 1FO0B 1ZLWH 4HGMA 1ZKAA 4GJTB 3QULA 3CFKA 1GYAA 1MH5A 4Y4FD 3CFCH 1MCDA 2A83B 2DQDL 5FYLD 3VI3F 4EI5B 2IH1A 3C5ZD 5JNYB 3E6FB 1HHHA 3QNXB 4HQQH 4OGZA 4ERSL 3AXLA 3GSUB 3ZYIA 3GKWL 1NGYB 5SWQB 1FNSH 4ODTL 3BSZH 4D0DB 3D3VB 3T1FB 1IC5L 4XCEB 4Y0GA 3CFDA 4JFOA 1RJCA 4M9PA 1G9ML 2EO9A 3SKOB 2XRAL 1ZTXL 4LSSL 1IC4H 2X09A 1JWMB 1WCQA 4LOUD 5DTFA 1V7MH 4IRJA 3FT2B 3NIFE 2X42A 4JKPL 2YEZA 5C0DA 3BZFB 4MNQE 2EIZA 2GT9B 5E94B 1KYOK 1HSBA 1MI5E 2HRPH 2YD7A 1A6TA 3VG9C 2F53A 1NMBH 5L6YH 5CCKH 2GSIB 2CKBL 3OB8A 1QLEL 2KQMA 1H3PL 5JHDB 4NC0B 4YJZL 5A16A 1F6AB 5TE7H 4F7TA 1I1YA 3I3EA 4MQ7A 5IQ9A 4I1NB 2G2RA 1RJLB 3MV9E 4XCFH 3L3HB 3MLWH 5BV7B 1OSPL 4KJWC 3Q2CA 5D1QD 3KYOA 3O9WB 4JFDA 4ODHL 1PKOA 3ARFC 4LF3A 4K3GA 3GI8L 3HMXL 4FQCL 1U8NB 2DBLL 4UTAL 3KYNA 1QVOA 4JG1L 5FYJE 5DD1H 4XC3L 2X4NA 5C0IB 3NABL 4E42B 4QGYA 3GFUA 4FQQA 4BH8B 1MVUB 2YS4A 3RFZC 4G6JH 2HWZL 1E6OL 4KDWA 2CK0L 4JKLA 2IF7A 3DOSA 2OTWA 3GSVA 3LQAH 3OXRA 5KZCD 2VLMD 3WXVH 3L3KA 2FJFA 3WSQH 1W0YT 1YY9C 1I3RA 2DKMA 2R0ZH 1IAII 2R69H 4GRWB 5CMAA 3HS0A 3V8OA 2SEBA 3ARBA 3P4NA 2R29H 2B2XH 4YXKH 3JWNC 2V7HB 4MCZB 3BUYA 5T3ZD 4YAQA 1WZ1H 1FFNB 5I2IB 5KAQG 4MJIA 3TH4T 3ZMRA 2F54D 1U92A 3FCTA 3O0RH 1U8HB 4KJQC 3UTQA 1UWGH 5MENE 4TSAH 1R5VB 2HTLC 4AL8L 3VRLF 3G6AA 5F93C 4L5FL 4KTDH 1MF2L 5E56A 5MEOB 2W1NA 1X5HA 3IXTA 3UC0H 4M3KB 3DI3B 3BPOB 4JHZA 4JRXD 3CUPA 1F11B 4WEMB 1P7QD 4HDIB 5D7LA 3O3EB 3OPZL 5F88B 4EUPG 5E08L 1F4AA 2MKWA 4Y5XC 3UZQA 4H1LB 3ROOA 4JN2A 4BKLA 2ICEA 4RWYL 3D85A 3P30H 4R90H 4KY1H 2Y07L 3RWDA 2NR6D 3CXDL 2FEDD 1T2XA 3TV3L 5F72S 3NFSH 4CBPA 4NZTH 4L8CB 1MCKA 4NN5B 5KVFL 3T0EB 4HKXA 4V2BA 2MCG1 8FABA 5F7DB 3SDYH 5ID1A 1EO8L 1A14H 5CILL 4L4TE 4OQTA 4NQEB 5FCUH 3F7VB 4ZS7H 1OAUL 4GUPA 5FM5M 3I50L 4K3JH 1LEKB 2AK4A 1VGKA 4Z7QF 3GMQA 2EDDA 5IBTH 4F7MA 2RCSL 5DJ0B 3RTQA 1A64A 5E99L 3B8SA 4IMKA 1A3LH 3FO9A 5F7EH 2OSLA 4ZAKA 5HGAB 3MBXL 4R3SA 2BSRA 1WAAE 4NRXB 4UU9B 4XC1H 4LOUC 5B39B 4MB3A 1FZKA 3QUXA 4U3HA 3RHWK 1MPAH 4YQXH 5KG9A 3O41B 3HUJE 5EZOL 1WLHA 1HIML 4A6YH 4G9FE 43CAB 3HZYA 5E9DA 2V17L 4N0RA 5IESH 5C0ND 4MX7B 4ZYKA 4F8TA 1YDPB 1TVHA 4NQSA 3T65A 3R1GH 4LVEA 1KPVB 3FO1A 3NCJL 3WFZA 3VRLE 3W9EA 2UZYB 3GIVB 4MSWA 4CADA 4X7TB 4RDQG 4JQXC 4Y1AE 3CDCA 1A1OA 3EZ8A 2P49B 5KAQF 5GGVH 4ETYA 2PCPA 4OJFL 2APVA 5HJ3A 2CDEA 2J8OA 3IDYB 2Y5TB 3SCMB 1E4XH 2PYFB 1CLYH 1O0VA 3S4SB 3OB0K 2KQNA 2W0FA 3MREA 1BD2B 1HN1A 2HT4D 5T1DL 1M71B 1XZ0A 2JJTA 3W0WA 3M17B 5DD0H 4HJJH 1MCRA 3FONA 4JZNB 3BRGC 4U4BA 4UQ2A 2QEJA 4MA7H 3QA3B 3ARFB 3G5VA 1G9NL 3O6LH 3JWDH 3NCFB 1TTGA 2P8PB 5FKPB 4IIQC 5F7HA 3GSNH 1Q0XH 1JI1A 2ESVD 3ZTJG 2KPNA 4N1EA 1MHPH 3BH9B 35C8L 4ZQKA 3MJ7A 3BWUC 1NFDB 1CDHA 3QDMB 3P11L 4HXAL 4RRPA 2AJ3A 2NXYD 4TNWF 1FZOA 4EN3A 2ZOLA 1HHKA 4R4FL 4S1DD 4NZUH 4BZ2H 4DGIH 5C0AB 3SO5A 1I8MB 5FO9A 1HYRC 4YDLB 4M7LH 5EBLA 1TNNA 3K74B 2YPLA 4P2OB 5GGTL 3I6KA 1NC4A 4NKDA 5J06A 4W70A 5ESAA 43C9B 1D5BB 1NJ9A 3BPLB 4LSRH 1M05A 3UTSE 4IRZL 1NGQL 2A6DB 1LO3H 5F3HA 1CCZA 4LCYA 3V5KB 1PSKH 4JM2C 1GGIL 3QJHB 3ARYA 4Y2DB 4FZ8H 1NEZB 5CGYD 4Z7UE 3FN9A 2FX7L 4ETQA 2Z8RA 3MTRA 4HKBA 1RPQA 1R3LA 2VQ1A 5EBMB 4EI6A 2VN7A 1G7MB 3ALPA 4HMEA 5BO1L 2BMKB 1VKXA 4LLQA 4APQC 3KJ4B 1DBBL 3V4PH 1EDQA 4M61A 1S7XB 4X9HA 4W68A 5ANME 2G60L 4BQCA 3DURA 2FB4L 4P23C 4F9LA 4C4KO 5IW1B 4IRJD 4LCUB 2A0LC 2YWYA 4Y5XB 1RULH 4RDQF 4XCYB 2F53D 4LPUA 5I19L 5D2NE 4L8SC 2XA8L 4M1DH 2LAGB 4FQLL 4JREB 5C9KA 4MA8H 1INDL 2VLJE 2H2PD 3ARZA 3O2DA 3N9GH 2EYSA 1JPST 3H9SD 2VZSA 4KVNH 4P4KA 1E28B 4Y4FB 3UJJH 5D1ZA 3GMOA 3C5ZB 2EZ0C 3B6SB 1KCRL 4J3TA 3SDAA 1HH6A 2IG2H 2N56A 4Z0BL 1CE1L 1S78C 4X99A 1WC7B 1KJMB 5C07E 1A7NH 3WFCH 3ZHLA 3W9DB 6CGTA 4DKFH 1T2QL 4AIZA 3X3GH 4LP5A 4QTHA 1JZ6A 1FO0L 1U2CA 3X14B 3O3AA 2X1QA 1CVSC 1ZHBA 4TUOA 4WW2A 4Y5VB 3G5YA 4X7EC 3Q5OA 5JO5B 1UB6B 4ZFOB 3KLHD 4KZEH 4BQBA 3VFVB 5I73C 1YNLH 4XWGH 1B6UA 2BHYA 2K7QA 3NPZB 1LE5A 4HUMB 1XGYH 3OGCA 3ULVE 4LAQH 3ZKQD 1CF8H 5D6DC 2WV3A 1H8SA 3WLWD 4PJFF 4NQDB 3ARQA 2GITB 4KHXH 3L7FB 2VYRE 1RK0A 1HKLH 1AGFB 5IBLC 3I75B 3V9FA 1KN4H 3E3QE 4RBPK 4G8IB 1J88A 5AEAA 3CSBA 3WIHH 1VGEL 1UM4L 4OM0H 4L8BA 3IF1A 4X4XA 4XP4H 2CRYA 4XH2A 1LO4H 5EB9A 3TJHD 1M7IA 4JY4A 4PJDA 4MJID 1IFHH 4R26H 5FO8B 2FCBA 2YHGA 3WL9B 5CLTA 4KC3B 2M1KA 4O5LH 1IGFL 1VFAB 1F4YH 3FB5A 3BP6B 3LMJL 2ILLA 3BMVA 2VJXA 4OKVB 5E5MA 5IT2H 1T20B 2JJUA 3L3DB 5GGSB 4LLUB 1XF3B 4BQ8A 4LLYA 5D7LD 3QBTB 3EYQD 5JPMB 1M7DA 1H3GA 4RMWA 2BNRA 1OAYL 4NKOA 5D93B 4OV5B 1JGLH 3KS0H 3L3GB 4XNXL 3W82A 1IEAB 1AGDA 5KZCB 3MLTA 2V5YA 1FAIH 4MMZC 3VXUE 3HNTH 2H41A 4HS8H 4PJEE 4PRHE 2Z9TA 5CINH 4FP8H 2EH7H 3QH3A 5MP6H 2V2TA 1ZA6B 4Q58C 4LSTH 3OZ9L 2O5XL 1JHLH 1Q9KB 4ELME 2EXYD 3MJ9L 1PKQA 1A9BA 1XCTB 3RA7L 1CZ8L 2NY3C 2IBGA 4HLZG 1AE6H 1CD1A 4ZDHB 1OY3B 4KHTH 4QXTA 3KYKH 2WLZA 4MXWH 1NGXB 3SGKC 3RTQD 1A1NA 1FVDA 3K8MA 3SPVB 1AI1H 4M6ML 3LRHA 4N0YH 3BVNB 4Z78A 1OM3L 1UJ3A 4JRXB 5BOPA 2AAVA 3MLYL 1JGDA 1FLTX 2E9IA 3QUXD 1JF1A 4FQIH 4ZUUB 5I1KL 1A3RL 1MIEL 3B3IA 4N8PA 1KJVB 1HDMB 3MLXL 2NX5A 1SQ2N 4KROC 4DUWA 1N8ZB 1I1AA 4XPBH 1W72L 4JGJA 1NDMB 1MJ8L 5ISZA 2YPKA 4NM8L 1EH9A 1T04B 2V5MA 2AK1H 5EORL 2YD8A 5FUOL 4BELD 1XGPA 4JY5L 4HUUA 1EHLL 2P8MB 4M7KH 1JTPA 5KVEL 5LGKA 5L2KA 2CGRH 3OG4B 2X1XR 4XRCB 3MNVB 4ODUB 1BIIA 4KDTA 3VI4F 2CMRL 2CLVA 2AV7A 1W0WA 1A7OL 3DRQB 1QBML 1DBML 1J8HA 4NBYB 1NGZB 4XMKH 4JJ5A 2W9DH 5EPMB 2WBKA 3RWFB 1IGIH 2OP4L 5FYJH 2LVEA 1BFSA 3MBEA 4PJGF 1FNEB 4Z6A