1T2RA

Structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
GAMAMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*UP*CP*AP*C)-3'
publication title Nucleic acid 3'-end recognition by the Argonaute2 PAZ domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nucleic acid binding protein/rna
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 1t2rA00
1VYNA 3QIRA 4W5QA 4NGCA 4NH6A 1SI2A 5KI6A 5JS1A 4NHAA 4Z4FA 4W5TA 3O7XA 4W5OA 4NH5A 4KREA 3MJ0A 2QVWA 2L5DA 4Z4CA 2FFLA 2XFMA 3O3IX 1T2SA 4F3TA 1T2RA 4Z4HA 2L5CA 4W5RA 1R6ZA 5T7BA 3O6EX 4W5NA 4NGDA 5JS2A 4Z4EA 4NGFA 4NH3A 4Z4GA 4OLAA 1SI3A 3O7VX 4NGGA 4OLBA 4KRFA 4Z4IA 1R4KA 4NGBA
chains in the Genus database with same CATH superfamily
3HJFA 1VYNA 3QIRA 4W5QA 4NGCA 4NH6A 1SI2A 5KI6A 5JS1A 1Z25A 4NHAA 4Z4FA 4W5TA 3O7XA 4W5OA 4NH5A 4KREA 3MJ0A 2QVWA 4L1UA 2L5DA 4Z4CA 2FFLA 2XFMA 3O3IX 1T2SA 3DLBA 4F3TA 3HK2A 1T2RA 3F73A 3DLHA 2L5CA 4Z4HA 4W5RA 3HO1A 3HM9A 2DB9A 1U04A 1R6ZA 5T7BA 3O6EX 4W5NA 1Z26A 4NGDA 5JS2A 4Z4EA 3HVRA 4NGFA 4NH3A 2BZEA 4L1PA 4Z4GA 3DA5A 1SI3A 3O7VX 4NGGA 4OLAA 4OLBA 4KRFA 4Z4IA 1R4KA 3U1UA 4NGBA
chains in the Genus database with same CATH topology
3HJFA 1VYNA 3QIRA 4W5QA 4NGCA 4NH6A 1SI2A 5KI6A 5JS1A 1Z25A 4NHAA 4Z4FA 4W5TA 3O7XA 4W5OA 4NH5A 4KREA 3MJ0A 2QVWA 4L1UA 2L5DA 4Z4CA 2FFLA 2XFMA 3O3IX 1T2SA 3DLBA 4F3TA 3HK2A 1T2RA 3F73A 3DLHA 2L5CA 4Z4HA 4W5RA 3HO1A 3HM9A 2DB9A 1U04A 1R6ZA 5T7BA 3O6EX 4W5NA 1Z26A 4NGDA 5JS2A 4Z4EA 3HVRA 4NGFA 4NH3A 2BZEA 4L1PA 4Z4GA 3DA5A 1SI3A 3O7VX 4NGGA 4OLAA 4OLBA 4KRFA 4Z4IA 1R4KA 3U1UA 4NGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYN A;  3QIR A;  4W5Q A;  4NGC A;  4NH6 A;  1SI2 A;  5KI6 A;  5JS1 A;  4NHA A;  4Z4F A;  4W5T A;  3O7X A;  4W5O A;  4NH5 A;  4KRE A;  3MJ0 A;  2QVW A;  2L5D A;  4Z4C A;  2FFL A;  2XFM A;  3O3I X;  1T2S A;  4F3T A;  1T2R A;  4Z4H A;  2L5C A;  4W5R A;  1R6Z A;  5T7B A;  3O6E X;  4W5N A;  4NGD A;  5JS2 A;  4Z4E A;  4NGF A;  4NH3 A;  4Z4G A;  4OLA A;  1SI3 A;  3O7V X;  4NGG A;  4OLB A;  4KRF A;  4Z4I A;  1R4K A;  4NGB A; 
#chains in the Genus database with same CATH topology
 3HJF A;  1VYN A;  3QIR A;  4W5Q A;  4NGC A;  4NH6 A;  1SI2 A;  5KI6 A;  5JS1 A;  1Z25 A;  4NHA A;  4Z4F A;  4W5T A;  3O7X A;  4W5O A;  4NH5 A;  4KRE A;  3MJ0 A;  2QVW A;  4L1U A;  2L5D A;  4Z4C A;  2FFL A;  2XFM A;  3O3I X;  1T2S A;  3DLB A;  4F3T A;  3HK2 A;  1T2R A;  3F73 A;  3DLH A;  2L5C A;  4Z4H A;  4W5R A;  3HO1 A;  3HM9 A;  2DB9 A;  1U04 A;  1R6Z A;  5T7B A;  3O6E X;  4W5N A;  1Z26 A;  4NGD A;  5JS2 A;  4Z4E A;  3HVR A;  4NGF A;  4NH3 A;  2BZE A;  4L1P A;  4Z4G A;  3DA5 A;  1SI3 A;  3O7V X;  4NGG A;  4OLA A;  4OLB A;  4KRF A;  4Z4I A;  1R4K A;  3U1U A;  4NGB A; 
#chains in the Genus database with same CATH homology
 3HJF A;  1VYN A;  3QIR A;  4W5Q A;  4NGC A;  4NH6 A;  1SI2 A;  5KI6 A;  5JS1 A;  1Z25 A;  4NHA A;  4Z4F A;  4W5T A;  3O7X A;  4W5O A;  4NH5 A;  4KRE A;  3MJ0 A;  2QVW A;  4L1U A;  2L5D A;  4Z4C A;  2FFL A;  2XFM A;  3O3I X;  1T2S A;  3DLB A;  4F3T A;  3HK2 A;  1T2R A;  3F73 A;  3DLH A;  2L5C A;  4Z4H A;  4W5R A;  3HO1 A;  3HM9 A;  2DB9 A;  1U04 A;  1R6Z A;  5T7B A;  3O6E X;  4W5N A;  1Z26 A;  4NGD A;  5JS2 A;  4Z4E A;  3HVR A;  4NGF A;  4NH3 A;  2BZE A;  4L1P A;  4Z4G A;  3DA5 A;  1SI3 A;  3O7V X;  4NGG A;  4OLA A;  4OLB A;  4KRF A;  4Z4I A;  1R4K A;  3U1U A;  4NGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...