1T38A

Human o6-alkylguanine-dna alkyltransferase bound to dna containing o6-methylguanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
151
Chain Sequence
b'EMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPSHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(6OG)P*CP*TP*AP*GP*TP*A)-3'
molecule tags Transferase/dna
source organism Homo sapiens
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
total genus 32
structure length 151
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t38A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t38A01
2K7LA 2TDXA 3K1PA 3V8KA 4L5JA 2HQRA 4IRGA 2PFBA 2P8TA 2V1XA 3BJOA 2JT1A 4Y15A 1HKTA 4R8HA 3ULQB 4JBAA 3LWFA 2CQKA 4DNCA 4A2UA 4XSXF 4A5MA 1EH7A 1D3YA 5E8GA 3VB2A 4AWXB 2MH2A 4ETSA 4ENKA 2E1NA 4HOBA 1EH6A 1HW2A 3F8NA 2EV0A 5BMZA 4ZYHA 5FD6A 1IN4A 2AS5F 1Z1DA 4RB1A 1P92A 3O3KA 1G3TA 1ZN2A 1FBQA 2YX4A 4BXUA 3LQQA 1IXRC 1JHFA 2P4WA 2IP2A 4M73A 2FBHA 3IC7A 5LRRA 4FHTA 4I09A 3KP4A 1IF1A 2JRTA 1ZGJA 1U8RA 3WTXC 2MD5A 4BHBA 2Q0OA 2UWMA 4IHSA 1E2XA 3HOTA 3KZYA 1ZAOA 4CICA 4EM2A 5D5XB 2K86A 4A6EA 5A2QZ 2JTVA 4U0VA 4A12A 2QQAA 3L9FA 3WG9A 5LEJA 3GWZA 2O61A 2VT2A 2F5DA 2XHKA 2VOPA 1YQAA 3C7JA 5L3EA 1MKMA 3RJPA 1LDDA 4Z2YA 3HTSB 2FXAA 2A07F 2G9WA 3GW2A 4B09A 2QVOA 4AD9A 1HKSA 5K1YA 2BEOA 5AONA 1SD7A 1WKMA 1HKQA 2YX7A 1CF7A 2ZNZA 4E70A 1TNSA 2OZUA 2M87A 3ZMTA 1I27A 5L3BA 4L18B 2RQPA 2IA1A 1MJAA 1B9NA 1S29A 2CWEA 5LGNA 1KU3A 4BAYA 1KGSA 5LHIA 3L2CA 2WV0A 4MQVA 5ICGA 2RDPA 1I1SA 5DCMB 5FLXK 3RTRA 4LLGF 3KE2A 1REPC 4XLPF 1TBXA 2CSOA 2VE9A 1K6OA 3Q9SA 4AVPA 3O2PE 1HW1A 2G7HA 5FGMA 2FE3A 2DQRA 4N9HA 1SD4A 3BPXA 2A6EF 3RIRA 2EV6A 3IRQA 2XVCA 2YSRA 3F8BA 4CYDA 3HIFA 3AAFA 3CUQB 2VN2A 2V9VA 3IRRA 1O7FA 1FZPB 5H20A 2NRAC 5ICFA 1BI2A 3M8EA 3FMRA 3R4KA 1KU7A 2JPCA 3PQKA 2IT0A 5JFRA 2EB7A 1LQ1A 3ISPA 3RYRA 4TV7A 2BBYA 3E5QA 2GXGA 5D5WB 1BI0A 4EM1A 1B59A 1LVAA 3SQNA 2HFHA 2J5PA 2VXZA 4HA8A 4M71A 5D5UB 2OBPA 3RPQA 4CXFA 4WK8F 2RC4A 1X3UA 2BE5F 1B4AA 4AIHA 2Y75A 1R00A 5HS9A 1Z6TA 3ZP5A 2ZFWA 1IN8A 3ZMVA 5LGTA 1WI9A 4M6XA 1RUOA 2QQBA 1R58A 1QO0D 2MH9A 1O3RA 4LB5A 2IW5A 3JW4A 1IRFA 2XGXA 3IKVA 2B0LA 3DEUA 3HSFA 1F5TA 2GA2A 5HOOA 3E6DA 5A2QK 3GX4X 5FB2A 1V4RA 3MWMA 5L3FA 1F4KA 3TO6A 5TJJA 4EJTA 1E17A 2H6CA 4ENJA 4AIJA 1U5TB 1XGMA 1I5ZA 4A5NA 4G6QA 3ZMDA 4OIOF 3HOSA 2LKPA 1BN5A 1TQPA 1OPCA 1QGPA 2DFIA 2DTRA 1XGSA 2ETHA 4P5OA 1WSUA 2KIFA 4L5IA 2JPBA 2XAFA 3TO7A 4G7ZF 1BI1A 1Z91A 1T2KA 5JHUA 2EA2A 5KK1A 3WTZA 5L3CA 1B6AA 2ZNYA 5IT3A 1BOAA 4KIFA 3R60A 3M7GA 1CF7B 4AIKA 4I0AA 1EV7A 2ZXJA 4G9YA 1YIOA 3E3VA 4Y13A 4P55A 6PAXA 5D8KB 2Z9OA 1ODDA 2NNNA 4ZZDA 2MLGA 3TOBA 5H6RA 2FBKA 2O03A 4M74A 3L7WA 4PZJA 1FP1D 1MD0A 4LJZF 1UHMA 4EJOA 1KYWA 1YW9A 4KUMA 1J0RA 3I54A 4KYWA 5DCMA 3KFWX 2OA4A 2CG4A 1R36A 2QLZA 4WX9A 5HDKA 1IRGA 4OINF 4I01A 2V1UA 2IJLA 1FY7A 2V6CA 1R5HA 4HBLA 4P96A 4HDUA 4BYYA 4YIFA 4UUVA 1OYYA 2M45A 3VOEA 2O0YA 3IKTA 5ICCA 4KDPA 1DPUA 3F21A 1U3EM 4KICA 3GXOA 3WU1B 2DK5A 1ZG5A 1FWZA 4OMYA 3U2RA 4NB5A 2ACJA 2ELHA 4M6YA 1Z7UA 2FOKA 2BYVE 1QZYA 4R79A 2W85A 3E6MA 3ECOA 5LHHA 4KNYA 4JQFA 4BHPA 4YFNF 1AOYA 1FOKA 4RS8A 1ZRCA 1IAWA 1TTYA 4YFKF 2KIMA 1C0WA 1T6SA 1MDMB 3JAMK 1STZA 3ABTA 4CGZA 4UHTA 5LGUA 3T8RA 3CUOA 3QP6A 3GEZA 1KQ0A 4LLNA 5D4RA 3WTSC 2H6BA 4EM0B 2VBWA 1P6RA 3I71A 4U7DA 4HW0A 1O57A 3KCCA 2D45A 3R61A 3GYHX 2PBIA 2NYXA 3T8TA 1IXSB 4LB6B 4BQAA 4HQMA 2HKXA 1O3SA 5CVUA 1P4WA 3ERED 4OMZA 1Z6RA 4EMSA 1D8JA 2EV5A 2ZKZA 4H0EA 2PMUA 3R0AA 3FX3A 3BPVA 4UVAA 4YFXF 3KP6A 4CZZA 3WTVC 1LDKB 5DD8A 3QRFF 3DKWA 4UNOA 1YG2A 2KIUA 2D2WA 1F1ZA 1BIAA 2H09A 1BM9A 1LJ9A 2IVMA 2QUFA 1RZ4A 3V8LA 1O3TA 3SXYA 2Z5UA 2VONA 1U78A 4GO1A 1UB9A 3WGGA 3BY6A 1JE8A 4IXAA 3CDHA 4GYIA 1U5TA 2L4MA 3J7AO 3KZZA 2D1HA 4Q48A 3NQOA 2FBIA 3JTGA 3RPUA 2R7DA 4P9UA 4KIGA 3O6BB 5F64A 2OAZA 3E6BA 1XGOA 1BJAA 2XASA 4S04A 4ENNA 2P5KA 2XV4S 3I59A 3PQJA 1OYIA 5EEGA 3EYIA 3OOPA 3U1DA 1XD7A 2KRFA 3ZN0A 4G94A 1TW2A 2DLLA 2IA0A 2VC0A 4WWCA 1IN7A 1WRJA 2L4AA 2EJRA 3P9CA 5DV5A 5JVTA 2EFQA 4GYGA 5DD4A 1IW7F 1I1GA 3KEOA 1ZARA 3WTYC 1YTYA 5DUIA 2FU4A 3I4PA 1PP8F 3LAPA 4UVBA 2YU3A 1I6XA 2RN7A 1QQIA 3JSPA 5JR3A 3EDPA 2Q2EA 3RKYA 2AXLA 2X0LA 3C1DA 1S7AA 2W25A 1QNTA 3E5XA 2PEXA 4LFUA 1J2XA 3B73A 1FBUA 5D4SA 3T0YA 3GZ6A 4QWQA 1XSVA 3SZTA 1W7PA 1RI7A 2EFPA 4RB3C 2QZ8A 4U88A 1SD5A 1RIOH 4U0YA 3T1BA 4G7HF 1JHHA 2MBFA 4WF2A 2STWA 2CYYA 3HSEA 4HX7A 3F6OA 1U6GA 3LAJA 2XAQA 1DPRA 5E18F 3M1EA 1FPQA 2XAHA 3GFIA 3KEQA 3V4GA 4M9ZA 2XRNA 2O8XA 2ESHA 4M9SA 5BPIA 5IT9Z 3GLXA 2E1CA 1IXCA 4LK0F 4OU0A 2FA5A 1XB4A 4EGZA 2L3DA 3CLOA 1H9TA 2HYFA 3F22A 2Q8KA 1V3FA 3QP5A 1ZG1A 1HQCA 2GIVA 4ESJA 4KT5C 2PG4A 2A61A 1U5TC 4RB0A 2DO7A 5LLQA 5HVQC 3BJAA 2FMYA 4B8XA 4RGSA 4O5VA 4L0ZB 1JXSA 2GAUA 3QPTA 2YPRA 1G6NA 1XMAA 2D1VA 2GQQA 4FX4A 2E7XA 3MAJA 3B02A 1ZLKA 1G4DA 4WXHA 4IRHA 2XKOA 3V7SA 2DQLA 3DPLC 1MJ9A 2GZWA 2STTA 3BOQA 4ESFA 4HX8A 4ASNA 4HF1A 4PGGA 2MC3A 1UHWA 3FXUA 3HTUA 3RKWA 2ESNA 4EGYA 2P6SA 4PDKA 1SMTA 4LMYA 3BROA 4FT8A 5FFZA 1L0OC 4BNCA 3ML6A 3K9TA 3F23A 3F6VA 2YR2A 3FHZA 3QU3A 2J5OA 1OR7A 4XSZF 4HV6A 1SFXA 2ISYA 3FWEA 3K69A 1SMYF 5H6QA 4KIBA 3E97A 5CJ9A 5E20A 2EFNA 4Y17A 2RKHA 4KN7X 1W4MA 5AIPA 5J8CA 3LA7A 4EJWA 2VBXA 1FYKA 5DCFA 2QBYB 4GCVA 3LQRA 1QZZA 3FMQA 1TW3A 4MHGA 2OZ6A 4XRFA 3VODA 3N4MA 3HRTA 1D8KA 4HZFA 3TDUC 3CO7C 3M8FA 5ED4A 2FRHA 3JSOA 2DT5A 3QOPA 1D5VA 3KP2A 2DAOA 2EFOA 1XCVA 4M72A 3EETA 1JGSA 3ROUA 4CDGA 4IRIA 3GFJA 1IZ1A 2A68F 3EYYA 1H9GA 1PP7U 3TKYA 1XDUA 3J81K 5BOXA 3HHHA 5EEHA 2LF8A 1XN7A 3WODF 1FP2A 2EA4A 1Q1HA 1G3WA 2F5CA 1TNTA 3H3UA 3TOAA 2M30A 4L9TA 1O7LA 1RNLA 1FYMA 2FQ3A 4JK1X 4R1HA 1G3SA 1GXPA 5CYVA 2FF4A 2OQGA 3W6KB 2VC1A 3P9IA 3KLNA 1Z9CA 5ILSA 3MZHA 3WU0A 4LK1F 1HSJA 3CUQA 2GXBA 1FSEA 2UXXA 2PJPA 3I64A 5K5RA 3QAHA 5LBQA 1SFUA 3RYPA 4LGWA 2K4BA 5E1ZB 2CFXA 1SFEA 2G7UA 3ECHA 4EJVA 2FMLA 2HS5A 1S6LA 1TLHB 2HYGD 2COMA 1MJBA 1AWCA 5ILVA 1ONVA 1J5YA 1HSTA 1ZH5A 1MZBA 3ZMSA 5FLXZ 1XCBA 4HLYA 2V79A 1T39A 3F8MA 2XROA 1UFMA 4IPAA 2ZJ2A 4HLXA 3S2WA 3J81Z 4LG0B 4RGUA 3IL2A 1J75A 2ZCWA 1ZLJA 5HLHA 5CVIA 2HZTA 4YG2F 4F7ZA 1PUEE 1MGTA 1S7OA 2E7WA 2QWWA 4A0YA 2HGCA 3R6SA 3GVAA 3P9KA 2LSOA 1WWXA 5ICEA 4IHTA 3D5LA 1USSA 4HAMA 3G3ZA 2KKOA 5K5QA 5J6XA 3ZMZA 1R23A 5DDGA 3FF5A 3WE3A 2WTEA 3ELKA 2VE8A 4G6DA 3LA3A 1FYLA 2CGPA 1NHAA 1ZRFA 1K7AA 3GF2A 3K1NA 4WXCA 3Q9VA 1LB2A 2K27A 1J59A 3RI4A 2L54A 3HRUA 2LNBA 3DF8A 2PN6A 3FXQA 2Z33A 1ZRDA 1ZHFA 2Z99A 5HS8A 1H0MA 1QPMA 1SAXA 5CVJA 3TO9A 3HYIA 2QBYA 2IPQX 2DW4A 3ZQ7A 3BZ6A 3F8FA 4XLNF 5D6EA 3C18A 4LD5A 5HDGA 4A6DA 2M5WA 3RKXA 2RNJA 4HDVA 1FSHA 1ON1A 2HR3A 5HDNA 2MA3A 2F5FA 1FC3A 5BQTA 3H92A 1KYZA 1XDSA 2QQ9A 1P4XA 5AIQA 1GVJA 5CVRA 3IWZA 3N97A 3CUQC 2P6TA 3HHGA 3FZVA 2PI0A 1OYWA 3FXRA 1GXQA 2VBZA 4I0BA 3P7NA 3W6JB 4GGGA 4EV0A 2QYOA 1FBSA 1EH8A 4KMUX 1P4AA 2PLYA 4EVIA 2DK8A 3LA2A 5E1WA 2RGVA 1BC8C 5JI6A 4MEYF 1UCRA 3CO6C 1ON2A 2JSCA 3WE2A 3SFZA 5ERIA 2HOEA 3RDIA 1YS7A 1YW8A 2Y0MA 4U7BA 3I59B 3WTTC 1XGNA 3MQ0A 1Z05A 3K1MA 4Q4ZF 2X4HA 4MTEA 3C3WA 1R1VA 4HYEA 3BJ6A 1IN6A 3FM5A 4I02A 4HV5A 1L3LA 3U9GA 2CW0F 1J9IA 4Q47A 3TDZC 2L02A 5FD5A 3WTUC 1HXDA 2FNAA 4CHUA 1HW5A 1K78A 4MNUA 2DPUA 1YO5C 2L01A 1R5GA 2LDUA 1LDJA 2XUBA 3DV8A 1YW7A 5E17F 2FSWA 2HWVA 4ENMA 4S05A 3GFLA 3EUHA 3V7RA 3CTAA 4I2OA 1KQ8A 1FNNA 2FNPA 3KP3A 2H27A 1DDNA 1ULYA 2A6HF 2W57A 2P7VB 1P2FA 3I5UA 5D5VB 1LEAA 3GFMA 1FLIA 3ZMUA 1XSXA 2OQRA 3DQVC 2VBYA 2V1DA 1T0FA 2BV6A 2HDCA 3L00A 1B1BA 2DBBA 2H94A 3WTWC 2ZBKA 4N0BA 4P9FA 1W7PB 2DI3A 3HRMA 1CGPA 1OKRA 1SD6A 2O6GE 1T98A 4GXOA 5DYMA 1KU2A 2O3FA 3MFKA 5K5OA 4M9XA 3F8CA 3DFGA 2M8EA 4EQQA 5ILUA 1KA8A 4Q5SF 4IF4A 4UV9A 4MQ9F 2P5VA 4G8XA 4RAZA 1KQ9A 4OIPF 3DP7A 4ZYGA 4HF0A 4A0ZA 1B9MA 1BC7C 4DQ2A 1IUYA 3Q5FA 2VOOA 3IHUA 1DUXC 4WCGA 3OV8A 3J80K 1LEBA 3ZN1A 4FX0A 4HF2A 1BI3A 3DPTA 3HUGA 3GZ5A 3TQNA 2GWRA 1YLFA 2HKOA 4UXNA 2ADUA 3G73A 2XIGA 4KA4A 1USTA 3GO5A 3EQLF 3F72A 3QU6A 5F6FA 5HLGA 3KLOA 3KP5A 1K79A 1ZG3A 2VT3A 3T5XA 2QENA 4OOIA 1XMKA 3V8JA 4A0XA 5HLIA 1S3JA 3HRSA 1MDMA 2R3SA 2CO5A 5F1RA 4LLLA 4KFCA 2HEOA 2OU2A 2WWYA 5HS7A 3PFIA 2ISZA 2IA2A 1KU9A 1FT9A 5L3DA 3KETA 4NQWA 3H3ZA 5BPDA 5D8LB 2P7CB 2ZMEB 4IJAA 3BWGA 3BP8A 3SHFA 4YIIA 3M9AA 5LEKA 2A3SA 2K4JA 2MLKA 1W7PD 3BDDA 5FFXA 4RGRA 2BGCA 1YYVA 1S8NA 5L3GA 2LF7A 1WQ2A 2A69F 2JZYA 3WGIA 2FEZA 2XAJA 1GHCA 2R7FA 1FX7A 4L9VA 1TQMA 3F3XA 3E6CC 1QBJA 3IWFA 1R1UA 2F5EA 4ZZLA 1TQIA 4MTDA 4O6JA 2RVCA 3MCZA 2NNYA 4HX4A 4RB2C 3DXJF 3WGHA 4I98B 3R0JA 5DUKA 4ZH4F 2XKPA 1K78B 2W24A 1G3YA 2QM3A 1YS6A 4L0YB 3VEPA 1R1TA 3JAMZ 2Z3YA 4RGXA 3E5UA 4D0PA 1R22A 3K2ZA 3JTHA 3GUDA 2DPDA 2HQNA 3MEXA 1XSDA 1OMIA 4XBFA 5KVRA 4KN4X 4EJUA 2UXNA 3QPHA 1DP7P 3MZYA 2A5YB 4OIRF 2P5LC 3REOA 4MEXF 5LHGA 1ZREA 4IVNA 4CO8A 1W5TA 3ZPLA 2K02A 1YFHA 2OD5A 2RV8A 4O3MA 3J80Z 4PCQA 4BH9A 5D6FA 1PDNC 2GA1A 2M1BA 2PMHA 2NAZA 5CVVA 3FMSA 5TRDA 4RAYA 4PGHA 4KMFA 1IN5A 4ZYDA 1W5SA 1RUNA 2PQ8A 1A04A 3I0TA 5LRSA 2W84A 4G7OF 3LFKA 3L09A 4HQEA 5IT9K 4L9NA 2KJCA 3HSRA 5CLSA 2NS0A 2UZKA 1U2WA 4ZYEA 4U0WA 4I7HA 3KP7A 4QLCU 4K2EA 1R7JA 1ZGAA 3NRVA 1T38A 3I58A 3NEUA 3SZPA 3V7CA 1BIBA 2C6YA 4OIQF 4UV8A 5J8FA 3LSTA 5BS6A 2IRFG 4LG0A 5DEQA 3FM3A 1LNWA 4NHJA 3K0LA 5E8IA 4L9JA 1HBXG 3ABUA 4WXDA 3TGNA 2ZO4A 1ZYRF 1J7KA 4ESBA 2EWNA 2DU9A 2Y48A 4UVCA 2EK5A 2KJBA 5FO5A 2HTJA 1BBYA 4ON0A 1VTNC 4N9IA 2HTSA 2EFWA 2F2EA 1O3QA 3CJNA 2VODA 4BHCA 2WC2A 1F9NA 3I53A 1Y0UA 4MGRA 3VFZA 5E1XA 2ZMEA 3COAC 3D0SA 2XAGA
chains in the Genus database with same CATH superfamily
2DMUA 3GLLA 2K7LA 2TDXA 3K1PA 3V8KA 4IQJA 4L5JA 2HQRA 2K85A 5KAIC 3D5RC 2LY9A 4IRGA 2PFBA 2P8TA 4LIUA 2V1XA 3BJOA 2JT1A 5AE2A 4Y15A 4A3IJ 2BY1A 3WG7H 3SEQA 2HVRA 1HKTA 4BJTA 4R8HA 3ULQB 4JBAA 2QSHX 2NUFA 1T56A 2DGCA 3PL8A 2WA0A 3FK6A 3DEWA 3LWFA 2CQKA 4DNCA 5J4YA 4A2UA 4XSXF 4BE0A 2K40A 2EN4A 5JLXA 4A5MA 1EH7A 5EEAA 1S9HA 1D3YA 5E8GA 3A03A 1MIJA 3DEEA 3VB2A 3BG7A 2RQLA 4AWXB 2MH2A 1SVLA 4ETSA 4A3JJ 2IS4A 3LSKA 4ENKA 2E1NA 2ID6A 3S2DJ 4M9VC 2H1LA 4HOBA 1EH6A 1XMQE 2GOXB 1JGGA 1HW2A 3F8NA 2VXDA 1ETVA 2EV0A 5BMZA 3JRDA 4ZYHA 2NUGA 2EOOA 1ZBTA 1YPNA 5FD6A 1IN4A 2AS5F 1Z1DA 4RB1A 2VF1A 1P92A 2MDRA 3OOUA 2UU9E 2LUQA 3O3KA 1G3TA 1ZN2A 1FBQA 2LTPA 3TMOA 2WY8Q 4LIVA 4F9BB 1YYOA 2YX4A 1F43A 4BXUA 3LQQA 1IXRC 4C3IJ 1KYQA 1JHFA 2EOYA 2P4WA 1ETQA 2IP2A 2X85A 1DI2A 2DMNA 4XKWA 1NCSA 4BBSJ 3P5JA 1VNDA 4M73A 4M3DA 2FBHA 3IC7A 5LRRA 1UN6B 4FHTA 4I09A 3MKWB 3KP4A 4ZC3A 2KHXA 1JUMA 1IF1A 2JRTA 1LUJB 1ZGJA 3DKYA 3UNGC 1PJSA 5A6BA 4IO9F 2EOXA 1U8RA 2NA2A 4B47A 1JUPA 3WTXC 2YTPA 1ZAAC 3F0CA 3PUFA 1TL8A 2MD5A 3AUZA 4R03A 4BHBA 2Q0OA 2M7BA 3HC7A 2UWMA 2NXNB 4YEJA 1ZQ3P 4IHSA 1E2XA 2KFDA 3HOTA 3G1LA 3KZYA 2KDZA 1ZAOA 4CICA 1K83J 4EM2A 2MW8A 3FK7A 1BA5A 5D5XB 2K86A 4A6EA 5A2QZ 1T4OA 2JTVA 4U0VA 1Z3XA 4A12A 5J40A 4U87A 1X1BA 2QQAA 3S15J 2EM8A 3PNTA 3L9FA 3WG9A 5LEJA 4JYKA 2EPPA 2LYCA 2JA2A 3ZQCA 2MABA 5LFAA 1HR0E 3GWZA 4LF7E 1X6EA 2O61A 1O4XA 2VT2A 1ETXA 2F5DA 4PJNA 2XHKA 5LD2C 2VOPA 5J1YA 1YQAA 3C7JA 5L3EA 1ZR4A 4X62E 1VQKI 1MKMA 3RJPA 4ZTJA 1MMAA 3K4CA 2LKSA 1V55H 1LDDA 4Z2YA 3S3NA 1NH3A 3HTSB 2MDGA 2FXAA 3NWSA 2A07F 4A3EJ 2DFEA 2G9WA 3GW2A 1PYVA 1KONA 1Y8QB 4HSRA 4B09A 3GMEA 1VF9A 4J19A 4L5NC 2KT0A 2QVOA 1HKSA 4RM3A 4AD9A 5K1YA 5DNYA 2ZFUA 2BEOA 5AONA 1SD7A 1WKMA 5B5EC 1HKQA 2YX7A 1CF7A 2ZNZA 4E70A 1TNSA 2OZUA 5F3WA 2M87A 3ZMTA 3OYBA 1I27A 4NHRA 2F4VE 2LCEA 5L3BA 3EPKA 1P7JA 5GTHC 4BY1J 1LFUP 4L18B 2RQPA 2IA1A 4ZDPA 1MJAA 2GLOA 2EP3A 4JI3E 1P7IA 1ACIA 1IBLE 1B9NA 4YIRX 4B4CA 1S29A 2CWEA 5LGNA 3KIOA 2NVTJ 5ADZA 1KU3A 4YY3E 4B3RE 4CCNA 1JI8A 3RPUD 4BAYA 1KGSA 5LHIA 3L2CA 2ENAA 2BY0A 2WV0A 4MQVA 2EN2A 4B3TE 5ICGA 2GXAA 2RDPA 2RPCA 1TT0A 1I1SA 5DCMB 4IQ4A 5FLXK 1G2DC 5FRNA 1E0EA 1IMUA 2ME0A 1MBFA 5C4JJ 2R0QC 4BBRJ 4JX5A 4BXXJ 1FMVA 1VQ9I 2QKMB 3RTRA 5IOYA 2LV2A 2VQHA 4LLGF 3KE2A 3OYAA 1A1FA 3A4CA 1REPC 4XLPF 3QG5C 1TBXA 3FKIJ 1IDYA 4E7SA 4DV2E 2ZSHB 2YPNA 4RH8A 2MC4A 2CSOA 2VE9A 2TCTA 2A05A 3LL7A 1K6OA 1L4SA 3E0JB 3Q9SA 3O2PE 4AVPA 1HW1A 2G7HA 2ZMEC 3M1CA 5FGMA 4BUPA 4BE1A 1IV6A 2JXPA 2W7NA 2ECBA 1APLC 2FE3A 2DQRA 2VUMJ 2YTJA 4N9HA 4E6KG 3AG2H 2HZDA 3ABKH 1SD4A 3BPXA 4XL9A 2EMBA 2A6EF 3RIRA 4W1UA 4IJDA 4E7HA 2LE2A 2CJJA 2EV6A 4DJAA 4FE4A 3IRQA 2XVCA 2YSRA 5J47A 4HEIA 2DB2A 2DXIA 1RETA 2E72A 2XGCA 3F8BA 3HIFA 2DOAA 4CA0A 3CUQB 4CYDA 3AAFA 2CV0A 2VN2A 2V9VA 3IRRA 1O7FA 1FZPB 3FBNB 1UHSA 5H20A 2NRAC 5ICFA 2HVQA 4F92B 1BI2A 3M8EA 2EORA 1A1JA 2RTXA 3FMRA 3LSHA 1TWHJ 2H36X 2A6TA 3W3CA 1W36C 3JRCA 2V86A 3R4KA 2EQ1A 2HXOA 1QPIA 2ZJQF 2YRHA 2XGEA 1R4NB 1KU7A 2KRCA 2JPCA 3PQKA 4FE7A 2O9LA 3FXLA 2IT0A 1TC3C 2EMXA 2XDVA 3QQAA 5JFRA 2EB7A 1LQ1A 1A31A 3ISPA 2O7OA 3RYRA 3OYFA 4TV7A 3O8GA 2BBYA 2VQFE 3EPZA 1FKAE 2I13A 3E5QA 1H89C 2GXGA 5D5WB 1Y6IA 2VPRA 3HM5A 1BI0A 5K7ZA 4EM1A 3G1OA 3CCEI 1B59A 3OIQA 4MIMA 1AHDP 1HA8A 4F9CB 2DRPA 1LVAA 3SQNA 3U1KA 4AYBA 2HFHA 2J5PA 2VXZA 1V5EA 4DV3E 2WADA 4HA8A 1QU6A 1HC8A 4M71A 3BQYA 5D5UB 2OBPA 3RPQA 1Z0XA 2YTDA 4D1QA 2EPLX 4CXFA 4NC8A 2R76A 4WK8F 2RC4A 1X3UA 2BE5F 2XF7A 1B4AA 4PUSA 4AIHA 4F2JC 1IV8A 2WBMA 2Y75A 1R00A 4LU9A 1XTAA 5HS9A 2JPAA 3BZCA 1Z6TA 4X0GA 3ZP5A 2LC2A 2ZFWA 3S1QJ 2YTNA 1IN8A 3ZMVA 5LGTA 1WI9A 2L2KB 3RCOA 4M6XA 2R7RA 4I6ZA 1KJKA 4UUTA 2OCEA 2QQBA 1RUOA 1NG7A 2ECCA 1R58A 3KEYA 1HCRA 2E5NA 4IHVA 1YYWA 1T0FC 3H0DA 1Y56A 5GAEJ 2YTEA 1OLTA 1QO0D 2ELJA 2K5CA 4LF4E 1RKTA 2B9DA 2MH9A 3IUOA 1O3RA 3F6HA 4WPYA 2BW3A 2ODRD 1DP3A 4LB5A 4KHPE 2Y31A 2RQQA 2JVGA 5KAFC 2IW5A 3JW4A 4RAGA 1GQEA 3OYGA 2EL4A 1MH3A 1IRFA 2XGXA 2M8GX 5IYDJ 5KL6A 3IKVA 4JI1E 2YSPA 5LMUE 2UUBE 1UILA 2B0LA 4RM2A 4R2QA 2DTZA 3GBGA 3K4LA 3CJTB 2BBGA 4UB6C 1JKRC 3DEUA 1GUUA 3HSFA 1F5TA 2JJ7A 4BACA 4NQWB 2OV7A 3OS2A 3JTZA 2E2JJ 2VQCA 3CZ6A 1BOBA 2YTOA 2GA2A 5HOOA 2EZLA 3E6DA 2JA6J 3IH2A 5A2QK 3GX4X 4IHWA 5FB2A 3BR2A 3I9V2 2XGDA 3B6CA 4F55A 4ZTFA 2CPNA 1V4RA 3MWMA 2Y9YA 4D5FA 5L3FA 1F4KA 2DMYA 2N8XA 2YRKA 1D1AA 3TEDA 4IKFA 3FIWA 5TJJA 3TO6A 4EJTA 4FQGA 1AKHB 1E17A 2H6CA 1DGWY 3CF5F 4ENJA 2LD5A 4AIJA 1U5TB 1PJQA 1XGMA 4JV5E 5EGOB 1I5ZA 2MYSA 2FJ1A 4G6QA 3ZMDA 4A5NA 1X1CA 4OIOF 9ANTA 1X48A 4HG2A 2LKPA 3HOSA 1A1KA 3K4JA 1BN5A 1TQPA 2DA2A 1OPCA 1UG2A 1P9QC 4XRSA 3TW6A 2AQEA 1QGPA 5GPAA 3ESWB 4G12A 3FDYA 2DDAA 1X2MA 2DFIA 2CMPA 3CCYA 3MKYB 2M7QA 4A3FJ 2DTRA 3C2HA 1XGSA 5B1BH 2ETHA 3MD2A 2NVUB 2A25A 3LOCA 2JMWA 2DA3A 4P5OA 5A2QC 1LKXA 5T6JA 1WSUA 3A0BC 2EM6A 1Z67A 2KIFA 4L5IA 1TZLA 3K6QA 2EPZA 3M99B 2JPBA 2K3FA 2K9QA 2XAFA 3TO7A 4C3JJ 4G7ZF 2MGQA 1BI1A 4CCJA 2JRMA 5A6KA 4LFBE 3OYDA 1Z91A 1T2KA 2DMQA 2EM9A 5JHUA 2Z1DA 2EA2A 2EPNA 5KK1A 2GLIA 3WTZA 5L3CA 3OMLA 1B6AA 2ZNYA 5IP9J 5IT3A 4N4RB 2AHQA 2BXZA 2EOFA 1BOAA 4KIFA 3R60A 5IY5H 3M7GA 2DLKA 3H36A 1CF7B 4AIKA 4I0AA 1X4OA 1EV7A 2ZXJA 1AU7A 1N78A 2NOGA 3H1CA 4G9YA 3K70C 1YIOA 2G0EA 3JRFA 4HNUA 1XMXA 3E3VA 4XORA 4Y13A 4P55A 2OF7A 1OCPA 6PAXA 5D8KB 2Z9OA 1ODDA 2NNNA 4BJ5C 4PK4A 4ZZDA 2MLGA 3TOBA 2FBKA 2O03A 2W00A 4M74A 3L7WA 4XLFA 4PZJA 1FP1D 5H6RA 1MD0A 4GEQB 4LJZF 4BGDA 3EPJA 1UHMA 4EJOA 1KYWA 1YW9A 1WGXA 4KUMA 1J0RA 1DGRM 3I54A 4KYWA 5DCMA 3OYIA 2LJUA 4XN0A 1MSFC 3KFWX 2OA4A 2CG4A 4Y3OA 2BB8A 1R36A 3HG9A 2QLZA 2OTLI 4WX9A 5HDKA 1IRGA 5FLXC 2LR8A 4OINF 2CSHA 4I01A 1IG7A 2V1UA 3RQIA 2IJLA 1FY7A 2Y9ZA 4MLQA 2V6CA 1B72B 1R5HA 4HBLA 4P96A 4HDUA 4BYYA 4YIFA 2L9SA 2R5YA 4C2UA 3VWBA 4UUVA 1OYYA 1YSAC 3P1XA 2M45A 2LMDA 3VOEA 2O0YA 3IKTA 4LOCA 2M0MA 3TW7A 5ICCA 1AA7A 2EOEA 1XG1A 3DLLF 4KDPA 1A6QA 1I94E 1DPUA 3F21A 2LOOA 1IQOA 2L8TA 1SVMA 1U3EM 2JWOA 3AV0A 2DFHA 3MVPA 4KICA 3GXOA 4J00A 1ENHA 4BE2A 1HOMA 4MO7A 3WU1B 2DK5A 1ZG5A 2KMUA 1FWZA 4OMYA 2JA8J 2DYRH 2CQ7A 2YUSA 3OMYA 3U2RA 2D9HA 4LF8E 2YZTA 4R2EA 3KYCB 4NB5A 2ACJA 2ELHA 4M6YA 3S16J 2EPKX 1Z7UA 2FOKA 2BYVE 2LFBA 3BGHA 5EF6A 1QZYA 3T1YE 2JP9A 4R79A 2W85A 4AUXA 2WAQA 1XX5A 1B69A 3E6MA 2ZB9A 1K61A 3EQ1A 3ECOA 5LHHA 4KNYA 2VKDA 4JQFA 3A01A 2JUCA 4BEHB 1JKPC 4BHPA 4YFNF 1AOYA 1WXRA 2L7FP 3CJRB 3FXMA 1XPXA 3UK3C 2HPIA 2O5RA 3W6VA 2EBIA 1RR8C 4RS8A 1FOKA 1IGNA 3S1MJ 4CYCB 3H9QA 1ZRCA 1IAWA 1TTYA 2VJ5A 4XK4A 2KIMA 4YFKF 1C0WA 1T6SA 1MDMB 2L33A 4CCMA 3JAMK 4II3A 1WJ5A 1STZA 1TWCJ 1UHZA 3ABTA 3CJQB 5HODA 4CGZA 4B3ME 4UHTA 5LGUA 3T8RA 1GLNA 3CUOA 3QP6A 3GEZA 1X1PA 1KQ0A 3ZQQA 5D4RA 4LLNA 1HNXE 1N36E 2ZSIB 3WTSC 2H6BA 1IBME 4EM0B 2VBWA 1P6RA 3I71A 4F91B 4U7DA 3D1NI 4HW0A 1O57A 3KCCA 1HDDC 2HJJA 2Z2SB 2D45A 2M34A 2R7UA 3R61A 2DLQA 5IWAE 3GYHX 1R4MB 2PBIA 3S8PA 1I50J 2NYXA 3T8TA 1IXSB 2BHYA 1A36A 4LB6B 2FTXB 3CD6I 3OL4A 4BQAA 2EPOA 4HQMA 3L2UA 2HKXA 2VJJA 5FROA 1O3SA 3A0HC 2J7JA 5CVUA 1VQPI 1P4WA 4G6TB 3ERED 1W0TA 4OMZA 3VYUB 1Z6RA 4BKXA 4D7NA 4EMSA 1Z77A 2VL8A 3OYCA 4E7ZA 1D8JA 2EV5A 3RZOJ 2ZKZA 3DCFA 4H0EA 2WB1A 2M9HA 4RLQA 2PMUA 3QYBA 3R0AA 3HOWJ 4XQFA 1YX5A 3FX3A 1I6HJ 3BPVA 2PRTA 3C4TA 4UVAA 4FCYA 4YFXF 5F0FA 3OR2C 3KP6A 3DJWA 2BW3B 4CZZA 2LREA 3C4BA 4GKJE 2HU9A 3WTVC 2R7WA 2OC6A 1LDKB 5DD8A 1F2IG 2V4JC 3QRFF 2KLOA 3DKWA 1YG2A 4UNOA 3AL0B 2K4VA 2KIUA 2D2WA 3G71I 1F1ZA 1BIAA 2H09A 1BM9A 1LJ9A 2IVMA 2ELKA 2EOSA 4ANJA 2QUFA 1GT0C 1W1WE 4BMJA 1RZ4A 3V8LA 2LRDA 2QQ8A 1O3TA 3SXYA 4DV0E 4TUIA 3PM1A 2VQGA 2Z5UA 2XB0X 1ZR2A 2VONA 1U78A 1ZELA 2KIQA 1Z1BA 3K4MA 4GO1A 3GTQJ 1UB9A 3WGGA 3BY6A 5TGTA 4AVZA 2O8KA 1WFXA 1JE8A 4IXAA 1OCTC 3CDHA 3GTGJ 2FX0A 2HQ5A 1WI3A 4GYIA 4BS9A 5C44J 3VYYA 1U5TA 1WJCA 2L4MA 4NXNE 3J7AO 3KZZA 4GFBA 2HI3A 2D1HA 4Q48A 4GKKE 3PSFA 2W1OA 3NQOA 2FBIA 4XLAA 2DOFA 4DR6E 1TWFJ 3H9JA 4LF6E 3JTGA 1MNEA 3LMMA 3UR3C 3RPUA 2R7DA 5B1AH 2L3JA 4P9UA 3ZRGA 1BBOA 4KIGA 3O6BB 3J80C 5F64A 4R2AA 2LUPB 2OAZA 2Q2EB 3E6BA 2NOJB 1XGOA 3CMMA 1BJAA 2XASA 3TP3A 1T4LB 1QZEA 4S04A 4M2ZA 5EZGA 2EMAA 4ENNA 1VFCA 1UAAA 2P5KA 2XV4S 3I59A 3PQJA 1OYIA 4Y4RA 2V89A 5EEGA 3EYIA 2JVAA 3BTLA 3OOPA 4NBQA 2RS6A 3S1NJ 5HLTA 3U1DA 1XD7A 1EF4A 2CQNA 1I3QJ 2KRFA 1HDPA 1K4TA 1B8IA 3A1YA 3HJEA 4NUBA 3ZN0A 3HZJA 4G94A 1TW2A 1H88C 1JK2A 2DLLA 2IA0A 2VC0A 4X66E 3ASNH 4WWCA 2HDWA 4JI2E 4F54A 1IN7A 5IYBJ 1LLMC 4X9JA 2ZJPF 1WRJA 2X6XA 2L4AA 4IEJA 1OQYA 4O43A 1GV5A 5HNFA 2WCC3 3BG9A 3UKGA 3OYHA 4DMIA 1WCMJ 4I76A 2EJRA 3P9CA 5K7HA 5DV5A 2R7ZJ 4XICA 2DSYA 5JVTA 2EFQA 2L7MP 2WAQN 4QPOA 4GYGA 3L2RA 2PJRB 2DA4A 5DD4A 2M9AA 4QPQA 3CCUI 2XAUA 3LLHA 1U8BA 1IW7F 2K9LA 1I1GA 3KEOA 3SEZA 1LPQA 2WZOA 1X3ZB 4V2FA 1ZARA 1Y8RB 3WTYC 1RC9A 1YTYA 1VQ5I 5DUIA 4X8WA 2FU4A 2EZIA 3MKZA 3MSWA 3I4PA 1PP8F 5AC5A 3LAPA 3CDLA 1E3OC 4UVBA 1N75A 2YU3A 1I6XA 5JVGF 2RN7A 3CC7I 4D9JA 3OS0A 1RMDA 4DR7E 4OAYA 2IBDA 4HPQA 1QQIA 2FD5A 3JSPA 3DF6A 4M0VA 1GV2A 3RMPA 4Z6YA 5JR3A 2LT7A 3EDPA 2Q2EA 4R2RA 5EJCA 3RKYA 3L1PA 1QHGA 5LMNE 2AXLA 1EA3A 3WHCA 2BY2A 1FEXA 4XR6A 2X0LA 2X6WA 2AQFA 1S7AA 2W25A 2XF5A 3C1DA 3ZQFA 2EOZA 1QNTA 1R71A 3E5XA 2PEXA 4LFUA 1J2XA 1ETWA 3NAUA 3B73A 3QYFA 2EPUA 2CQQA 1FBUA 4WFTA 2NS7A 5D4SA 5IV8B 1GTKA 3DKXA 5FKMA 3T0YA 3GZ6A 4QWQA 2JSPA 1YOVB 4CCKA 5F0CA 3I56I 1XSVA 2X6YA 2P0WA 1ETKA 2BY3A 4XKBA 2V1NA 4IHYA 2F4OB 3GTJJ 4V19K 3SZTA 2JY9A 2A5WA 1W7PA 1RI7A 4M6VA 4Y52J 5IP7J 2EFPA 1BR4A 4RB3C 2EPRA 2QZ8A 4U88A 3HQ1A 1SD5A 3GTOJ 3VPRA 1RIOH 2FQ4A 1GVDA 4U0YA 1HLVA 5CFFE 3T1BA 4F6MA 4G7HF 4XOPA 1JHHA 2MBFA 1TT5B 1BW6A 1BW5A 2DDBA 1ZBQA 2I10A 4WF2A 3WU2C 2CYYA 4HX7A 3HSEA 3LAJA 3F6OA 1U6GA 2STWA 2XAQA 1DPRA 5E18F 3M1EA 1FPQA 4N4NB 2YS9A 2IGKA 1M1EB 2XAHA 4DBRA 1RC7A 3GFIA 3KEQA 1I3AA 3V4GA 4M9ZA 4NZVA 2WBTA 3PJRA 2XRNA 2O8XA 4PFOA 1MBGA 3DWLE 3THNA 4P78A 5TSEA 1ETOA 1TWAJ 4Y7NJ 2CRGA 2ESHA 4M9SA 4A3GJ 2X1EA 1MMGA 4R2CA 2H8WA 5IYCJ 3GTKJ 5BPIA 5IT9Z 3GLXA 3K70D 4J01A 1IXCA 2E1CA 4LK0F 4OU0A 2FA5A 1XB4A 4EGZA 2L3DA 3CLOA 1G2HA 5KL7A 1SFKA 2JWTA 2Q8UA 2VKEA 1H9TA 2FUG2 3H5AA 2HYFA 2BVLA 3F22A 2ELZA 2W82A 3PUBA 2Q8KA 4JI6E 2EPXA 5J1UA 1V3FA 4XNFA 2XSJC 4JOMA 3QP5A 4C2MJ 1ZG1A 1HQCA 4D5CA 2GIVA 3J81C 1XNQE 4ESJA 4ZDOA 2KHMA 1MBJA 4KT5C 3EPHA 2GBYA 3K4NA 2PG4A 2A61A 2ME6A 1U5TC 3FIGA 4RB0A 2DO7A 2CT1A 5LLQA 2FGGA 3BG5A 4Q35B 5HVQC 4XLEA 4CH7A 2R5ZB 3MHHC 3J7AG 3OYNA 3BJAA 4MFDA 2E2IJ 3BF2A 2FMYA 4B8XA 1G8XA 4RGSA 2DT7B 1JJ6C 2DCEA 3CDIA 5FKOA 4O5VA 3ZQGA 4L0ZB 1JXSA 2GAUA 3ADIA 1IBKE 3QPTA 2YPRA 1WHNA 1G6NA 1XMAA 5B66C 3EPLA 2EM4A 3S14J 4AIDA 2D1VA 2GQQA 4FX4A 3HPZA 3IWBA 1XNRE 2E7XA 3MAJA 1BJZA 3B02A 1JJ8C 1G4DA 1ZLKA 4WXHA 4IRHA 2R7XA 1Y1VJ 1D0YA 3ADLA 2EQRA 2XKOA 2V8QB 3V7SA 2DQLA 3TBIA 3QODA 1TWGJ 3DPLC 3IAS2 5EZHA 4XM3A 3TP0A 1MJ9A 5E3OA 2VASA 4RDUA 1BR2A 2GZWA 2STTA 4EEFG 4LITA 2YTGA 2XPUA 3BOQA 3KYDB 4ESFA 5EG0B 4HX8A 4ASNA 4HF1A 2LMZA 3ADJA 2YWQA 4PGGA 2MC3A 3THOB 1RESA 1UHWA 2F4MB 3CF2A 5GPCA 3FXUA 3HTUA 3RKWA 2GHFA 4OX9E 2ESNA 3GZNB 2E2HJ 4EGYA 2P6SA 4PDKA 1SMTA 4LMYA 4A3DJ 3H5RA 3BROA 3PFYA 4FT8A 4ITVA 2DMIA 5F0HA 4A3LJ 5A6BD 5FFZA 1L0OC 4BNCA 3G4SI 3ML6A 2IGNA 3K9TA 2ADRA 2JOBA 3F23A 3IH3A 3F6VA 2YR2A 1X47A 4D7MA 1X58A 4KJZA 1W36D 3CQZJ 3FHZA 3S3OA 3PO3J 2IS1A 3BZKA 4DKKA 4PFPA 4E7KA 3QU3A 4AYBN 2J5OA 3BTCA 1OR7A 4XMYA 3Q3SA 2CV2A 4R8OA 2VKHA 4O4KA 2BVMA 2EQ3A 4XSZF 4GRIA 4HV6A 1SFXA 1TP4A 2ISYA 3FWEA 1WVRA 2M4IA 3K69A 4C9YA 1SMYF 5FLMJ 5IXMB 5H6QA 1X5WA 4M30A 5DTDA 4KIBA 2VJIA 3AL0C 1QU3A 3E97A 5CJ9A 5E20A 3KPHA 3OYLA 1FJGE 1FIPA 2EFNA 4Y17A 2RKHA 4KN7X 1W4MA 5AIPA 5J8CA 2K7IA 4WSPA 1B8IB 3LA7A 2LY2A 3BR0A 5GADJ 2HC5A 3G1MA 4EJWA 2VBXA 1TN9A 2IHR1 2EMHA 3Q0WA 1FYKA 2OCCH 5DCFA 3ZQLA 5GTIC 1PVEA 1WZ2A 2EE8A 4HTGA 2QBYB 2UUCE 2ENCA 4GCVA 3LQRA 4IL6C 1QZZA 4BC9A 3FMQA 2L2OA 1TW3A 4AC0A 5CQGA 1ZTRA 2HXIA 4MHGA 2OZ6A 1X6HA 3OIPA 1PDAA 4XRFA 2YSOA 3VODA 2EMWA 4ABZA 4YHHE 4Q28A 3N4MA 3BTJA 3HRTA 4DBQA 2XRLA 1D8KA 2UUZA 2HDDA 4DR2E 5A69A 4HZFA 3TDUC 3M07A 3CO7C 1U9NA 5F08A 3M8FA 2EL5A 2L3CA 4PJJA 5ED4A 1N3GA 2FRHA 1YZ9A 5EGOA 1O0WA 1VQ6I 1OISA 3MMYB 3IWCA 3VHTB 3JSOA 3JRHA 2DT5A 3JRBA 1YIJI 5CKTA 2ELYA 3QOPA 4NXME 1D5VA 3KP2A 2DAOA 2DJNA 2EFOA 3HPGA 1XCVA 3OR1C 4M72A 3EETA 2LKXA 1SFOJ 3U21A 4I8OA 1JGSA 3ROUA 3FXOA 2HNHA 4CDGA 4IRIA 2QCOA 3GFJA 1IZ1A 1MBHA 3BCBA 2A68F 3EYYA 4BQOA 1H9GA 3CMYA 3N05A 1PP7U 2PX9A 3TKYA 3CC2I 4JI4E 1XDUA 2XC7A 2R7TA 3J81K 1OCCH 4QIWN 3HHHA 5BOXA 3QPSA 1X3WB 2LF8A 5EEHA 1XN7A 4DV7E 3WODF 2X51A 4DOZA 1FP2A 4YELA 2EMCA 3OSFA 2EA4A 2LJHA 2EILH 1K6YA 1Q1HA 4PJLA 2LVHA 1LFBA 4JI5E 2N3HA 1G3WA 2PMZA 4QTRA 2F5CA 1TNTA 1WJBA 3H3UA 4GZNC 2JK3A 3CCRI 1N33E 4A3KJ 4CZCA 3TOAA 2M30A 4L9TA 1O7LA 2VE7C 3H0GJ 1RNLA 1FYMA 2VKVA 1DU0A 2FQ3A 4JK1X 1J09A 3OL3A 4PSWA 4LTYA 4R1HA 4WYQB 1WJFA 4RBOA 2EMGA 4DV1E 2LTRA 1G3SA 1S5LC 2HOAA 3PIPF 1GXPA 3GTMJ 3HKZN 4X65E 1SAUA 3PNVA 5CYVA 2V6EA 1IJWC 3VDXA 3OYEA 2FF4A 2OQGA 5JHFA 1LFPA 3W6KB 2VC1A 1E3HA 3P9IA 4YRVA 3KLNA 1SEUA 4P1WA 4KISA 1FOYA 1FJLA 1Z9CA 4UY8I 1D0ZA 5ILSA 1Y39A 2OPTA 4XN3A 4BU2A 2DOEA 2DA7A 3HXLA 4EATA 1ZU1A 3MZHA 3C6MA 2W4SA 3ZOBA 3WU0A 3CCVI 4LK1F 1HSJA 3CUQA 3LFUA 2LBFB 2GXBA 3KX2A 4XRMA 1T08B 1FSEA 3LMLA 1MNMC 2UXXA 2X1DA 2BZTA 3LSMA 3H5NA 2PJPA 3BIDA 2EPFA 2VI6A 3HTXA 1RKWA 2EOJA 1WJPA 3I64A 4CCOA 1D1BA 5K5RA 3QAHA 5LBQA 1JT6A 3DTEA 4NDLA 4BL0B 4ZDLA 1SFUA 2B7TA 2CUJA 3RYPA 2L9RA 3BG3A 4LGWA 2K4BA 2LRSA 2DODA 2NUEA 5E1ZB 2QSGX 2CFXA 3KZIC 4O24A 1SFEA 1UMQA 2LY1A 2I9IA 2G7UA 2V26A 3ECHA 2K9NA 4B3AA 2FMLA 4EJVA 2HS5A 2IGOA 1S6LA 3RSNA 2B7EA 1TLHB 2HYGD 1X49A 4LFAE 2COMA 1MJBA 1AWCA 1FOXA 5ILVA 2YTIA 1BB8A 1ONVA 1J5YA 2H8RA 2M1SA 3HOXJ 2B9SA 1HSTA 1VQNI 2R5ZA 1ZH5A 1MZBA 1NTCA 3ZMSA 1A1IA 5FLXZ 1XCBA 3SFIA 1YYKA 4HLYA 2V79A 1T39A 2ENHA 3F8MA 3M8JA 1UFMA 4B3XA 2XROA 1B72A 2OJED 2XSDC 3IH4A 2IS2A 4M3EA 2R7OA 4IPAA 2GM4A 2ZJ2A 1VQOI 1A1GA 3JU0A 2CUZA 4HLXA 3S2WA 3J81Z 4LG0B 4MLVA 3S17J 4RGUA 3AG1H 3EUKL 1JTXA 3FHNA 1X4PA 4JP0A 3IL2A 2Y0SN 1TF3A 1UZCA 1J75A 2ZCWA 1ZLJA 1Q1VA 2UV1A 3BCAA 5HLHA 5CVIA 2XB5A 2HZTA 2NVYJ 1FIAA 4YG2F 2L0KA 2KOUA 1STUA 2EH3A 2EN8A 4F7ZA 4XKCA 3OYMA 1PUEE 2EM0A 4OWRB 1MGTA 1NK2P 5IT9C 1S7OA 2E7WA 2QWWA 1Y0NA 2R92J 2EM7A 3IP4B 4A0YA 2HGCA 2GOMA 3FISA 4FISA 3MKLA 5AC4A 3R6SA 5KNLA 4E7JA 4R2SA 2WBUA 1ZK8A 3GVAA 3P9KA 2EPMX 2EPCA 2LSOA 1N32E 3NARA 1WWXA 1T4NA 5ICEA 2V83A 4IHTA 1MH4A 3D5LA 2E5ZA 1USSA 4OAZA 4UUSA 3GTPJ 4HAMA 2M4KA 1PUFB 2B63J 3G3ZA 2KKOA 5K5QA 2YRMA 2X6OA 5J6XA 3ZQIA 4CCLA 3BLYA 3ZMZA 1R23A 1VQLI 2OUMA 5DDGA 2DT6A 2E1OA 3FF5A 3WE3A 3OSGA 2H1KA 2WTEA 3CC4I 3ELKA 2FOWA 3F9KA 1BL0A 4TUGA 2L6MA 2EOMA 2VE8A 4G6DA 3DTIA 3LA3A 2KZGA 2YTQA 2LK2A 1FYLA 2CGPA 1NHAA 1K7AA 1ZRFA 3GF2A 3K1NA 2N8GA 2HVSA 2GPIA 4WXCA 1IO2A 3PO2J 2HHHE 3Q9VA 1LB2A 4AU7A 2K27A 3CCJI 5GAGJ 4DZJA 5E79C 1J59A 3RI4A 1VQ4I 2L54A 3HRUA 2EN3A 5FJ8J 2LNBA 1NK3P 1DU6A 3DF8A 2PN6A 3DBHB 5EG0A 4II2A 3FXQA 2ZJRF 1AKHA 3A2KA 3BBGA 5F1JA 2Z33A 4F9AB 2V87A 1ZRDA 2P81A 1WH5A 1ZHFA 2Z99A 5HS8A 1GDTA 1H0MA 2B7VA 2EMKA 4DV4E 2PMZN 1QPMA 1SAXA 5CVJA 4J8ZA 3TO9A 3HGYA 3HYIA 4FASD 1YUJA 1AAYA 2LLKA 5LL6R 1MBEA 1HF0A 2QBYA 4I99C 2IPQX 2DW4A 1QA6A 3ZQ7A 3BZ6A 1UG0A 2LP0A 3F8FA 1T8IA 4C2TA 1F36A 1MNDA 3MZ8A 1ZGWA 4XLNF 5D6EA 4XLCA 4QSHA 3C18A 2E1MB 1V54H 3M4OJ 3HKZA 4LD5A 5HDGA 3C2BA 3FXJA 2M5WA 4A6DA 4FK5C 3RKXA 2RNJA 3AKZA 4HDVA 1FSHA 1ON1A 2HR3A 5HDNA 2MA3A 3IAM2 1NEIA 5KL5A 1CQTA 2F5FA 1QVUA 1FC3A 2JOXA 5BQTA 3H92A 1R9TJ 2EOIA 2VRDA 4JI8E 4B3SE 1JKQC 2AXTC 4A3MJ 1KYZA 1XDSA 2KRHA 2QQ9A 1P4XA 4KWYA 5AIQA 2ZXWH 2E34A 2CUEA 5A6AA 1GVJA 4XRSG 5CVRA 3HL2A 5DM6F 1UBDC 3IWZA 2RAEA 2L2NA 3T1HE 4LG3A 1GZ6A 3DBRB 3BR5A 5E3NA 3N97A 3CUQC 4NNJA 2P6TA 3HHGA 3OTOE 4HNVA 3FZVA 4RAFA 1OYWA 2PI0A 3FXRA 1YUIA 5B3SH 1IRZA 1QHHD 2XF6A 1GXQA 1E3PA 2VBZA 3F6GA 1YE9A 4HRIA 3BR6A 3M3YJ 2ZXIA 3VK6A 4I0BA 3P7NA 3W6JB 1RPWA 4GGGA 4EV0A 4M3BA 2QYOA 1FBSA 2MKDA 1EH8A 3BR3A 2LO3A 2KDOA 3W2AA 1LVKA 1P4AA 3B6AA 4KMUX 2PLYA 2QA4I 4EVIA 2DK8A 3LA2A 5E1WA 4N4OB 4GDFA 2RGVA 5BR8E 3BG6A 1BC8C 2I5UA 4NC6A 1K4SA 2HPMA 5JI6A 4MFEA 2YTFA 5KL2A 3QPLA 4MEYF 3SZGA 1UCRA 1WJAA 3CO6C 1ON2A 2JSCA 2M0CA 3GCMA 1T95A 4XOTA 2QF7A 3WE2A 4HNTA 1T33A 2RREA 2E36A 2X1CA 3SFZA 5ERIA 2HOEA 3RDIA 2BXYA 1YS7A 4HEA2 1IC8A 1YW8A 1POGA 3W2VA 2DFFA 2Y0MA 1MSEC 2YU9J 2KP6A 4B44A 4U7BA 1WHQA 4M3FA 4L5EA 3I59B 3WTTC 4BC7A 3RZDJ 1XGNA 3MQ0A 1Z05A 1R5ID 3AG3H 2RSMA 2R7VA 4O5GA 1OCRH 3K1MA 4Q4ZF 2CV1A 2X4HA 4IZZA 1KZHA 4MTEA 3RKQA 4BDZA 1VQ8I 3BTIA 3C3WA 3CCQI 1R1VA 4HYEA 1J5EE 4FETA 1YHQI 4DYQA 3BJ6A 1WJDA 1IN6A 3K4BA 3FM5A 4I02A 3OYKA 1FTZA 4HV5A 3S93A 3H09A 5AE3A 1L3LA 3U9GA 3GTLJ 2XPVA 2CW0F 1J9IA 5M5YJ 4Q47A 2IEKA 1JT0A 2ZC2A 3TDZC 2L9NA 1JK1A 2R1FA 4BEHA 2DJIA 2L02A 3L2QA 3J7Yp 5KL4A 5FD5A 3WTUC 3HPHA 3DTKA 1HXDA 2FNAA 5K7FA 2PJRA 4CHUA 1G59A 1R6RA 1HW5A 2BOLA 1OCOH 1K78A 2VB6A 4MNUA 2DPUA 3KWRA 2MSYA 4X1EA 2LBFA 3ZXSA 5F27A 3KYLA 2QEXI 4E7IA 1YO5C 3K6GA 2B3TB 4IS1C 2L01A 2WV1A 1D0XA 1R5GA 2WBSA 2HOSA 2LDUA 1LDJA 2ICWG 1YRNB 2XUBA 2Y30A 3DV8A 4DYCA 1YW7A 5E17F 4XIDA 1JTYA 2FSWA 2EM5A 3J7ZI 2HWVA 4V2GA 4S05A 4ENMA 2EWLA 3GFLA 5DS9A 3ASOH 2KZVA 3I55I 5CQEA 3EUHA 4F3QA 3V7RA 3CTAA 4I2OA 1KQ8A 4BQQA 4C3HJ 2CTDA 3J7AY 3LNQA 1FNNA 2FNPA 3H9GA 2L5QA 3KP3A 2H27A 2QKLB 3QYEA 4KITB 1DDNA 1ULYA 2A6HF 2W57A 5F04A 1YJWI 2EL6A 2P7VB 5M5WJ 1P2FA 5C4XJ 2EN7A 3I5UA 5D5VB 4LF5E 3D5SC 1LEAA 3GFMA 5FKNA 1FLIA 3ZMUA 1XSXA 1RR7A 2OQRA 3DQVC 1PJRA 2VBYA 3JCUC 2E19A 1T0FA 2AO9A 2BV6A 2V7FA 2V1DA 1VQMI 5JLWA 2HDCA 3L00A 1B1BA 2DBBA 2H94A 5DM7F 1V5GA 3WTWC 2ZBKA 5J3LA 2DIXA 2EMIA 4N0BA 4UB8C 1V5FA 3LSGA 3JRGA 4P9FA 1W7PB 3CP2A 5CPRB 2R4GA 3DU5A 2DI3A 3HRMA 3OWTA 2MC5A 1CGPA 1OKRA 1SD6A 1S72I 1X2NA 2L9VA 2O6GE 2RS7A 4RA2A 3A02A 1T98A 1VI0A 4GXOA 2KISA 3H35A 1X1DA 4LFCE 3HPSA 1RRJA 5DYMA 1KU2A 2V9KA 3VSKA 2O3FA 3S1RJ 3MFKA 5K5OA 1UJ8A 3F8CA 3DFGA 4M9XA 2M8EA 4EQQA 3HOZJ 2JYAA 4IOCF 2L2MA 5ILUA 3K4KA 1KA8A 4A3BJ 2E71A 4Q5SF 4DGWB 2F8BA 4IF4A 4UV9A 4A3CJ 1ETYA 4MQ9F 2E5LE 2P5VA 4ZJZA 2EIKH 1LE8A 3K7AJ 2JA7J 2GIZA 4G8XA 1OFCX 5EYRA 1AH5A 4RAZA 2LTSA 4L8NA 2NABA 1KQ9A 4MLOA 4OIPF 2NS8A 1BBGA 3DP7A 3S32A 4ZYGA 2X9DA 4HF0A 1OCZH 4A0ZA 1IQSA 1PUFA 1B9MA 2LBSB 5J4VA 4Y33A 1BC7C 4DQ2A 1BR1A 3EUAA 1IUYA 3Q5FA 1TF6A 2VOOA 4P7DA 2IXSA 3IHUA 1UELB 2VQEE 2MFZA 1DUXC 3DLAA 4WCGA 2HGHA 1D1CA 1YJ9I 4CSWA 3NWTA 3OV8A 3ERMA 3ZOQB 5IP6A 3J80K 1LEBA 2UXDE 2WAEA 3J7YJ 3ZN1A 1YX3A 2EMYA 4FX0A 1PKPA 4M3GA 3HEFA 2DA1A 1JKOC 4HF2A 1BI3A 4DV5E 4IOAF 4NC7A 4PJ0C 4RMNA 3DPTA 2MKNA 3S2HJ 3HUGA 3X2QH 1A5JA 2JUGA 3GZ5A 2N3GA 3TQNA 3IWDA 2GWRA 2DMTA 1YLFA 5KHDA 2HKOA 2KPMA 4UXNA 1ITYA 3AFHA 2ADUA 3LSPA 4DR3E 2MC6A 2MD0A 3G73A 1A1HA 4PJMA 2OTJI 2XIGA 4BY7J 4DV6E 4KA4A 3FXKA 1USTA 3GO5A 2CH0A 1MMSA 1WH7A 3EQLF 3F72A 2ZXHA 3ABMH 3QU6A 2M4GA 5F6FA 2EIMH 4OOGC 5HLGA 3CLQA 2E35A 3KLOA 2NVXJ 3KP5A 3DU6A 1K79A 1ZG3A 2VT3A 2QENA 4H4KC 3T5XA 4OOIA 1XMKA 3V8JA 1N77A 2R93J 1ZKGA 4JI0E 5EDNA 1S7EA 1MMDA 1WPKA 4A0XA 2L7KA 2E1MA 5HLIA 3I4NJ 4DR5E 2EMLA 1S3JA 3HRSA 2EPAA 1N25A 5KCMA 1MDMA 2M7AA 3RQ4A 2R3SA 4ZYAA 2CO5A 5F1RA 1X1AA 4LLLA 4FTHA 4DUYE 4KFCA 2HEOA 2OU2A 5M3MJ 2WWYA 3ECRA 5HS7A 3PFIA 3CMAI 3C6KA 3JREA 2ISZA 2IA2A 1A1LA 2DYSH 3SDBA 2V85A 1EKZA 1KU9A 5FKKA 1FT9A 1W0UA 1HNWE 5L3DA 2WY7Q 2Y69H 3KETA 3E1SA 3H3ZA 2CUFA 4NQWA 3ZR8X 5D8LB 1XC5A 5BPDA 2ZM6E 2P7CB 2ZMEB 4IJAA 1NG6A 5GAHJ 3BWGA 1ORKA 3BP8A 3MN2A 4XLHA 2F4IA 3ADGA 2K3PA 2LVSA 2CW8A 2LH9A 2Q1ZB 3SHFA 3O8HA 4YIIA 3M9AA 3ZGKA 2A3SA 5LEKA 3CMEI 2K4JA 2MLKA 4KZSA 4R2DA 1W7PD 2VQLA 2QSFX 3BDDA 4XONA 5FFXA 1D5YA 2D5VA 1A35A 4RHBB 4RGRA 2BGCA 5E3LA 3VSLA 5KL3A 1YYVA 4B43A 3V42A 3HB9A 1S8NA 4JX4A 1JUSA 5L3GA 3EUHC 2LF7A 2IS6A 2CQXA 2UXBE 1WQ2A 2YU5A 2A69F 3MHSC 2EOQA 1X6FA 2JZYA 3W2WA 3WGIA 2FEZA 2XAJA 2JVHA 1YJNI 1GHCA 2CU7A 2R7FA 4B1RA 1FX7A 4L9VA 3JRAA 1TQMA 2V9PA 3SJMA 2HOTA 1DQ3A 3VYXA 3F3XA 2Y2ZA 3E6CC 3PIOF 1QBJA 3IWFA 2E60A 3BT9A 3PSIA 3IV5A 1R1UA 1EKEA 2F5EA 2EMZA 4ZZLA 2M3AA 4F93B 3H3VK 1TQIA 1FOWA 4MTDA 4O6JA 4DIQA 2RVCA 1ERDA 4C30A 3MCZA 1P47A 2NNYA 2VIXA 4HX4A 4RB2C 3DXJF 4K0KE 3WGHA 3Q0UA 4I98B 5C3EJ 3R0JA 3OY9A 1IRXA 1Z21A 2IGMA 5DUKA 4ZH4F 4X6AJ 2JN6A 1PJTA 2XKPA 4BCAA 1K78B 1MW7A 2EM3A 2W24A 3JR9A 4CUGA 3CP8A 3Q0VA 1G3YA 2QM3A 3TL4X 4BXFA 1YS6A 4L0YB 2X48A 3VEPA 2K9SA 5M3FJ 1R1TA 3JAMZ 4XKVA 2F5VA 1YRNA 1W5CC 1U9OA 2Z3YA 1VZ0A 2WAFA 4RGXA 2EQ0A 3E5UA 3CESA 3ZQHA 1OJLA 2EN6A 4D0PA 1R49A 1R22A 3K2ZA 5TISC 4BDYA 2L92A 1MBKA 3JTHA 4A69C 5HNHA 2R5YB 3GUDA 5J1RA 1SC7A 1OR7C 2DPDA 3I4MJ 2HQNA 4F52A 5AE1A 2JR1A 3BR1A 3MEXA 2Z16A 1XSDA 3CCLI 3PNYA 1OMIA 4XBFA 4BBYA 1MMNA 2E1MC 5KVRA 2EMFA 4DYRA 4KN4X 5FRMA 4EJUA 2UXNA 3QPHA 1DQUA 2EN1A 3OS1A 3HOUJ 4WSGA 1DP7P 3MZYA 1FTTA 2A5YB 4OIRF 2P5LC 3TQMA 3REOA 4MEXF 5LHGA 2YT4A 1ZREA 4IVNA 4PSXA 2V88A 4CO8A 1W5TA 4IX7A 3ZPLA 2K02A 1DGCA 3JRIA 1YFHA 1SVOA 2OD5A 2RV8A 4DUZE 1ZR9A 3QWLA 4O3MA 2ID3A 2TRTA 3J80Z 4PCQA 1MEYC 3G2BA 4BH9A 5D6FA 1I39A 1WHUA 1PDNC 2EJ4A 2DN0A 2GA1A 2KQRA 2CW7A 2M1BA 2PMHA 4CYCA 2NAZA 1FMWA 5CVVA 3FMSA 3VYSB 4JX6A 1EJ9A 1N34E 2I8DA 1RQ0A 1IDZA 1SR9A 3AG4H 2VJ4A 4RAYA 5TRDA 2EZHA 3K2AA 4PGHA 4DZPA 4BJ6C 4KT6A 2M2EA 4KMFA 2DA6A 3DBLB 4RLFA 1IN5A 5IOZA 2JQ7A 4LF9E 3SDGA 4ZYDA 3VYRB 1W5SA 1RUNA 2PQ8A 1A04A 3I0TA 5LRSA 2RSIA 2W84A 4BQNA 5E3MA 4G7OF 3LFKA 3HDDA 5IPAA 2HQAA 5M5XJ 1Y1WJ 3L09A 3S3MA 5AASA 4HQEA 5IT9K 4F6NA 4AM3A 3DPUA 2QGUA 4L9NA 4AQYE 1WJEA 2KJCA 3OYJA 2ODRC 1J26A 5FKLA 3HSRA 5CLSA 1VQ7I 3A01B 2NS0A 1YI2I 5BNGA 2UZKA 1U2WA 2EM2A 4ZYEA 1IUFA 4U0WA 2EOHA 4DR4E 4I7HA 3KP7A 3ONQA 4HSTA 4QLCU 4K2EA 1R7JA 1ZGAA 4S0HB 3QOEA 2DMPA 4B48A 2KONA 3NRVA 3BQZA 1G2FC 4W97A 3HUGB 1T38A 1LE8B 3HBLA 3LSJA 3I58A 2MG4A 4JYAE 1SANA 3NEUA 3OIOA 2EZ6A 3SZPA 3V7CA 3JAMC 2YU8A 1BIBA 2C6YA 4OIQF 4UV8A 5J8FA 2KL4A 2R7QA 5H2FC 2FV4B 5GP9A 3LSTA 5BS6A 4E4HA 2IRFG 3HOVJ 2WB1N 4LG0A 5DEQA 4UUSB 3FM3A 1LNWA 4NHJA 3CCMI 2Y0SA 3K0LA 5E8IA 1X19A 2EZKA 4L9JA 3VYTB 1HBXG 4R2PA 3G6EI 1QVTA 3ABUA 4WXDA 4X64E 2HYJA 3I3LA 3TGNA 3L2WA 2F6CA 2L7ZA 2ZO4A 3ZCOA 3C2GA 1ZYRF 3WHBA 2VPLA 1J7KA 1X3CA 4ESBA 3ABLH 3HGGA 2EWNA 1A6IA 2DU9A 2LG4A 4JI7E 1XS9A 2Y48A 2F48A 4UVCA 1XMOE 3FBIB 1Z7LA 2EK5A 4DW6A 2KJBA 1YITI 5FO5A 2EIJH 2UUAE 4A93J 3CCSI 2HTJA 2BHZA 2DA5A 5FLVA 1BBYA 4ON0A 2JA5J 3FKJA 1QRYA 2W48A 4DR1E 4E7LA 4N9IA 1VTNC 2HTSA 2CS3A 2EFWA 2F2EA 2K9MA 1O3QA 3CJNA 2VODA 2RNGA 4BHCA 2WC2A 3E7LA 3LSRA 2EINH 2IAIA 2CFOA 1HNZE 1U0JA 1F9NA 3I53A 1Y0UA 5A6JA 4MGRA 3VFZA 3LSIA 4IHXA 2COBA 3SYTA 2VLAA 3L2VA 2NVQJ 3BC8A 2R7SA 1Z3YA 5E1XA 1H8AC 2ZMEA 3COAC 3D0SA 3HOYJ 3K10A 2XAGA 2XPWA 2UXCE
chains in the Genus database with same CATH topology
2K7LA 2TDXA 3K1PA 3V8KA 4L5JA 2HQRA 4IRGA 2PFBA 2P8TA 2V1XA 3BJOA 2JT1A 4Y15A 1HKTA 4R8HA 3ULQB 4JBAA 3LWFA 2CQKA 4DNCA 4A2UA 4XSXF 4A5MA 1EH7A 1D3YA 5E8GA 3VB2A 4AWXB 2MH2A 4ETSA 4ENKA 2E1NA 4HOBA 1EH6A 1HW2A 3F8NA 2EV0A 5BMZA 4ZYHA 5FD6A 1IN4A 2AS5F 1Z1DA 4RB1A 1P92A 3O3KA 1G3TA 1ZN2A 1FBQA 2YX4A 4BXUA 3LQQA 1IXRC 1JHFA 2P4WA 2IP2A 4M73A 2FBHA 3IC7A 5LRRA 4FHTA 4I09A 3KP4A 1IF1A 2JRTA 1ZGJA 1U8RA 3WTXC 2MD5A 4BHBA 2Q0OA 2UWMA 4IHSA 1E2XA 3HOTA 3KZYA 1ZAOA 4CICA 4EM2A 5D5XB 2K86A 4A6EA 5A2QZ 2JTVA 4U0VA 4A12A 2QQAA 3L9FA 3WG9A 5LEJA 3GWZA 2O61A 2VT2A 2F5DA 2XHKA 2VOPA 1YQAA 3C7JA 5L3EA 1MKMA 3RJPA 1LDDA 4Z2YA 3HTSB 2FXAA 2A07F 2G9WA 3GW2A 4B09A 2QVOA 4AD9A 1HKSA 5K1YA 2BEOA 5AONA 1SD7A 1WKMA 1HKQA 2YX7A 1CF7A 2ZNZA 4E70A 1TNSA 2OZUA 2M87A 3ZMTA 1I27A 5L3BA 4L18B 2RQPA 2IA1A 1MJAA 1B9NA 1S29A 2CWEA 5LGNA 1KU3A 4BAYA 1KGSA 5LHIA 3L2CA 2WV0A 4MQVA 5ICGA 2RDPA 1I1SA 5DCMB 5FLXK 3RTRA 4LLGF 3KE2A 1REPC 4XLPF 1TBXA 2CSOA 2VE9A 1K6OA 3Q9SA 4AVPA 3O2PE 1HW1A 2G7HA 5FGMA 2FE3A 2DQRA 4N9HA 1SD4A 3BPXA 2A6EF 3RIRA 2EV6A 3IRQA 2XVCA 2YSRA 3F8BA 4CYDA 3HIFA 3AAFA 3CUQB 2VN2A 2V9VA 3IRRA 1O7FA 1FZPB 5H20A 2NRAC 5ICFA 1BI2A 3M8EA 3FMRA 3R4KA 1KU7A 2JPCA 3PQKA 2IT0A 5JFRA 2EB7A 1LQ1A 3ISPA 3RYRA 4TV7A 2BBYA 3E5QA 2GXGA 5D5WB 1BI0A 4EM1A 1B59A 1LVAA 3SQNA 2HFHA 2J5PA 2VXZA 4HA8A 4M71A 5D5UB 2OBPA 3RPQA 4CXFA 4WK8F 2RC4A 1X3UA 2BE5F 1B4AA 4AIHA 2Y75A 1R00A 5HS9A 1Z6TA 3ZP5A 2ZFWA 1IN8A 3ZMVA 5LGTA 1WI9A 4M6XA 1RUOA 2QQBA 1R58A 1QO0D 2MH9A 1O3RA 4LB5A 2IW5A 3JW4A 1IRFA 2XGXA 3IKVA 2B0LA 3DEUA 3HSFA 1F5TA 2GA2A 5HOOA 3E6DA 5A2QK 3GX4X 5FB2A 1V4RA 3MWMA 5L3FA 1F4KA 3TO6A 5TJJA 4EJTA 1E17A 2H6CA 4ENJA 4AIJA 1U5TB 1XGMA 1I5ZA 4A5NA 4G6QA 3ZMDA 4OIOF 3HOSA 2LKPA 1BN5A 1TQPA 1OPCA 1QGPA 2DFIA 2DTRA 1XGSA 2ETHA 4P5OA 1WSUA 2KIFA 4L5IA 2JPBA 2XAFA 3TO7A 4G7ZF 1BI1A 1Z91A 1T2KA 5JHUA 2EA2A 5KK1A 3WTZA 5L3CA 1B6AA 2ZNYA 5IT3A 1BOAA 4KIFA 3R60A 3M7GA 1CF7B 4AIKA 4I0AA 1EV7A 2ZXJA 4G9YA 1YIOA 3E3VA 4Y13A 4P55A 6PAXA 5D8KB 2Z9OA 1ODDA 2NNNA 4ZZDA 2MLGA 3TOBA 5H6RA 2FBKA 2O03A 4M74A 3L7WA 4PZJA 1FP1D 1MD0A 4LJZF 1UHMA 4EJOA 1KYWA 1YW9A 4KUMA 1J0RA 3I54A 4KYWA 5DCMA 3KFWX 2OA4A 2CG4A 1R36A 2QLZA 4WX9A 5HDKA 1IRGA 4OINF 4I01A 2V1UA 2IJLA 1FY7A 2V6CA 1R5HA 4HBLA 4P96A 4HDUA 4BYYA 4YIFA 4UUVA 1OYYA 2M45A 3VOEA 2O0YA 3IKTA 5ICCA 4KDPA 1DPUA 3F21A 1U3EM 4KICA 3GXOA 3WU1B 2DK5A 1ZG5A 1FWZA 4OMYA 3U2RA 4NB5A 2ACJA 2ELHA 4M6YA 1Z7UA 2FOKA 2BYVE 1QZYA 4R79A 2W85A 3E6MA 3ECOA 5LHHA 4KNYA 4JQFA 4BHPA 4YFNF 1AOYA 1FOKA 4RS8A 1ZRCA 1IAWA 1TTYA 4YFKF 2KIMA 1C0WA 1T6SA 1MDMB 3JAMK 1STZA 3ABTA 4CGZA 4UHTA 5LGUA 3T8RA 3CUOA 3QP6A 3GEZA 1KQ0A 4LLNA 5D4RA 3WTSC 2H6BA 4EM0B 2VBWA 1P6RA 3I71A 4U7DA 4HW0A 1O57A 3KCCA 2D45A 3R61A 3GYHX 2PBIA 2NYXA 3T8TA 1IXSB 4LB6B 4BQAA 4HQMA 2HKXA 1O3SA 5CVUA 1P4WA 3ERED 4OMZA 1Z6RA 4EMSA 1D8JA 2EV5A 2ZKZA 4H0EA 2PMUA 3R0AA 3FX3A 3BPVA 4UVAA 4YFXF 3KP6A 4CZZA 3WTVC 1LDKB 5DD8A 3QRFF 3DKWA 4UNOA 1YG2A 2KIUA 2D2WA 1F1ZA 1BIAA 2H09A 1BM9A 1LJ9A 2IVMA 2QUFA 1RZ4A 3V8LA 1O3TA 3SXYA 2Z5UA 2VONA 1U78A 4GO1A 1UB9A 3WGGA 3BY6A 1JE8A 4IXAA 3CDHA 4GYIA 1U5TA 2L4MA 3J7AO 3KZZA 2D1HA 4Q48A 3NQOA 2FBIA 3JTGA 3RPUA 2R7DA 4P9UA 4KIGA 3O6BB 5F64A 2OAZA 3E6BA 1XGOA 1BJAA 2XASA 4S04A 4ENNA 2P5KA 2XV4S 3I59A 3PQJA 1OYIA 5EEGA 3EYIA 3OOPA 3U1DA 1XD7A 2KRFA 3ZN0A 4G94A 1TW2A 2DLLA 2IA0A 2VC0A 4WWCA 1IN7A 1WRJA 2L4AA 2EJRA 3P9CA 5DV5A 5JVTA 2EFQA 4GYGA 5DD4A 1IW7F 1I1GA 3KEOA 1ZARA 3WTYC 1YTYA 5DUIA 2FU4A 3I4PA 1PP8F 3LAPA 4UVBA 2YU3A 1I6XA 2RN7A 1QQIA 3JSPA 5JR3A 3EDPA 2Q2EA 3RKYA 2AXLA 2X0LA 3C1DA 1S7AA 2W25A 1QNTA 3E5XA 2PEXA 4LFUA 1J2XA 3B73A 1FBUA 5D4SA 3T0YA 3GZ6A 4QWQA 1XSVA 3SZTA 1W7PA 1RI7A 2EFPA 4RB3C 2QZ8A 4U88A 1SD5A 1RIOH 4U0YA 3T1BA 4G7HF 1JHHA 2MBFA 4WF2A 2STWA 2CYYA 3HSEA 4HX7A 3F6OA 1U6GA 3LAJA 2XAQA 1DPRA 5E18F 3M1EA 1FPQA 2XAHA 3GFIA 3KEQA 3V4GA 4M9ZA 2XRNA 2O8XA 2ESHA 4M9SA 5BPIA 5IT9Z 3GLXA 2E1CA 1IXCA 4LK0F 4OU0A 2FA5A 1XB4A 4EGZA 2L3DA 3CLOA 1H9TA 2HYFA 3F22A 2Q8KA 1V3FA 3QP5A 1ZG1A 1HQCA 2GIVA 4ESJA 4KT5C 2PG4A 2A61A 1U5TC 4RB0A 2DO7A 5LLQA 5HVQC 3BJAA 2FMYA 4B8XA 4RGSA 4O5VA 4L0ZB 1JXSA 2GAUA 3QPTA 2YPRA 1G6NA 1XMAA 2D1VA 2GQQA 4FX4A 2E7XA 3MAJA 3B02A 1ZLKA 1G4DA 4WXHA 4IRHA 2XKOA 3V7SA 2DQLA 3DPLC 1MJ9A 2GZWA 2STTA 3BOQA 4ESFA 4HX8A 4ASNA 4HF1A 4PGGA 2MC3A 1UHWA 3FXUA 3HTUA 3RKWA 2ESNA 4EGYA 2P6SA 4PDKA 1SMTA 4LMYA 3BROA 4FT8A 5FFZA 1L0OC 4BNCA 3ML6A 3K9TA 3F23A 3F6VA 2YR2A 3FHZA 3QU3A 2J5OA 1OR7A 4XSZF 4HV6A 1SFXA 2ISYA 3FWEA 3K69A 1SMYF 5H6QA 4KIBA 3E97A 5CJ9A 5E20A 2EFNA 4Y17A 2RKHA 4KN7X 1W4MA 5AIPA 5J8CA 3LA7A 4EJWA 2VBXA 1FYKA 5DCFA 2QBYB 4GCVA 3LQRA 1QZZA 3FMQA 1TW3A 4MHGA 2OZ6A 4XRFA 3VODA 3N4MA 3HRTA 1D8KA 4HZFA 3TDUC 3CO7C 3M8FA 5ED4A 2FRHA 3JSOA 2DT5A 3QOPA 1D5VA 3KP2A 2DAOA 2EFOA 1XCVA 4M72A 3EETA 1JGSA 3ROUA 4CDGA 4IRIA 3GFJA 1IZ1A 2A68F 3EYYA 1H9GA 1PP7U 3TKYA 1XDUA 3J81K 5BOXA 3HHHA 5EEHA 2LF8A 1XN7A 3WODF 1FP2A 2EA4A 1Q1HA 1G3WA 2F5CA 1TNTA 3H3UA 3TOAA 2M30A 4L9TA 1O7LA 1RNLA 1FYMA 2FQ3A 4JK1X 4R1HA 1G3SA 1GXPA 5CYVA 2FF4A 2OQGA 3W6KB 2VC1A 3P9IA 3KLNA 1Z9CA 5ILSA 3MZHA 3WU0A 4LK1F 1HSJA 3CUQA 2GXBA 1FSEA 2UXXA 2PJPA 3I64A 5K5RA 3QAHA 5LBQA 1SFUA 3RYPA 4LGWA 2K4BA 5E1ZB 2CFXA 1SFEA 2G7UA 3ECHA 4EJVA 2FMLA 2HS5A 1S6LA 1TLHB 2HYGD 2COMA 1MJBA 1AWCA 5ILVA 1ONVA 1J5YA 1HSTA 1ZH5A 1MZBA 3ZMSA 5FLXZ 1XCBA 4HLYA 2V79A 1T39A 3F8MA 2XROA 1UFMA 4IPAA 2ZJ2A 4HLXA 3S2WA 3J81Z 4LG0B 4RGUA 3IL2A 1J75A 2ZCWA 1ZLJA 5HLHA 5CVIA 2HZTA 4YG2F 4F7ZA 1PUEE 1MGTA 1S7OA 2E7WA 2QWWA 4A0YA 2HGCA 3R6SA 3GVAA 3P9KA 2LSOA 1WWXA 5ICEA 4IHTA 3D5LA 1USSA 4HAMA 3G3ZA 2KKOA 5K5QA 5J6XA 3ZMZA 1R23A 5DDGA 3FF5A 3WE3A 2WTEA 3ELKA 2VE8A 4G6DA 3LA3A 1FYLA 2CGPA 1NHAA 1ZRFA 1K7AA 3GF2A 3K1NA 4WXCA 3Q9VA 1LB2A 2K27A 1J59A 3RI4A 2L54A 3HRUA 2LNBA 3DF8A 2PN6A 3FXQA 2Z33A 1ZRDA 1ZHFA 2Z99A 5HS8A 1H0MA 1QPMA 1SAXA 5CVJA 3TO9A 3HYIA 2QBYA 2IPQX 2DW4A 3ZQ7A 3BZ6A 3F8FA 4XLNF 5D6EA 3C18A 4LD5A 5HDGA 4A6DA 2M5WA 3RKXA 2RNJA 4HDVA 1FSHA 1ON1A 2HR3A 5HDNA 2MA3A 2F5FA 1FC3A 5BQTA 3H92A 1KYZA 1XDSA 2QQ9A 1P4XA 5AIQA 1GVJA 5CVRA 3IWZA 3N97A 3CUQC 2P6TA 3HHGA 3FZVA 2PI0A 1OYWA 3FXRA 1GXQA 2VBZA 4I0BA 3P7NA 3W6JB 4GGGA 4EV0A 2QYOA 1FBSA 1EH8A 4KMUX 1P4AA 2PLYA 4EVIA 2DK8A 3LA2A 5E1WA 2RGVA 1BC8C 5JI6A 4MEYF 1UCRA 3CO6C 1ON2A 2JSCA 3WE2A 3SFZA 5ERIA 2HOEA 3RDIA 1YS7A 1YW8A 2Y0MA 4U7BA 3I59B 3WTTC 1XGNA 3MQ0A 1Z05A 3K1MA 4Q4ZF 2X4HA 4MTEA 3C3WA 1R1VA 4HYEA 3BJ6A 1IN6A 3FM5A 4I02A 4HV5A 1L3LA 3U9GA 2CW0F 1J9IA 4Q47A 3TDZC 2L02A 5FD5A 3WTUC 1HXDA 2FNAA 4CHUA 1HW5A 1K78A 4MNUA 2DPUA 1YO5C 2L01A 1R5GA 2LDUA 1LDJA 2XUBA 3DV8A 1YW7A 5E17F 2FSWA 2HWVA 4ENMA 4S05A 3GFLA 3EUHA 3V7RA 3CTAA 4I2OA 1KQ8A 1FNNA 2FNPA 3KP3A 2H27A 1DDNA 1ULYA 2A6HF 2W57A 2P7VB 1P2FA 3I5UA 5D5VB 1LEAA 3GFMA 1FLIA 3ZMUA 1XSXA 2OQRA 3DQVC 2VBYA 2V1DA 1T0FA 2BV6A 2HDCA 3L00A 1B1BA 2DBBA 2H94A 3WTWC 2ZBKA 4N0BA 4P9FA 1W7PB 2DI3A 3HRMA 1CGPA 1OKRA 1SD6A 2O6GE 1T98A 4GXOA 5DYMA 1KU2A 2O3FA 3MFKA 5K5OA 4M9XA 3F8CA 3DFGA 2M8EA 4EQQA 5ILUA 1KA8A 4Q5SF 4IF4A 4UV9A 4MQ9F 2P5VA 4G8XA 4RAZA 1KQ9A 4OIPF 3DP7A 4ZYGA 4HF0A 4A0ZA 1B9MA 1BC7C 4DQ2A 1IUYA 3Q5FA 2VOOA 3IHUA 1DUXC 4WCGA 3OV8A 3J80K 1LEBA 3ZN1A 4FX0A 4HF2A 1BI3A 3DPTA 3HUGA 3GZ5A 3TQNA 2GWRA 1YLFA 2HKOA 4UXNA 2ADUA 3G73A 2XIGA 4KA4A 1USTA 3GO5A 3EQLF 3F72A 3QU6A 5F6FA 5HLGA 3KLOA 3KP5A 1K79A 1ZG3A 2VT3A 3T5XA 2QENA 4OOIA 1XMKA 3V8JA 4A0XA 5HLIA 1S3JA 3HRSA 1MDMA 2R3SA 2CO5A 5F1RA 4LLLA 4KFCA 2HEOA 2OU2A 2WWYA 5HS7A 3PFIA 2ISZA 2IA2A 1KU9A 1FT9A 5L3DA 3KETA 4NQWA 3H3ZA 5BPDA 5D8LB 2P7CB 2ZMEB 4IJAA 3BWGA 3BP8A 3SHFA 4YIIA 3M9AA 5LEKA 2A3SA 2K4JA 2MLKA 1W7PD 3BDDA 5FFXA 4RGRA 2BGCA 1YYVA 1S8NA 5L3GA 2LF7A 1WQ2A 2A69F 2JZYA 3WGIA 2FEZA 2XAJA 1GHCA 2R7FA 1FX7A 4L9VA 1TQMA 3F3XA 3E6CC 1QBJA 3IWFA 1R1UA 2F5EA 4ZZLA 1TQIA 4MTDA 4O6JA 2RVCA 3MCZA 2NNYA 4HX4A 4RB2C 3DXJF 3WGHA 4I98B 3R0JA 5DUKA 4ZH4F 2XKPA 1K78B 2W24A 1G3YA 2QM3A 1YS6A 4L0YB 3VEPA 1R1TA 3JAMZ 2Z3YA 4RGXA 3E5UA 4D0PA 1R22A 3K2ZA 3JTHA 3GUDA 2DPDA 2HQNA 3MEXA 1XSDA 1OMIA 4XBFA 5KVRA 4KN4X 4EJUA 2UXNA 3QPHA 1DP7P 3MZYA 2A5YB 4OIRF 2P5LC 3REOA 4MEXF 5LHGA 1ZREA 4IVNA 4CO8A 1W5TA 3ZPLA 2K02A 1YFHA 2OD5A 2RV8A 4O3MA 3J80Z 4PCQA 4BH9A 5D6FA 1PDNC 2GA1A 2M1BA 2PMHA 2NAZA 5CVVA 3FMSA 5TRDA 4RAYA 4PGHA 4KMFA 1IN5A 4ZYDA 1W5SA 1RUNA 2PQ8A 1A04A 3I0TA 5LRSA 2W84A 4G7OF 3LFKA 3L09A 4HQEA 5IT9K 4L9NA 2KJCA 3HSRA 5CLSA 2NS0A 2UZKA 1U2WA 4ZYEA 4U0WA 4I7HA 3KP7A 4QLCU 4K2EA 1R7JA 1ZGAA 3NRVA 1T38A 3I58A 3NEUA 3SZPA 3V7CA 1BIBA 2C6YA 4OIQF 4UV8A 5J8FA 3LSTA 5BS6A 2IRFG 4LG0A 5DEQA