1T2RA

Structural basis for 3' end recognition of nucleic acids by the drosophila argonaute 2 paz domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
GAMAMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEEGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleic acid 3'-end recognition by the Argonaute2 PAZ domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nucleic acid binding protein/rna
molecule keywords 5'-R(*CP*UP*CP*AP*C)-3'
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2004-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 1t2rA00
4W5NA 4Z4IA 2L5CA 4NGGA 5KI6A 2FFLA 4Z4EA 4NGDA 2L5DA 4NGFA 4F3TA 4NGBA 4W5QA 3O6EX 1R6ZA 4NH5A 4KRFA 4KREA 4W5TA 1T2RA 3O7VX 4Z4GA 5JS1A 1T2SA 4OLBA 5T7BA 4W5RA 4NGCA 2QVWA 2XFMA 1R4KA 4Z4HA 4W5OA 4NH3A 4NH6A 1VYNA 3O3IX 1SI2A 3MJ0A 5JS2A 4Z4CA 3QIRA 1SI3A 4NHAA 4OLAA 4Z4FA 3O7XA
chains in the Genus database with same CATH superfamily
4W5NA 4Z4IA 2L5CA 4NGGA 5KI6A 2DB9A 2FFLA 4Z4EA 2L5DA 4NGDA 4NGFA 4F3TA 4NGBA 4W5QA 3O6EX 1R6ZA 3HO1A 3DLHA 4NH5A 4KRFA 4KREA 1Z25A 4W5TA 4L1UA 1T2RA 3O7VX 4Z4GA 3HJFA 3HK2A 5JS1A 3DLBA 1T2SA 4OLBA 1Z26A 3F73A 5T7BA 4W5RA 4NGCA 2QVWA 1R4KA 4Z4HA 2XFMA 4W5OA 3HM9A 4NH3A 4NH6A 1VYNA 3O3IX 1SI2A 3MJ0A 5JS2A 1U04A 3DA5A 4L1PA 4Z4CA 3QIRA 1SI3A 4NHAA 4OLAA 3U1UA 3HVRA 2BZEA 4Z4FA 3O7XA
chains in the Genus database with same CATH topology
4W5NA 4Z4IA 2L5CA 4NGGA 5KI6A 2DB9A 2FFLA 4Z4EA 2L5DA 4NGDA 4NGFA 4F3TA 4NGBA 4W5QA 3O6EX 1R6ZA 3HO1A 3DLHA 4NH5A 4KRFA 4KREA 1Z25A 4W5TA 4L1UA 1T2RA 3O7VX 4Z4GA 3HJFA 3HK2A 5JS1A 3DLBA 1T2SA 4OLBA 1Z26A 3F73A 5T7BA 4W5RA 4NGCA 2QVWA 1R4KA 4Z4HA 2XFMA 4W5OA 3HM9A 4NH3A 4NH6A 1VYNA 3O3IX 1SI2A 3MJ0A 5JS2A 1U04A 3DA5A 4L1PA 4Z4CA 3QIRA 1SI3A 4NHAA 4OLAA 3U1UA 3HVRA 2BZEA 4Z4FA 3O7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5N A;  4Z4I A;  2L5C A;  4NGG A;  5KI6 A;  2FFL A;  4Z4E A;  4NGD A;  2L5D A;  4NGF A;  4F3T A;  4NGB A;  4W5Q A;  3O6E X;  1R6Z A;  4NH5 A;  4KRF A;  4KRE A;  4W5T A;  1T2R A;  3O7V X;  4Z4G A;  5JS1 A;  1T2S A;  4OLB A;  5T7B A;  4W5R A;  4NGC A;  2QVW A;  2XFM A;  1R4K A;  4Z4H A;  4W5O A;  4NH3 A;  4NH6 A;  1VYN A;  3O3I X;  1SI2 A;  3MJ0 A;  5JS2 A;  4Z4C A;  3QIR A;  1SI3 A;  4NHA A;  4OLA A;  4Z4F A;  3O7X A; 
#chains in the Genus database with same CATH topology
 4W5N A;  4Z4I A;  2L5C A;  4NGG A;  5KI6 A;  2DB9 A;  2FFL A;  4Z4E A;  2L5D A;  4NGD A;  4NGF A;  4F3T A;  4NGB A;  4W5Q A;  3O6E X;  1R6Z A;  3HO1 A;  3DLH A;  4NH5 A;  4KRF A;  4KRE A;  1Z25 A;  4W5T A;  4L1U A;  1T2R A;  3O7V X;  4Z4G A;  3HJF A;  3HK2 A;  5JS1 A;  3DLB A;  1T2S A;  4OLB A;  1Z26 A;  3F73 A;  5T7B A;  4W5R A;  4NGC A;  2QVW A;  1R4K A;  4Z4H A;  2XFM A;  4W5O A;  3HM9 A;  4NH3 A;  4NH6 A;  1VYN A;  3O3I X;  1SI2 A;  3MJ0 A;  5JS2 A;  1U04 A;  3DA5 A;  4L1P A;  4Z4C A;  3QIR A;  1SI3 A;  4NHA A;  4OLA A;  3U1U A;  3HVR A;  2BZE A;  4Z4F A;  3O7X A; 
#chains in the Genus database with same CATH homology
 4W5N A;  4Z4I A;  2L5C A;  4NGG A;  5KI6 A;  2DB9 A;  2FFL A;  4Z4E A;  2L5D A;  4NGD A;  4NGF A;  4F3T A;  4NGB A;  4W5Q A;  3O6E X;  1R6Z A;  3HO1 A;  3DLH A;  4NH5 A;  4KRF A;  4KRE A;  1Z25 A;  4W5T A;  4L1U A;  1T2R A;  3O7V X;  4Z4G A;  3HJF A;  3HK2 A;  5JS1 A;  3DLB A;  1T2S A;  4OLB A;  1Z26 A;  3F73 A;  5T7B A;  4W5R A;  4NGC A;  2QVW A;  1R4K A;  4Z4H A;  2XFM A;  4W5O A;  3HM9 A;  4NH3 A;  4NH6 A;  1VYN A;  3O3I X;  1SI2 A;  3MJ0 A;  5JS2 A;  1U04 A;  3DA5 A;  4L1P A;  4Z4C A;  3QIR A;  1SI3 A;  4NHA A;  4OLA A;  3U1U A;  3HVR A;  2BZE A;  4Z4F A;  3O7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...