1T2QH

The crystal structure of an nna7 fab that recognizes an n-type blood group antigen
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
217
Chain Sequence
EVQLLEESGPGLVQPSQSLSITCTVSGFSLTSYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCARNRGYSYAMDSWGQGTSVTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mutational Analysis of an Antibody that Recognizes an N-type Blood Group Antigen
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Fab NNA7 Heavy Chain
total genus 43
structure length 217
sequence length 221
ec nomenclature
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t2qH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t2qH01
2OX5A 3RPKA 3WL9A 4LLWA 3DX8B 4F15B 1OGAB 3MLUH 2OJEA 2DTML 1MAJA 2YD9A 3HE7C 4E41E 1F6FB 4KJPD 2HKHL 1HK6A 4U05A 1IBGH 3Q6FA 5ILTH 4HWBL 4APQB 3C8HA 1NPUA 3MV7D 3DX9A 5F89A 5DVLA 5FGBA 3KPPB 5IW1A 3FQRB 1BQHG 4WO4B 4DKAA 4MDIB 4PR5A 3S36L 3OAZH 3KGRA 2DQIL 2XKNB 5HGDA 2I07B 3V9FA 1XEDA 4PRAA 1SJHB 1S7TA 4M03A 5FFLA 3X3FH 1BD2A 4HH9B 2Y9RT 1FIGL 1KCVL 2I07A 3CMGA 2QQKH 1YNTA 3F62A 1JTTA 4IRJC 3ARBC 4HUVB 4D0CA 4DKEL 2ENSA 2ZSWB 3ZYIA 4JO1H 3C5ZD 4FFWD 2Y6SD 1BEYH 1T7YA 4YX2H 2A1WL 3ILQC 5BCAA 3CNKA 4PP2A 5CUSH 3MRLB 1CWVA 2VNCA 5DT1L 1X5ZA 4IRSD 5DK0A 2Q1EA 4RAVB 1KTRL 1DTUA 3LEVH 1MCRA 1OOAA 2YRLA 1UVQA 5CZXC 4KJQD 2VSDA 1N4XL 3P4OB 5GGSY 2AJ3B 2VDQL 3E1F1 5F96L 3PWNB 2I5YL 1IC4L 2BVEA 3DURA 5D72L 2Y5TB 3QEGL 3DNKA 1WIUA 2QADD 4WW1A 1KLGA 1SEBA 2NZ9C 4WU5B 3X17A 3ILQD 1NCDH 1HEZA 2AK4A 2BZDA 1WBYB 4BELD 1KJ2H 3FO9A 2PXYC 2ZKHH 4NC2B 4X4ME 5D70L 1XCTA 4NRXB 3V4VH 3BQUA 3QUMH 5F8RC 5DMYA 4UZGA 5L7XL 5T1MA 2GSIA 4IRSC 1RFDL 3DVFA 2BNRA 3ALWA 4TUKL 3VFOA 1NQBA 2P1YA 1FDLH 2Z31A 4FQJL 4N9GB 3GB7B 1RZ8A 5IFHL 4PRDB 2EEBA 1IMHC 4BQ9A 5ADOL 1UYWL 1AHWC 4TVSa 5DZLA 1V7NL 5FCUH 1AXSA 1ZHLA 4AIZA 1FBIL 1NL0L 1OAUL 4CNIA 4PJIE 2CIKB 1MLBB 1BZ7A 3UTTA 5D1ZC 4IHOB 3CLFH 3P2TA 4G8IB 4I3SL 3MGAA 5IT2H 2V7HA 2EE3A 3WXVH 2NY1B 5CJXA 3NCMA 1RVFL 1VFAA 1VHPA 3HR5A 5FYJH 5CJQL 1YMMA 5DURD 1O7SA 4D3CL 3ARGD 3MRNA 4MD0B 1M7IA 1Y0LA 1CE1H 3VFVB 4U6HB 2MCPL 3NIDF 3CVHH 2IJ0C 4FZEL 3QFDB 5DJCB 2DKUA 1BF8A 4XBEL 4NUGH 5T3XH 1H5BA 1OHQA 2DTSA 5LJYH 2R29L 3WS3B 5C08E 1A9EB 4Y88A 2VDNL 4Y4KB 5FGBC 2FCBA 4WRLA 3PHQB 3OGCB 2ADFH 5DI8B 4F3FB 2R1YA 3VRIB 1EBPA 2NXZB 1A6ZA 5T1LB 4Y19B 3U4BH 2R29H 4Z7VF 3ULUH 1KB9K 4L8CA 1SEQH 5T33L 4GS7B 2APXA 4J1UB 4POZC 3CD4A 4IDJL 2YSSB 4JGJA 2P5WE 4JM4L 3ULSA 3LQAH 1TQBB 3D18B 1IGIH 3VXRD 1NBVH 5I1EL 2P44B 1G7IB 3LN4A 1U8OA 2QL1A 1EGJH 4PGJA 3KPRA 4D2NA 1EHLL 4WHTA 2BSRB 1INQB 6CGTA 3EOAA 3QPQC 3PHOB 1YNLL 4MB4A 2IH1B 5HDLA 1HOCB 1I7RA 5DD3H 5SWSB 5K9KA 5DS8B 3STZB 3V52H 3K7UA 3AROA 1BFSA 5CKGA 5AUMA 1FBIH 1NL0H 1NBYB 5B38B 2G60L 4MLSA 2F58L 4KVNL 1Y6NR 1MJ8L 1EO5A 1GGYA 3SJVE 4ACPA 1L4IA 3PNWB 4E41D 5EZJB 1U93B 2MOVA 1R5IA 4ZO8A 1NMAL 1KELH 1F4XL 1NFIA 4Z77B 1NMBL 4NQXB 1MREH 3H2WA 2PN5A 2BFVL 4OZFB 1HXMA 3WIIL 1E4KC 1U8IA 1N6UA 3QCUL 1H3XA 3F7YB 5GRUH 1MCJA 4UIMA 1H3TA 1HXYA 5DHYA 4WI6A 7FABH 2P8MA 1LO4H 3TEUA 2F74A 3QFJD 1NMBH 4JZNB 3LKOA 2FYYB 2AJVL 1WIOA 1TCRB 3CSYA 1LO5B 4FTVD 3B5HA 3C2AL 1KGCD 3PUCA 3GJEA 2IPKA 1H8OA 1YEEL 2ZUQC 2EDEA 1U0QA 3KWWB 3WEXB 4U1SB 2P8PA 3WO4B 2DQDH 3N1FC 5IB2A 5A40E 3REWA 1FVEB 5I8CB 1HN1A 5GHWH 1QFWL 2UUDH 1XT5A 4Y1AB 1CFSA 3RZCC 3IDYC 3SOBL 5D8JH 1LK3H 1K8DA 4OZ4A 1CL7L 4JFEA 3IFNL 4ZFZB 1QBML 1T5XB 3SPVA 1UJ3A 2A1WH 4M93C 1W0VA 2G9HA 1BEYL 3DTXA 1BVLA 2VYRE 1LP9B 3VJ6B 1BVKB 4GKSB 3FO1A 2RCSH 3CFCL 4GMTH 1F13A 5AWNH 1GGCH 3U7YH 4NYLB 5C7XH 1BAFL 3OGOE 3SGJA 5DJ0A 1S5HA 3C8DA 4X8JA 3SKMB 1KCVH 4NJAH 1PZ5A 4JPWL 1GZQB 4MCZA 4PB0L 3IETB 3FCTB 1YPZA 4Z7QE 2ADFL 5C2BL 2R2CA 2Z35B 4GAGL 4ETQA 4UILL 3BD3A 4JQVC 4L9LB 4HKJB 4JM2A 1BWMA 5HYEA 2QEJA 2Y23A 2LU4A 5HGBB 3ULVH 5D71H 1T0MA 4YHKL 3IDJA 3ULVF 2XQYG 1JI1A 4JN2B 4X9GA 1V7MH 1RI8A 5C6TL 1MHPL 4OM0L 4WJ5A 4BKLB 1Y6KR 1EGJA 3MRBB 4TOYL 2ZCKL 4FRWA 3OKMA 3LH2H 3V7MA 3C87A 4PRNB 4LPUA 3EDEA 2H9GA 4P2QB 4KXZH 1CLZH 3Q5YA 4O9HH 2LVCA 3CU1A 1WCBA 1RZKL 4GQ9L 1KBGH 3SDCC 4BZYA 1OSZA 4Q9BA 4KMTL 5CP3H 5DF0A 2J6EA 1Q9LA 1WEJL 2BNQE 2ZCLH 2FGWL 3O6KL 1RUKH 2VDLH 2XA3A 5C0GB 43CAB 4UOW0 1SY6L 1UYWH 5CMAB 1MFEH 4QKXB 3MJ9H 3L95B 1A14H 4F9LA 4EDWL 5EBMA 2QQNH 4CVXB 4P49A 4CVUA 3UTOA 3GBMH 3QIBC 1FVCA 1JPSL 4X5WB 1JWSA 1NEUA 4FQJH 2R0ZL 3QJHA 2OR9H 5F71A 4OGYL 5GJTL 4B0MM 3GUTB 5E5UB 5C1MB 2Z93A 4C4KT 4D9QD 2YD1A 5D9SB 2DWEA 3N06B 4X8JB 2QSQA 5EO9B 3IXAA 1UXSA 3QEQE 3BDYL 4GKSA 4QRTB 2RIKA 5JOPD 2JCCA 1AQDB 3D0LA 2JLLA 4U33A 4LGPB 4CJ0A 4G6KL 4F7CA 3DROB 2MPAH 2GY5A 2DRUA 5GZND 3DYMA 4PJXE 5E2WL 1CN4A 4FQCH 5DO2D 2VZ3A 4LHUB 1T20A 3MGTA 1AI1H 1N4XH 2AXGB 1T0NA 4XXCC 4HULB 2OS7A 4JM2F 3MNVA 3ME0A 1UFUA 2C3WA 2LABA 2VLRB 4BFGA 4H5SA 1BMGA 3UPRB 1LEIB 2XOTA 2AVGA 1S7XB 2QQLH 3AB0C 3MV01 3LD8C 3LZFL 4APQD 5C07B 1S5IL 3CSPA 3ARDB 4XPFL 1PX4A 5CUSL 5H35A 4LDOB 3KVQA 1MEXL 1T7VA 2GJ6D 1TETH 5HHXH 4NFDA 1A1MB 5TE6H 1TJHL 5IR1B 5CJOL 3WFDL 3O0RL 5I1DB 3IFPA 4I1NB 1ZT4A 4JFXA 4GKOA 3DRTA 3TBYA 2ORBL 3DX6B 1SQ2N 1UH4A 1Q0XH 1FSKB 4QHNA 2I9LA 4PJFB 3DV4B 4XZUA 5DR5H 3T04D 3DJ9A 1YEIH 3UBXA 1LEGB 1M6OB 5E4EC 3O11A 5KTEH 3O2VL 2D7QA 5DJ2A 3SJVD 2ZWLT 2COQA 5HHQB 3A6CL 1LD9A 5IG7A 3CZFB 1YEFH 4U4BA 4APQC 2YKLL 4RMRA 4KUZH 3AU1B 2C7UB 5FV1L 4NQDB 2V7NA 2ICEB 3HE7B 4HWZA 1L7TH 1CICA 1XF2A 2YD7A 1OAXL 3HLAA 5DMKA 3IDIB 4AENB 4HAFA 4G6FD 1FIEA 1EZVY 1X44A 3VXTA 3B2UC 5TE7L 4NPYA 3CX2A 1KUMA 1NAKH 1CDIA 4BFBD 3GO1L 1ORQB 3G5YA 2IGFH 3FQXB 3BJ91 4JDVB 5FYKE 1JPTH 2NXZD 4WFFE 4G9FA 2P5WD 4KKBC 2H2PC 1Q9WB 1KGCE 1CTOA 2Y7QB 2QHRH 4KXZI 1EAPB 5FO9A 1JGDB 1JRHL 4KQ3L 1MJUL 3IKKA 5JORB 1U8LB 3GKWL 5C6WH 3UTZA 5D96B 2D0FA 4XCNB 3B3IA 4LARL 3FFCA 1DR9A 1TVHA 3P11L 4ZUVB 5BV7L 2ICES 4NWTL 2Q20A 4F3FA 4HFUH 4IRSA 5DFVD 2VXSL 4G7VL 2Q87A 2A83A 4TNWK 4TRPH 4ZUTA 2JK5B 3HPLA 1G7LA 3LRSB 4CKVX 5DK2A 4Y5YC 4RFNC 1AO7E 4MA1C 4Z8FL 4YGVB 1ND0A 2NY3D 4MB3A 4YDVA 3FT4B 2NLJA 3MBEB 1NGQL 2NYYC 2XN9D 4JAMB 2H2PD 1RIVL 2IQAB 2VDOH 3SDYH 4JG0L 5HTSA 2FBJH 4ERSL 1Q8MA 4PJ9C 2NY1C 3FHQA 4DKDC 2OSLA 2VN7A 4NZUL 2DIBA 2VQTA 2P7TB 1DBBH 4D8PB 2OZ4L 5ITBH 2HJFB 5JQ6L 4RMVA 1YUHB 4NO2A 3QO0A 3QFJA 4WWKD 1P53A 5GGTL 2ZOLB 1XGPB 5DFVC 4H1LB 5FCSH 4NRYB 3VDBA 3KYMB 1DL7H 4TYUA 3S35L 4OFYA 1OT1A 2NX5E 5ICYA 4Z7VE 3KDMA 3ZHKA 3PQYE 1JRHI 3MNWB 2DQTH 5SWQA 4DOHE 1WZKA 3LKQA 1UA6L 4CUCA 5E8PB 3IS0X 1IQDA 5T1MB 4AL8H 5DVMA 4NGHL 4OZIB 4LP4A 4IMKA 1J05B 4PTUB 3ROLB 5FF6A 4KRMB 1TMCB 1KOAA 2DQHL 2N7AA 1YJDH 4DN3H 3ARQA 4U6VL 3ARTA 2AAVA 4NP4L 2DAVA 1PQZA 2X41A 5ESVB 4WU5A 3T77A 4UTAL 2F54D 1G6RB 3QXWA 4WW1B 1KN4H 5EOTB 4NZTH 3TNMA 3WHXA 3TBVA 3QIUA 3L1OH 4CMHB 5KVFL 5CBAA 1NCAL 1PG7W 2VR9A 1JHKH 3T2NH 2W9EL 4TNVF 3ES6A 4JG1H 3CFEB 3PP4L 3QXVA 2OYPA 5GSRB 2XQBH 1NC4B 1QNZL 3O8XC 2F54A 2VUYA 3EYOA 1EEYA 3TT1L 4JCMA 3NBNA 4JPIB 3RDTD 5HVHC 4LLYB 4Z5RA 3D2UD 1A9BB 5E9DB 4PJ5A 1U8KA 4X80L 1NEZA 5FF6B 1YPZE 4HGKC 3ZT5A 1QTYT 1R3KA 4Y8DC 2K9UA 4KMLB 2FGZA 3WFCL 5L0QB 4OD3H 2QHLA 5IWLC 1FFPA 4H20L 5BZDA 1NLBL 3V8CA 3D85D 5HJ3A 2VRAA 2GTWB 2Y25A 5KZCB 2Z92B 4ENED 3ARBB 4FG6C 3VWKC 4DAGL 2KZ1B 3TN0A 3F7QA 2X05A 1WAAE 1QYGH 5LGHH 4DVRH 3SDDC 1OVZA 4OT1H 3L5XL 4RNRA 2WIIB 3TT1H 1I3VA 4H1LG 3GSQB 2WLZA 1AP2B 3HZYB 3QEQA 4H0GA 4UV7H 1DE4B 5GIRA 2WWKT 4JG1L 2QKIB 1QRKA 3P3YA 5IBUB 3LPFA 3UJTH 4Q0XH 3ZKND 1XMWA 2OR8A 3TA3C 4O58H 3KPQB 4Z7OF 1OWRM 3VA2C 1DBKL 3QEQD 2NLJB 3MBEA 5GGRB 1N5YH 1M4KA 1F3DH 3MRHA 5C0EB 4DUXA 3UJIH 4Q6IC 2MKLC 4O2EA 4PG2C 1VENA 1YJDL 4FABH 1E4XL 4B50A 1PY4A 3JV6B 4LF3B 5J3HC 4PRBB 4X0KB 2A83B 3VXUB 4F9PA 1G9MH 3CUPA 3P73A 1FZMB 1JI2A 4MDJB 1GC1L 3B3IB 1GGBH 1KLUA 2APFA 5KVGH 1YNKL 4GO6B 5IHZA 1NDGA 2GITA 2A6KB 2VERN 2BVOB 3K8MA 2CIIB 1UH2A 1FNHA 4M4RA 2KBGA 5GS1B 1GGBL 5KVGL 3P77B 3VD4A 5D7JD 4WY7L 2GUOB 3QAZC 2HLFD 2C3GA 5I19H 1D5IH 2NW2A 5F93C 3WUWG 3QUYA 1IEAA 2OZ4H 4YLQT 3RUGB 2MTPA 1F4AA 4AYFA 1P5VA 5DUML 2YA1A 1HQ4A 3UJIL 4DZBB 3MRKA 3B8YA 3C9NB 4HV8A 4BZ1H 4C57C 1G9EA 2DDQH 1MHEA 5L2KA 1ZAGA 3HLAB 1HQRB 4RA3A 3MJ8A 4P4KD 4PLKD 1MCOL 1KLUB 1T04A 2GJZB 4HDIB 1WF5A 1AE6L 3MOBH 1IFHL 3QNYB 4AMKL 1YN7B 1KULA 3QUXC 5C0IB 3TO2A 5HSFA 4J3OC 3MV11 3ARZA 4M02A 4GW1A 4UV7L 4D9RE 3U46A 4M4PA 4LF3A 5LQBH 1M6OA 3OB0H 3D85B 4NM8L 2HLFC 1Q9KB 2ZJSH 1G7HB 3I6GA 5TDNA 4EIGB 3WE6A 4OT1L 2EH8L 5B4MD 2BRQA 4PJFA 3QCVH 4BSVA 5BXFA 4I9WE 3WFBL 4P5TB 4P48A 3WFEH 4Y4FD 3KPQA 1D5XB 3TT3L 3KLSA 4M8VA 2DQCL 3ZKQD 1JNJA 2W91A 5I1DA 2JJTC 5ERWA 5I1IL 4CMMB 4MQTB 1A1MA 4JO4L 1V3JA 2IGFL 4ORGA 4ZUUB 3QO1A 4OLVL 1WT5A 2W0PA 1QR1B 2PYEB 3QG7H 3WJJC 3HN3A 4LHJB 1U92B 5BV7C 4O51B 1ERNA 1FJ1B 2FHFA 3K74B 1L0QA 1QLFB 1CGVA 5E00A 4KK6D 3MV9D 4OIBA 1P7QB 5I1HL 1OARH 5EUOA 4XAKE 1LO2H 4KUZL 1I9JL 3ISWA 3SGEI 2W9EH 1MI5B 1VCAA 1S7QB 1FFPB 4U1KB 5I17B 4BQBA 3L1OL 1JF6A 4L8DB 2FJGA 3F7RA 1IC5H 5D5ME 1F45A 3IDXH 4NZTL 1A6AA 4N0RA 5DJ8A 2E5EA 1PG7H 1H3PL 4FQ1H 3TNNB 4ZD3H 2IAMA 5F1IB 2ZNXA 1I7ZA 4NP4H 1G7QB 3NPZB 1FLTX 5FYLD 5DD1L 5JHLL 4V1DD 1T22A 4OQTH 3FL7A 5J13B 1A1NB 1KPUB 2JJUA 4OD2A 4J3SA 4ONOA 3RWIB 4GUPA 5C0FB 3NAAH 3SE3C 2QLVB 1FZKA 4X6CB 1JWSB 3ULUD 3O81A 4QXTA 2UV3A 3O3EB 4YDIL 2E9JA 3H42H 1RUML 1MRDH 1U36A 1YQVL 3H3KA 4ODBD 3L5JA 3KPRE 4GRWE 4DZBA 5JNYB 1F3RB 2X4QA 4XPHH 1W0WB 3VE0A 3EYUH 2H1PL 5KSVB 5KANI 4PJBF 2OI9B 3HRZB 5M7QA 5SV4A 2F5AL 4EKXA 2NTSP 3MODH 2AXHA 5K9OB 3TIEA 1U8JB 3MLTA 1MRFL 4NC0B 3S37H 2AERT 3AAZA 4MS8D 2EO1A 3LS5L 2EDXA 4BKLA 2A6KA 1FPTL 2E7CA 4PJXA 4PJEE 3ROOB 1I7TA 4K7PH 4MD4B 3GMOA 1KPRA 1XGPA 4OIAA 4MDJA 5F6IB 4P99A 3QWRD 5H94B 3VXUA 2FIKB 4HIEB 1DBAH 3RPIB 1WTGT 2YUXA 3CLEL 2R0ZH 4PLOB 4LARH 4I3RL 5JO5A 3TH4T 3TWCH 1UH3A 3MROB 5GGRA 5I15H 2CXGA 4UQ3B 1OSPH 3HE6A 1G6VK 4WU7B 2FO1A 3W11D 4XI5C 3GMRA 3G6JF 5JIIA 4J3VA 1Y6MR 1BQLH 2NTFB 4GBXD 3T4AA 4CVZB 1J8HE 1N0XH 4OBSA 4G80B 2VUOA 1PG7X 3QEQB 3HZYA 1MIEL 2OL3L 2VR4A 1Z3GH 2E6PA 4MVBD 1S7UA 3MFGB 3JWDH 4TULL 3D39A 3VWJB 3IF1B 5F7LB 3RDTB 2X4NA 3JSSA 5CBEB 4HEPG 2VZOA 3B9KA 1KFAH 5FK9A 1MHPH 2W60B 2GTWA 4JFHD 3QI9D 2YKLH 1NGWA 3EO9H 4LNVA 1RAMA 2EIDA 5GSVB 1BBDH 4PJBB 3VFMB 2X44D 5F7YC 3UTSB 5D2LF 3D2UB 2NY5C 1T1YB 3HAEH 4X6BA 5T3ZH 5KW9L 1HHGA 3RY5A 1U8KB 4UNVA 3V7AG 5ISZD 4KK9D 1S3KL 1Z5LA 4R4FH 1I3RB 1HE7A 4G8GD 1XF2B 1C8PA 5GS3A 3D48R 1ES0B 4Y16D 3U0WL 3GIVA 3TYFA 3LS5H 4PJFE 5TE6L 1ONQB 5JW4N 2YPLA 3ZE2E 1R5VB 3QUXA 1B0RA 2EIEA 4K23H 1EZVX 4XPFH 4YK4C 1VPOH 2VXUL 4OV5A 4EI5D 5I1AA 1AXTL 1LNUA 2KKQA 5MEOA 4NKOB 4YXLH 4ZFGH 4XZUB 3IDNA 1NCUA 1I9IL 2YD5A 4S2SB 2EDTA 3IJSA 4XAKD 3ZYOA 3AXLB 4P5KA 5IMOA 3UAJD 1Z0MA 5KAQG 1IQDB 3HNSH 3OR6B 1Z9LA 2A38A 2W0FA 5T3XD 5EORH 1F00I 3WFZA 2ZG3A 4R0LB 3MNWA 1X5IA 4GH7B 2DQUL 3GI8H 3IU4L 3GSXB 4Y16C 1CE6B 5KAQF 5GGRY 1MFDL 1LO4L 3P4NB 2H6PA 5ANME 1WC7A 1J8HD 4K3DL 5GRUL 1NSNL 5F1NA 3PGDB 2HG5A 3I84A 3T65B 4U1IA 4L8CB 2A9NH 4KZEH 4RFNB 3BDXA 5F72S 4MQ7A 1KB5H 1TZHB 2AJYL 2XWBB 1Z2KA 4OGYH 3RAJH 2BY0A 2P8LB 2R1WA 3IDXL 3NN8B 3D3VD 5FYKL 5KN5B 1DQMH 4OI8A 3AUVA 2I9TA 4HJ0C 1KC5H 3DX7A 4QYOA 3V6ZA 5IOPB 3KPSA 3QIWA 3OZ9H 3FT4A 1M7XA 2MQCA 3OL2A 2RR3A 1RIUH 1KJ2A 2HVKA 4O2FA 3BW9A 5I1HH 1SVZA 4MD0A 3MRNB 3VFVA 1HYRC 2XTJC 4ZXBD 3VXOA 1IAIM 3OKLB 3QEHA 4HK0B 4M93B 1R6VA 3OJDA 2PCPB 5EWIL 3VXSD 3GKZA 4HQQH 1DQLL 1A3LL 2XWBA 3TYGH 4PJ9B 4AEIH 5IF0A 3U6RB 4JKPH 2XN9E 3SE3A 5KOMC 3U79A 2ZCKH 1HWHB 1OQXA 4CVXA 4X4XA 4A6YH 3KPSE 1JHLH 4OLUH 2CIKA 3EJYC 4TSCH 5LGJB 3VXPA 4HUNB 2NZIA 1ZE3C 4JZOA 1NCNA 2GIYA 2NY2B 5IM7B 4Y4FB 2ZUQB 2NY0C 3QCVL 2HJLB 1QA9A 2C3XA 4JDVA 5C07D 1Q94B 4UB0H 4MD5B 4R2GD 2FX9H 2ADGB 2ZJSL 2Z31B 5JW5A 1OCWH 1VEMA 2NX5B 4JRYA 1U8NB 1FNGA 2IAMD 2Z91A 3E8UH 3KS0H 4OLWH 2P5EB 4DOHB 2EYSA 3V0AC 4XH2B 3H9YA 4NJAL 4U1NA 1X4YA 5IBLD 3ZE1E 5T3XL 3MOBL 1WK0A 1YC8A 5C8JA 1S9VA 3LEYL 3DIFA 1GGCL 1WWCA 4K2UL 4MYWB 1S7VA 3FZUC 1SEBB 5HDBE 5I9QC 4GKNB 3BWAB 4OV5B 3O4OC 5F6HI 1QEWB 4HKJA 1B0RB 4RAHA 5C0DA 2BCKA 2DQEH 1YMHB 4X7CC 5CEZL 2YRPA 4K7FB 1KXQE 3IETA 4P2OD 1T7ZA 3TP4A 4QOKA 3QUMB 5IT2L 4A2MA 1N6QL 1G7PB 4WNQA 3U36B 4YO0A 3KPRD 3NGBC 3OXSB 4NYLA 3QUZD 4MB5A 4J12A 4OZGF 4RA0C 1G9NH 5FO7A 1I1AD 1LP9A 4XBGA 1BVLB 4RGND 3DRQA 2OJZH 2CDFB 3D39E 1UJ3B 2DQEL 5EU7E 4ALAL 3PDDA 5BW7A 2EE2A 1I1YA 3EOTH 1LO0L 5DZOA 4LCWE 4P4RA 6FABL 1S7XA 3WBDA 1MIML 4Y16A 3CFJB 5GRXG 3VRJB 2A0LC 2KQMA 2ZKHL 4JPKL 4P2OC 5J11B 3QIUD 3O2WL 1A7OH 4J8RB 2J88L 3STBA 1VGEL 1N5YL 3BP6B 1S7UB 1VEOA 3C8KA 2R2HA 3TO4B 5IGXL 4IJ3B 3CU7A 1MRCL 5L2KD 1BBJA 4LLMB 4L4TB 2FX9L 4G80A 4I5BB 3I6LE 4TTDD 4Q0XL 1YMMD 5KJRL 2VLKD 1H3GA 2I5YH 4LSDA 5D4QA 4RGNC 5KSBE 2NY5H 5IROA 3QWOA 5ESQA 5JR1H 4U0QB 5F7HA 4IS6B 4WU7A 3N1PC 3FOLA 5SX4H 4YZFE 3LEVL 5D9SA 3VW3H 1T1WB 1BOGB 1JK8A 1GZPA 4LHQB 4ZTPH 5JO5B 5EOCL 4S1QH 5IEKA 5D7SH 4WW2A 4QNPF 4DFHA 1I9EA 3QSKB 3OPZH 5EZJA 5FGCB 1NLBH 3MYZA 2APTA 1FFRA 5EIQA 5EBMB 2CO7B 1N5AA 5E5MB 2PETA 1Z6JT 4MWFB 5HHPA 3PXHA 4KMQA 4LHUG 4UNUA 5HYSG 1ZANL 1QO3B 1P84J 3BZEB 4YIQA 5B38A 2XNAB 2R56L 4IMLA 4XNMA 5SX5K 2AV1B 2UWEA 4E5XA 3U4BL 4GG8B 2G5RA 5K9KB 3T0ED 1RK0B 1WCBB 3WNKA 3E6FA 2J8UA 4I0PA 3RAJL 3QDAA 3PWPD 4OZHF 3HS0A 4L29B 4HS3A 3OKKB 1INQA 5IWLA 4PRNA 4I0PD 3U7WL 1IGYA 1BQHA 2CK0L 1YZZA 1W0WA 2VABA 1JGEB 1D5MA 3PWJB 4HWBH 1SM3L 3FAWA 4XCCL 1FFNB 1WLHA 1V3MA 4ONHA 3QEUB 2NY4C 4A2LA 4JDTH 4F2MB 2A77H 3MLVH 4B7IA 4ODXB 1NJ9A 1CF8H 3G6DL 5L8LB 1F58L 4U6VH 4MA8H 1D6VH 3IVKA 4XHJD 5HHVH 1FZKB 4X6CA 4HGWA 5DRZA 1BIHA 1A6WH 4OLYH 4ZO9A 5I16B 4W4OC 1C5DA 4MXVE 4K71C 1INDL 3HNVL 3IDYB 1MPAL 1J87A 2C3VB 1S5HB 5IROC 5GGUB 1KTLA 3FOMA 1I1RA 5L2JB 2BVQA 3S9DB 1A5FL 4K7PX 3AFLA 4K23L 3HR5B 4CAGA 1T5XA 1J1XH 2O61A 4ZFZA 2VLKA 2X1QA 3HI5L 1SJEA 4OGAD 2AJSL 2XWTA 5A2JH 2Y06H 3MRCA 1CICD 2X9YA 1OGAD 2EDKA 3L6FA 5JQ6H 4N8CH 4ONGL 2EDYA 1CFNA 5EUOB 1TQCC 3UTTB 2ARJA 1JPGA 2GJJA 32C2A 3KPNB 3WKML 1I8IA 2R39A 2CJUL 2FBJL 5J11C 1NCDL 3C60C 2DBLH 3FJTA 4UOW1 4HT1H 3BH9B 3FONB 1U92A 5I73C 1T83A 1NGQH 1F6AA 3C08H 1P2CB 2W9LA 3NCYP 4N9GA 3V2AR 2GT9A 3CSYB 4Z7VA 4NQEE 4WGWB 4JHBA 4KI1A 2DOCA 2FX8L 1FL6A 3BWUC 2IFFL 4OFIA 2F74B 4PV9A 1OP9A 1MFBH 1EVTC 1OD9A 2VR5A 4NWTH 4ZQKB 3D0VA 4JFDE 4X98A 1QSFE 5DT1H 4CDHA 1G7HA 1J0JA 3I6GB 4OM1L 5TDNB 2O93L 3BAEL 1MJJB 3QI9B 4M7JH 4G8EA 2Y5TA 3B8SA 5K93A 1U93A 4R26L 1IM3B 3RFZC 2GYSA 3F12A 3HZKA 1LO3H 3G5ZA 5I66A 1T04B 5ICXB 1IKFH 1SBSL 3VI3F 2DM7A 4HH8A 2EE9A 1OSPL 2IH3B 2ZSVA 3EDJA 2L7UA 2IBZX 2YPLD 5DK0B 5F7UA 1IGCH 3O9WA 4I3GA 1E6OH 1F3JA 3DXAE 1KTDA 4GG6B 1YN6B 1OF2A 4NQCA 5JHDA 1CBVH 3IDMB 2MNUA 3NZ8B 5D7JB 1BD2E 5T5NG 1FP5A 2XN9A 1IAKB 1IEAB 4R9HA 3KPRB 3MJ7B 2DIJA 1P6AB 2BRRH 4Y4KC 5JOEA 3FRUA 4TVPE 1NLDL 3VXNB 3X12A 4DGYH 1NBZB 4OV6F 5FO8A 5TDPB 4L4JA 1DQJA 4ZO6A 3TN0C 3UC0L 5IESH 3HE6C 3D87B 5AAMA 3WCYA 3R06A 4TUJB 1S9WA 2K7QA 5DZNA 1SBSH 4PJ8B 5EULV 4HG4J 2BOCB 5DTFA 3VG9C 3SE8L 4PRBA 1LO3L 2C5DC 4RWYH 3WLBB 5J6GB 4JN1L 1OM3H 4NKMA 4R26H 5TQ2L 1KXTB 4MMXC 1UB6A 3HG1A 3MRDB 3Q6FB 5ACZB 1FAKT 4E0RB 3MV7B 3QIWC 3VFGL 5D6CA 1YQVH 3RX8A 1M7IB 1Y0LB 3GBNH 4Y4KD 1JIBA 3H3PH 5FM4A 1LE9B 3LQZA 3NGBB 1MCKA 2R0WL 5INCB 2X89A 3SDXF 1BP3B 4JFFD 4C56B 2AV7A 4P2QE 5CEXB 1N3NA 4BH7A 3GEWB 3HMXA 2QKIA 2FH6A 4NN6C 4EJ1C 3S88L 5EC1B 2HT2D 4X6DE 3REVB 1CR9H 1D6EB 2A74A 2YHGA 5LWYL 3G6JE 4ZSOB 3NIFF 3QR2A 3H9SE 1MLBA 2PW2A 4XCFH 2LTQB 5TH2B 4XC1L 3U4EB 3MLWH 3ARBD 1CDCA 5I9QB 1KG0A 5IFAL 2HFEA 4NOFA 5AD0A 5DRXB 3OJVC 4GW5A 5DD0L 3BPOB 2VKWA 3W2DL 1C5CL 4I18C 3C5ZC 1J0IA 1MWAA 2RGSA 1K4DB 3O6FC 1QQDA 2DS4A 5I18L 2B39A 4ODHL 5JXED 4HIJA 5HHNA 3X14B 4M7KH 2YPLE 1Y18B 4MHHI 1NEZB 1XF5B 2APWA 3KJ6H 3VA6A 1J12A 2YPKA 4BSWB 3K0WA 3UTSE 1QQDB 1TZGL 3G5XB 4XT1C 1WTLA 3G6AA 3SGEH 4EDWH 3VG0H 2B1AH 1EEYB 4S1SL 2XICA 5AD0B 2CLZB 3HAEA 1RZJL 2VXQH 2EKJA 2KUTA 3DUUB 3CXHK 2C4FT 2HKFL 3PWLB 4NT6A 4LVOC 5CD5C 5T5FL 5EU7C 4N5ED 2NZ9D 5BS0B 5JQHC 4Z7NF 4L8SB 3P40A 4Z76B 4PY8J 3E6HA 3ZL4H 3AM8C 3FQNB 1NKRA 3OKYA 2ATPA 2DQFB 3WFBH 2R69L 1G6RA 2IPUG 4ZXBA 2VLRE 3PV6B 3RWDB 1U95A 1F58H 1H0DA 3HNTH 5BOZG 3SCMD 4R7DA 5A1AA 1J0HA 4NO5A 4WFGD 4U6YA 3OKDA 3L3OA 4S1RH 5GRJL 1C16A 3AGVA 1F5WA 4S11A 3LEXA 3WD5L 1V7ML 4E0RA 1M71B 2CO6B 2MHAA 2OL3B 4YHKH 3SBWA 3D3VA 5DVNA 5ACMA 4AMKH 1FL5B 2CPCA 1MCOH 3NFNB 1OPGL 1S9WB 2NXYC 1BQSA 1S9YB 1GRWA 4FNLH 2DWDB 2DL9A 2VITA 4LPXA 1AJ7L 3H9HB 2J4WH 1UZ8A 4KKCC 1A7QH 4RMSA 4P46D 3VWJC 2VOTA 2DN7A 5EPMA 3S36X 1A6TA 1MFAH 5TPWL 5JIKA 1EEUA 2PKDA 2X1PA 5TDPA 4OB5H 3D9AL 1NGYA 2B20A 2DBJA 3HKFA 1CGYA 3BGAA 3N85L 5F7DA 3K3QA 4GBXA 4KV5E 3SO3C 1UXWB 4KDWA 4F7EB 4WI4A 4GXUN 4L1HA 4DFIA 2J7LA 2V9QA 5FA3A 1NMCB 4P2OA 3CH1B 1O7VA 3IXTB 2CMRL 1TVDA 5EBLB 1WAAA 2PR4L 4YE4H 4NWUL 4WEBH 3RWFA 1QFOA 1BF2A 2FD6L 4Z7WB 1MSPA 5GS0L 4R8WL 4KKCD 4LLUA 1ADQL 4AEEA 5ITFB 4JQVA 4OUUA 5F6HJ 1WBZA 4FABL 2HAZA 3VH8G 2H41A 3TIDA 3HZMB 3HZVA 2V2XB 3DHMA 3G5VA 5EZLA 4RFEB 4F15C 4JFQB 1BOYA 3DV6B 4O58L 1YY8B 1T83C 5IJVA 3OAUH 4NRZB 4OF7A 3QPQD 5E94A 2D7TL 3DVGA 4GXUM 5E6YA 2OQJA 4F9PC 2Y07H 3OXRA 2OI9C 3ILPB 5EU5A 2FJHB 2GT9B 4EN3C 4G6MH 2FECI 4M62L 3BSZL 3FB7B 3LSOA 3EYSL 3S97C 4DVBB 2HJKB 4L4TD 4LCWA 4MJ5A 1E4KA 4ZMAT 1ETZA 1UB5A 1U8MA 1AD0A 1D5ZB 1GHFH 3OHXB 3W82A 2A73B 2FLBT 2VE6A 2HMIC 1WZ1L 3BVNA 5BQ7A 1LD9B 2HRPH 3HG1E 2FEEI 3W0WB 1KCRL 3DXAA 2NW3A 5DJ2B 4GG6F 3ECBB 5JPMA 1AR2A 3CXHJ 5ID1A 4WV1C 4JRYE 4W4OA 2H45A 4MJ6A 5CEZH 2VL5B 1FG2B 1VGKB 4HKXA 2B0SL 2DJ4A 4V1DA 2J4WL 3QRGH 4JO2H 5FYKU 3IKCA 5T3XE 4CW1B 1BLNA 4R4BA 1CG9B 1K5NA 3GHBL 4OKVB 3HB3D 4F7TA 4DN4H 5GGUA 2FR4A 1MAKA 3LEYH 1CGUA 1CGXA 5E2VL 3VFNA 4O2CB 1YEKH 3MC0A 1E6JL 5IR1A 2JB5H 3QIBA 1SEQL 5T33H 4XGZB 4M6NH 5TQ0H 1C5DB 3MREB 3NIDE 1FVDA 4OZIE 5HI4D 1CXKA 1J8HA 5J6HA 4JFOB 3BH8B 4U1MA 1QFWI 2NY6D 3NA9L 4HGWB 4MXQD 1XIWC 4UB0L 1FFOA 4LCUA 4PJDA 1FNEA 5F7MC 3FFDB 3HNTL 3UPRA 2X1OA 3ULVC 4QRQB 3RGVA 3MZGB 5JMRA 3HPJA 3H6JA 5IMLB 3VXSB 4WI5A 3CVHL 4ZYKB 3MGTB 3B43A 4L4VD 4NGHH 2VABB 4PTTB 5J1TC 4TSCL 3S98A 3V0WL 3QCTH 4GRMA 3PDGA 1X4ZA 2P49B 2QSTA 5J56B 3SE9H 1QSEB 1AD9A 4F7CB 3HB3C 4N0FB 4U1GC 1BWWA 3BP7A 1PEZA 3VXMB 4L29A 4HQQL 1QVOB 4GMSL 3C5JB 2WBKA 4K9EL 5IHUH 4QRRA 4Q58C 4X6DA 4E5XB 3NPSC 4UV4H 1JE6A 1R3HB 1UXSB 5E6ID 2W65B 3INUL 5L2KE 4LLVA 4WUKH 5TE4L 2WW8A 5E8NB 2FO4A 4OCWH 1XIWD 5ID0B 5ITBL 1DLHA 5KSAA 1FL3A 2I27N 5I8OH 3AY4C 4ORZC 4XBPB 4GLRH 4PJ5D 3AREA 4QGYA 3T8XA 2AGJL 1RJLB 4KZDL 1DQML 4OCNC 2A6DB 2HH0H 5E24E 3OG4B 4LQ1A 4OIIL 1P4IL 4HAGA 2BSTB 4P4KA 3DGGB 3LN9A 1DLHB 2H2SD 5KSAB 1IAOA 1RJYB 1JCKA 5JOFB 3G9AB 4RFOH 4K3GA 2DMCA 1JK8B 4P2QD 3S4SA 3I2CL 1HH6A 1IGFH 4XNQA 1X3DA 3BKMH 2DLFH 5CHNA 1SY6A 3FOLB 3T3PF 4EVNA 1CR9L 1FLRH 5C92A 4M7ZC 4Q7DA 2LE9A 2A6IA 4HW6A 1G9NC 1TVBA 2H9GB 5IFJB 3JWOL 1MWAL 1QRNE 1A64A 4NQUA 5ANMA 2HT4D 2VL4A 1F8TL 5D1QC 3EZJB 3MJGX 4NM4H 3X3GL 1UKQA 3QG6B 2IMMA 2ADIB 5DJYA 1OAQL 5HGBA 1BFOA 5C6PB 1QG3A 3UJJL 1S7SB 4J4PD 1GPOL 1IT9H 4PY7A 2H2SC 5IEHA 3VRJA 4YXLL 3LIZH 3FRPG 4X7SL 4JY5H 4LEXH 1OQOA 3VXUE 4JR9L 4YDKL 1F90H 4LCYB 1VFBA 4HUWB 1ZT1B 2F54E 5DJ6B 1BJ1H 2IEPA 3CFDA 3EOYG 1JMXA 1FG9C 4XCEB 3LAFA 3VXRE 4TUOB 1W72L 2ENYA 3GMQB 4U7KA 2F53A 2FB4L 1KPVA 3M17B 3VFNB 1E4WL 1MCPH 4KKLC 1KIRA 5F9OL 1K5NB 2W9DH 5DA0B 3GMQA 2X4RB 2BXZA 5F21B 1BLNB 2C26A 3OAYH 3VJ6A 1FIGH 4EDXB 1JBJA 4V2BA 1CZ8H 3QP3A 2ZUVA 1QSFA 3PL6B 1UWEH 3P30L 1A4JA 5FDYA 2HLAA 5DD5H 4EI5B 1CZ8L 4R6UA 5DR5L 1BX2B 4JCLA 3QPXL 4R97B 4WHCA 5A43C 1FVEA 2VZTA 4X6DF 1U8MB 3DIFB 2N4IA 1V5JA 3EUUA 1NUFA 4LDLB 2YEZB 5T5NF 1JYNA 3MR9A 1DBML 3LKNB 4JGMA 4RZCB 2AKRA 2NR6C 3KNBA 1U8PB 4PJ7A 4LRNH 4TULH 3AREC 2ATKB 5EU5B 4XRCB 1TCRA 2ZCHL 1FNGB 1Z3GL 4EXKA 1S7WA 5B38G 1ZA3B 4F7PB 1ZKAA 3NOIA 4XP9L 4JY5L 2ZP0T 4LEXL 4OM1H 3JXAA 5GGSB 2NQCA 2MFNA 1ZWIA 5FM5M 4NQEB 3RA7L 1IT9L 1NGZA 2J1KA 4RMUA 2F5BH 3C5ZA 4QHUA 4OAWA 4TNWF 5E6ZA 3VGDA 3MJ9A 3PABA 1YY8A 3DV6A 3UYRH 3VD7A 5F9JA 2FX8H 3ZE0F 1NFIB 4Z77A 4NUJA 4JFDB 4U1LA 1K8IA 4KC3B 5DEGB 1R5IB 3BFOA 3U83A 1T7WA 2DYPD 1IM9A 3FT2B 5J89A 1W8NA 4XNXH 1E27A 4XP5L 5BRZA 4XVUC 1JNNH 2PYEE 4MNGB 5D7LD 4DTGH 4Y4HD 3PL6C 1M7DA 2NR6D 2C9AA 3MV8B 4FFYH 2PO6A 3RWFB 3OKLA 5MHSE 5J9PB 4YHZH 1TZIB 3SJVA 4FTVE 5HBBA 5E2UL 3IXTA 4L4VE 1KJ2B 4LLDB 2A6JA 5FA3B 2WANA 1HOCA 1I7RB 2PTVA 4XVJL 3V6ZB 5GGTA 1ORSA 1RZ7H 2V17H 5L9DL 2ESVA 2HH0L 3MV9A 4L3EE 4OCSL 1DUYB 1MRFH 1ED3A 2UY6A 2R1WB 1FO0B 5E9DD 2YD6A 3BHBB 3KG5A 2LU7A 2X9WA 2Q76A 3D18A 5GS0C 3RQ3A 1T2JA 2JELL 5DQDH 1BGXH 1U58A 1CDBA 4N0UB 5MEPB 3L5IA 3IJHA 2PYFB 3W5NA 4XPAH 2V5TA 1MHHB 3ZSTA 3BGMB 4PJHA 5D5MF 4N1EA 4XP9H 1J5OL 1RUMH 5FKPA 4LVHB 3E2HB 3FO0L 1A2YA 4B41A 5JHDE 1EHNA 1I1FB 2F8XC 4J7RA 1CFTA 4U3HA 4MXWL 4C55A 1D6VL 4WCYL 1MHCB 4AEHH 4LRNL 3MREA 3RIAK 3LQMA 2W0FB 5LAXA 3SKNA 3GMPB 2ESVD 1H5BB 1EEZA 1YECL 4IOIA 5MENA 1G7MA 4NN5B 4O2CA 2Q8BL 2OL3A 2X09A 3OJ2C 5C08A 3ZHDA 4G8GA 4EOWH 2CSPA 2FR4B 3WNLA 1A1OA 5I1LB 3QDGE 5D7IB 2QTEA 5DD1H 8FABB 4IEFB 4KJYB 4Q9QL 2Q3AA 1I8KB 2PO6B 4MA1B 4R7DB 3MV8A 4NKOA 2AEQH 2EDJA 5GS0D 3JV0A 2BMKA 2ITDA 3I3EA 4ZXBB 3CX5J 4GAGH 3GMLA 4MJ6B 5BRZB 3FQNA 3WIHL 5KSUA 3RVXC 1MH5B 2OTWA 3EGSB 3TLRA 1G7JA 5I8EB 4KJQC 3W0WA 3H9ZA 5FHAL 4IHOA 4HS8L 2IC2A 4J3UA 3KR3L 4MJIB 4OTXL 3HAEB 3PABB 1B4RA 1E4WH 3GMNA 3GHBH 1I9RH 4X4MA 1DN2A 1ULVA 3C5ZB 3B9AA 3H9SB 1MJ7L 5CEZE 1ZSDB 1QFUH 3BKYL 2GI7A 3MMEB 1P4BH 1IGMH 1RZ8B 1UKTA 5DA4A 3RVUD 1ACYL 2B0SH 5IP4A 1Z9MA 5EZIL 2DI9A 1LK3L 4XRCA 1F02I 2FLRT 3L3GB 4JQXA 5F70A 4U31A 3QHZL 5JUEH 2YXMA 5EA0H 3IJYA 3HI1A 4ODUB 3UJJH 1CFVH 3BE1L 2E9IA 4YDLB 1GHFL 3IU3B 2ICWA 2ERJC 1OAQH 4OF3A 3WJJA 3ARVA 1K4DA 2XQYK 2ED7A 3K81A 1F8TH 3MACH 4YHIA 2MKWA 5C0CE 3O6ML 1JUFA 4G6ML 3C2AH 5K9JH 2QSVA 3L3JB 5DFTA 3O8XD 2G2RB 3QULA 4YR6A 1DQDL 3BD4A 2AJ3A 2AI0L 2XACC 3VMNA 1UWXH 3DLQR 3RVUC 3VG9B 2NTFA 3OV6A 2BVPA 4U1JA 2GHWB 1AE6H 3BP4B 3N1MC 1PAMA 2VWEC 4U6XB 2HFGH 3NABH 2BP3A 2BFVH 35C8H 4Z7NE 3LQZB 2F53B 3M17A 5I1CH 1EO8H 3HE6B 4PRIA 4M5YH 3OAYK 5EC2A 3ARGC 1KELL 1IC1A 3NIFE 5EUKB 2LTQC 2WUCL 5MI0B 5JDSB 1BIIA 3WMSA 1S78C 3ARDD 4C83A 4LDEB 5ADPL 3RPIA 2R2EB 1NGYB 1YYLL 1T5WA 5GS0H 4Y5YA 1T80A 2V2TA 2FIKA 5TE4H 5EFIB 2GSGB 4EXPX 1YNTB 4C56D 4XMPH 3V79C 5DJYB 2ADIA 5B39G 4MD4A 3H9HA 3FQUA 1R24B 1VKXB 2GK0A 3BGFC 3CVHB 4U2YA 4LSSL 1NBZA 1PFCA 4YFEA 2F15A 3AAZB 4P2RE 4FXKB 4CVWA 2Q6WA 5IFJA 4HPYL 2FZ3A 2ZG2A 1IGIL 4JDZB 3TBTA 1UADC 3BUYA 1FGNL 4K94L 5TPWH 1S78D 5KS9E 3RKPA 3HC4L 1UACH 5CGYC 3ZKXC 1HH6B 3HHRB 4M7LH 3O9WB 5D6DA 1P1ZA 1HI6A 4FS0A 4MXVF 5DRNA 2JIXB 5JPNA 2LFGA 4JFFB 4NKDA 3VH8B 1SHMA 3O3EA 2WQ8A 1FRGH 4I4WA 1NANI 1RJLA 1X4XA 2P4AB 3T8XB 1VERA 3T2OA 1UWGH 4EUPH 1X6NA 1YEKL 2R0KH 4ODTL 4PJ7E 3SKUD 3DUUA 3JUZA 1SMOA 3SHSA 4UIKH 2VZVA 4W81A 1JFQL 2MCPH 1RU9L 3G6AB 5E08H 4D3CH 2R4SL 5FOJA 3L5XH 4K07A 4DUVA 4D9QE 4CBPA 2M8XA 1FAIH 1D9KB 3A67H 2XG5A 4C4KO 4EQ3A 3WXVL 3C5JA 1UEMA 5DQ9A 4Z7UE 4KPHH 4MJ4A 3QDJE 4EUPG 4LAQH 5AYUH 4ZAKD 1JMZA 3I75A 3WNNA 1FL6B 5C86A 2HRPL 4XPBL 5T5FH 5L88H 2VAAB 4K8RH 4TQEL 2VXTL 2J12B 4P4KC 3QA3B 4PJDE 1P2CA 4QHLA 3VWKA 4UI2A 1KB5A 3VG0L 3QUXD 4GW5B 5DRXA 1HNGA 4DKFL 1FJ1A 3ARFB 3K1DA 3GSWA 4L9LC 5F3HB 5LCVL 3KPNA 3QDGA 2AQ1A 4NN7B 2Y07L 1MQKL 3FTGA 1D6EA 4DUWA 5LG1A 4NJ9L 1EUTA 3BKCH 4K71B 3S34L 4EI6A 5EC1A 4RIRA 2JB6B 2D7TH 1I4FB 2AXFA 2GFBA 1KEMH 3NH7H 2P47B 3P0YL 3LMJL 5AZEL 4WFHD 4DQOH 3HMXL 4JREB 5INCA 4FQHA 3BPLB 2MQ3A 3OKOA 4P5TA 4WWKB 3HUJF 3TJEL 4XCYB 5DQJB 4ZFOL 4AZ8A 2UVEA 2DQUH 3WE6B 2WMPA 4X5XB 5EOQH 5D72H 4Z0BH 3V5DB 1WWWX 4RCAA 4YH6A 3PGCA 3VI3E 1JVKA 1ADQH 1KIUA 1WIPA 1L7IH 2W1NA 3SQOL 1ZLVK 4AL8L 2P5EE 1K2DB 5BQ7B 2ZUTA 4HLZH 1T89A 5HPMA 4NWUH 1NDMA 1AXIB 4HUMB 5F3HA 3W81A 1VDGA 1I9IH 2PR4H 4Z78A 5EU6D 1UB5B 1ETZB 4NZDA 4NBZB 1INEH 4U0RC 3VDCA 2VXUH 3FQTA 3PG2A 3W9DB 3X11A 4I77L 4UQ2A 4I2XE 3L3DA 1QPXA 4P5MB 2R15A 1JN6B 5HYJD 1IGYB 3SDAC 1NCCH 4HKZB 4OB5L 1JZ7A 5E94B 1GC1C 4NQCB 4NRZA 1VFUA 4WFGE 3Q2CA 3P77A 1RIVH 2WP3T 1O0VA 1H9VA 2XXCB 3HMWL 3I85A 2WK2A 4ZFOB 5IB5A 5ICXA 3S36H 2HN7B 4ELMB 2AK4D 3G5ZB 4RGNB 3RL1B 5I66B 4KWUA 4M6AA 4OUUB 3CUPB 3LKPA 1TXKA 4X0KA 3KYAA 5HGGS 3VGFA 4N1HB 3HRPA 1IBGL 3WD5H 1MUJA 5HHOD 4NKDB 1RZGA 4MNHA 1HI6B 3O45B 5EBLA 1IJ9A 1JHTB 5CEZD 1U3YA 5E2TL 4NDMB 3RVTD 3A6OA 3EYVA 3MRGB 3ZKXB 4QY8A 3QXDA 4IS6A 3GRWL 1AKJB 4PJEA 4L4TE 3LKSA 3CFBA 4GBXB 3QQ3B 2X89D 1JPTL 5HI5C 4MA7L 4GRWF 1B0GA 1WV7T 5ACLA 1CDYA 2QQQA 1XGRB 1UJ3C 5IIEB 3TH3T 3CSBA 1FH5H 1LK2A 5HD8D 4IMKC 4I0KA 3D6GA 4HF5L 4IIQA 5DO2C 1JP5A 1QHPA 4JPVH 1GAFH 1QRNB 5DUBA 3MUGB 1UZ8B 5FB8A 1ZS8A 2BDNH 2H32H 4LSUH 1C5BH 1A8JH 3GSNL 1S8DA 1I8IB 3TV3H 5DHVH 4XVSH 5MEND 4YPGA 3SGDI 3RGHA 3FAXA 1L7TL 3VFPA 4M1DL 4OD1L 1I85A 4U3XA 5FGCE 4XWGH 1DSFH 4OJFH 4YGAB 4P2RD 2VLKB 2XWJA 3NA4A 1RHFA 4HSQA 3NFSL 4LASL 1VA9A 4W4NA 1XAUA 1I8LC 5EU6B 2UZIL 5J7CC 2M26A 2EH7L 2C1OB 2HA1A 4N8VA 3VFRA 3DI2B 3J8F7 4LSRH 1A9BA 2CRIA 4M48H 1RUAL 4G42B 3U30B 3VXRB 1Q0XL 5HD8C 4MVBC 1YYMH 1NC4A 3RTQD 2BHYA 4GSDH 5E1AA 3B2VL 1NBQA 1B88A 4PBWD 5C71A 1A7RH 2AJSH 1G9MC 9CGTA 5J0BA 1YMHA 1TETL 5D1ZB 4KK8C 2R9HD 4M1CC 4ODXA 4BQ8A 4QNPE 4YHIB 3QI9C 4GKNA 4RISH 5D1XA 4R2GB 3LZFH 2C4XA 4YDIH 1PQZB 4P23C 3T77B 1S9VB 5TGBA 2HWZL 1XF5A 4G6JH 5GISH 4C54A 4WI9A 1OAYL 2DLEA 3IJYB 1Y18A 4XH2A 4FZ8L 5BRZD 4BFIB 2AS5M 3SQOH 4ZPVB 2NY7L 3C6SB 3JBG7 3NFPB 3HUJA 4WFHE 3S4SG 2MPAL 5DJXB 5HHVL 3S5LB 1DZBA 4GG8A 4GXVL 4GRWH 1MF2L 4KAQL 4O02H 1CF8L 5DEZA 4RGOL 1T66D 1KT2A 4U49A 4PS4L 3B6SA 4PJCA 1PW3A 3BZEA 3O4LB 2EEAA 2WBWB 1AGBA 2CK0H 3MLSH 3T0VA 1F4WL 1OGTA 3QQ4A 4H8WH 1YEGH 1J8KA 4P23D 2XFXA 2HJFA 4PJEF 4I9WD 3ARYA 3X13A 3BKCL 3S34H 4QT5A 4JJ5A 1VFMA 4U1HB 3UTTE 4C56A 4XNZC 3QNZA 2K3TA 1EIBA 5CJ8A 2IQAA 3EDKA 1GZPB 5I2IB 2R56H 1OLLA 3ARFC 3GGWA 1MFEL 2YBRA 5ESAA 4YBQC 5ACZA 2YXFA 5D93C 4QTIL 5FUOL 1SYSB 5EO0A 3WSQH 2O5ZL 3MA9L 5FYLL 3FO2A 5HI3D 2XT1B 2YUWA 1GOGA 5BW7C 1F11B 2CLRB 2VLLA 1HHHB 1KBGL 2DM2A 4PJ9D 2P8LA 4EUPA 1CLZL 1A2YB 3RWEB 3T2PA 4RWHA 3L5WB 2GEEA 3BAEH 4AJ0A 1KV3A 5CD3B 2GTZB 5SWZA 1JF1B 4ZTPL 5E2TH 3FB8A 3FT3B 4LEOB 4FTVA 4UOJA 3T0DA 4WWKC 1WQVT 1A3RH 3RVVD 3LPWA 5JR1L 2Y7QA 4JHZA 2DJSA 5DK3A 3IFOA 4ISVB 3FQXA 4TSAL 3NMEA 1LE5A 3F7VB 4NN7C 4P0DA 5JHDB 3BQUD 5FO7B 2VJXA 4QXWA 4KTEH 5HI3C 5CFHA 5KVEL 2XTJD 4OCRL 3K2UH 4BZ2H 4BZ1L 3VD3A 4B7LA 3U36A 4K94H 1MFCL 3JTSB 2I25N 4ONGH 3AU1A 1CD0A 4QOKB 3TPKA 3F12B 2Y06L 1E27B 1IM3A 2QSCH 3MO1B 3BO8B 5C0DB 3GIZH 3RWHB 5B21A 3PDOB 5K33A 4MNQE 4Q2ZB 3AC0A 1J1PH 3LHPL 4PUBL 3TBWA 1AIFB 4TSBL 4LPCA 1D9KC 1EA9C 2FNBA 3JTSA 2GK2A 1OL0A 1QFWH 1GXEA 3NCCB 1MPAH 4MJIE 1A4KB 4NQEA 3RDTC 1Z5LB 5E99H 1XCQB 2P5EA 3LV3B 2Q7YB 5C0CA 1IE5A 3IFPB 3VFWB 4Q9RH 4YHNB 1ZA3A 4P57A 3LHPH 5ADPH 4KH2A 5KVDL 3BDBA 1ZXQA 3D2UA 1IRAY 2WUCH 3AM8A 5GSVA 3VFMA 2EDFA 2AK1H 3LB6C 4JDTL 4UAOC 3MR9B 2DQJL 4UT9H 2PNDA 3FONA 4AQ1B 1P4LA 3PWUA 4NQED 3MRRA 5IM7A 4XCCH 1RUQH 2HFGL 3VWKD 1U91B 4R97C 5CBEA 3L3HB 1QR4A 2XTLA 1CXEA 4YHPA 2A2QT 3U6RA 1TLKA 5IF0B 1DQDH 1FORL 5ENWB 2UZYB 4MAYB 4QXUL 2FEDC 2XA8H 4EQ2A 2X4UB 3G6JB 4ZSOE 2XWTB 1SJEB 3TVMB 5GJSL 3DROA 3IFLL 2PCPA 4P59H 4P2CG 1T03L 5A2KH 1IGJB 5IMKB 3RX5A 3QEHB 4HK0A 5FV2A 4DKFH 3T3ME 5ICZB 4DVRL 2DB8A 1HYSD 1JL8A 4HUXB 1X5KA 1DQQA 4H26A 3FO2B 4Z0XB 2BVQB 1VEPA 5B22A 1KIRB 1PEWA 5JIHA 5CIPB 2N7BA 4YHMH 1UGNA 4CN6A 5L88L 3QQNA 2VISA 5AZ2L 4OD3L 3WFCH 3ZSSA 5I0DA 1X6LA 1J1OH 1X5JA 1LMKA 5ISZE 3SCMB 3QIUC 2NY2D 1LDSA 4S1QL 5EOCH 3DUSB 3W5MA 2LQRA 2VLJA 4OLZL 2V9RA 3QQ4B 4WI7A 4EN3A 4MX7B 5DURB 1I9RL 2Z31D 1FNSL 4TVPD 1CD8A 1IAMA 4JM4H 2BNUB 2R0KL 4IDJH 1L6ZA 3OR7B 4PRIE 5IW6B 1BJMA 4PGDA 4AH2B 4YC2C 4ZS7H 1JWUA 4PLJC 3MLRL 4ZNEE 4P59L 3IFLH 1T03H 1MRCH 5DC4B 1TVBB 4N90D 4BFEA 4XP6H 3ABZA 1KSRA 5IUSA 4M8QA 1RURH 2VLJE 3QUKA 4XP4L 4BFIA 4MJID 5J13C 3AXLA 4P5KB 2CLVA 4BK5A 3IAGC 2ITCB 4P9HH 3IDNB 1BZ9A 2NY2C 2GQHA 1T0MB 4FXGB 1CE1L 4HPYH 3MX0A 4YEEA 3BRGC 3C6LD 2AK1L 3ZYJA 3EOTL 1H5BC 1R5VA 4OF5A 3D1MC 3CVIL 3VGAC 2H26A 1F2XK 5CLTA 5CZVL 1CGWA 4LVHC 1XH3A 2EEDA 4PJAB 1EUUA 2XZAH 2CRYA 3BIBX 1G7QA 3SN6N 5ADOH 2DLIA 3EFDL 3UDWC 1DBBL 1Z9SA 1HHGB 1OAKL 2HTLC 1VPOL 1K4CA 4NNXB 1T1YA 3V6OA 5IFHH 2EO9A 1GOFA 3GIZL 5M94B 2VQ1A 4LL9A 1FDLL 1QSEA 3TJHC 4JFEB 4GRMB 5ENWA 1JYWA 4HWEH 3DGCR 4KUCF 4PREA 2WWMD 2W60A 5JDJA 4X7DC 5JA8B 3L3HA 1H3UA 1P7QA 3PE9A 4YHLL 2UVFA 5FK9B 2D2OA 3B9KB 3RGVB 3KYNB 4YHZL 5E00B 3EW3B 5GQBA 4LCUB 4PJDB 2CQVA 3V5HB 2B1HH 1P84K 3BH8A 4LASH 4XP5H 4J4PA 1AR1C 5L6YH 1P7HL 1XGRA 3RI5F 1LO5A 5FGSA 4G3YH 2WQRA 4CVZA 3EIFA 3DRQB 2FYYA 3RVWD 3LKOB 4XWOD 3W9EB 2HTLD 1B9ZA 4OD1H 4P46A 1NCBL 5CILL 4C58B 1HXYB 1REIA 4HUUA 1RZFH 3TJHD 1MVUA 2YA0A 2X4OA 1CICC 3IKCB 4MNQA 4WNQB 1G7PA 1HXMB 4OZFA 5DHXB 3N1GC 3EJZD 4V1DB 4FFZH 2WWMC 1HHKA 4ZOEA 4MNHB 4HF5H 1EBAA 3TBWB 1NGPL 5IQ7L 4N0CD 4WV1B 1F3DJ 5ID1B 3G08B 1N7MH 1KENH 2PW1B 4HIEA 1K6QH 3C60D 1N0XL 4Y4HB 3HR6A 4NCDA 1YN7A 3BWAA 3MV8D 3C09B 3AS0A 2GJZA 4P5TC 4QTIH 5FUOH 3ULUC 1E4XI 1KPRB 1R3IL 4OBRA 4DK3A 3G04A 1DJSA 2BNQB 3BIKA 3GRWA 4NFBA 3BKJH 2ITCA 5C08D 2VC2L 3Q6GL 3ALPA 3BRFA 5FYKH 1U8JA 3MLTB 3WIHH 1XF3B 3P30H 1U8NA 4JRYB 3EDFA 2IALB 3N0PB 1FE8H 1F4YH 1NC2D 2OQJB 5FKAA 5DYOB 4I2XB 4OZHA 2AEQL 3WJLC 5JXAH 4ZOAA 4CN1A 3TC9A 1QA9B 2HTKD 2A9NL 1F4WH 5IW6A 1FYTE 4QRUA 5BMFL 3FN9A 1T1XA 3L7FB 5JNYA 2ORBH 2Q7NA 4Q6IB 4PGBB 3P0VH 5GS1A 5JZ7D 3QH3B 4LRIA 3W9DA 4JFQA 2EIBA 3D3VE 5F88B 5DMIH 4OLEA 3FB8B 3TIDB 4GRLC 1PJ9A 1NH6A 1A6ZB 3L7EB 4HZLA 5T1LA 1MEXH 3LVEA 2XTJE 1RUPL 1CS6A 4EUPB 1F90L 5A2IH 1EAJA 3OGCA 3HNSL 1CK0L 4OD2B 1ZHNB 2VSCA 4RMQA 2VLLB 2WINA 4OGXH 4RGNE 3ZDXE 2X1WL 3SO5A 3CC5B 3H7BB 1EMTH 2VDML 2YRZA 4X5XA 5C0EA 3CDGB 4NZRL 4JQIH 4CU6A 4PGCB 1DQQB 12E8H 3DX7B 4QYOB 5E2WH 1CGSL 1N64H 1BZQK 4P3WA 1MCBA 4M5ZL 1LEKB 5D2LA 4XI5D 4UT6L 2AJZA 1T2XA 1PD6A 4FMKA 5BVJA 1I4FA 4MAYA 3QDMD 4QT5B 3HE6D 2EYTA 1PSKL 2V2WB 1AP2A 2RJMA 2C3HA 3MLZH 5I30H 2Y5EA 1A6TB 1AGBB 2XZQH 5CSBA 2CRZA 1FYTA 4FMFA 2P48B 3WN5A 1AXSB 1YJDC 4M48L 3P4NA 2X4SB 3UDWA 5HVHB 1S9YA 2DWDA 3TA3B 4XXDA 3NFNA 3ARBA 1IC5L 3QT2A 3S5LA 4O4YH 2AEPH 3MNZA 3CAFA 2AGJH 4NO0D 3EO9L 2BNRB 4YHNA 1Q9OA 3VFWA 1HWGB 4NHUB 3GK8L 4OI9A 4Y0GA 3QISA 4NJ9H 1R3KB 2NMSA 5I76A 3P4MB 4OZGA 5DQ9B 4QEGA 4F37K 2XRAH 4BSVB 1B4JL 3EHBC 3F58H 3CK0L 4P23A 3PWPE 2HT2C 1H0DB 4KK9C 5D1QB 4LLYA 3BPCA 5IV2A 2OTUB 5KOVC 3ZTJH 5EU6E 1FYHB 2MJWA 4I0CC 1EJOL 4YHYB 2O5XH 4CU8A 3ZLQC 4L3CB 2P24A 2CUIA 3E0GA 4KRPB 1RY7B 2E27L 1BQLL 5L0QC 2APVA 2KH2B 2ICWI 4WHDA 4I4WB 2VDRH 3PWLA 2H8PA 2CD0A 7CGTA 2WBJB 5C6TH 4QRPE 1U3HA 3MJ8B 1Q1JH 5HYJE 5EOTA 3WHE0 1CLYH 3QWQB 2EKSB 3QNXB 3VGBA 1KNOB 1G1CA 3A67L 4JY4A 4Z7QF 5IVNA 3QB7C 4BSWA 5C2BH 3NA9H 1JFQH 4X6BB 1X5HA 2O5YL 2YD4A 3QUYB 4M6NL 4NHUA 1ZEAH 4PJBA 1WAAF 4WTXA 3AS3A 1DFBH 4ISVA 4O00A 4PJAF 1HKFA 4LQFL 3VXMD 4M6ML 1KJVA 4HUVA 2RFXA 2F19H 4YPGB 2X70A 1IAII 3I6LD 3TA3A 5FYJU 4N5EC 1R24A 4JRXB 3GDBA 1KG0B 4KY1H 5HHOE 3S35X 4H1LA 4N0YL 3S37L 1F6LL 2R23A 2GSGA 5GS2H 3E3QC 4ZSOA 1MCWM 1FGNH 4R4ND 1L6XA 2F5AH 3U0TB 5IKCA 2V2WA 1B0GB 3SCMC 5TF0A 3STLB 5I19L 3JWOC 3OWEA 3DX9B 4X83A 2AJZB 5IQ9A 1GGIH 2GAZA 5F97E 1BIIB 2CUHA 2W92A 3U82B 4OCXL 5CGMA 4HJ0D 1TENA 4ZOBA 3QXDB 3NCFB 4JANB 4NO0B 1Z0NA 1KCLA 4LLWB 1P7QD 3WL9B 5E8OA 3VMOA 3ZTNH 1TJIH 2ARWA 4U1HA 2BVPB 3SKJH 3MXWL 3PQYB 4RDQF 5BO1H 5GIRB 1DE4A 2XZCH 4FQLL 4ZO7A 2HYMA 3BKML 5KANG 3SE4A 3CXDL 2EZ0C 1DEDA 3QWRA 4XCNA 5EOQL 4F7MB 4G7YH 1I7TB 4ZFOA 3MA7A 1DBKH 3IT8D 4MQSB 2OXGA 1KT2B 1P4IH 3TN0B 1JGDA 1EAPA 1KJVB 4UAOB 3NABL 3RTQB 3P0YH 3UCRA 1AKJD 3FB6A 3NH7L 4OUOA 1N0LA 4HCRL 2YUZA 3SDAA 4F8TA 2FD6H 1HDMA 3L3GA 2G60H 3OMZA 1HKLH 4RBPK 3GFUA 1OARL 5L8JB 5D7LB 2P42B 4WUKL 1G6RL 4JB9L 1NEZG 4UV4L 3MXVL 3QNXA 5CP7A 5JXEA 3RWGA 3GMNB 2IANE 3VXQB 3HE7A 2ICEA 1U3JA 3H8NA 5KS9F 4MJIA 3BZFA 4TQEH 1GGIL 2BSED 4L3EB 2ZG1A 3FZUD 4ZUSA 2JJVA 3ETBF 4GUPB 5HPMB 2F53D 3QIUB 5FYJE 4NNYB 4X9FA 2OTWB 2DQCH 4X9BA 1LEGA 1T22B 4H0IA 3WFEL 2J8UE 5EBWB 3QHTC 3V5DA 3GM8A 4KY1L 5I74C 3JZ7A 4N8VB 4MNQB 3VFRB 2IAMB 5E08L 1YEHL 3G9VA 1OPGH 4FQHB 2F19L 5I76B 1J05A 4EN3D 4DZ8A 3UP1A 3MCLH 5CGTA 1CIDA 3W9EA 5I17A 4MAUL 2B8OT 1J9CT 1UWGL 3LKRA 3SKNB 4HS8H 1NCAH 2JB6A 1NFDA 4PJGE 4LCIL 4POYA 5SWQB 4KHXH 1NCTA 3IDGA 2FIRT 4QCIA 1F6AB 3QDGB 4LPVA 4KHTL 1YEHH 4XXDB 4AM0B 3Q1SL 1FO0L 1W0YT 2AJUL 5FB8B 4JO2L 1MHHA 4NRYA 3TBSA 5FYJL 4O51A 4PJGF 1LEIA 4M7LL 5LGKA 5E7FA 4E41A 3KYNA 1KB5B 3IAPA 4G6FB 3HC4H 1JPGB 2ARJB 32C2B 4QHLB 1QD0A 1RJZB 3E3QE 2VAAA 4KRLB 4CMMA 5BVJB 3S7GA 1EXUB 5K59F 3UXFA 4HFWA 4KROC 4LVOB 1V7NH 2WUBH 4NNPH 5FCUL 3OAZK 3D0LB 4DZ8B 2D0GA 4S1SH 1JNHA 3MQIA 4PJIB 4NKIL 5EZOH 3S3SA 1JJUA 3BSZH 5F9WC 3CDGA 4NDMA 3CK0H 4NFCA 5H2BA 5EO9A 5HI4C 3WUWA 5GZOD 5EBWA 1ROWA 3CC5A 1MUJB 3ALXA 3O8XB 2HVJA 4ZUTB 1OGAE 2IPTH 3KYOB 5E6IA 3WLWD 4HMCA 3QQ9C 1M1SA 1JGUL 3RL1A 4L3EA 4ZUSB 1CDUA 3BZFB 4OCSH 4X5WA 1NFDE 1U8HA 3OAUL 4NQTA 4X6FB 1NJ9B 2E7HA 1U41A 4BQ6A 1VACA 2UWEE 4XVJH 1C5CH 3A6BL 3O6FB 5DRNB 3L3KA 4KRPD 1EO8L 1MCCA 5B3NA 43CAA 3F7PC 1KACB 3QH3A 3BPOC 5E2UH 4XC1H 3CMOL 2CLVB 1WJ3A 5C0AD 1MCNA 1UZ6E 4YFLF 5TF1L 4R8WH 1IKNA 4Y19E 4L8SC 2AI0H 4PGEA 3OKKA 5E6IC 2NW2B 1X5FA 2IALA 1JN6A 4I0PB 2GUOA 1OT2A 1TPXC 3VXTB 1N2RB 2ATKA 3RTQA 3NCYS 2AKRB 4P3DA 1N64L 1CGSH 2VB5A 2F53E 1QYGL 5B39B 3IDIA 5DMKB 3OR7A 4XAWL 3QQ9D 4JQIL 1V05A 1ITBB 1JRHH 1J88A 4YIQB 3QIBD 5IHZB 3DETD 4NQDA 4Z78B 4YX2L 1MCLA 3WHE1 1SYVB 2D7PA 4HCRA 3RA7H 5SWSE 1ZLSH 5HHQA 1AQKL 1MVFA 1WFNA 4LU5H 3LRGA 1DP0A 5LXGH 2EDNA 5BVPL 5TE7H 4JRWA 1ACYH 3BN9C 4X80H 4LPYA 1BVZA 3DV4A 4EDXA 4HXAH 2OP4H 4C59B 5EC2B 3OX8B 3DXAD 3UZEA 1KN2L 4HIXL 3TBYB 1QNZH 3ZDXF 1U9KA 5C0BB 5F3BB 3N9GH 5ESQB 1UC6A 4LQFH 5IQ9B 5I1JH 1U3HD 5EU4B 4HK3J 2J5LC 1N8ZB 3KAAA 3RKDD 4LCWD 2G9HB 1W0VB 1XGYL 4IOSD 5CJ5A 5DD5L 4NN6B 4D0BA 5FGRA 4YWGH 4QWWD 5J4MA 1UWEL 2WIIA 4KVCH 3ARFA 4JRXA 1F42A 4HX1A 5I8KH 2Z8VC 2ICCA 5F9OH 5IMMA 5J1AA 2CGRH 4PREB 3MYJB 3QG6A 3IU3A 3TZVC 4KI5E 4PYGA 5HYFA 1N6VA 3F6LA 2IPKB 2OP4L 3GJEB 3QDHA 5HHXL 3S96A 4KKLD 1GOHA 1KENL 5BVPH 4BK4A 1NGPH 4P57B 1S5IH 4KI5F 1U3HC 4PGZA 4DWHA 4YDKH 5IQ7H 4QRSB 4PRPB 2WNGA 4LU5L 4FFZL 4JHWH 1AQKH 2P8MB 2L7JA 4QHMA 2VWEE 2DWEB 2XRAL 5E95B 3UTSD 2EKSA 3WO4C 3H9SA 1RZFL 5I71C 3U48A 4Y7MA 1AHWA 2EICA 4M00A 4M7KL 3PF2A 2Z93B 4MLIA 5JOFA 5LVEA 4XAWH 3OF6A 4ZTOH 2H26B 4NZUH 3T2QA 5CBAB 5I18H 5L9DH 1P9MA 1P9MC 1QEWA 5E4EB 3MRMA 4JFFA 4XBPA 4FXGA 1MCWW 3TZVB 5F44A 4J6RL 2DBLL 2FWOA 5D1XC 4AT6A 2CJUH 4KJYA 3ZT7A 3KHOA 3C60B 5FDWA 4XHQA 3ROLA 1W2KT 3ZDYE 3BUYB 2EYSB 4LKCA 2NXZC 2YD3A 2R0LH 4WIQA 1EEZB 2WIMA 1UM4H 1H15B 4KKBD 3HE7D 1JNNL 4OKDA 3W39A 2NX5A 4KJPC 3MBXH 5SX4I 4UT6H 1QHOA 4DJMA 2R0WH 3RNQA 2HJLA 1I1FA 1NC4D 5SWSD 5T1LD 1MJUH 4ZTOL 3ZKSD 1HH9B 3T08A 4ZYKA 3FQUB 1FZJA 3VDAA 3IDJB 1NC2B 2B7DT 3Q48A 1FYTB 2XZAL 5K59E 1NAMA 3EO1B 4MX7A 3QBTB 4X4XB 5DUPL 5CEYA 1WEJH 1YUHA 4ELMF 5A2LH 3ZDZE 2Y72A 1FFOB 2GTZA 3MV9E 5CZVH 2Q76B 3TGXA 3GO1H 4HBCH 1I85C 5E7BA 1HIML 4BSJA 3RWEA 4O9HL 1RUPH 3SCMA 5J6HB 1J8HB 1DUYA 2WUBL 4NNPL 3UBXG 2NY3C 4NQCD 4S1DC 3WS3A 2XTJB 4BYHA 1XIWA 2G5BB 3UC0H 4FFWC 1AGFB 5EO0B 3MLPA 1OTTC 5DJCA 3QFDA 2NY4B 2J8HA 3EDDA 1CLOL 5ISZA 2BRRL 1I75A 5FEBA 3LRSA 3SPVB 1ZHNA 1TPXB 2YC1B 1TTGA 2VL5A 4XP6L 2BJMH 3MLYL 3VFSA 2G2RA 3ECBA 1TZHA 4KHXL 4OCYH 1E6OL 4Y1AA 1JUFB 3THMH 2ID5A 4L4VA 5DD6B 3MUHL 5FOBA 1E6JH 2B4CC 1DLFH 1IKFL 5E2VH 5FO9B 4BUHA 4PGBA 4Q6IA 3GNML 1I1CA 1V3LA 4RX4D 1F2QA 1KLFA 4G9FB 1NGZB 5E70A 4JVUA 1K3IA 3RWJA 3FB7A 3LSOB 3V4UL 1HZHH 4OLZH 1GGTA 3O6FD 2IADA 3SDCB 5DJXA 4F7PA 5FUCC 2VN4A 5CCKH 3HUJB 3OR6A 4Y2OA 2XZZA 5D8JL 4D94A 1NFKA 1CVRA 5E03A 4Y1AE 1GVIA 3BQUB 4RMWA 3RWJB 4XX1E 5IMOB 3LKNA 1L0XA 3O3AB 1RD6A 4LCCB 4M1GH 4WUUE 3QDMA 1WFUA 4NQSB 3ARXA 4HWZB 5K9QI 5F9WB 4X99B 2FHCA 1NCBH 4IOFC 1J11A 2OK0L 1WZLA 3VGEA 2XV6B 2V2XA 5FOBB 2E8YA 3TF7C 3CZFA 2FSEA 3B5TA 3PDOA 3PWPB 5EH1A 3AVEA 4JB9H 1MH5A 3PNWA 2AJVH 2HFFB 3GMLB 5CD5D 1HKLL 15C8L 5FA4B 2J88H 5E1AB 4GAYB 1HHJB 4IRJB 3ULUF 1CFQB 2Y4SA 3WKMH 1QRND 1IGFL 1ZGLP 1I3RA 4RAVA 3VD5A 3BZ4B 4G8GB 4P2OB 1E0OB 1KPVB 1MIMH 4I13B 1G7MB 2W59A 5EU6A 2PTTB 3DVNB 3KPOA 3V4PH 3GMPA 5LAXB 5HVFB 2VLKE 1UXWA 4FP8L 1JGUH 1KCUL 5F7DB 4LFHG 1CFTB 5KVDH 4XMLL 2ZSWA 1AGDB 3IFOB 4N68A 5I8OL 3V5HA 1EHXA 3VFUA 1X5YA 4PRHB 3EFDH 4KKNA 3ULSB 4OCWL 3SDXB 1FC1A 3EKCA 4F80A 4H5SB 5D2NE 4PY7B 1K9TA 3IJHB 5FUZL 2DI8A 1IEBA 3ARWA 1RUKL 1ZT7A 5EOCJ 1NC2A 3BN3B 3KLHC 1T0NB 1FZJB 3CDCA 4Y19A 1QRNA 5DUBB 2JIXD 4TSBH 1T20B 4HBQA 1RZKH 4GQ9H 1J1PL 1YNLH 4PUBH 3VWJD 3ZKNC 3CVIH 3T09A 4OCXH 3AY4A 4NBXB 1A9EA 2QSCL 3IDUA 3P9MA 4IJ3C 4UU9A 1ORSB 4TOYH 4LLAA 3V0WH 1KXVC 3LQAL 1XF1A 1M71A 4LLDA 2R2BA 4U6HA 1BPVA 3C60A 5FDWB 4N0YH 2E7LC 1B0WA 1TTUA 4U6YB 4BZ2L 3U7WH 1ZLWH 3D5OF 4WO4C 4JJ5B 5M95B 3QXUA 3KLHD 2A6DA 3LKPB 1WISA 2JB5L 1FL3B 5F9JB 3DSFL 1JTOA 3QXAA 4PJCB 1FNSH 4FQQA 5AWNL 4QHUB 1BZ9B 4PJXB 3V6FB 3O9WC 4LP5A 4S1RL 5J1SC 4WHYH 1E28A 3WNPA 3G5XA 1ZWIB 4G6AC 3QYCA 3PGFL 4Q74A 2YPKB 1A3LH 1IKNC 1S7WB 5D7SL 4XTRC 4P2QA 3VXMA 3SOBH 5IVXB 1CXIA 1JWUB 4OQTA 1MCSA 3RRQA 1LDPH 4GAFB 1H8NA 2XKUA 5AZ2H 5GHWL 1O5DT 1OAUH 3K8LA 2O5ZH 5TGBB 4WTZG 3MYJA 2VXQL 1RIUL 3M07A 4I48B 4PLKC 5I1KH 1YY9D 5D7LE 5JLZA 5IMLA 1PVHA 3HPJB 5EUOF 1CL7I 4M62H 4R96A 4V2CB 3CJJA 3B9VA 3F58L 3ZMRA 2HLAB 3FCTA 3N50A 5FXCH 4YZFF 2A74B 1XGTB 3QHFL 3OKNA 2JF1A 4N8PA 3PGCB 3B9EA 4XX1G 4CADA 2IAND 4Y5XC 3GZKA 2PO6C 5A16A 1RMFL 2X4RA 4WFFD 4Y4FC 1NSNH 5DJ0B 3VGGA 3L9RA 3ARGB 5B3JF 1XR9B 4OKVA 4F7TB 3RBSA 2C1OA 5DQJA 4XCYA 3W2DH 4CW1A 3HFML 2X2YA 4MSWA 4ZS6D 1L9MA 4WFED 1UB6B 3T0XA 2J8OA 2OJZL 5DJ6A 3RGVD 3S3PA 4HUWA 4U1KA 4ZAKB 2ZUYA 1K8DB 1RK1B 3DWTA 1T0PB 4HXBH 3RY6A 4N5UA 3FN0L 4KVNH 1C1EL 3BVNB 1SYVA 1S7SA 5GISL 2A73A 1YEDB 3MCG1 2IG2H 4PJGB 4MXQC 4M5ZH 1QBAA 1OB1B 5SV3A 3V52L 1QP1A 2FX7H 3O6LL 1DN0B 3SEPA 12E8L 5DD3L 3ULVD 4LPWA 2PO6D 1LK2B 1S7RA 4P3DB 5F7WC 4PYHA 4WDIA 4HC1L 1EHLH 4WO4A 1N2RA 1MAMH 2VDMH 1TIUA 4HZAA 3HI6L 1P5UA 1QLEH 3WYRA 3QQ3A 5I1EH 4PGEB 3LV3A 4O5LL 3I75B 3RJDA 1J10A 4EVNB 1D5XA 4U2ZA 4EZMA 2QQKL 1U8IB 3EYVB 3MRGA 5F9AC 3S4SB 3DX8A 1F3JB 1S3KH 1N59B 1OAZH 4OLWL 4JRXD 5GGVY 4LSPH 1N26A 5EZLB 3WS6A 3G5VB 1AO7B 1DVFB 4YFLI 5C09B 1VACB 3D85A 4Z18A 1JZ2A 3WIFB 1OCWL 1IGTB 4DGYL 3U46B 4ONFL 4QTHA 5C9JA 5JW4Q 3TO2B 1A0QH 5CKAA 4ODSH 4Z7WA 4K3EL 1GL4B 1A3RL 5IB5B 2VLMD 43C9B 2DTMH 1P1ZB 1V3KA 1J86A 5E4IA 3SDAD 2DI7A 4ODVH 1FZOA 4DGIL 2NNAA 3BUTA 3KJ4C 1UG9A 1A6VH 3FHAA 4AEIL 3HAEG 2IH1A 2FECL 2WBJC 5E8EB 4YK4B 4MA3B 4LNRB 3SGKC 1MQ8A 1PBYA 1ZA6A 2AABL 1EXUA 4FQXB 2AEWA 4XVTL 2E27H 4JVWA 3VRLF 4Z7VB 5J8OA 4BA8A 1XFPA 4H25A 2ED8A 4Y5XA 1N7ML 1Q38A 4NQDD 4WUUD 4HS6A 2AQ3A 4F33A 3FQTB 3NZHH 2GK0B 3MTRA 3SY0B 3CPLA 4E41B 2AJXL 1VKXA 4JY6A 4OCLC 5FECA 5D1QD 1L0YA 3LRHA 4S0SD 2VITB 2VTFA 3VRIA 1NDMB 2UY7A 4JFOA 4QCIB 1MFBL 1ZGLA 2EDOA 5I75B 1JWMA 3QUML 4HMEA 1T5WB 1RK1A 3MRCB 4XGZA 3IS1X 4L3AA 3V8OA 2WBJD 4LGRB 1SYSA 4GRLB 3MRHB 5E2JA 3LEXB 5GXBB 4MSWB 1MFDH 4QF1A 1FQ9C 2DIAA 4PRIB 5DSCB 5I2IA 5J12B 5EDXA 3FOMB 3IU4H 5HI5D 2DL2A 1OAZL 3QJFA 3ARGA 4O02L 5IFAH 3UPCA 3QNZB 5A16B 1CVSC 1HINH 3FN3A 3I3DA 4WW2C 2G75B 2AW2A 5E9DE 3X13B 1VADA 2X4PB 4WW2F 4Z7WF 3VFTA 3LDBC 4YR6B 1QLEL 4UT7L 5DRZB 4ZG1A 3GSRB 4HKBB 4KDTC 4RAUA 3SDDB 4ETYA 4FXLA 1XF4A 1OLZA 3MOAL 3VWKB 3NTCH 1FFNA 2Z92A 4CL7A 3T0BA 1U8QB 2GKIA 4JO1L 3OXRB 2DM3A 5D7LA 5GRVK 4DKEH 3GJFA 2ED9A 4ZPVA 4HXBL 3GJFK 2X7LB 3WXWL 1UZ6F 5EU3B 3FB6B 2CDGA 3FFCE 2DMKA 3WNOA 3RTQC 2X10A 2RB8A 3K8KA 4UBDC 4JPIA 4ZD3L 4RDQG 2GJ6B 1MCDA 3V6FA 5KW9H 3RP1A 5E8DL 4G9FD 4K7PY 4PJ7F 4UDTB 1NLDH 5TFSH 3EAKA 4UUJA 4EI5C 5KS9A 4JFEE 5I1GL 5B3JE 1I9JH 3REVA 1RURL 3QHFH 4FQPA 3LN5B 5JW3H 2OBGA 4XMKH 2AV7B 2H3NA 2VKXA 1LVEA 4X6CF 2ITDB 4G42A 4QOKD 4CGTA 3CH1A 5D6DC 1ZHKB 4NO0A 3ORJA 4HD9A 5J57B 5D6CB 4DW2H 5FIEA 1A1OB 5I1LA 4X6CE 1R3IH 5IJKC 3K4DA 3QWOB 4K8RL 3BXNA 3TCLA 1JTPA 4MA7H 1A6PA 3NACH 4RSVA 2KZWA 2NYYD 1MNUH 1EFQA 3STLA 3KPMA 2BX5A 4LMQE 4ZUWB 4YUEL 1GYAA 1K6QL 3VFPB 2BOCA 5DTFB 3CVHA 4N1CA 2R2HB 3TO4A 1J1OL 4TUJA 3TESA 4ZODA 4J2XA 4HH9A 4JRYD 3ZKMC 1B6UA 2EDBA 4JY6B 3RUGE 2ZOLA 2R4SH 3BEWA 4PRAB 1PZUB 4OFVA 3SY0A 3QO0B 5EFIA 2RFXB 3Q5TA 1D5BB 5FO8B 4MDIA 4PR5B 3PV7A 3R0MA 2R2EA 1AGDA 4Z7OE 1HCVA 4P4RB 3DUHA 2OSLB 4FQXA 4A6YA 5AG9A 2CH8A 1I1YB 1YEJL 3LKSB 5T1KB 4PJEB 1AKJA 3MV9B 5FM8A 1IAKA 2CDFA 4LVNC 4YXHH 4MA3A 3IDMA 5IGXH 5F7FA 4GG6A 3DHJA 4HT1L 3OKDB 4BH8B 2DDQL 1FZOB 3B9KC 3LOWA 3PV6A 3O45A 3RWDA 4YGVA 3AMKA 5DUMH 1B2WL 2H3NB 5J9PA 1X9QA 1HHJA 4IRJA 1NCCL 3ZKMD 5LBSH 1JNLH 4MNGA 4K7FA 1LO0H 4JHAL 1T89C 2W0LA 5JOPE 3EYFB 4YC2B 3NCJH 1UJTA 2CLZA 5GS1C 1OAKH 2MMXA 4H88L 4CDGC 2OTUA 5C0RH 5IV2B 2FX7L 3O6LH 1N59A 2EXYC 5E99L 3QXTA 3QDMB 3T0AA 3NAAL 5EU3A 4U1NB 2XY1A 2X7LA 4G43B 3B9KD 4L1DA 4X7TA 2WZPD 1Q9OB 2P43B 4G9FE 4RQQB 3R1GL 5BS0E 5JW5B 1ZLUK 1WFOA 4P5MA 4KI5C 5HGAB 4MA8L 1Q94A 3X11B 4DK6A 1D3CA 3Q3GA 2YN5A 1RHHB 3K46A 4M43H 5D5MB 3B9DA 5J12C 4JZOB 2V7NB 3TCXA 3LMJH 5AZEH 1JZ6A 1RMFH 4W70A 4Y1AD 1A02N 1K2DA 1PGRB 2JJWA 1XZ0A 1QKZH 3SDDD