1T38A

Human o6-alkylguanine-dna alkyltransferase bound to dna containing o6-methylguanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
151
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPSHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(6OG)P*CP*TP*AP*GP*TP*A)-3'
total genus 32
structure length 151
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t38A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t38A01
1BN5A 4HF2A 2HOEA 2M30A 4KIGA 3JAMK 1IN4A 4JQFA 5BS6A 1R1UA 5AIPA 1LDKB 2OQRA 2PI0A 1QO0D 1G4DA 3RKXA 3W6JB 3MQ0A 4GGGA 2Q2EA 3ZMDA 2O3FA 2DFIA 2A6EF 1USTA 3SXYA 4G8XA 2F2EA 3DFGA 4IHSA 4KA4A 4YIIA 4UV9A 1MJ9A 3GEZA 1TBXA 1FYKA 1TNSA 4P55A 1OYIA 3WTWC 3M7GA 1O3RA 4OIQF 3RI4A 3FM5A 1PP7U 1FC3A 1RZ4A 3HSRA 5JI6A 2D45A 1U5TB 1K7AA 2HEOA 4RB1A 4KMFA 2L02A 4LG0A 1P4WA 1IN6A 3R0JA 4XSXF 4CHUA 1FPQA 4H0EA 1BIBA 2EFPA 3QU6A 2UWMA 3CO7C 4P9FA 3DQVC 2FMLA 4BXUA 2L01A 1HKSA 4R8HA 4LK0F 1EH6A 3VFZA 3IKVA 1YTYA 2A61A 4PGGA 4A0YA 1MJAA 2CGPA 2CO5A 2QQBA 3I59A 3K0LA 5CJ9A 4ESBA 3T8RA 2QYOA 1E2XA 5DDGA 4EMSA 1I5ZA 3I0TA 4A0XA 2EA4A 5HDGA 4LLLA 4HV6A 5LHHA 3WTUC 5F1RA 3F22A 2VBYA 2BGCA 1RI7A 3IKTA 1BI1A 2FF4A 2DK8A 1FNNA 1BM9A 3HUGA 2FBKA 4CZZA 3G3ZA 1KQ8A 4IRIA 2O03A 2OA4A 5HLGA 4MEXF 2P6SA 3L7WA 2YX7A 2PBIA 4KT5C 5DEQA 1Q1HA 4G7HF 3FWEA 4M9XA 3P9KA 4WF2A 4Q4ZF 3ABTA 3ZN0A 2RQPA 3J81Z 3LA7A 2MH9A 5DD4A 3E5UA 2CYYA 2KJCA 2RVCA 2PQ8A 4PCQA 1DDNA 2WTEA 3IL2A 1J7KA 3HTUA 4QLCU 1FYLA 4O5VA 1E17A 1BI0A 4AIKA 1R36A 2OD5A 3ERED 1HXDA 1QBJA 2IPQX 4LMYA 2XGXA 3KP7A 4AD9A 2COMA 4EGZA 1FLIA 3I64A 1ZHFA 4MTEA 2P8TA 2V79A 2B0LA 2Q8KA 1IUYA 2ZKZA 1R1VA 2DPDA 4Y17A 4LB6B 3WTYC 2NYXA 2XAJA 4FX0A 1XMKA 4HZFA 1MD0A 2ZXJA 1GVJA 2RNJA 1HBXG 2VBXA 3GF2A 5JVTA 1G3WA 4KNYA 3GUDA 1Z7UA 5BMZA 3KZYA 1FZPB 1TQMA 1W5TA 2GXBA 3J80K 1ZREA 4I0AA 5L3GA 5H6QA 4B8XA 1GHCA 4RGXA 2M8EA 1I27A 2RC4A 3BJOA 2ZJ2A 4GO1A 2A68F 3G73A 4N9IA 4BNCA 3RIRA 5ICFA 4OMZA 4ON0A 2QWWA 1IXCA 5LBQA 3ZN1A 2LF8A 5L3BA 3HOTA 3EYIA 3E6DA 2X4HA 3M8EA 4ENNA 3SHFA 1P2FA 3QP6A 3ECHA 5FD6A 4RAZA 5KVRA 4BHCA 4HW0A 5TRDA 3C18A 3DPLC 3TGNA 2D1HA 5E17F 3RPQA 1YW7A 2ACJA 1MZBA 4U0WA 1FP2A 2K4JA 4HDVA 1J0RA 3BPVA 2EB7A 1OYYA 2G7HA 5E1WA 1HW1A 3BROA 1SFUA 5CYVA 3J80Z 4G6QA 1ZRDA 5ILUA 1JXSA 3E6CC 2XAHA 2MBFA 1ULYA 3HHGA 4G94A 2R7DA 3BZ6A 2XIGA 2RGVA 4MHGA 3K1NA 2GWRA 3F8MA 1T38A 2NAZA 4P5OA 4NQWA 2IA1A 4A2UA 1R23A 4AIJA 2OU2A 5E20A 1KU9A 2E7WA 1S7AA 1USSA 1KQ0A 2VOOA 3QPTA 1TLHB 2VT2A 5EEHA 1Z1DA 3K1PA 3SZPA 4KICA 1Y0UA 1BJAA 2NNNA 4NHJA 3Q5FA 3P7NA 4M9ZA 2FMYA 3I59B 1W4MA 4ESJA 1U2WA 2PFBA 2Z3YA 5HOOA 2XKPA 2K02A 3LWFA 2DQLA 4L9TA 2G7UA 5FGMA 4IRHA 4A6DA 3JAMZ 4M73A 2ZMEB 3BWGA 3RKYA 5K5QA 3H92A 4FT8A 1X3UA 3FXUA 4G7ZF 2P7VB 1EH7A 1XGSA 3TO7A 2E1NA 2W24A 1XSDA 2IW5A 5DD8A 1K6OA 2BYVE 2DLLA 2J5OA 3BJ6A 1IAWA 2YX4A 1RIOH 3JTHA 4M9SA 2EWNA 3R6SA 4S04A 1ODDA 1QGPA 3B73A 4CICA 2E7XA 2FNPA 2MD5A 1P92A 4B09A 2PMHA 3ZP5A 2FNAA 5DCFA 3KETA 3BP8A 3GZ6A 1KU3A 3QPHA 3ZMVA 3IRRA 2QENA 3F6VA 1B9NA 3KEOA 2DU9A 3CUQA 4EJWA 1HQCA 1LEBA 5FO5A 4R1HA 2TDXA 2FXAA 4CGZA 2DT5A 1ZN2A 5H6RA 4UVAA 2IT0A 2J5PA 1CF7B 5J6XA 3T5XA 4Z2YA 2ESNA 2XRNA 3RYRA 4OIOF 4U7BA 1O3SA 2CG4A 3ML6A 5HLIA 4L18B 2AXLA 2HKXA 2A6HF 1ZGAA 3Q9VA 3GYHX 4ENJA 3HTSB 5ICGA 3ECOA 2FQ3A 5BOXA 1S6LA 3MAJA 2XKOA 3BDDA 4EJVA 4HOBA 4HLYA 1G6NA 3CTAA 1O7LA 1O57A 1ZAOA 5HS7A 3MWMA 5L3DA 1J9IA 4P96A 3L9FA 2V6CA 4PDKA 2M5WA 3T1BA 3H3UA 1UB9A 4O6JA 2VOPA 3E6BA 5LRSA 4KDPA 1U6GA 4YG2F 4A6EA 1BIAA 2XASA 2A3SA 4YFKF 3RDIA 4U7DA 2EV0A 3DF8A 1CF7A 1AWCA 1SAXA 2YU3A 3LAJA 2XVCA 2PLYA 1TW3A 3WTVC 1QQIA 1ZLJA 1XGOA 1XMAA 4BHBA 4AVPA 4HLXA 4U88A 2M87A 2H6BA 1LDDA 4IPAA 1K78A 5D6FA 2STTA 1MDMB 3WGGA 4LK1F 1SMTA 2HFHA 2AS5F 1F5TA 3COAC 2JRTA 2VBZA 3V7CA 3F6OA 2CQKA 1V4RA 5FLXZ 4ZYGA 1I1GA 2O8XA 4OINF 2QLZA 4G9YA 4ENKA 3MCZA 2A5YB 1ONVA 3TDZC 3T0YA 1DPRA 3HIFA 3LFKA 2IRFG 4XLPF 1TNTA 4MEYF 1EH8A 5FFZA 1KU7A 2IP2A 2LF7A 3R61A 1D8JA 3V7RA 5FFXA 4HAMA 1U5TA 3U2RA 1K78B 3SZTA 3CUQC 1XDSA 3NRVA 2UZKA 3TO9A 2GXGA 5HVQC 1H9GA 1R58A 3DV8A 1SD7A 1WI9A 1MDMA 2FRHA 5D6EA 4XSZF 2XUBA 4GYIA 3KP6A 3WG9A 3WTXC 1WWXA 1R1TA 2H94A 4BHPA 2VONA 3D0SA 1ZLKA 4HX7A 5IT9K 1H9TA 4NB5A 2C6YA 3LQQA 1H0MA 2QUFA 4M6XA 2QM3A 4RAYA 1O3QA 3W6KB 2P5KA 3FZVA 2CSOA 2QBYA 1UFMA 4CO8A 3O3KA 3GX4X 1PDNC 2ZFWA 1UCRA 1FBUA 2ZNZA 4KIBA 1G3YA 1TQPA 4KMUX 4E70A 1J5YA 2XAGA 2FBIA 3F8CA 3DXJF 3HOSA 1HW5A 4WXHA 3FM3A 5BPDA 2GA1A 4I0BA 2ISZA 2HGCA 4KYWA 2FA5A 4PGHA 3BY6A 3I54A 1DP7P 1GXPA 1FT9A 1YS7A 5BQTA 3C1DA 3V8KA 2JZYA 4LFUA 1IRFA 4FHTA 1QNTA 4I2OA 1LDJA 4M72A 4EM1A 2IVMA 5HS9A 3GO5A 1LVAA 2VE9A 1YIOA 1LNWA 2GA2A 2DO7A 4KN4X 1NHAA 4RB0A 1XSXA 3KP2A 4IRGA 2ZMEA 2D2WA 2EA2A 1XGNA 5E1XA 2DW4A 4EJTA 3JW4A 2A07F 1KA8A 1D5VA 5D8KB 4RS8A 5IT3A 1IRGA 1REPC 2FBHA 2VXZA 2XAFA 3SQNA 3FMRA 1PUEE 2ELHA 1PP8F 3EYYA 2EK5A 1LEAA 1SFXA 3E6MA 1R5GA 4Y15A 4HF0A 3AAFA 2HZTA 3ZMTA 2DPUA 3RYPA 4UV8A 1D8KA 3ULQB 2KKOA 1OYWA 2D1VA 4LGWA 2HTJA 5L3FA 1G3SA 4DNCA 1MGTA 5DCMB 4G6DA 4R79A 4HX8A 2VODA 4ZYDA 4O3MA 2CFXA 4CDGA 4MNUA 2GAUA 3JSPA 4A0ZA 2F5DA 4F7ZA 2NRAC 2DQRA 3K1MA 5JHUA 3CDHA 5DCMA 4RGUA 3TKYA 5HDNA 1ZG1A 1YLFA 3M1EA 2RN7A 2EJRA 1BOAA 3WGIA 4ZYEA 1R5HA 1J75A 3V8JA 5ILSA 2WWYA 1W7PA 1U78A 3GLXA 4ZYHA 3N4MA 2GIVA 2KIUA 2BEOA 4CYDA 2DK5A 2HYGD 2HS5A 2FE3A 4IF4A 3PFIA 4I7HA 2RDPA 1RUOA 4RB2C 4XBFA 2JPCA 1IN7A 1T39A 4PZJA 2W25A 2LNBA 1S3JA 1HW2A 4RB3C 3HRMA 3WODF 2NNYA 3EUHA 3VEPA 3KLNA 3KCCA 3V8LA 1OKRA 5J8FA 2PMUA 2V1XA 3HSEA 3P9CA 1T0FA 4HA8A 2MC3A 1RUNA 1BC7C 3EETA 4HV5A 1P4AA 2OQGA 3VOEA 1XD7A 4U0YA 4HX4A 1IXRC 2Z99A 1BI2A 4AIHA 2VC1A 4HQMA 4ZZDA 1V3FA 1YW8A 3TO6A 4L9JA 3WTSC 3GFMA 2P7CB 3S2WA 5ILVA 2QZ8A 4ASNA 3LAPA 2KIMA 1Z9CA 4MGRA 3CUQB 4L0ZB 2HQNA 3ISPA 2W85A 3E5XA 4IJAA 2PEXA 1J2XA 2H27A 1XSVA 2OBPA 4A12A 2V1UA 3H3ZA 4OIRF 5CVUA 2K27A 3FXQA 1HSJA 4GCVA 4L5IA 4ZH4F 3ELKA 1J59A 2V1DA 4WCGA 2STWA 3V4GA 2ETHA 2VBWA 1TQIA 1XCVA 2KIFA 3LQRA 4L9VA 4JK1X 5LHGA 2W57A 1U3EM 1FWZA 3I5UA 3OV8A 2WV0A 4HQEA 2GQQA 4UUVA 5E8IA 2M1BA 3DEUA 4IVNA 1ZRFA 5H20A 3GZ5A 1IW7F 1FBSA 3U9GA 4Q5SF 1KYZA 1YS6A 1L3LA 1L0OC 3KE2A 3HRUA 5LEJA 5KK1A 1GXQA 2G9WA 3GWZA 2K4BA 1B4AA 4HF1A 1U8RA 1WKMA 3DP7A 4KFCA 3FX3A 1I6XA 2XV4S 5IT9Z 3I58A 1JHHA 1BBYA 2ESHA 4N9HA 3JTGA 4L9NA 4XRFA 2HYFA 2DBBA 1UHMA 2LDUA 3FMQA 4I01A 1FY7A 2VC0A 3HSFA 1A04A 4LJZF 4I02A 4MQ9F 1HKQA 1ZGJA 5LGTA 4YFXF 1LQ1A 1ZYRF 1T2KA 4GYGA 2EFOA 1EV7A 1W7PB 4A5MA 1STZA 2VT3A 1SD6A 1U5TC 2L3DA 5HS8A 1WSUA 3RJPA 4KUMA 4P9UA 1UHWA 1C0WA 2VE8A 3GFIA 2PJPA 3FXRA 3ABUA 3LA3A 4WXDA 4K2EA 4HDUA 3T8TA 3PQJA 4AWXB 2OZ6A 2P5VA 2IA0A 4UVCA 3KEQA 5F6FA 5D4SA 2L54A 5ICCA 1SD5A 5D5XB 2PG4A 3IWFA 1S29A 3NEUA 2YPRA 3LSTA 1Z6TA 1XB4A 3K2ZA 1B9MA 1R22A 4BYYA 5ICEA 5CVJA 2O61A 1XN7A 4LLNA 3RKWA 4I09A 3IRQA 5JR3A 2QVOA 4KIFA 1OMIA 5CVIA 4LB5A 4IHTA 1YQAA 3WE2A 4Y13A 3WGHA 5E1ZB 3QP5A 2R7FA 3BPXA 4EGYA 3B02A 2ZBKA 2XAQA 4OOIA 3GFLA 1KU2A 5LHIA 4MTDA 1DPUA 1TTYA 3CLOA 3V7SA 1T98A 3FMSA 4UXNA 3C3WA 4BH9A 3TDUC 2CW0F 3F3XA 4I98B 5LEKA 4LLGF 1YYVA 3M8FA 1JHFA 4WWCA 2V9VA 2EFWA 1WQ2A 4RGSA 5D5UB 1FSHA 5E8GA 3I53A 1WRJA 1AOYA 3RPUA 5LGUA 3BOQA 5D5VB 2EV6A 2RV8A 5DUIA 1IXSB 1QZZA 4M71A 3F8FA 2QQAA 4YIFA 3Q9SA 3ROUA 2Y48A 1Z05A 3QAHA 3HRTA 4KN7X 3QRFF 3ZQ7A 4N0BA 5K5OA 1LJ9A 1KQ9A 3NQOA 4BQAA 5A2QK 2FSWA 1F4KA 3SFZA 5CVVA 1T6SA 2CWEA 2ZO4A 2P5LC 1RNLA 2X0LA 5J8CA 3MZHA 4BAYA 3CO6C 6PAXA 1W7PD 1IN5A 1F1ZA 4HBLA 5HDKA 2Z5UA 3KP3A 1SMYF 2Q0OA 2K86A 2RKHA 4RGRA 1FYMA 1ZARA 5K1YA 1ZH5A 2HKOA 3KLOA 2UXXA 2YR2A 3J7AO 4JBAA 2YSRA 2P4WA 4WXCA 2XROA 4L5JA 2MH2A 4OIPF 5FB2A 3HHHA 2GZWA 2H09A 4M6YA 4ENMA 3J81K 1FSEA 1CGPA 3E5QA 2DAOA 1Z6RA 5JFRA 1XDUA 2JTVA 1OPCA 3EQLF 3IC7A 2UXNA 5D8LB 3GW2A 3E97A 1S7OA 4M74A 4GXOA 2VN2A 1SD4A 3VB2A 1HKTA 1O3TA 1MKMA 5L3CA 3KFWX 3ZMZA 2ISYA 3IHUA 5CVRA 3F72A 2HQRA 3TOBA 3QU3A 5LLQA 5A2QZ 1FOKA 1B6AA 2Y75A 1D3YA 5F64A 2IA2A 3ZMUA 2O0YA 3LA2A 2L4AA 5DUKA 2ADUA 4QWQA 4EJUA 3R4KA 5K5RA 5BPIA 4LG0B 3N97A 2IJLA 1YW9A 1BI3A 4EM2A 1IF1A 4TV7A 4Q48A 4OMYA 2HWVA 1FBQA 3F23A 1K79A 1KYWA 4EVIA 3MFKA 2ZCWA 5D4RA 1ZG5A 1FP1D 5ED4A 1ON2A 4ESFA 3E3VA 5LGNA 2FU4A 3I71A 1BC8C 3DPTA 2WC2A 4U0VA 3QOPA 3WTZA 1OR7A 3K69A 2BE5F 2R3SA 5AIQA 1QZYA 1JE8A 4YFNF 1R7JA 3F8BA 4ETSA 4G7OF 3R0AA 4MQVA 2F5CA 4UNOA 2K7LA 5HLHA 2O6GE 3BJAA 3M9AA 1R00A 2FOKA 4EJOA 5D5WB 2E1CA 5FLXK 2Z9OA 4OU0A 1P6RA 2XHKA 2KJBA 3WTTC 2LSOA 2QBYB 2M45A 1SFEA 1I1SA 3JSOA 3L09A 3OOPA 3KZZA 3GXOA 5LRRA 4DQ2A 2F5FA 2Z33A 4FX4A 1S8NA 2P6TA 1B1BA 1FX7A 5L3EA 1QPMA 4UHTA 2NS0A 3ZPLA 1O7FA 3HRSA 4D0PA 3CJNA 1F9NA 2JT1A 3KP5A 2L4MA 2Y0MA 3RTRA 5DV5A 5CLSA 2EFQA 1DUXC 5AONA 5TJJA 2FEZA 3TOAA 1HSTA 4WK8F 4UVBA 2MA3A 3MEXA 3IWZA 4EM0B 2JPBA 3GFJA 2DI3A 2OZUA 1MJBA 3REOA 2BV6A 5ERIA 2KRFA 2HTSA 1YO5C 4L0YB 3D5LA 2HR3A 3WU1B 3GVAA 2QQ9A 1ZRCA 1ZG3A 4A5NA 2A69F 1P4XA 1ON1A 5FD5A 1TW2A 3O6BB 1W5SA 3K9TA 3R60A 2F5EA 4Q47A 3O2PE 2JSCA 3I4PA 2BBYA 1YFHA 1KGSA 5DYMA 2ZNYA 4LD5A 2MLGA 4EQQA 3TQNA 3U1DA 5EEGA 2OAZA 3EDPA 3FHZA 4EV0A 3F8NA 4WX9A 3L00A 1LB2A 4CXFA 1VTNC 1G3TA 3P9IA 1IZ1A 4IXAA 1XCBA 1B59A 3F21A 2HDCA 1JGSA 4XLNF 3ZMSA 3MZYA 3L2CA 2W84A 3PQKA 4ZZLA 2DTRA 2EFNA 4HYEA 4S05A 3KP4A 3WU0A 3FF5A 3DKWA 1XGMA 2LKPA 3C7JA 3HYIA 2MLKA 3CUOA 2PN6A 5E18F 2EV5A 2H6CA 3VODA 1IN8A 1Z91A 1YG2A 3WE3A
chains in the Genus database with same CATH superfamily
1BN5A 4HF2A 5FLMJ 2HOEA 2M30A 1ZR2A 2GLIA 4KIGA 1I50J 1MSEC 2EOSA 2K9LA 3JAMK 3CCYA 3MSWA 2E19A 1IN4A 3THOB 4JQFA 5BS6A 3K4MA 5AE2A 1R1UA 5AIPA 2LTPA 1IDYA 3VYXA 4HNVA 1LDKB 2AQFA 2ZXIA 2OQRA 2PI0A 2MW8A 1SANA 1QO0D 1G4DA 3OYMA 5DTDA 2VB6A 2K9SA 3RKXA 3W6JB 2QEXI 2RS6A 4P78A 4NBQA 2H36X 3MQ0A 2WADA 4GGGA 2LD5A 2BW3B 2Q2EA 4CCMA 1IC8A 3ZMDA 4Y7NJ 4F93B 2O3FA 2DFIA 3HZJA 2A6EF 5F08A 3ERMA 4F92B 1USTA 3SXYA 4G8XA 4C3HJ 3B6CA 2F2EA 3DFGA 1SEUA 1Q1VA 2KZVA 4IHSA 1LVKA 3CZ6A 1YRNB 4KA4A 4YIIA 4BDZA 3KPHA 4UV9A 5HNHA 2EMHA 1MJ9A 4O5GA 3GEZA 1TBXA 1FYKA 4D5CA 1TNSA 4P55A 3AL0B 1OYIA 4DV6E 3WTWC 3HDDA 2EQRA 2UXCE 4MLVA 3M7GA 1O3RA 3FIGA 4OIQF 1A31A 3RI4A 4B3AA 3FM5A 2WY7Q 4F52A 1PP7U 2EPAA 1FC3A 3JRGA 2LLKA 3SFIA 2DLQA 1RZ4A 3W2VA 3HSRA 2Y9YA 2HOTA 5JI6A 3F6HA 2VLAA 3BR3A 1ITYA 2D45A 2RSIA 1T95A 2E34A 1U5TB 2DT7B 4CA0A 1K7AA 2DOEA 2HEOA 2PX9A 4RB1A 4KMFA 2RS7A 4B47A 1TF3A 2JY9A 2L02A 4LG0A 1P4WA 5A6KA 1IN6A 3R0JA 3OYIA 1XMXA 2ID3A 4XSXF 4CHUA 3QG5C 4A69C 4UUTA 2N3GA 3HEFA 2OC6A 1FPQA 1X47A 4H0EA 3K4CA 2NVTJ 2EMLA 1BIBA 2EFPA 3QU6A 2UWMA 1MNDA 4HEA2 5GP9A 1UG2A 3CO7C 4LFAE 4P9FA 3G2BA 2QSHX 5CPRB 3EPZA 3DQVC 4UUSA 4DYCA 2LMDA 2FMLA 4BXUA 2L01A 1B69A 4C9YA 3S16J 3GTQJ 1HKSA 4BDYA 4R8HA 4LK0F 1R4MB 1EH6A 2W1OA 3VFZA 2A05A 3IKVA 1YTYA 2EN4A 4OWRB 2A61A 2QKLB 4PGGA 3AFHA 5F1JA 2HVSA 3W6VA 1TF6A 3VDXA 1FTTA 4A0YA 1F2IG 2KL4A 2LT7A 5F04A 1MJAA 2L33A 4F3QA 4M0VA 2ME0A 2L9RA 4A3IJ 3A0BC 2CGPA 1YUIA 2CO5A 3ZQLA 2QQBA 1R5ID 3I59A 2P81A 2RQLA 3K0LA 5CJ9A 1APLC 4ESBA 3T8RA 3S1QJ 4UB8C 5B3SH 2QYOA 4YY3E 1E2XA 4AUXA 3H5RA 5DDGA 3SJMA 4EMSA 2V7FA 3BR5A 4NHRA 1YYWA 2HVRA 1I5ZA 2ZFUA 3I0TA 1S5LC 1KJKA 4A0XA 4RDUA 2EA4A 2Z2SB 3BTLA 5HDGA 1VQLI 4HRIA 4JI8E 1OCRH 4Y52J 4LLLA 4HV6A 4M3EA 5B1BH 5FKKA 5IV8B 5AE3A 2M7AA 3DTKA 2KDZA 5LHHA 3A2KA 1LKXA 3WTUC 4PFOA 5F1RA 3EPJA 1VQ5I 3F22A 5GAGJ 4BE1A 4A3CJ 2VBYA 4NQWB 2BGCA 1HLVA 1RI7A 3IKTA 4WYQB 1Z3XA 2UUZA 2WAFA 1BI1A 2HDWA 2IEKA 2NXNB 2FF4A 2DK8A 3BG7A 4IHVA 2IGOA 2YTPA 3CCUI 1LLMC 1FNNA 2KFDA 3HOVJ 1BM9A 1YYKA 3BQZA 3HUGA 2FBKA 3JCUC 4CZZA 3G3ZA 1FJLA 2I8DA 2L7MP 5LFAA 3S3MA 1KQ8A 3CD6I 1WVRA 1YSAC 4IRIA 2O03A 2OA4A 5HLGA 2YZTA 3DKXA 3M1CA 4XL9A 4MEXF 1TP4A 2P6SA 1M1EB 3L7WA 4B1RA 3BF2A 2YX7A 2PBIA 3ONQA 3OS2A 3GTPJ 4KT5C 2Y2ZA 1I3QJ 1WI3A 4JX4A 5DEQA 3PJRA 1Q1HA 3FWEA 4M9XA 4G7HF 2X6XA 2JUCA 3P9KA 4WF2A 4Q4ZF 1IQSA 1YUJA 1JK1A 3ABTA 2KDOA 3ZN0A 4D1QA 2M1SA 3EQ1A 2JOBA 2RQPA 3J81Z 2LR8A 3BR6A 3LA7A 3OMLA 3KX2A 1IBKE 4LF5E 3A1YA 3BZCA 2JVAA 2MH9A 1R49A 1X1BA 1I6HJ 2GOMA 4ZDPA 5DD4A 3E5UA 1UAAA 2CYYA 2KJCA 2RVCA 2PQ8A 4PCQA 5HLTA 1DDNA 4IL6C 2VL8A 2EIMH 3H9QA 2WTEA 3IL2A 2F4VE 2EPFA 5B1AH 1ZQ3P 4GKKE 1J7KA 1N75A 3HTUA 4QLCU 1FYLA 4XLEA 2WAEA 4O5VA 1E17A 3IV5A 1ETQA 1H8AC 4HTGA 3T1YE 1BI0A 4AIKA 1R36A 2XC7A 2OD5A 2LJUA 4LFBE 3ERED 1HXDA 3LSMA 1QBJA 2TRTA 2B63J 2IPQX 1JI8A 5A2QC 4FASD 2R5YA 4LMYA 3ZOBA 2XGXA 3JRBA 3PM1A 1EF4A 3C2HA 4BC7A 3KP7A 4AD9A 2COMA 4EGZA 3J7Yp 3IH4A 1FLIA 3I64A 1ZHFA 2F5VA 2LFBA 4MTEA 2IS4A 2P8TA 2V79A 4M6VA 2YS9A 2B0LA 2Q8KA 4ZDOA 2ZKZA 1IUYA 2LK2A 1R1VA 2DPDA 4M30A 1P7IA 3QYEA 4Y17A 2E2JJ 3RMPA 5KL3A 1IV8A 5KNLA 3TP0A 4LB6B 5A6JA 2CV2A 4DBRA 3WTYC 1J26A 2NYXA 2XAJA 3DKYA 4FX0A 1XMKA 3GTOJ 2Q8UA 4HZFA 1BR1A 2VUMJ 1MD0A 4NXME 2ZXJA 4BKXA 1GVJA 1IJWC 2RNJA 4XN0A 1HBXG 5M3FJ 2IS6A 2W48A 2VBXA 3GF2A 1A1LA 1G2FC 5JVTA 1G3WA 4KNYA 2B9DA 3GUDA 1X49A 3MZ8A 1G2HA 1X1PA 1Z7UA 4HSRA 5M5XJ 5BMZA 3KZYA 2MDGA 1FZPB 1NG6A 2YTFA 1TQMA 1W5TA 3KIOA 5HODA 1ZKGA 3I9V2 2GXBA 5FKMA 1RKWA 3J80K 3I56I 4I0AA 4B44A 1ZREA 4X6AJ 1U8BA 3HOUJ 4A3EJ 3PO3J 5L3GA 2DA2A 5H6QA 4B8XA 1GHCA 4RGXA 2M8EA 1I27A 2RC4A 3ZQIA 4BE2A 3BJOA 4QTRA 2ZJ2A 4B3ME 1YZ9A 2YU5A 5T6JA 4GO1A 1IRXA 2A68F 4N9IA 3G73A 1HOMA 4LTYA 4BNCA 2JVGA 5ICFA 3RIRA 4OMZA 4ON0A 2QWWA 3EUHC 4IKFA 4TUIA 2DGCA 1IXCA 4G12A 3P5JA 3ZN1A 5LBQA 2LF8A 2JRMA 5L3BA 3N05A 3HOTA 4XQFA 3EYIA 2DMTA 3ECRA 1Z21A 4IZZA 4AQYE 1HR0E 2LV2A 3E6DA 2X4HA 2JK3A 2JWTA 3M8EA 4ENNA 3SHFA 1P2FA 1TT5B 3HGGA 3QP6A 4OOGC 3ECHA 3FKIJ 3CCQI 1GLNA 5FD6A 4RAZA 5KVRA 4BHCA 4HW0A 5M3MJ 3JRHA 3IAS2 3VYRB 3OY9A 1D0YA 4GKJE 4DYQA 5TRDA 2L0KA 2L9SA 2WAQA 3C18A 3DPLC 3PFYA 3TGNA 4RH8A 1TZLA 3KWRA 2D1HA 5E17F 3RPQA 4E7KA 1YW7A 2BW3A 2Q2EB 2EILH 2ACJA 1MZBA 4D5FA 4RLQA 2EZHA 2WZOA 5IOZA 4E7IA 4U0WA 2ZB9A 3BTIA 3OYKA 1FP2A 5ADZA 2F4MB 2K4JA 4X1EA 3K70C 3DLLF 4HDVA 2CV0A 4YIRX 1VQMI 1J0RA 2JA7J 1XMOE 3BPVA 2EB7A 3H36A 3MKLA 1OYYA 3A0HC 2G7HA 1VQ6I 3OSGA 1Z0XA 1WJEA 2DMPA 4BXFA 2CPNA 2CUZA 2CQ7A 1IO2A 4LIVA 5E1WA 2EOOA 1HW1A 3BROA 1SFUA 3BG5A 3OWTA 5CYVA 1PVEA 3J80Z 1F43A 4KZSA 4G6QA 4FE7A 5GAEJ 2AQEA 1ZRDA 5ILUA 4KITB 1JXSA 5E79C 3E6CC 2KRHA 1RRJA 4F6NA 2YRKA 2E5LE 2HQ5A 5JLWA 2BY0A 2XAHA 1HF0A 1IMUA 3C6MA 1OCOH 3Q3SA 2MBFA 3BZKA 1WJBA 1Z7LA 2EPOA 1ULYA 1PUFB 2ENHA 3HHGA 3EUAA 3BT9A 4G94A 2MC4A 4DW6A 1MBKA 2R7DA 1DP3A 3HPSA 1UG0A 3BZ6A 2UUAE 2XIGA 2KIQA 2RGVA 4MHGA 2WBTA 4DMIA 1DU6A 2JWOA 3K1NA 1WXRA 2GWRA 1RC9A 2NVUB 2YTNA 3F8MA 1T38A 1N34E 1T4OA 4BJTA 2OTLI 1SAUA 1YHQI 1U9NA 2NAZA 2RPCA 4P5OA 4NQWA 2IA1A 4A2UA 1R23A 4AIJA 4AC0A 2M4KA 1MBEA 5GAHJ 2E60A 1ETYA 2XGDA 2OU2A 3J7YJ 1A1JA 4PJNA 3UNGC 5E20A 4FQGA 4B3XA 1ZK8A 2VI6A 2EMIA 1KU9A 2E7WA 1S7AA 1USSA 2QSGX 1KQ0A 3K10A 2ZJRF 2RAEA 2VOOA 3QPTA 1H89C 3OYEA 1TLHB 2VT2A 3L1PA 4IHYA 5KAIC 2YSOA 3AUZA 5BNGA 1IV6A 1VQ7I 4A3BJ 1YJWI 2LVSA 2VKHA 5EEHA 1Z1DA 3OR1C 3K1PA 4XIDA 3SZPA 4K0KE 4KICA 4S0HB 1Y0UA 2K85A 4DV2E 4YEJA 5FLXC 1BJAA 2NNNA 4NHJA 3Q5FA 2M34A 2Y31A 2LVHA 3P7NA 4M9ZA 2FMYA 3I59B 2JYAA 1W4MA 2FJ1A 4ESJA 4I6ZA 4AM3A 1U2WA 2PFBA 1E3HA 2Z3YA 2ADRA 4N4RB 3HB9A 1X3WB 3OYHA 1VQOI 5HOOA 2XRLA 2XKPA 2K02A 2HOSA 4L8NA 3LWFA 1X1DA 5M5WJ 4M2ZA 4DOZA 2DQLA 2MGQA 2BB8A 4DZJA 3Q0WA 2WBSA 4A3JJ 4L9TA 2G7UA 5FGMA 4IRHA 4A6DA 2E1OA 2LY9A 3JREA 1SFKA 1Y39A 3JAMZ 1Y56A 4A3GJ 2EMFA 4UUSB 4M73A 4E7SA 2ZMEB 3BWGA 3PNTA 3MHSC 2UUCE 3RKYA 5K5QA 3H92A 4FT8A 1X3UA 3ZOQB 4IS1C 3FXUA 3WHBA 4G7ZF 1VNDA 2WB1N 1X1AA 2UV1A 3CP8A 2JN6A 2OV7A 2P7VB 4JI5E 2VJIA 3F0CA 3HOWJ 1EH7A 1RETA 1XGSA 3TO7A 2E1NA 2W24A 1XSDA 5J4YA 2IW5A 5DD8A 2EBIA 3VWBA 2XDVA 1K6OA 2BYVE 2DLLA 2J5OA 2CH0A 1ENHA 3BJ6A 1IAWA 2YUSA 2YX4A 2EJ4A 1D1BA 3OL3A 3A01B 2RQQA 2NVYJ 1TWCJ 4JI3E 4RM2A 1RIOH 2VKDA 3JTHA 4FCYA 3TQMA 3I3LA 4M9SA 2HHHE 2EWNA 3R6SA 4S04A 1ODDA 1QGPA 3B73A 4CICA 2E7XA 2FNPA 2MD5A 1P92A 2HYJA 4B09A 2PMHA 4V2GA 3ZP5A 4RAFA 2LBFB 2FNAA 2V86A 2B3TB 3FXKA 1MMSA 4XLHA 4MLOA 5DCFA 3RQIA 2V9KA 3JRDA 1EA3A 5FKNA 2K7IA 1FIAA 3KETA 3RPUD 1LPQA 3BP8A 4D9JA 3GZ6A 2R76A 1KU3A 3QPHA 1ZTRA 3GMEA 3ZMVA 3DCFA 3IRRA 1A1HA 2QENA 1QPIA 2EN1A 3AG4H 3F6VA 2DA3A 1QRYA 5GTIC 1B9NA 3KEOA 3CCVI 2DU9A 5EGOB 4J00A 2HNHA 1MMDA 1HQCA 1W5CC 2JJ7A 3CUQA 4EJWA 1LEBA 5IXMB 3VK6A 2BBGA 5FO5A 3TW6A 3C4BA 4R1HA 2DCEA 4NZVA 2TDXA 2FXAA 4KWYA 2DFFA 1IG7A 1W36C 2W7NA 2DLKA 4R2QA 4CGZA 2DOAA 2DT5A 5JLXA 3BLYA 5C3EJ 1ZN2A 1PJQA 2ZSIB 5KCMA 1X48A 5E3LA 1DQUA 5H6RA 3QYFA 5F27A 4UVAA 1O4XA 2ID6A 2XGCA 2IT0A 2J5PA 1CF7B 3CF5F 1UILA 5J6XA 1XTAA 2X1DA 3T5XA 3MHHC 4Z2YA 2ESNA 2XRNA 3RYRA 4OIOF 4U87A 4U7BA 3IWBA 4F2JC 2LRDA 3PIPF 1O3SA 2CG4A 3ML6A 2EE8A 5HLIA 1VQNI 4L18B 3OL4A 1WJFA 4ZDLA 2L2MA 2AXLA 2HKXA 2A6HF 3X2QH 1ZGAA 3Q9VA 3GYHX 4ENJA 3HTSB 5ICGA 3JRAA 2Y69H 4P7DA 3ECOA 4BEHB 5J1UA 1A1GA 1YE9A 2FQ3A 5BOXA 1AAYA 2V9PA 1S6LA 3MAJA 2N8GA 4HNTA 3PUBA 2R5ZB 3M4OJ 3OIPA 1YX3A 1MIJA 2XPWA 2JXPA 2XKOA 3BDDA 1WHQA 2VF1A 2XF7A 4EJVA 4HOBA 2K9QA 5E3MA 1WH7A 4M3BA 4HLYA 1G6NA 3CTAA 2VKEA 4PJ0C 1O7LA 1O57A 1ZAOA 5HS7A 1TWFJ 2ENCA 3MWMA 3DJWA 5L3DA 5J3LA 2EIKH 4P96A 1J9IA 3L9FA 2PMZN 2V6CA 1OCCH 4PDKA 4BEHA 2M5WA 3T1BA 4F91B 3HPZA 3H3UA 1Y0NA 1UB9A 1U0JA 4O6JA 2VOPA 2M9HA 3E6BA 3H0DA 2XF6A 2DA5A 5LRSA 3ASNH 4KDPA 1U6GA 4LFCE 4YG2F 5K7ZA 4A6EA 1BIAA 4BU2A 2XASA 2A3SA 3ZRGA 4YFKF 4LF8E 1TWHJ 3RDIA 2Y30A 1Z67A 5CQEA 4U7DA 2EV0A 1X2NA 3DF8A 1CF7A 2K9MA 2R7WA 1AWCA 1AU7A 1SAXA 2DMNA 2WBMA 2D5VA 2YU3A 1BW5A 1IBLE 3LAJA 2XVCA 2PLYA 1TW3A 2H1LA 3WTVC 5IPAA 2FUG2 1QQIA 4DUZE 3ESWB 1H88C 1ZLJA 1XGOA 1XMAA 3DTIA 4BHBA 2DDBA 3DBRB 4AVPA 4HLXA 1A6QA 3ADIA 2LREA 5LL6R 4U88A 2DMUA 4R2EA 4RMNA 3EPLA 2M87A 2H6BA 2EL5A 1LDDA 2DTZA 5KL6A 4IPAA 1K78A 5D6FA 3FXLA 2STTA 5BR8E 1MDMB 3IAM2 2K3FA 3ADJA 1AH5A 1ZELA 3WGGA 4LK1F 3HC7A 1SMTA 2GIZA 2HFHA 1W1WE 2AS5F 1F5TA 3BTJA 3COAC 1X3CA 2JRTA 2VBZA 1XS9A 2DMYA 3V7CA 3IUOA 2B7VA 2EM0A 1NK3P 3F6OA 4OAYA 2LTRA 2CQKA 1V4RA 5C4XJ 4ANJA 2IGNA 4E4HA 4BBRJ 5FLXZ 3H0GJ 2ZJQF 2YTGA 1VQKI 4ZYGA 2EZLA 1I1GA 1LUJB 3OR2C 4X66E 1BW6A 2O8XA 2X48A 4OINF 2QLZA 4G9YA 4ENKA 3MCZA 5IT9C 2A5YB 3LMMA 1A1FA 3CMEI 1ONVA 1RR7A 3TDZC 3T0YA 2OCEA 1DPRA 3HIFA 4R8OA 2EOZA 2ICWG 3LFKA 1UJ8A 2IRFG 3CDIA 2R92J 4XLPF 1TNTA 1XX5A 1WJDA 2QKMB 4JYKA 2E35A 4MEYF 1EH8A 4RLFA 5FFZA 5M5YJ 1KU7A 2IP2A 2LF7A 1TC3C 3R61A 4R2SA 1D8JA 3V7RA 2EL4A 4HSTA 2KOUA 5FFXA 2UU9E 3LL7A 2M8GX 4WFTA 4HAMA 1U5TA 3FISA 3U2RA 1K78B 3SZTA 3CUQC 5J47A 2E2IJ 1QHGA 2ZC2A 1XDSA 2KT0A 3NRVA 3FIWA 4GDFA 2UZKA 5FLVA 2HOAA 2XAUA 3TO9A 2W4SA 2LUPB 2GXGA 5HVQC 1H9GA 1R58A 3DV8A 1SD7A 4FTHA 4DV0E 2JA6J 1WGXA 3EPKA 3UK3C 1WI9A 1MDMA 2FRHA 5D6EA 4XSZF 2XUBA 1R4NB 4QPQA 4DYRA 4GYIA 3KP6A 5F3WA 4F9CB 3CCJI 1NEIA 2F8BA 4FISA 2EMWA 3WG9A 5IP9J 3AV0A 3H9GA 3K4NA 2QQ8A 3WTXC 1WWXA 1R1TA 5IYDJ 4L5NC 4B43A 2BOLA 2H94A 4BHPA 1PJSA 2VONA 3D0SA 1ZLKA 3CC2I 1HNXE 4LIUA 1TT0A 4HX7A 2DXIA 3FDYA 2HGHA 2DA7A 5IT9K 1H9TA 3FXOA 4NB5A 1V5EA 4AYBA 3PSFA 2C6YA 3LQQA 1H0MA 2YRHA 2QUFA 2NUEA 4M6XA 2QM3A 4RAYA 5IYCJ 3U21A 1O3QA 4BGDA 2EN2A 3W6KB 1ERDA 2P5KA 3FZVA 5GPAA 4R2DA 2CSOA 4DBQA 2QBYA 1UFMA 2R7SA 4CO8A 3HJEA 3O3KA 2L7FP 3GX4X 4HPQA 2VRDA 1PDNC 1BBGA 1DGRM 4E6KG 3HXLA 2ZFWA 4CYCA 1UCRA 1FBUA 2ZNZA 4KIBA 1S72I 3DU6A 2VQFE 1G3YA 1STUA 1YYOA 4Q28A 4DR3E 2JA8J 1TQPA 2O7OA 2CRGA 4KMUX 4GZNC 4E70A 1J5YA 2N8XA 3DBHB 5IYBJ 2XAGA 1B8IB 2FBIA 5EEAA 2EM8A 2MSYA 2V88A 3F8CA 3DXJF 2JSPA 2DOFA 3HOSA 3OYNA 1HW5A 2DN0A 3K2AA 4WXHA 3FM3A 2R4GA 1LFPA 5BPDA 2GA1A 2EMZA 2EPPA 1OLTA 1GZ6A 3F9KA 2VQHA 1NTCA 2JUGA 2L9VA 2MYSA 4I0BA 2ISZA 2EZ6A 5EF6A 2HGCA 4KYWA 1D1CA 4CUGA 2LKXA 3F6GA 2FA5A 4PGHA 1MSFC 1NH3A 1OISA 3BY6A 3I54A 4ZTFA 1DP7P 3LLHA 1JKOC 1YRNA 1GXPA 1FT9A 2DYSH 1YS7A 5BQTA 4X62E 4JI1E 1CQTA 1N3GA 4DKKA 1WH5A 1V5FA 3C1DA 5K7FA 2EPLX 1UMQA 2V4JC 5B5EC 4BJ5C 4F9AB 3V8KA 1ZR9A 2JPAA 2JZYA 2XB0X 4LFUA 1YITI 4XKVA 1BBOA 3BCAA 2FV4B 1IRFA 2DIXA 4FHTA 1QNTA 1A36A 4I2OA 1LDJA 2ZXWH 4M72A 2O5RA 3LSPA 4LG3A 1T0FC 4MFEA 4EM1A 4DR5E 1SC7A 3O8HA 4XN3A 2IVMA 1UHZA 1G59A 4HNUA 5HS9A 3GO5A 2HI3A 1MBGA 1LVAA 3S15J 2H1KA 3BR1A 2DODA 3GTJJ 3H5AA 4JX5A 2CUJA 2X1CA 2X6YA 2VE9A 1YIOA 1FKAE 3QOEA 1JGGA 1LNWA 2GA2A 4Y4RA 2DO7A 4DR4E 4KN4X 3K6GA 1NHAA 4NC7A 4RB0A 3LSRA 2RSMA 2NVQJ 2XPVA 3TMOA 2LJHA 1XSXA 3KP2A 4IRGA 1QVTA 2FGGA 2ZMEA 2D2WA 2EA2A 1XGNA 1N36E 1MH3A 4PFPA 3I4NJ 5E1XA 1Z1BA 2DW4A 4EJTA 3JW4A 2A07F 1KA8A 3Q0UA 4A3KJ 1D5VA 3ZQFA 2EOXA 1OR7C 1ORKA 5D8KB 4UB6C 4RS8A 4WPYA 1JUPA 2QF7A 4NDLA 3SEZA 5IT3A 1REPC 1IRGA 2EM4A 2FBHA 2VXZA 5C44J 2XAFA 2EZIA 1XMQE 5IWAE 5GTHC 3SQNA 4DGWB 3FMRA 3U1KA 1A6IA 3HM5A 1YJNI 2B9SA 1PUEE 1HCRA 2ELHA 1S9HA 3CJQB 1PP8F 3EYYA 2EK5A 1LEAA 3VSLA 1PUFA 1SVMA 1DQ3A 2R93J 4FETA 1IRZA 2CSHA 4AYBN 3E6MA 1SFXA 1R5GA 4Y15A 4XRMA 2EQ3A 2FX0A 1X1CA 4II2A 3CF2A 4HF0A 3AAFA 2HZTA 2I13A 5TISC 3C6KA 2NOGA 3ZMTA 2NABA 2V1NA 2L9NA 4C3IJ 2DPUA 3RYPA 2YSPA 4UV8A 2EH3A 3QYBA 1XC5A 2IS1A 1D8KA 1J5EE 3ULQB 2KKOA 1VI0A 2EMKA 3G1OA 4CCNA 1OYWA 1S7EA 2D1VA 4LGWA 2HTJA 2H8RA 1T33A 5L3FA 1G3SA 4DNCA 1MGTA 5DCMB 4BQNA 4G6DA 4R79A 3P1XA 4HX8A 2VODA 3W2WA 4ZYDA 4E7HA 4O3MA 2CFXA 4CDGA 2B7TA 2KISA 2JOXA 4MNUA 5A6AA 2GPIA 2GAUA 3JSPA 4A0ZA 3MVPA 1O0WA 2F5DA 1G8XA 1OCTC 4PJJA 4F7ZA 1FOWA 2NRAC 3WG7H 3OYJA 1L4SA 2DQRA 2YTIA 1Y6IA 3K1MA 5JHUA 3CDHA 1DGWY 2VQEE 4V2FA 5DCMA 4LF4E 2HZDA 4RGUA 3TW7A 3TKYA 3PSIA 4DV7E 5HDNA 2JR1A 1ZG1A 1YLFA 3M1EA 5EG0A 2RN7A 3VYSB 4PJLA 4LU9A 4BC9A 4XLAA 1ZGWA 2EJRA 2L2NA 1BOAA 2WAQN 3WGIA 2VE7C 2CUFA 4ZYEA 5KAFC 1RPWA 2LBSB 2VJJA 4XORA 1R5HA 1IUFA 1J75A 3V8JA 5ILSA 1HNZE 2WWYA 1PYVA 1W7PA 3S93A 1U78A 2VKVA 4BE0A 3GLXA 3FBNB 4ZYHA 2KPMA 3KYDB 2GIVA 3N4MA 9ANTA 2I9IA 4ABZA 2KIUA 2BEOA 4CYDA 2DK5A 1U9OA 2HYGD 2AXTC 2VQGA 4BXXJ 4B4CA 1LFUP 2GHFA 2HS5A 2V89A 2FE3A 4IF4A 3PFIA 4I7HA 1FOXA 2EZKA 2M0MA 2RDPA 2IGMA 1RUOA 4RB2C 2YU9J 2DMIA 4ITVA 1JT6A 1BL0A 2GOXB 1P9QC 4XBFA 2JPCA 1IN7A 1T39A 2WA0A 4PZJA 1BB8A 1E3PA 2W25A 3JRFA 2LRSA 2LNBA 1S3JA 1VFCA 1HW2A 4RB3C 3AKZA 1GV2A 2HPMA 3S17J 3HRMA 5EZHA 3LSJA 4BY7J 1OCPA 3WODF 3ZCOA 2NNYA 3EUHA 3VEPA 2LP0A 3KLNA 1K83J 3KCCA 3OS0A 3K4JA 4PSWA 3V8LA 4CCKA 1OKRA 3OIOA 5J8FA 2PMUA 1W0UA 2V1XA 3HSEA 3P9CA 3M99B 3H09A 1T0FA 3K4BA 4HA8A 2MC3A 3OOUA 2ODRD 1RUNA 1BC7C 3EETA 4HV5A 1P4AA 2E5NA 2FD5A 2OQGA 4E7ZA 4XOTA 3VOEA 1WJPA 5JHFA 1XD7A 4U0YA 4HX4A 4X9JA 1IXRC 3OYCA 2Z99A 3MKYB 1BI2A 3BQYA 3OSFA 1HDDC 1JK2A 3LSKA 3CDLA 4AIHA 2ZJPF 2E1MB 3GTKJ 2JQ7A 4R2AA 2GM4A 2JA2A 2VC1A 4IOAF 3IWDA 2DA6A 5LMNE 2EN8A 4GRIA 4XR6A 4HQMA 4ZZDA 1V3FA 1YW8A 3TO6A 5J40A 3I55I 3HQ1A 3ASOH 1A5JA 4L9JA 3WTSC 3HKZN 1P7JA 2YU8A 3GFMA 3K6QA 4R2PA 2HXOA 3NWTA 2AHQA 3IWCA 4RAGA 4XMYA 2P7CB 2EM5A 4L5EA 2LH9A 3S2WA 2EOQA 5ILVA 2QZ8A 2YTOA 2A25A 4ASNA 3LAPA 1AA7A 1QA6A 2V26A 2KIMA 3FK6A 4DZPA 1Z9CA 4MGRA 5J1RA 5EJCA 1XNQE 3VYYA 3OYLA 2DSYA 3W3CA 2VPLA 1YJ9I 2DA4A 3CUQB 4L0ZB 1MMNA 2HQNA 2K5CA 2TCTA 3ISPA 2MKDA 3HTXA 4M3DA 2W85A 4IEJA 3E5XA 5KHDA 3JR9A 5FRMA 4IJAA 2PEXA 4AU7A 2R0QC 1J2XA 2XSJC 2H27A 1RQ0A 1XSVA 3A4CA 2OBPA 4A12A 2V1UA 5CKTA 3H3ZA 4OIRF 2IHR1 2PJRA 2KONA 1N33E 1NCSA 1UBDC 3H3VK 1T08B 2ODRC 2MD0A 2OPTA 5CVUA 2K27A 2EMGA 4HEIA 3FXQA 1D0XA 3VYTB 1D5YA 4W97A 1HSJA 2X1EA 2L2OA 4GCVA 4L5IA 3VYUB 4ZH4F 4RBOA 1K61A 2WBUA 3ELKA 2CV1A 1J59A 2EPKX 2V1DA 4WCGA 1R6RA 4II3A 1W36D 2STWA 3V4GA 2ETHA 1VQ9I 3GTMJ 2EM7A 2VBWA 4KHPE 1TQIA 1XCVA 2KIFA 3LQRA 4L9VA 2R7QA 3HOYJ 1P47A 2D9HA 4JK1X 5F0HA 5LHGA 2XSDC 3CCEI 2MDRA 2W57A 2KHXA 2EOHA 4PUSA 4JYAE 2E1MC 2EINH 2W00A 2KLOA 1U3EM 1EJ9A 3SZGA 3GCMA 1FWZA 1OQYA 3I5UA 3OV8A 1GTKA 2E1MA 2WV0A 4HQEA 2GQQA 2CT1A 4UUVA 4UY8I 2EPMX 4Y3OA 3CCSI 5E8IA 2BXYA 2M1BA 3DEUA 4IVNA 4F9BB 1ETXA 4JX6A 5FJ8J 4IOCF 4BMJA 1I39A 2VQCA 5B66C 3G71I 4X0GA 1K4SA 1ZRFA 3K7AJ 5H20A 3NAUA 3GZ5A 4CSWA 4DR1E 3HGYA 3GBGA 1TN9A 3HPHA 5K7HA 1JKPC 1T4NA 2EM3A 1IW7F 2OTJI 2R7XA 3I4MJ 1WFXA 1FBSA 3U9GA 2EMYA 1JTXA 4Q5SF 1KYZA 2E5ZA 3CCMI 2K3PA 2OJED 1WPKA 2ME6A 3OYBA 3VPRA 1YS6A 2CW8A 1L3LA 1L0OC 1ETOA 3PNYA 3KE2A 2GLOA 3ABLH 3HRUA 5FKOA 2EOIA 4NXNE 1V55H 5LEJA 2WCC3 2I5UA 5KK1A 4XRSG 4A3FJ 1GXQA 3AG1H 1NG7A 2EPCA 2RTXA 3L2WA 2AO9A 1HDPA 2G9WA 3GWZA 2Y0SN 2K4BA 3KYCB 1B4AA 2M2EA 4HF1A 1U8RA 2E2HJ 1E3OC 1WKMA 3DP7A 1ACIA 1Z77A 4KFCA 1WZ2A 2NA2A 3FX3A 2R5ZA 2LO3A 1KZHA 1I6XA 3HPGA 2ZXHA 2XV4S 5IT9Z 1A1KA 2QGUA 3J7AY 3CC7I 5AE1A 3S14J 3I58A 4YRVA 1JHHA 2KHMA 1BBYA 2ESHA 4CH7A 4N9HA 3JTGA 3RSNA 1RKTA 4L9NA 4XRFA 4BBYA 5LMUE 2P0WA 4I76A 1KONA 3S1RJ 2HYFA 3OYAA 2EPZA 2L3JA 2DBBA 2HPIA 3G1MA 1UHMA 2LDUA 1HA8A 1ZBQA 4YELA 4BBSJ 3FMQA 4I01A 1BOBA 3BGHA 1FY7A 2VC0A 3HSFA 3S2HJ 4X8WA 1WJCA 3HUGB 4DUYE 1A04A 4LJZF 4I02A 4MQ9F 1HKQA 3S1MJ 1ZGJA 5LGTA 1AHDP 4YFXF 2F48A 1LQ1A 2I10A 4DJAA 4CCJA 2JMWA 3DLAA 1ZYRF 1T2KA 2HDDA 2MKNA 3J80C 1X6HA 4GYGA 4MIMA 4DV4E 2EFOA 2R1FA 2DA1A 1EV7A 4DR2E 1W7PB 4BY1J 3S32A 3E1SA 3AG2H 4A5MA 1STZA 2CU7A 3M07A 2VT3A 5FROA 2NVXJ 2LTSA 1SD6A 3QPSA 1PDAA 1U5TC 2Y0SA 2L3DA 3ZQCA 5HS8A 1WSUA 4V19K 3RJPA 4KUMA 1F36A 2CW7A 4BL0B 3B6AA 2KQRA 2M4IA 2QSFX 4P9UA 1WHNA 1UHWA 2LE2A 4JP0A 4CCLA 1C0WA 1WCMJ 2VE8A 1DU0A 3GFIA 4NUBA 5DS9A 1FEXA 2HJJA 3CCLI 2PJPA 3FXRA 3ABUA 3LA3A 4WXDA 4K2EA 4HDUA 3T8TA 3A02A 3PQJA 2ECBA 4AWXB 5HNFA 3H1CA 1DGCA 2OZ6A 2P5VA 2IA0A 4UVCA 2KMUA 1GQEA 4ZTJA 4A3DJ 3KEQA 5F6FA 2EM9A 3HL2A 1YOVB 2L54A 5D4SA 1SD5A 5ICCA 5D5XB 2PG4A 3IWFA 4NC6A 3OYDA 1RMDA 1S29A 2PMZA 3NEUA 1JUSA 2YPRA 3LSTA 3OYGA 1Z6TA 4HG2A 1MNMC 2L2KB 1T8IA 2EOMA 4XKBA 2FQ4A 3BIDA 3S1NJ 1X6FA 4C2MJ 1XB4A 3K2ZA 1B9MA 1R22A 4BYYA 5ICEA 3RKQA 2XPUA 1WJAA 2EIJH 4XNFA 5CVJA 4BS9A 4M3GA 2O61A 1XN7A 4LLNA 3RKWA 4I09A 3IRQA 3LMLA 3BG6A 2E36A 3ZQHA 3S8PA 2QVOA 5JR3A 3JTZA 1UHSA 4J01A 4KIFA 1OMIA 1FJGE 5CVIA 5JVGF 2EPUA 2LYCA 2O9LA 2BXZA 4LB5A 1WJ5A 1NK2P 4IHTA 4G6TB 1YQAA 4GFBA 3WE2A 3ZXSA 2M7BA 2EM6A 3GTGJ 4Y13A 1W0TA 3WGHA 3GZNB 3CC4I 5DM6F 5E1ZB 3L2UA 1SR9A 3QP5A 1UELB 3G4SI 3QWLA 2R7FA 2MFZA 2CUEA 1B8IA 2OCCH 3BPXA 4LF9E 3SDBA 4EGYA 2GXAA 3B02A 2HC5A 2ZBKA 2XAQA 4LOCA 2OUMA 4OOIA 3HKZA 2IXSA 5KL4A 4NNJA 3GFLA 2EOJA 4XOPA 4D7MA 3GTLJ 4DR6E 2EN7A 2K40A 4C3JJ 1KU2A 5LHIA 1EKEA 4MTDA 1DPUA 1SVLA 1TTYA 2BY1A 4QIWN 3CLOA 2CQNA 1WHUA 2OF7A 3V7SA 4N4NB 3S3OA 3AL0C 2EN6A 1T98A 3FMSA 4UXNA 2GBYA 3W2AA 2CS3A 3C3WA 3J7ZI 4BH9A 3TDUC 2CW0F 4DV1E 3IH2A 2BVLA 5KL2A 3BTCA 3F3XA 4I98B 2UXBE 3LNQA 2EOFA 5LEKA 2QA4I 5DNYA 4LLGF 4DR7E 1YYVA 3M8FA 2FTXB 3KZIC 1JHFA 4WWCA 2NS8A 3BCBA 2EP3A 1T4LB 2V9VA 2EFWA 1WQ2A 4RGSA 4M3FA 1ZR4A 2ECCA 5D5UB 4JI7E 1FSHA 2QCOA 5KL7A 5E8GA 3I53A 1PJRA 4XLCA 2VASA 1WRJA 3HOZJ 1XNRE 4R2CA 1AOYA 2EPXA 3RPUA 1BR4A 3FBIB 3PO2J 1LE8B 5LGUA 3BOQA 2LC2A 4XKCA 1Y1VJ 3H35A 5D5VB 2EMAA 5A69A 1XG1A 2EV6A 4Y33A 2RV8A 5DUIA 1IXSB 1GV5A 1QZZA 3BG9A 4M71A 4YHHE 3FXJA 3F8FA 4DIQA 4XRSA 2L92A 2DMQA 2QQAA 3OS1A 2ENAA 3V42A 4YIFA 3DEEA 3Q9SA 3ROUA 2Y48A 1Z05A 3DWLE 3QAHA 1JT0A 3CJRB 3NARA 3HRTA 4KN7X 1B72B 2MABA 4E7LA 3CLQA 1QHHD 3QRFF 1JJ8C 3J81C 3ZQ7A 4A3LJ 4N0BA 5K5OA 2V83A 5IOYA 1LJ9A 1N77A 1KQ9A 2L6MA 2IBDA 3NQOA 2V87A 4BQAA 2G0EA 5A2QK 1X3ZB 2FSWA 2EORA 1F4KA 2IS2A 3SFZA 1K6YA 5J4VA 5CVVA 2X6WA 4CYCB 4O43A 1T6SA 4E7JA 2CWEA 2ZO4A 4RM3A 1KYQA 2P5LC 4FE4A 2UUBE 4N4OB 1HC8A 1RNLA 2X0LA 4D7NA 5J8CA 3MZHA 4O24A 4BAYA 3CO6C 4C2TA 3FXMA 5CFFE 1FTZA 6PAXA 1W7PD 3G1LA 1IN5A 1F1ZA 2DJIA 4HBLA 1E0EA 4BCAA 5HDKA 1SFOJ 5IP7J 4F54A 2Z5UA 3KP3A 1SMYF 5EG0B 2Q0OA 3LSGA 4XKWA 1BR2A 2HU9A 2R7TA 4I8OA 2K86A 4M9VC 1DI2A 2RKHA 4RGRA 1FYMA 1VZ0A 1ZARA 5K1YA 3PIOF 1ZH5A 2HKOA 3KLOA 4EATA 1GT0C 3QODA 2UXXA 2YR2A 4ZC3A 3J7AO 1G2DC 4JBAA 1Y8RB 3C2GA 2YSRA 5EYRA 2L3CA 2P4WA 4WXCA 3BR2A 3CMAI 4B3TE 2XROA 4LF7E 4J19A 2YPNA 4WSGA 4L5JA 2ZM6E 2MH2A 4OIPF 4W1UA 5FB2A 1R9TJ 2EPNA 4ZYAA 4BACA 1VF9A 2PJRB 3HHHA 4Z6YA 3LSHA 1QVUA 2GZWA 2X6OA 2H09A 4M6YA 4ENMA 3J81K 1FSEA 1CGPA 2A5WA 2R7RA 3LSIA 3BG3A 4C30A 3A01A 2ELYA 3E5QA 3Q0VA 2DAOA 1ZAAC 2LG4A 1Z6RA 4OAZA 1JKQC 2LY2A 5JFRA 1XDUA 2JTVA 1OPCA 3EQLF 3ZGKA 3IC7A 2UXNA 4JI6E 5D8LB 3GW2A 1LFBA 3E97A 4PK4A 1S7OA 4M74A 2CTDA 4GXOA 2VN2A 5GADJ 1SD4A 4KISA 3LFUA 2CQXA 3VB2A 1HKTA 4I99C 1O3TA 2WB1A 4IQ4A 3G6EI 1MKMA 5L3CA 3KFWX 1Y8QB 3ZMZA 5FRNA 2DFHA 2ISYA 3OIQA 3IHUA 5CVRA 1VQ8I 3MKWB 3F72A 3THNA 2M7QA 2HQRA 1QZEA 2M4GA 3TOBA 3CMMA 3QU3A 5LLQA 5A2QZ 1FOKA 1A35A 2E72A 1B6AA 2Y75A 1I3AA 2V8QB 2YT4A 1D3YA 2BVMA 5F64A 4OX9E 2IA2A 3ZMUA 1YX5A 2O0YA 5A6BA 2NS7A 3LOCA 3LA2A 2L4AA 2CJJA 2ADUA 1FOYA 5DUKA 2ELZA 1X4PA 4QSHA 2KZGA 4C2UA 3DTEA 1PKPA 1OJLA 2B7EA 3HOXJ 4QWQA 4EJUA 3QPLA 2LCEA 3R4KA 3TP3A 1MW7A 2M3AA 5K5RA 3EUKL 4RA2A 1X6EA 1IBME 1MMAA 2R7ZJ 5BPIA 1JJ6C 4LG0B 3N97A 3FK7A 2V85A 2IJLA 2XB5A 2WV1A 3CMYA 2DRPA 1YW9A 5E3OA 1BI3A 4EM2A 1IF1A 1MMGA 4TV7A 4Q48A 2RREA 4OMYA 2HWVA 4A3MJ 2YTEA 1FBQA 3AG3H 1ETWA 2EPRA 3F23A 1IDZA 1K79A 1KYWA 1D0ZA 4R03A 4A93J 4FK5C 2BY3A 1QU6A 1X4OA 4EVIA 3MFKA 1MBFA 1ETVA 2ZCWA 5D4RA 5C4JJ 1ZG5A 3PL8A 1FP1D 4F6MA 4XM3A 5ED4A 1ON2A 4ESFA 4IHWA 3DU5A 3E3VA 5F0FA 5LGNA 1GDTA 2FU4A 2EOEA 2PRTA 3I71A 5E3NA 1BC8C 3UKGA 3ADGA 3M3YJ 1GUUA 3DPTA 2ZMEC 2NUFA 2WC2A 4U0VA 3QOPA 3MD2A 4AIDA 3H5NA 5DM7F 1T56A 3NWSA 5AC5A 3WTZA 1OR7A 1J09A 3K69A 5IP6A 3CCRI 2O8KA 1UZCA 2Q1ZB 2ELJA 4JI4E 2BE5F 2BY2A 2R3SA 3CJTB 1ETKA 5AIQA 4J8ZA 4Q35B 1AKHA 1A1IA 2EMCA 2ELKA 1QU3A 1QZYA 3SEQA 1YPNA 4IJDA 2CQQA 2XGEA 1JE8A 1MBJA 4YFNF 2X51A 1R7JA 5GPCA 4O4KA 2LBFA 4XICA 3F8BA 4ETSA 2EQ0A 4G7OF 3R0AA 2E71A 4MQVA 2F5CA 3H9JA 4ZJZA 4UNOA 1MBHA 2K7LA 5HLHA 2O6GE 1YIJI 3BJAA 3M9AA 2M9AA 2JP9A 1R00A 2YTQA 4B3SE 2FOKA 4EJOA 3GLLA 5D5WB 2HVQA 3ZQGA 2HXIA 3T1HE 1JKRC 2E1CA 3HG9A 1XPXA 5FLXK 2HQAA 2EQ1A 2N3HA 2Z9OA 2A6TA 4OU0A 2EL6A 5KL5A 3J7AG 1P6RA 4KT6A 1RESA 3DEWA 2XHKA 2KJBA 1UN6B 3WTTC 2LSOA 2QBYB 5FKLA 1PJTA 1MEYC 2M45A 1SFEA 2JA5J 4XLFA 5TGTA 1I1SA 1N25A 3E0JB 2BHYA 1JTYA 3JSOA 5EGOA 2IAIA 5AC4A 1AKHB 2LY1A 5F0CA 3L09A 2L8TA 3OOPA 3PNVA 1V5GA 3C4TA 3KZZA 3GXOA 1ZU1A 2BHZA 1OFCX 3VHTB 5LD2C 5LRRA 1LE8A 1X58A 2DYRH 1X2MA 4DQ2A 4DV3E 2EM2A 2F5FA 2Z33A 3EPHA 3L2RA 4IHXA 4FX4A 1S8NA 2P6TA 3ABKH 3L2QA 2XF5A 5IY5H 3WU2C 1B1BA 1FX7A 5L3EA 1QPMA 4UHTA 2NS0A 3RZOJ 2R7VA 2L7KA 3ZPLA 1O7FA 4WSPA 3HRSA 4D0PA 3CJNA 1F9NA 2K9NA 3BC8A 2FOWA 3MMYB 3D5SC 3HBLA 4XONA 1N78A 1D1AA 2X9DA 2LKSA 1OCZH 2EMBA 2JT1A 1VQ4I 3OMYA 3TEDA 2VJ4A 3KP5A 3OYFA 2L4MA 4JV5E 2H8WA 1TWAJ 2Y0MA 3RTRA 1FIPA 1FMWA 5DV5A 3SYTA 2UXDE 2W82A 5CLSA 2EFQA 2DB2A 1N32E 3KYLA 2M0CA 1DUXC 5AONA 2Z1DA 3M8JA 3ADLA 5TJJA 3MN2A 2DT6A 3JRIA 4X64E 4MFDA 3WHCA 2FEZA 3TOAA 1HSTA 2CFOA 2COBA 2X85A 4LITA 4NC8A 2MA3A 4UVBA 4WK8F 2Y9ZA 2EWLA 3MEXA 3IWZA 4EM0B 2RNGA 2JPBA 3GFJA 1BJZA 4F55A 5EDNA 4MLQA 4BQQA 2Z16A 3QQAA 2DI3A 2OZUA 4MO7A 4B48A 1MJBA 3REOA 2VQLA 2BV6A 5ERIA 1B72A 2KRFA 4X65E 2HTSA 1YI2I 2NOJB 3IH3A 3O8GA 1GVDA 3SDGA 1YO5C 4L0YB 1I94E 3D5LA 2LUQA 4QPOA 2HR3A 1R71A 2DFEA 3ZQQA 3WU1B 4GEQB 2YTJA 2VPRA 5J1YA 3GVAA 2QQ9A 1ZRCA 1ZG3A 2JVHA 2R7UA 1VQPI 4IQJA 2F4OB 4AVZA 3CESA 1HNWE 4JI2E 3A03A 4A5NA 1Y1WJ 3UR3C 4JI0E 2A69F 5H2FC 4KJZA 1V54H 3RQ4A 4BQOA 5CQGA 1IGNA 4R2RA 1Z3YA 3OTOE 1P4XA 1ON1A 5FD5A 1POGA 1TW2A 3O6BB 3DF6A 5AASA 3ABMH 3K70D 1W5SA 2KRCA 2R5YB 3K9TA 2VJ5A 3R60A 4BJ6C 3TL4X 4TUGA 4LF6E 2F5EA 2YWQA 2VIXA 2L5QA 3TBIA 2WY8Q 1RR8C 4Q47A 3O2PE 3FHNA 2JSCA 3I4PA 3JRCA 2BBYA 1YFHA 2YTDA 1KGSA 5DYMA 2EN3A 3D1NI 2ZNYA 4LD5A 2MLGA 4EQQA 4EEFG 5TSEA 3MKZA 3C2BA 5A6BD 2DJNA 4P1WA 3TQNA 3U1DA 2K4VA 1EKZA 3DPUA 5EEGA 4CZCA 2OAZA 4BUPA 3EDPA 3KEYA 3FHZA 4EV0A 3F8NA 4WX9A 4PJMA 3L00A 1K4TA 2EMXA 2MC5A 2F6CA 1LB2A 2LMZA 2BZTA 3S3NA 4CXFA 1VTNC 1G3TA 2LOOA 3P9IA 1IZ1A 4IXAA 3JAMC 3PUFA 3S2DJ 2J7JA 1XCBA 1B59A 3JU0A 3F21A 3RZDJ 1IQOA 3CQZJ 3VSKA 4H4KC 2HDCA 2DDAA 1TL8A 1SVOA 1JGSA 4XLNF 3L2VA 1X5WA 3ZMSA 4RHBB 2ZSHB 1X19A 3MZYA 3IP4B 3L2CA 4JOMA 2V6EA 1ZBTA 2R7OA 2W84A 4PSXA 2YRMA 3PQKA 4ZZLA 3DBLB 3RCOA 2F4IA 2DTRA 2EFNA 3K4LA 4HYEA 4IO9F 3CP2A 1RC7A 1MH4A 3FKJA 4S05A 3KP4A 3WU0A 1MNEA 3FF5A 4XK4A 4DV5E 1TWGJ 2VXDA 3DKWA 2EOYA 1XGMA 4IX7A 2LKPA 1FMVA 2KP6A 3C7JA 3HYIA 2MLKA 3CUOA 2MG4A 2PN6A 5E18F 3BBGA 2NUGA 5EZGA 1JUMA 2EV5A 1BA5A 2H6CA 2L7ZA 3ZR8X 3VODA 1IN8A 2IGKA 4B3RE 3D5RC 1Z91A 3BR0A 3E7LA 4CCOA 2CMPA 3K4KA 1YG2A 2MC6A 3WE3A
chains in the Genus database with same CATH topology
1BN5A 4HF2A 2HOEA 2M30A 4KIGA 3JAMK 1IN4A 4JQFA 5BS6A 1R1UA 5AIPA 1LDKB 2OQRA 2PI0A 1QO0D 1G4DA 3RKXA 3W6JB 3MQ0A 4GGGA 2Q2EA 3ZMDA 2O3FA 2DFIA 2A6EF 1USTA 3SXYA 4G8XA 2F2EA 3DFGA 4IHSA 4KA4A 4YIIA 4UV9A 1MJ9A 3GEZA 1TBXA 1FYKA 1TNSA 4P55A 1OYIA 3WTWC 3M7GA 1O3RA 4OIQF 3RI4A 3FM5A 1PP7U 1FC3A 1RZ4A 3HSRA 5JI6A 2D45A 1U5TB 1K7AA 2HEOA 4RB1A 4KMFA 2L02A 4LG0A 1P4WA 1IN6A 3R0JA 4XSXF 4CHUA 1FPQA 4H0EA 1BIBA 2EFPA 3QU6A 2UWMA 3CO7C 4P9FA 3DQVC 2FMLA 4BXUA 2L01A 1HKSA 4R8HA 4LK0F 1EH6A 3VFZA 3IKVA 1YTYA 2A61A 4PGGA 4A0YA 1MJAA 2CGPA 2CO5A 2QQBA 3I59A 3K0LA 5CJ9A 4ESBA 3T8RA 2QYOA 1E2XA 5DDGA 4EMSA 1I5ZA 3I0TA 4A0XA 2EA4A 5HDGA 4LLLA 4HV6A 5LHHA 3WTUC 5F1RA 3F22A 2VBYA 2BGCA 1RI7A 3IKTA 1BI1A 2FF4A 2DK8A 1FNNA 1BM9A 3HUGA 2FBKA 4CZZA 3G3ZA 1KQ8A 4IRIA 2O03A 2OA4A 5HLGA 4MEXF 2P6SA 3L7WA 2YX7A 2PBIA 4KT5C 5DEQA 1Q1HA 4G7HF 3FWEA 4M9XA 3P9KA 4WF2A 4Q4ZF 3ABTA 3ZN0A 2RQPA 3J81Z 3LA7A 2MH9A 5DD4A 3E5UA 2CYYA 2KJCA 2RVCA 2PQ8A 4PCQA 1DDNA 2WTEA 3IL2A 1J7KA 3HTUA 4QLCU 1FYLA 4O5VA 1E17A 1BI0A 4AIKA 1R36A 2OD5A 3ERED 1HXDA 1QBJA 2IPQX 4LMYA 2XGXA 3KP7A 4AD9A 2COMA 4EGZA 1FLIA 3I64A 1ZHFA 4MTEA 2P8TA 2V79A 2B0LA 2Q8KA 1IUYA 2ZKZA 1R1VA 2DPDA 4Y17A 4LB6B 3WTYC 2NYXA 2XAJA 4FX0A 1XMKA 4HZFA 1MD0A 2ZXJA 1GVJA 2RNJA 1HBXG 2VBXA 3GF2A 5JVTA 1G3WA 4KNYA 3GUDA 1Z7UA 5BMZA 3KZYA 1FZPB 1TQMA 1W5TA 2GXBA 3J80K 1ZREA 4I0AA 5L3GA 5H6QA 4B8XA 1GHCA 4RGXA 2M8EA 1I27A 2RC4A 3BJOA 2ZJ2A 4GO1A 2A68F 3G73A 4N9IA 4BNCA 3RIRA 5ICFA 4OMZA 4ON0A 2QWWA 1IXCA 5LBQA 3ZN1A 2LF8A 5L3BA 3HOTA 3EYIA 3E6DA 2X4HA 3M8EA 4ENNA 3SHFA 1P2FA 3QP6A 3ECHA 5FD6A 4RAZA 5KVRA 4BHCA 4HW0A 5TRDA 3C18A 3DPLC 3TGNA 2D1HA 5E17F 3RPQA 1YW7A 2ACJA 1MZBA 4U0WA 1FP2A 2K4JA 4HDVA 1J0RA 3BPVA 2EB7A 1OYYA 2G7HA 5E1WA 1HW1A 3BROA 1SFUA 5CYVA 3J80Z 4G6QA 1ZRDA 5ILUA 1JXSA 3E6CC 2XAHA 2MBFA 1ULYA 3HHGA 4G94A 2R7DA 3BZ6A 2XIGA 2RGVA 4MHGA 3K1NA 2GWRA 3F8MA 1T38A 2NAZA 4P5OA 4NQWA 2IA1A 4A2UA 1R23A 4AIJA 2OU2A 5E20A 1KU9A 2E7WA 1S7AA 1USSA 1KQ0A 2VOOA 3QPTA 1TLHB 2VT2A 5EEHA 1Z1DA 3K1PA 3SZPA 4KICA 1Y0UA 1BJAA 2NNNA 4NHJA 3Q5FA 3P7NA 4M9ZA 2FMYA 3I59B 1W4MA 4ESJA 1U2WA 2PFBA 2Z3YA 5HOOA 2XKPA 2K02A 3LWFA 2DQLA 4L9TA 2G7UA 5FGMA 4IRHA 4A6DA 3JAMZ 4M73A 2ZMEB 3BWGA 3RKYA 5K5QA 3H92A 4FT8A 1X3UA 3FXUA 4G7ZF 2P7VB 1EH7A 1XGSA 3TO7A 2E1NA 2W24A 1XSDA 2IW5A 5DD8A 1K6OA 2BYVE 2DLLA 2J5OA 3BJ6A 1IAWA 2YX4A 1RIOH 3JTHA 4M9SA 2EWNA 3R6SA 4S04A 1ODDA 1QGPA 3B73A 4CICA 2E7XA 2FNPA 2MD5A 1P92A 4B09A 2PMHA 3ZP5A 2FNAA 5DCFA 3KETA 3BP8A 3GZ6A 1KU3A 3QPHA 3ZMVA 3IRRA 2QENA 3F6VA 1B9NA 3KEOA 2DU9A 3CUQA 4EJWA 1HQCA 1LEBA 5FO5A 4R1HA 2TDXA 2FXAA 4CGZA 2DT5A 1ZN2A 5H6RA 4UVAA 2IT0A 2J5PA 1CF7B 5J6XA 3T5XA 4Z2YA 2ESNA 2XRNA 3RYRA 4OIOF 4U7BA 1O3SA 2CG4A 3ML6A 5HLIA 4L18B 2AXLA 2HKXA 2A6HF 1ZGAA 3Q9VA 3GYHX 4ENJA 3HTSB 5ICGA 3ECOA 2FQ3A 5BOXA 1S6LA 3MAJA 2XKOA 3BDDA 4EJVA 4HOBA 4HLYA 1G6NA 3CTAA 1O7LA 1O57A 1ZAOA 5HS7A 3MWMA 5L3DA 1J9IA 4P96A 3L9FA 2V6CA 4PDKA 2M5WA 3T1BA 3H3UA 1UB9A 4O6JA 2VOPA 3E6BA 5LRSA 4KDPA 1U6GA 4YG2F 4A6EA 1BIAA 2XASA 2A3SA 4YFKF 3RDIA 4U7DA 2EV0A 3DF8A 1CF7A 1AWCA 1SAXA 2YU3A 3LAJA 2XVCA 2PLYA 1TW3A 3WTVC 1QQIA 1ZLJA 1XGOA 1XMAA 4BHBA 4AVPA 4HLXA 4U88A 2M87A 2H6BA 1LDDA 4IPAA 1K78A 5D6FA 2STTA 1MDMB 3WGGA 4LK1F 1SMTA 2HFHA 2AS5F 1F5TA 3COAC 2JRTA 2VBZA 3V7CA 3F6OA 2CQKA 1V4RA 5FLXZ 4ZYGA 1I1GA 2O8XA 4OINF 2QLZA 4G9YA 4ENKA 3MCZA 2A5YB 1ONVA 3TDZC 3T0YA 1DPRA 3HIFA 3LFKA 2IRFG 4XLPF 1TNTA 4MEYF 1EH8A 5FFZA 1KU7A 2IP2A 2LF7A 3R61A 1D8JA 3V7RA 5FFXA 4HAMA 1U5TA 3U2RA 1K78B 3SZTA 3CUQC 1XDSA 3NRVA 2UZKA 3TO9A 2GXGA 5HVQC 1H9GA 1R58A 3DV8A 1SD7A 1WI9A 1MDMA 2FRHA 5D6EA 4XSZF 2XUBA 4GYIA 3KP6A 3WG9A 3WTXC 1WWXA 1R1TA 2H94A 4BHPA 2VONA 3D0SA 1ZLKA 4HX7A 5IT9K 1H9TA 4NB5A 2C6YA 3LQQA 1H0MA 2QUFA 4M6XA 2QM3A 4RAYA 1O3QA 3W6KB 2P5KA 3FZVA 2CSOA 2QBYA 1UFMA 4CO8A 3O3KA 3GX4X 1PDNC 2ZFWA 1UCRA 1FBUA 2ZNZA 4KIBA 1G3YA 1TQPA 4KMUX 4E70A 1J5YA 2XAGA 2FBIA 3F8CA 3DXJF 3HOSA 1HW5A 4WXHA 3FM3A 5BPDA 2GA1A 4I0BA 2ISZA 2HGCA 4KYWA 2FA5A 4PGHA 3BY6A 3I54A 1DP7P 1GXPA 1FT9A 1YS7A 5BQTA 3C1DA 3V8KA 2JZYA 4LFUA 1IRFA 4FHTA 1QNTA 4I2OA 1LDJA 4M72A 4EM1A 2IVMA 5HS9A 3GO5A 1LVAA 2VE9A 1YIOA 1LNWA 2GA2A 2DO7A 4KN4X 1NHAA 4RB0A 1XSXA 3KP2A 4IRGA 2ZMEA 2D2WA 2EA2A 1XGNA 5E1XA 2DW4A 4EJTA 3JW4A 2A07F 1KA8A 1D5VA 5D8KB 4RS8A 5IT3A 1IRGA 1REPC 2FBHA 2VXZA 2XAFA 3SQNA 3FMRA 1PUEE 2ELHA 1PP8F 3EYYA 2EK5A 1LEAA 1SFXA 3E6MA 1R5GA 4Y15A 4HF0A 3AAFA 2HZTA 3ZMTA 2DPUA 3RYPA 4UV8A 1D8KA 3ULQB 2KKOA 1OYWA 2D1VA 4LGWA 2HTJA 5L3FA 1G3SA 4DNCA 1MGTA 5DCMB 4G6DA 4R79A 4HX8A 2VODA 4ZYDA 4O3MA 2CFXA 4CDGA 4MNUA 2GAUA 3JSPA 4A0ZA 2F5DA 4F7ZA 2NRAC 2DQRA 3K1MA 5JHUA 3CDHA 5DCMA 4RGUA 3TKYA 5HDNA 1ZG1A 1YLFA 3M1EA 2RN7A 2EJRA 1BOAA 3WGIA 4ZYEA 1R5HA 1J75A 3V8JA 5ILSA 2WWYA 1W7PA 1U78A 3GLXA 4ZYHA 3N4MA 2GIVA 2KIUA 2BEOA 4CYDA 2DK5A 2HYGD 2HS5A 2FE3A 4IF4A 3PFIA 4I7HA 2RDPA 1RUOA 4RB2C 4XBFA 2JPCA 1IN7A 1T39A 4PZJA 2W25A 2LNBA 1S3JA 1HW2A 4RB3C 3HRMA 3WODF 2NNYA 3EUHA 3VEPA 3KLNA 3KCCA 3V8LA 1OKRA 5J8FA 2PMUA 2V1XA 3HSEA 3P9CA 1T0FA 4HA8A 2MC3A 1RUNA 1BC7C 3EETA 4HV5A 1P4AA 2OQGA 3VOEA 1XD7A 4U0YA 4HX4A 1IXRC 2Z99A 1BI2A 4AIHA 2VC1A 4HQMA 4ZZDA 1V3FA 1YW8A 3TO6A 4L9JA 3WTSC 3GFMA 2P7CB 3S2WA 5ILVA 2QZ8A 4ASNA 3LAPA 2KIMA 1Z9CA 4MGRA 3CUQB 4L0ZB 2HQNA 3ISPA 2W85A 3E5XA 4IJAA 2PEXA 1J2XA 2H27A 1XSVA 2OBPA 4A12A 2V1UA 3H3ZA 4OIRF 5CVUA 2K27A 3FXQA 1HSJA 4GCVA 4L5IA 4ZH4F 3ELKA 1J59A 2V1DA 4WCGA 2STWA 3V4GA 2ETHA 2VBWA 1TQIA 1XCVA 2KIFA 3LQRA 4L9VA 4JK1X 5LHGA 2W57A 1U3EM 1FWZA 3I5UA 3OV8A 2WV0A 4HQEA 2GQQA 4UUVA 5E8IA 2M1BA 3DEUA 4IVNA 1ZRFA 5H20A 3GZ5A 1IW7F 1FBSA 3U9GA 4Q5SF 1KYZA 1YS6A 1L3LA 1L0OC 3KE2A 3HRUA 5LEJA 5KK1A 1GXQA 2G9WA 3GWZA 2K4BA 1B4AA 4HF1A 1U8RA 1WKMA 3DP7A 4KFCA 3FX3A 1I6XA 2XV4S 5IT9Z 3I58A 1JHHA 1BBYA 2ESHA 4N9HA 3JTGA 4L9NA 4XRFA 2HYFA 2DBBA 1UHMA 2LDUA 3FMQA 4I01A 1FY7A 2VC0A 3HSFA 1A04A 4LJZF 4I02A 4MQ9F 1HKQA 1ZGJA 5LGTA 4YFXF 1LQ1A 1ZYRF 1T2KA 4GYGA 2EFOA 1EV7A 1W7PB 4A5MA 1STZA 2VT3A 1SD6A 1U5TC 2L3DA 5HS8A 1WSUA 3RJPA 4KUMA 4P9UA 1UHWA 1C0WA 2VE8A 3GFIA 2PJPA 3FXRA 3ABUA 3LA3A 4WXDA 4K2EA 4HDUA 3T8TA 3PQJA 4AWXB 2OZ6A 2P5VA 2IA0A 4UVCA 3KEQA 5F6FA 5D4SA 2L54A 5ICCA 1SD5A 5D5XB 2PG4A 3IWFA 1S29A 3NEUA 2YPRA 3LSTA 1Z6TA 1XB4A 3K2ZA 1B9MA 1R22A 4BYYA 5ICEA 5CVJA 2O61A 1XN7A 4LLNA 3RKWA 4I09A 3IRQA 5JR3A 2QVOA 4KIFA 1OMIA 5CVIA 4LB5A 4IHTA 1YQAA 3WE2A 4Y13A 3WGHA 5E1ZB 3QP5A 2R7FA 3BPXA 4EGYA 3B02A 2ZBKA 2XAQA 4OOIA 3GFLA 1KU2A 5LHIA 4MTDA 1DPUA 1TTYA 3CLOA 3V7SA 1T98A 3FMSA 4UXNA 3C3WA 4BH9A 3TDUC 2CW0F 3F3XA 4I98B 5LEKA 4LLGF 1YYVA 3M8FA 1JHFA 4WWCA 2V9VA 2EFWA 1WQ2A 4RGSA 5D5UB 1FSHA 5E8GA 3I53A 1WRJA 1AOYA 3RPUA 5LGUA 3BOQA 5D5VB 2EV6A 2RV8A 5DUIA 1IXSB 1QZZA 4M71A 3F8FA 2QQAA 4YIFA 3Q9SA 3ROUA 2Y48A 1Z05A 3QAHA 3HRTA 4KN7X 3QRFF 3ZQ7A 4N0BA 5K5OA 1LJ9A 1KQ9A 3NQOA 4BQAA 5A2QK 2FSWA 1F4KA 3SFZA 5CVVA 1T6SA 2CWEA 2ZO4A 2P5LC 1RNLA 2X0LA 5J8CA 3MZHA 4BAYA 3CO6C 6PAXA 1W7PD 1IN5A 1F1ZA 4HBLA 5HDKA 2Z5UA 3KP3A 1SMYF 2Q0OA 2K86A 2RKHA 4RGRA 1FYMA 1ZARA 5K1YA 1ZH5A 2HKOA 3KLOA 2UXXA 2YR2A 3J7AO 4JBAA 2YSRA 2P4WA 4WXCA 2XROA 4L5JA 2MH2A 4OIPF 5FB2A 3HHHA 2GZWA 2H09A 4M6YA 4ENMA 3J81K 1FSEA 1CGPA 3E5QA 2DAOA 1Z6RA 5JFRA 1XDUA 2JTVA 1OPCA 3EQLF 3IC7A 2UXNA 5D8LB 3GW2A 3E97A 1S7OA 4M74A 4GXOA 2VN2A 1SD4A 3VB2A 1HKTA 1O3TA 1MKMA 5L3CA 3KFWX 3ZMZA 2ISYA 3IHUA 5CVRA 3F72A 2HQRA 3TOBA 3QU3A 5LLQA 5A2QZ 1FOKA 1B6AA 2Y75A 1D3YA 5F64A 2IA2A 3ZMUA 2O0YA 3LA2A 2L4AA 5DUKA 2ADUA 4QWQA 4EJUA 3R4KA 5K5RA 5BPIA 4LG0B 3N97A 2IJLA 1YW9A 1BI3A 4EM2A 1IF1A 4TV7A 4Q48A 4OMYA 2HWVA 1FBQA 3F23A 1K79A 1KYWA 4EVIA 3MFKA 2ZCWA 5D4RA 1ZG5A 1FP1D 5ED4A 1ON2A 4ESFA 3E3VA 5LGNA 2FU4A 3I71A 1BC8C 3DPTA 2WC2A 4U0VA 3QOPA 3WTZA 1OR7A 3K69A 2BE5F 2R3SA 5AIQA 1QZYA 1JE8A 4YFNF 1R7JA 3F8BA 4ETSA 4G7OF 3R0AA 4MQVA 2F5CA 4UNOA 2K7LA 5HLHA 2O6GE 3BJAA 3M9AA 1R00A 2FOKA 4EJOA 5D5WB 2E1CA 5FLXK 2Z9OA 4OU0A 1P6RA 2XHKA 2KJBA 3WTTC 2LSOA 2QBYB 2M45A 1SFEA 1I1SA 3JSOA 3L09A 3OOPA 3KZZA 3GXOA 5LRRA 4DQ2A 2F5FA 2Z33A 4FX4A 1S8NA 2P6TA 1B1BA 1FX7A 5L3EA 1QPMA 4UHTA 2NS0A 3ZPLA 1O7FA 3HRSA 4D0PA 3CJNA 1F9NA 2JT1A 3KP5A 2L4MA 2Y0MA 3RTRA 5DV5A 5CLSA 2EFQA 1DUXC 5AONA 5TJJA 2FEZA 3TOAA 1HSTA 4WK8F 4UVBA 2MA3A 3MEXA 3IWZA 4EM0B 2JPBA 3GFJA 2DI3A 2OZUA 1MJBA 3REOA 2BV6A 5ERIA 2KRFA 2HTSA 1YO5C 4L0YB 3D5LA 2HR3A 3WU1B 3GVAA 2QQ9A 1ZRCA 1ZG3A 4A5NA 2A69F 1P4XA 1ON1A 5FD5A 1TW2A 3O6BB 1W5SA 3K9TA 3R60A 2F5EA 4Q47A 3O2PE 2JSCA 3I4PA 2BBYA 1YFHA 1KGSA 5DYMA 2ZNYA 4LD5A 2MLGA 4EQQA 3TQNA 3U1DA 5EEGA 2OAZA 3EDPA 3FHZA 4EV0A 3F8NA