1T38A

Human o6-alkylguanine-dna alkyltransferase bound to dna containing o6-methylguanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
151
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPSHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(6OG)P*CP*TP*AP*GP*TP*A)-3'
total genus 32
structure length 151
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t38A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t38A01
3RTRA 3FM5A 1J59A 1F9NA 2VXZA 1IN4A 1TNTA 3WTXC 3JAMK 2UXXA 2Q8KA 2EV5A 4CICA 1AOYA 4M9ZA 4LB5A 2Z5UA 2P6SA 2QENA 4LLGF 4EVIA 1I5ZA 4JQFA 5E1ZB 3M7GA 4EJVA 2KRFA 3BJ6A 1IXRC 5DYMA 2ZCWA 3I71A 4I2OA 1MJ9A 3F6VA 2FBHA 4EMSA 4UV8A 2ADUA 4BNCA 2XV4S 2W57A 1FLIA 4ZZDA 2GXBA 2W24A 2VBYA 3O6BB 4QWQA 1YS7A 2P6TA 5LLQA 1T39A 4O3MA 2STWA 3ZMUA 3I58A 2DBBA 5EEHA 5D4SA 1MJAA 3G73A 2OZ6A 3U2RA 4RGUA 5FO5A 3WGHA 2XRNA 1TQMA 3DF8A 2XKOA 2D1VA 1TW2A 3ZN1A 3TOAA 3JTHA 4XLNF 5E17F 4L18B 2VE8A 4ZYGA 5HS9A 1QNTA 1SMYF 4RB2C 1DP7P 3RYRA 1FT9A 2H27A 2RKHA 3J80K 1RZ4A 1KQ0A 4UVCA 4U0YA 4KN4X 4HLYA 2IVMA 3TQNA 1Z1DA 2RVCA 4GYGA 3LA3A 3H3UA 1RUNA 1USTA 4A6DA 1QBJA 5IT3A 4CDGA 1IRGA 3I0TA 2F5FA 2DPDA 3H92A 2LF8A 2HOEA 5CVJA 4LJZF 1FYMA 2R3SA 4YIFA 4KIBA 1BJAA 3V8LA 4U88A 3DV8A 5E20A 5LHIA 1LJ9A 4EGYA 1BIAA 3V7SA 5H6QA 1ZRFA 2O61A 2X4HA 1O7FA 3RJPA 5HLIA 1R7JA 3IKTA 3BOQA 4A5NA 2D1HA 1JXSA 2XVCA 3CO7C 1OYYA 2VC0A 3PQJA 4LD5A 3ZQ7A 2LKPA 4EM2A 5CYVA 3ISPA 5KVRA 2EFWA 5L3DA 4WK8F 3LWFA 1QZZA 4EJTA 5HOOA 1EH8A 2CW0F 3HRTA 3KCCA 3U9GA 1FBQA 2BE5F 4MTDA 2ACJA 3GWZA 5DD8A 5DEQA 2XAJA 1SFXA 2GA1A 1ZAOA 1LQ1A 4HF2A 4R79A 2IRFG 4RGSA 1AWCA 2K02A 1BM9A 2L4AA 4ESJA 4A6EA 3KP2A 3AAFA 1O57A 3F72A 1WKMA 4IHTA 5E8GA 1BIBA 3F23A 2VT2A 2VBXA 3TO9A 2DK8A 2HR3A 2Y0MA 2STTA 5HLHA 2GIVA 1OPCA 1IXSB 2WTEA 4ZYEA 4IRHA 1TQPA 2OD5A 4HQMA 2EB7A 1IN8A 1K79A 3FXUA 1P92A 3F21A 1YO5C 5IT9K 1GVJA 2HQRA 1XGMA 2A6HF 2VN2A 1H9TA 1FP1D 3BWGA 2G7HA 4IRIA 5CVUA 3MCZA 1T0FA 3GX4X 3HOSA 2VBZA 4OIPF 4BQAA 5KK1A 3ZMSA 4LGWA 1R23A 3HRMA 3SHFA 3W6JB 1Z91A 5HDNA 4WX9A 2OA4A 5D5XB 1O3RA 3FX3A 4M6YA 2E7WA 4LB6B 4XRFA 2ZMEA 3C3WA 2MBFA 1R1VA 2FF4A 3GZ5A 1XCVA 4ESFA 3DQVC 3WGGA 2PBIA 3E6DA 5L3BA 3WTVC 3RKXA 3V8JA 1WWXA 3Q9SA 5ICFA 2O0YA 3ELKA 4BHBA 4N9HA 3GVAA 1R1TA 4MEYF 2CSOA 2P5VA 2FNAA 4NQWA 4I09A 3QOPA 3SZTA 3QP5A 5D6FA 3KP4A 3KP6A 1OYWA 2W25A 2Y48A 3LFKA 2H09A 4ENNA 1B9NA 4B8XA 3ERED 1ZGAA 1TLHB 2QLZA 5F64A 2PEXA 1Z7UA 2A07F 4E70A 2A61A 5BMZA 1QO0D 3I5UA 1ZREA 1J7KA 4L5JA 5LHGA 2G9WA 4M71A 1IUYA 1XMKA 1J9IA 4HA8A 1F5TA 3HUGA 3BP8A 1NHAA 5BPIA 2WWYA 1IAWA 2HDCA 1T6SA 1XN7A 1P4XA 3E97A 2EV6A 2F5CA 2NAZA 2ZJ2A 3BDDA 2P5KA 2F5DA 1U78A 2OQRA 2YU3A 1RI7A 3O2PE 1P4WA 1XSXA 1IN5A 4IPAA 1R22A 3EQLF 1LDDA 4G7ZF 4HF0A 3WG9A 2EA4A 3I54A 4L9VA 4LK0F 5LEJA 1XSDA 4EGZA 1R36A 2ZKZA 3ROUA 2X0LA 4WXCA 3COAC 2ZBKA 4DQ2A 4CYDA 1ZH5A 2IA2A 3WGIA 4Q47A 2ETHA 2VC1A 3E6CC 3HSFA 4QLCU 2G7UA 2NNNA 1OR7A 3LQQA 1FOKA 5FGMA 3BROA 3C7JA 3REOA 1QZYA 1Z05A 2MH9A 2MH2A 4IF4A 3FWEA 4I01A 5D5VB 3Q5FA 2DLLA 2JPBA 2BV6A 3CUQB 4RGXA 4RS8A 1SMTA 3U1DA 1QGPA 3T0YA 2RV8A 1U5TC 3NEUA 2ZFWA 3E3VA 3BY6A 2XUBA 1IZ1A 2YPRA 4ZYHA 1PP8F 3GUDA 3IKVA 4HV5A 4ZYDA 5ILSA 2DI3A 2AXLA 3CUQC 1U3EM 2VODA 3J81Z 3E6BA 4R8HA 1U2WA 3EYYA 4GO1A 5FD6A 3D5LA 3HTSB 1ZLJA 3C18A 1KA8A 1MDMA 4HOBA 1S7OA 4GCVA 1USSA 4LK1F 4P5OA 5FFXA 4ENKA 1ULYA 3ZP5A 2H94A 4M6XA 2KIFA 1BI3A 1FP2A 1ZG1A 3RPUA 1FYLA 3IRQA 2JT1A 4KMFA 1FPQA 4Q4ZF 4LMYA 3HTUA 3TKYA 2IA0A 1CF7B 5ICCA 1SD7A 4FX4A 3TDUC 4HZFA 5H6RA 3WTZA 3GZ6A 3FM3A 3TO7A 1W5SA 1W5TA 2XASA 3L9FA 1HQCA 3WTUC 1QQIA 2P8TA 3WTWC 2CQKA 3R6SA 1S3JA 3KP3A 5ED4A 3T1BA 5HLGA 4HQEA 3E5XA 3GFLA 3NQOA 5BOXA 4NB5A 2RN7A 2VOOA 1HW1A 4BXUA 3ECOA 3K1MA 2QQBA 1FX7A 1KGSA 5A2QZ 1H9GA 4M9SA 4HYEA 3B73A 4EV0A 1HKSA 5HVQC 3WU1B 1S8NA 2XAHA 5K5OA 1O7LA 3E6MA 5L3FA 3WE2A 2HZTA 3I4PA 3M8EA 4CZZA 2JTVA 4OIRF 5J8CA 1SAXA 4OMZA 2IP2A 2W85A 4L9JA 1OMIA 1W7PD 1HKTA 1K6OA 1Z6RA 2IPQX 1XD7A 1IXCA 1DPRA 5A2QK 2A3SA 4UVBA 1MD0A 1FYKA 2KIMA 2RGVA 4I02A 2ESNA 1KYZA 3L2CA 2RQPA 1EV7A 1I1GA 1MKMA 3I64A 3HYIA 2XAFA 4ZH4F 5AONA 3VOEA 5DCMA 4MNUA 1J0RA 5LGTA 2EFPA 2Z9OA 1ONVA 4M74A 5L3EA 4UVAA 3TOBA 5FB2A 3RPQA 3RKYA 2HTJA 2V9VA 2HYFA 1SD6A 5D8KB 3N97A 4YFXF 1SFEA 2FMYA 1KYWA 3DPLC 3V8KA 4S04A 1HKQA 5LRSA 4OU0A 2IJLA 4CXFA 4A12A 2FNPA 3E5UA 4U7BA 2CGPA 4FHTA 1R1UA 2QWWA 4AIJA 2HGCA 5CJ9A 2JPCA 1Y0UA 4HX4A 3ZMDA 1XGNA 2FE3A 1F4KA 2PMUA 3DFGA 4KIFA 1QPMA 4AVPA 3I59A 2FSWA 4KDPA 2XHKA 1ZARA 2D2WA 4L9TA 1B59A 2XAGA 4PCQA 4G7HF 3EDPA 4S05A 2C6YA 2MA3A 1V4RA 4MHGA 2L54A 2KIUA 4Y13A 2NYXA 3KZYA 3SZPA 2O03A 1L0OC 3T8TA 2ZNZA 4M9XA 3CDHA 4N9IA 2WC2A 3RYPA 3GFJA 2M45A 3JW4A 2A6EF 5HDGA 4M73A 1R5GA 2DQLA 1HBXG 5DCMB 1B9MA 1RIOH 4EM1A 2F2EA 2ESHA 5FFZA 3SQNA 2Z33A 3R4KA 2FRHA 2NRAC 1FBUA 3KEQA 5LRRA 3PFIA 4UHTA 3LA7A 1GXQA 4MEXF 3EYIA 4P9UA 2HYGD 3J7AO 5E1XA 3ECHA 1TNSA 3ABTA 4Q5SF 1YLFA 3T5XA 4HX8A 1LNWA 1KU3A 5DV5A 3S2WA 2JRTA 3CJNA 4F7ZA 5L3CA 4EJOA 4XBFA 3NRVA 2XROA 1ZG5A 4WWCA 4UUVA 1TQIA 4IHSA 2E1NA 5JI6A 4Z2YA 2ZXJA 3R0AA 3QRFF 2DU9A 5L3GA 2B0LA 3L09A 4XLPF 3KZZA 2QYOA 4MQVA 1YFHA 3ZMTA 2FMLA 2QQAA 1I6XA 3Q9VA 3F8MA 5CVRA 2UXNA 5FD5A 4LLLA 1YW7A 2K7LA 2DT5A 1ODDA 3HSRA 5JFRA 4EQQA 2P5LC 1G3TA 3M1EA 4GGGA 3JSPA 4G9YA 3P7NA 5ICGA 3EUHA 1BI0A 2MLKA 5J6XA 3FHZA 2KKOA 1EH7A 4R1HA 5DDGA 3C1DA 4ENJA 3B02A 2YSRA 3RIRA 2JZYA 3DPTA 2XKPA 1KU9A 1B4AA 4L0ZB 1P2FA 1E2XA 4BHCA 5J8FA 2GA2A 1O3SA 1SFUA 2EV0A 1FSEA 4BAYA 1XB4A 4A0XA 2QBYB 1BC8C 1BN5A 3K1PA 2ELHA 4WXHA 4BYYA 4OOIA 3K69A 5DUKA 4IVNA 3WE3A 4OMYA 1L3LA 1T98A 2J5PA 2O8XA 2EWNA 3ZMZA 2XAQA 5BQTA 1U5TA 3H3ZA 2IW5A 2HQNA 5DCFA 4KFCA 5DD4A 4MGRA 4DNCA 4B09A 3K0LA 2M87A 1KQ9A 2LNBA 2QQ9A 3MFKA 2JSCA 1T38A 1Z9CA 1FNNA 2L3DA 4I98B 2OQGA 5H20A 2HS5A 1REPC 4GXOA 2EA2A 1JHHA 2XGXA 3MEXA 3SXYA 4A5MA 2QM3A 3KLOA 2FA5A 3JSOA 3HOTA 4KYWA 1ON2A 4LG0B 3KP5A 2M8EA 1W4MA 1J2XA 1G3YA 3LAPA 4YG2F 1HXDA 2QVOA 4O5VA 1F1ZA 2GAUA 4UV9A 4XSXF 5AIPA 1E17A 1HSTA 4HX7A 2BEOA 3IWZA 4BHPA 2VOPA 3K1NA 2LSOA 2M1BA 3CTAA 2V79A 4H0EA 2YX4A 4WF2A 3IL2A 1G6NA 4PDKA 3R60A 1WRJA 4PGGA 2KJBA 2DO7A 2D45A 2PN6A 4L5IA 4LG0A 5FLXZ 1HSJA 4G6DA 1ZRCA 3GFMA 3QU6A 4JBAA 1J5YA 4ASNA 4HAMA 1FC3A 2V1DA 2RC4A 1UB9A 5DUIA 1JHFA 4BH9A 5ICEA 1BC7C 3JTGA 1HW5A 4FT8A 1MDMB 1IN6A 2P7VB 3FMRA 2F5EA 2HWVA 3P9IA 2EJRA 3KFWX 4YFKF 3HSEA 3FF5A 5EEGA 5F1RA 2HKXA 4FX0A 1XCBA 3ML6A 6PAXA 4XSZF 3M8FA 2PLYA 5AIQA 1RNLA 1LB2A 3QP6A 3RI4A 1PDNC 3P9CA 2YR2A 1BI1A 2E1CA 4HDVA 3LSTA 3FMQA 3CO6C 1B6AA 3F8FA 3J81K 1S6LA 5ILUA 2KJCA 4WCGA 1B1BA 1G3WA 4AIHA 4TV7A 2QBYA 1XGOA 3E5QA 1LEAA 1UHMA 1P6RA 1P4AA 1UHWA 3HIFA 4AD9A 2R7DA 3K9TA 1W7PB 4JK1X 4KMUX 2L02A 3CUOA 3RDIA 3JAMZ 4ON0A 5LEKA 1WSUA 4Q48A 1U6GA 1R5HA 4HF1A 5CVVA 5TJJA 2DW4A 1YW9A 2J5OA 1S29A 3GLXA 1ON1A 1OKRA 3L00A 3V7RA 1Q1HA 3WTYC 1XMAA 3I53A 2VE9A 1H0MA 1IF1A 3J80Z 4I0BA 1YTYA 2Y75A 3K2ZA 1DPUA 2IT0A 2BBYA 4ESBA 4N0BA 2DTRA 2P7CB 3ABUA 4PZJA 1MZBA 3BZ6A 3OOPA 1K7AA 2COMA 5D4RA 1UFMA 1ZN2A 3F8BA 3CUQA 2EK5A 5CLSA 1WI9A 4KICA 3QAHA 1KQ8A 2YX7A 2Z99A 3VODA 4YIIA 2A5YB 1FZPB 2MC3A 3BPXA 1CGPA 5K5RA 3SFZA 2EFOA 2EFQA 3MZYA 1K78B 3R0JA 1R58A 2LDUA 3KE2A 4G94A 1I1SA 2HKOA 4I0AA 2FBKA 4LFUA 1YG2A 2DQRA 2GWRA 2V6CA 3GXOA 2WV0A 3TDZC 2K27A 1GXPA 1ZLKA 1U5TB 2A69F 3FXQA 3ZN0A 5CVIA 4O6JA 3DKWA 3W6KB 1PP7U 1YYVA 2Q2EA 5ERIA 2EFNA 5TRDA 2H6CA 3IWFA 5K5QA 4HLXA 1J75A 1EH6A 1C0WA 4U0VA 4PGHA 3ZMVA 2PI0A 2RDPA 1XGSA 3DP7A 5F6FA 1MJBA 3BJAA 2M5WA 2TDXA 2DFIA 2ZO4A 2K86A 1STZA 3M9AA 3IRRA 2UWMA 4UXNA 1T2KA 4I7HA 3MAJA 1YW8A 5E8IA 4EJWA 2CO5A 4HV6A 4A0YA 4MQ9F 3WU0A 3I59B 2M30A 4EJUA 2V1XA 1W7PA 3WODF 3VB2A 1X3UA 4OIOF 4AIKA 1TTYA 2O3FA 3KP7A 4RAZA 2VBWA 1G3SA 3G3ZA 3ULQB 3GF2A 4HBLA 3QPHA 3VFZA 4ETSA 5D5UB 2IA1A 1ZYRF 3BJOA 1OYIA 4G7OF 1ZG3A 1KU2A 2CFXA 4M72A 1D8JA 2UZKA 2QUFA 5LGUA 4AWXB 3QU3A 3HRSA 4U0WA 3IHUA 1XDSA 1V3FA 3TGNA 3LA2A 2DAOA 1BBYA 4OINF 3VEPA 2NNYA 3F3XA 4RGRA 4P55A 3DXJF 2Z3YA 4RB3C 2MLGA 3F8CA 4U7DA 5BS6A 3RKWA 2ZMEB 4A2UA 1SD4A 4CGZA 2PJPA 2OU2A 3GW2A 1XSVA 3KETA 2CG4A 3D0SA 3GO5A 1LVAA 1ZRDA 1KU7A 2NS0A 3PQKA 2HEOA 5D5WB 3F22A 3P9KA 3T8RA 3V7CA 1G4DA 4KT5C 5LBQA 4D0PA 3KLNA 2V1UA 2DPUA 1SD5A 3ZPLA 3WTSC 1YS6A 2PMHA 5FLXK 4RAYA 5LGNA 2O6GE 1FSHA 1I27A 1HW2A 4IJAA 2FQ3A 1XDUA 4OIQF 1ZHFA 1YIOA 4K2EA 2CYYA 4NHJA 4HW0A 5ILVA 2ISZA 3HHHA 5D8LB 5IT9Z 1BI2A 1FBSA 2AS5F 3MZHA 3KEOA 1LEBA 3BPVA 4KIGA 5E18F 2BYVE 3MWMA 1VTNC 5JVTA 3HRUA 4GYIA 1O3TA 4Y17A 2HTSA 4KNYA 4MTEA 2XIGA 4G8XA 5HS7A 3MQ0A 2H6BA 1S7AA 1WQ2A 1D5VA 4YFNF 2OZUA 4ZZLA 5D6EA 2OBPA 1TBXA 1IN7A 4RB1A 3TO6A 1UCRA 4RB0A 3O3KA 2VONA 3DEUA 2ZNYA 3L7WA 5K1YA 2LF7A 1RUOA 1IW7F 3GFIA 1JE8A 1FWZA 1TW3A 2L4MA 5HS8A 4L0YB 5JR3A 1A04A 5HDKA 2PG4A 2BGCA 1YQAA 1D3YA 2FBIA 2ISYA 3FXRA 1FY7A 1U8RA 4A0ZA 4CO8A 3HHGA 2FEZA 3LAJA 3LQRA 1GHCA 3QPTA 2GQQA 4ENMA 2R7FA 3FZVA 1Z6TA 4KN7X 2RNJA 1ZGJA 2GXGA 3R61A 3OV8A 2W84A 5E1WA 1BOAA 1D8KA 3F8NA 5JHUA 2Q0OA 4P9FA 4UNOA 3CLOA 2FU4A 1LDKB 4KUMA 2DK5A 3GYHX 4WXDA 1JGSA 2E7XA 4EM0B 2FXAA 1IRFA 2A68F 1PUEE 1R00A 2OAZA 2GZWA 4IXAA 2P4WA 2PQ8A 3F6OA 4L9NA 4G6QA 4HDUA 2FOKA 3EETA 1MGTA 2VT3A 3IC7A 1DDNA 5BPDA 2HFHA 4KA4A 1K78A 2K4JA 2L01A 1DUXC 2CWEA 4LLNA 3WTTC 1LDJA 4Y15A 4CHUA 4P96A 1CF7A 4IRGA 5LHHA 3GEZA 3V4GA 2MD5A 2QZ8A 2K4BA 2PFBA 1O3QA 3FMSA 3N4MA
chains in the Genus database with same CATH superfamily
3RTRA 5A6KA 3EPJA 3FM5A 3H1CA 2QKMB 3OYMA 2N8GA 3G1LA 1J59A 2CW8A 1F9NA 2VXZA 2X48A 1IN4A 1TNTA 3WTXC 3JAMK 3C4TA 1VQMI 3ECRA 1ETQA 4DV1E 2UXXA 3DPUA 1MBJA 1EKEA 4FETA 1LPQA 4DV3E 2Q8KA 2VQEE 2EV5A 4CICA 2ID3A 1AOYA 5GAGJ 4M9ZA 2B7VA 2CUFA 3H36A 2R76A 3OWTA 4R2EA 3HPZA 4LB5A 2Z5UA 2CU7A 4DR4E 2JOXA 2P6SA 4O5GA 2QENA 4LLGF 4EVIA 4Y4RA 1I5ZA 1K4TA 5GAHJ 4C2TA 4JQFA 4ZYAA 4S0HB 5E1ZB 3M7GA 4EJVA 2KRFA 1OJLA 3BJ6A 3OSGA 1DQ3A 2LJUA 5M5XJ 1IXRC 3IAM2 5DYMA 2DGCA 2ZCWA 4B3RE 3FXJA 3I71A 4I2OA 1MJ9A 5M5YJ 2OTLI 3F6VA 1TC3C 2E5ZA 2FBHA 4EMSA 2EMHA 2WADA 4CA0A 2OCEA 4UV8A 3PUFA 2DTZA 2ADUA 5FKKA 4BNCA 3A0BC 1BW6A 2XV4S 2EWLA 2VQHA 2W57A 1FLIA 4ZZDA 2GXBA 2R7RA 2M34A 2M4GA 4JYKA 1AKHA 2W24A 5C44J 2EM3A 5K7FA 2DFFA 2V6EA 3ZOQB 2VBYA 3O6BB 3WHCA 3KZIC 4QWQA 1A5JA 2H1KA 1MEYC 1YS7A 2P6TA 2I10A 2MC6A 4FISA 5LLQA 1T39A 3QYBA 2JMWA 4PSWA 3OYJA 3N05A 4O3MA 1T0FC 5CQEA 3ZMUA 1Y1VJ 2STWA 4LG3A 4B43A 2AXTC 3HM5A 2AO9A 2FGGA 3I58A 3HGGA 1YI2I 3T1HE 1PYVA 3DBHB 2IS2A 2MGQA 2LT7A 2DBBA 1YPNA 3K4LA 5EEHA 5D4SA 5JVGF 1MJAA 3G73A 4DV4E 2OZ6A 1GV2A 3BR1A 3U2RA 1AH5A 4RGUA 5FO5A 5IY5H 5LD2C 3WGHA 2XRNA 1TQMA 1Y1WJ 1JKRC 3DF8A 2R93J 1Z21A 2KMUA 2MYSA 2XKOA 3A01B 5FLVA 2D1VA 1QU6A 1G2DC 1TW2A 3CC4I 5LL6R 2M1SA 3BBGA 3M4OJ 2YTNA 4A3GJ 3ZN1A 1S7EA 3TOAA 2RAEA 4II3A 4IS1C 3ZGKA 3JTHA 1X47A 4XLNF 5E17F 1J09A 5H2FC 2K9SA 2JQ7A 1WJBA 1LE8B 4L18B 4IX7A 2VE8A 3EUAA 4ZYGA 5HS9A 1QNTA 3MVPA 2EOMA 1SMYF 4RB2C 2VKEA 1F43A 4O24A 1DP7P 2DRPA 3RYRA 1FT9A 2H27A 2RKHA 3J80K 2EMZA 4A3LJ 1DP3A 3TP3A 1RZ4A 2LFBA 1KQ0A 4UVCA 4U0YA 4KN4X 4OAYA 4HLYA 1MBEA 2M4KA 2IVMA 2LP0A 4PJMA 3GTMJ 3HTXA 2RS6A 2OJED 4GEQB 2LMZA 4UUSA 2XF6A 3S2HJ 1ZTRA 2V7FA 1S9HA 3TQNA 1Z1DA 4HEIA 3KPHA 3DLAA 4LF5E 3ZRGA 5A6BD 2RVCA 1G59A 4F9CB 2XPUA 1OCPA 2V9PA 4GYGA 3DBLB 3LA3A 1MMNA 3B6CA 3H3UA 2FJ1A 1RUNA 1USTA 4A6DA 4DKKA 3C4BA 1QBJA 2CH0A 5IT3A 4CDGA 1IRGA 2VRDA 3I0TA 2F5FA 2GLIA 5FKLA 2DPDA 3H92A 2LF8A 1UILA 2HOEA 4AIDA 3K4JA 2BVLA 5CVJA 2JVHA 4LJZF 2ZXWH 1FYMA 2R3SA 1UG0A 3SDBA 3BCAA 4YIFA 1N33E 1R5ID 3GTQJ 4KIBA 1BJAA 3V8LA 3FIGA 4U88A 4L5NC 3DV8A 1UBDC 5E20A 3BR0A 1Z7LA 4PJLA 5LHIA 1LJ9A 3S1MJ 2V88A 4EGYA 3VYXA 1DI2A 1MBKA 3HL2A 3CCRI 4R2QA 1BIAA 3V7SA 4TUGA 5H6QA 1ZRFA 2O61A 1WXRA 2X4HA 1O7FA 3RJPA 5LMUE 2CV2A 5HLIA 1R7JA 2VJ4A 4MO7A 5ADZA 3IKTA 3BOQA 2LE2A 3VPRA 1NEIA 5B1AH 4ZTFA 2R1FA 2ENAA 3T1YE 2XGEA 2CV0A 4A5NA 2D1HA 2V89A 4I6ZA 4AM3A 2XVCA 2K9NA 1JXSA 4R2SA 5IWAE 3CO7C 4NDLA 1OYYA 2VC0A 3HOVJ 2DOFA 3PQJA 4HRIA 4B3ME 4JI8E 3PNYA 3CZ6A 1Z67A 4LD5A 3ZQ7A 2YT4A 2LKPA 4EM2A 2UXCE 5CYVA 3ISPA 5KVRA 1PUFB 2EFWA 3KX2A 5L3DA 3OIOA 2D5VA 4WK8F 3LWFA 2DA7A 1YHQI 4F54A 1QZZA 3THOB 4EJTA 5HOOA 1EH8A 2CW0F 3HRTA 2EOHA 2K3FA 3KCCA 3U9GA 1GDTA 1FBQA 2BE5F 4DR7E 4MTDA 4GZNC 2CUEA 2ACJA 1D0ZA 2L7ZA 3GWZA 2Z1DA 4Y7NJ 4JI1E 3S1RJ 3SFIA 1XNQE 4E7SA 5DD8A 5DEQA 2UU9E 2XAJA 1SFXA 2GA1A 1FJGE 3HKZN 2CMPA 1ZAOA 4N4OB 5EF6A 1LQ1A 1P7JA 1X1DA 4HF2A 4AU7A 4R79A 2IRFG 2NVQJ 3AFHA 1MBHA 2L9NA 4RGSA 2LCEA 2LH9A 1AWCA 4RLFA 1I6HJ 3UNGC 2K02A 3MN2A 1BM9A 2L4AA 4ESJA 3LSRA 2M2EA 1A1JA 2B7TA 5DNYA 4A6EA 5EDNA 3KP2A 2EL4A 3AAFA 4CUGA 1L4SA 1O57A 3F72A 1WKMA 4IHTA 2GLOA 4O43A 5E8GA 1BIBA 3LSPA 5M3MJ 3F23A 4J19A 2DJNA 1N3GA 4Q35B 4JI6E 2VT2A 3FXMA 3E1SA 2VBXA 3TO9A 1HA8A 2DK8A 2HR3A 3ZQFA 2K3PA 2Y0MA 2L9RA 2STTA 1FJLA 5HLHA 3OY9A 2GIVA 1OPCA 4R2PA 2LRDA 4IQJA 1IXSB 4A3BJ 2WTEA 2LUPB 2FTXB 4ZYEA 4M3GA 2HU9A 4IRHA 2WCC3 2EZLA 3DTKA 1TQPA 2OD5A 4C3IJ 4HQMA 3ESWB 2EB7A 1IN8A 1Y39A 2X1CA 3FXUA 1K79A 4P1WA 4PUSA 2EIJH 1P92A 3F21A 1YO5C 5IT9K 2WAQN 2HHHE 1HOMA 1GVJA 3JRCA 3EPHA 1VQLI 2HQRA 4XLFA 1X4OA 1TWFJ 1XGMA 3BR2A 2A6HF 2VN2A 1F36A 4CCNA 4JV5E 3ABKH 4X65E 1Z3XA 1A1HA 3BR6A 1H9TA 1FP1D 1SAUA 1Y0NA 4LITA 2KZVA 1SANA 3BWGA 5B66C 5KL2A 2G7HA 4IRIA 1VQ4I 5AE1A 5CVUA 3MCZA 1T0FA 3GX4X 2RPCA 3HOSA 4R2AA 5LMNE 2UUCE 2OUMA 2VBZA 3ADIA 3QPLA 2CQNA 3X2QH 4OIPF 2MFZA 2EMFA 4BQAA 5KK1A 3ZMSA 1PUFA 2WA0A 4LGWA 5F04A 1QRYA 1R23A 3HRMA 2XDVA 2IBDA 1Z91A 3HB9A 3GBGA 5CQGA 3SHFA 3W6JB 2Y9ZA 4WPYA 3J7Yp 1Z1BA 5HDNA 4F9AB 2V4JC 1YYOA 1IRXA 4WX9A 2OA4A 5D5XB 3CF2A 3H3VK 2BW3B 1M1EB 3CDIA 1O3RA 3FX3A 4M6YA 2E7WA 2LRSA 1WH5A 1IRZA 2YTPA 2QSGX 3IAS2 3ZQLA 2QEXI 2VQGA 2YWQA 4LB6B 4XRFA 4BKXA 2ZMEA 3IH3A 3JRBA 3JAMC 1ZBQA 3C3WA 3BLYA 2MBFA 4ZC3A 1R1VA 2FF4A 3GTGJ 3GZ5A 5TSEA 1XCVA 2YRKA 4ESFA 1OR7C 3DQVC 4KZSA 3WGGA 3BIDA 2PBIA 2VQLA 4DZPA 1TL8A 3E6DA 1DU6A 4H4KC 5L3BA 3WTVC 5EJCA 2VQFE 3CCQI 3RKXA 3V8JA 1XG1A 5IPAA 3G4SI 4E7KA 1YSAC 2E1MA 3BQYA 5HODA 2WB1N 1FKAE 4JI3E 1WWXA 3NWSA 3G71I 3Q9SA 5ICFA 1YYWA 2O0YA 1VQ9I 3ELKA 4EATA 3SYTA 4BHBA 2DIXA 5BNGA 2ZXHA 4N9HA 4KHPE 3GVAA 1R1TA 1VQ6I 1MMSA 3L1PA 3HKZA 3ABLH 2VJ5A 1X58A 1WGXA 4MEYF 2CSOA 3S32A 3LNQA 3VDXA 3CP8A 2EQ0A 1MMGA 2Y31A 2P5VA 1AA7A 2H8WA 2FNAA 1LFUP 4NQWA 2EOQA 4I09A 3QOPA 4HPQA 3SZTA 2GOMA 2B7EA 4BGDA 1U8BA 3JREA 1W5CC 4E7IA 1ZAAC 4J8ZA 1TWAJ 5AC5A 3QP5A 1JK2A 2K9MA 5D6FA 2IGKA 4BXXJ 3KP4A 3KP6A 1OYWA 4IEJA 1MMDA 2W25A 4XONA 2LVHA 3QYFA 2Y48A 2BW3A 3LFKA 3GLLA 3AG4H 1YJNI 2H09A 4NC8A 2YSPA 2JSPA 4ENNA 1B9NA 2KHXA 4B8XA 3LSKA 3ERED 1ZGAA 4E4HA 2JP9A 1TLHB 3TW7A 2QLZA 3BR5A 5F64A 4RHBB 1G2HA 2PEXA 3D5SC 4JX5A 1EKZA 1Z7UA 4GKJE 3HOUJ 4MLVA 4LOCA 1VFCA 2OF7A 2DMTA 4RAFA 1FMVA 2A07F 1A1LA 3BZKA 4E70A 2A61A 1ZGWA 3ADGA 2DOEA 2EMXA 5BMZA 2O5RA 5C3EJ 1QO0D 3I5UA 1ZREA 1J7KA 4L5JA 5LHGA 2G9WA 3EUKL 2G0EA 4M71A 3KYLA 4IZZA 1IUYA 2YU8A 2YRHA 5HLTA 4B3TE 1XMKA 1J9IA 4HA8A 1F5TA 5IP7J 4JI4E 3FIWA 3HUGA 2I9IA 3BP8A 4M3BA 4N4RB 1NHAA 2M8GX 5BPIA 2PX9A 2XPWA 2WWYA 1U0JA 1IAWA 2QKLB 2HDCA 2EPRA 1T6SA 5J40A 3OYAA 1X48A 2ZM6E 1XN7A 1YUIA 3H5RA 1P4XA 3E97A 2EV6A 4LF9E 2F5CA 1YX5A 2NAZA 2ZJ2A 3BDDA 2P5KA 4R8OA 2LTRA 2L3JA 2M7BA 2F5DA 1U78A 2LTSA 2LVSA 2PMZA 2VB6A 4AQYE 2OQRA 2YU3A 1AKHB 4XKBA 2EJ4A 1RPWA 4C9YA 1YZ9A 2KDZA 1RKWA 1RI7A 1VQ7I 4XN3A 3O2PE 4JX6A 4BC7A 3PM1A 5KAFC 1LFPA 1P4WA 1XSXA 1X3WB 1IG7A 2ENHA 2OTJI 1IN5A 4IPAA 3AV0A 3FKJA 1R22A 5K7HA 2JVAA 3OIQA 3EQLF 1LDDA 3HOWJ 2BB8A 4ABZA 2CW7A 2EZKA 4G7ZF 4HF0A 2L2MA 2DA6A 3WG9A 2E2IJ 3CJRB 2EA4A 4FE7A 3I54A 4L9VA 4LK0F 5DTDA 3I4NJ 3C2BA 5LEJA 1TWHJ 1XSDA 1TN9A 3S1NJ 4EGZA 4WYQB 2EN1A 1PJSA 1FIAA 1R36A 2ZKZA 1UHSA 1I3QJ 3S16J 4DUYE 3ROUA 4N4NB 2WY8Q 2HOSA 3IH4A 1X6FA 2M7QA 3OYDA 3UK3C 2X0LA 4XMYA 4WXCA 3COAC 2KZGA 2F4IA 2ZBKA 3A2KA 2CSHA 4DQ2A 2K7IA 4CYDA 1ZH5A 2IA2A 3WGIA 4Q47A 2ETHA 3F6GA 2VC1A 1IC8A 3E6CC 3HSFA 1OFCX 5F3WA 4QLCU 2UV1A 2XAUA 3OTOE 4FTHA 2G7UA 2YTDA 2KPMA 1JUSA 2EQ1A 3JRDA 5E3NA 2NNNA 1OR7A 3LQQA 3CMEI 1FOKA 4X8WA 2KT0A 1RESA 1P9QC 5FGMA 3BROA 3C7JA 3REOA 3CC2I 1QZYA 1Z05A 2IXSA 3VYYA 2RS7A 5GP9A 2MH9A 2MH2A 1LLMC 1UMQA 3J80C 2DT6A 2GPIA 4L8NA 5KCMA 4XRMA 4IF4A 4E7LA 2BOLA 4FE4A 3FWEA 4I01A 1MH3A 5EEAA 5D5VB 3J81C 2EPAA 4GFBA 2ID6A 2EQRA 3Q5FA 2DLLA 2JPBA 2BV6A 3CP2A 3QPSA 3S17J 1PJQA 3CUQB 3ADLA 1D1AA 4RGXA 4RS8A 1SMTA 2BZTA 3QWLA 2JA6J 3JU0A 2R5YB 3U1DA 1QGPA 3T0YA 2JVGA 2RV8A 1U5TC 4M2ZA 3NEUA 2DJIA 2ZFWA 2R4GA 3E3VA 1TF3A 3BY6A 2R92J 2EPLX 2XUBA 1MH4A 1IZ1A 4X62E 1ZELA 2YPRA 2DYRH 4ZYHA 4KITB 2M9HA 3PIOF 2HOTA 5GADJ 4NHRA 1PP8F 3EPZA 3GUDA 4BMJA 2IGOA 2VE7C 1VQ5I 2EOYA 4UUTA 2EQ3A 3IKVA 4HV5A 4ZYDA 1N78A 5ILSA 2VUMJ 2DI3A 2AXLA 3VYTB 2MDGA 1MNMC 3CUQC 5LFAA 1U3EM 1IO2A 1R49A 2VODA 3DCFA 3J81Z 4GDFA 2NUGA 3E6BA 4R8HA 4LFAE 1U2WA 3EYYA 4GO1A 5FD6A 2KOUA 3D5LA 1A1IA 3HTSB 1E0EA 1ZLJA 2BVMA 3C18A 1KA8A 1R4MB 1MDMA 2RNGA 4HOBA 4DJAA 4YHHE 1S7OA 4GCVA 4GKKE 1USSA 2KL4A 4LK1F 4P5OA 5FFXA 4ENKA 1ULYA 3ZP5A 2H94A 4M6XA 4X9JA 4JI0E 2KIFA 2QF7A 1SEUA 1BI3A 3W2VA 1FP2A 1FMWA 2ZJPF 2CQ7A 3RPUA 1ZG1A 1FYLA 2LO3A 3IRQA 1Q1VA 4M30A 1BB8A 2JT1A 4KMFA 1HF0A 5J47A 1ZR4A 1FPQA 2EMYA 2LR8A 1I3AA 4Q4ZF 2EIKH 1R6RA 4LMYA 3HTUA 4BUPA 1UJ8A 3SEZA 4OAZA 1BR1A 3TKYA 4D5FA 2IA0A 3BQZA 1CF7B 5ICCA 3DU5A 4WFTA 1SD7A 4FX4A 3TDUC 4FQGA 2K9QA 4HZFA 5H6RA 2CQXA 2E36A 5CPRB 3WTZA 5J3LA 3GZ6A 4D7MA 3FM3A 2IEKA 2WBTA 1ETYA 2E2JJ 1MNDA 3ZOBA 3A02A 2LD5A 3TO7A 1W5SA 1W5TA 3CD6I 2X6OA 2XASA 3L9FA 1HQCA 4X66E 3MD2A 3WTUC 1A36A 1D1BA 2HQ5A 5B5EC 1OCZH 3NWTA 3QG5C 1QQIA 2F4OB 4BS9A 3CMAI 2P8TA 3WTWC 2WAFA 2WAEA 1QA6A 2CQKA 3R6SA 1NH3A 2L9SA 2X1DA 2EOSA 1S3JA 3DWLE 3KP3A 5ED4A 3T1BA 5HLGA 4PK4A 1GTKA 2EMAA 4KWYA 4R2DA 2LBSB 4HQEA 3E5XA 3GFLA 3NQOA 5BOXA 3U1KA 3LOCA 4NB5A 3S15J 2RN7A 2VOOA 4PJ0C 2IAIA 3LSIA 1HW1A 4XN0A 3RZOJ 4BXUA 3ECOA 3K1MA 2QQBA 1FX7A 1KGSA 5A2QZ 1H9GA 1SC7A 4UB8C 1E3PA 2L9VA 4M9SA 4QSHA 1WH7A 1OISA 1G8XA 3E0JB 4HYEA 5GTIC 3B73A 2UUBE 4XLAA 1R9TJ 1D5YA 3H9JA 1HKSA 4EV0A 1B69A 2L92A 1VZ0A 2ZSHB 1KZHA 5HVQC 3WU1B 1K6YA 1S8NA 2Y30A 4PFPA 2XAHA 5K5OA 1O7LA 3PL8A 4K0KE 3E6MA 3OYKA 2O9LA 2MDRA 2BXZA 1JT0A 4XKWA 5L3FA 3WE2A 4BJ6C 2YTJA 1KYQA 3DEWA 1YUJA 1QHGA 2HZTA 2GBYA 3I4PA 3M8EA 1MBFA 4M3DA 4MIMA 4CZZA 2A25A 4RBOA 2YU9J 2JTVA 2NABA 4OIRF 3P5JA 4I99C 5J8CA 2KISA 1SAXA 4JP0A 1JT6A 3ABMH 4OMZA 2IP2A 2W85A 1Y6IA 3PSIA 3TQMA 4L9JA 1OMIA 1W7PD 1HKTA 1HNXE 4XIDA 3MMYB 1K6OA 1Z6RA 2HI3A 2LLKA 3F9KA 1IJWC 1TZLA 2IPQX 1XD7A 2RQLA 1IXCA 3QYEA 3AKZA 1DPRA 1YX3A 4CYCA 2LG4A 2VKVA 3B6AA 5A2QK 1B8IB 1OCTC 2A3SA 2JWTA 3BTCA 4UVBA 1T08B 4CSWA 1MD0A 3S93A 2Y9YA 1FYKA 2IS1A 3LLHA 2ELZA 1HC8A 2KIMA 2RGVA 2EM8A 3GTPJ 1X1AA 3LMLA 2R5YA 2AQFA 3LSJA 4I02A 3RSNA 1Z3YA 2ESNA 1XX5A 1KYZA 3L2CA 2ZMEC 1WCMJ 3MKWB 2RQPA 4YY3E 2EILH 1EV7A 3KEYA 1I1GA 1MKMA 3I64A 3I9V2 3HYIA 3BG6A 2XAFA 4ZH4F 1WJAA 2CJJA 2JRMA 4IHVA 5AONA 2NOJB 3VOEA 2LYCA 4RH8A 5DCMA 1WVRA 4MNUA 1WHQA 3GZNB 2EORA 2LY1A 2WV1A 4RM2A 1LE8A 2W7NA 2EPCA 1J0RA 4X1EA 2HDDA 4U87A 5LGTA 3K6GA 3PNTA 3ASOH 3LSMA 1Y8RB 2EFPA 4DBQA 2Z9OA 3MHHC 2LKSA 1ONVA 4CYCB 4M74A 5L3EA 3LMMA 4UVAA 5IV8B 3TOBA 5FB2A 3RPQA 4DYCA 3RKYA 1VNDA 4X6AJ 1G2FC 4MFDA 2HTJA 4F6NA 2V9VA 2ODRC 5F27A 2HYFA 3C6MA 2OC6A 2DN0A 1T95A 2YU5A 1SD6A 1ZU1A 3IH2A 4F55A 2BXYA 2LY2A 5D8KB 5AE2A 1ZK8A 4Y52J 3MKZA 3N97A 1UELB 4YFXF 3M07A 1SFEA 2FMYA 1XMOE 1KYWA 3DPLC 3V8KA 2CT1A 3K4KA 4S04A 1HKQA 5LRSA 3OYHA 4OU0A 2IJLA 4RDUA 2K5CA 2EM0A 4CXFA 5GTHC 1R71A 4IOAF 1O0WA 2FNPA 3E5UA 3L2QA 4CCKA 4U7BA 4A12A 2CGPA 4FHTA 5HNFA 4A93J 1GLNA 1R1UA 2QWWA 4C2UA 1I94E 2ICWG 4AIJA 4M3FA 3P1XA 2HGCA 4UB6C 5CJ9A 3K4BA 2JPCA 5B1BH 3RQ4A 1Y0UA 2EINH 4HX4A 3ZMDA 3J7ZI 2EPPA 1XGNA 2JXPA 2FE3A 4LU9A 1F4KA 2PMUA 2EM9A 3VSKA 3DFGA 1JUMA 4KIFA 2JPAA 3BT9A 1QPMA 1X19A 4ZJZA 4AVPA 5EGOB 3I59A 2FSWA 3EPKA 3D1NI 3PIPF 4KDPA 1WJCA 2XHKA 5IOZA 3HBLA 1ZARA 2QSHX 2D2WA 1SVOA 4L9TA 1B59A 5K7ZA 2ZJRF 1TWGJ 2XAGA 4A69C 4PCQA 4G7HF 1GQEA 1BR2A 4B4CA 1ETVA 3EDPA 4S05A 2C6YA 2DDBA 2MA3A 1MBGA 3ONQA 1V4RA 2EPXA 2WZOA 2LUQA 4MHGA 2L54A 5AC4A 2XPVA 2KIUA 2E71A 2N3GA 4Y13A 2FUG2 2NYXA 3KZYA 2XGDA 2HVRA 2EMCA 3SZPA 3BZCA 4M9VC 1WPKA 4BQQA 1B72A 2JA8J 2O03A 2NVTJ 3BG3A 1L0OC 2UUZA 2W1OA 3T8TA 4F2JC 4LFCE 2ZNZA 4M9XA 2Y0SA 2XF5A 4CCMA 3K70C 3UKGA 3HJEA 3CDHA 4HNTA 2EPUA 4N9IA 2WC2A 3RYPA 5J1YA 3GFJA 4DZJA 4D5CA 2M45A 3JW4A 4BDZA 3G2BA 2A6EF 4HSRA 5HDGA 4M73A 2FQ4A 1R5GA 1JKPC 2DQLA 1HBXG 5DCMB 1FOWA 1X4PA 4PSXA 3TW6A 2MABA 1B9MA 2Q1ZB 2JA7J 1RIOH 4C30A 2JR1A 4EM1A 2F2EA 2ESHA 4XICA 4I8OA 4A3CJ 3A1YA 5FFZA 2ELJA 1BA5A 1A35A 3SQNA 2Z33A 2ZC2A 2V1NA 5M5WJ 3R4KA 2FRHA 2NVUB 1FBUA 3KEQA 5LRRA 2NRAC 2QSFX 3PFIA 4UHTA 3LA7A 3BG5A 1GZ6A 1GXQA 4MEXF 4R03A 3EYIA 4P9UA 1T8IA 2HYGD 4NC6A 3CCUI 3SDGA 3J7AO 3JRAA 5E1XA 3HOXJ 1SFKA 4D7NA 2EOJA 3ECHA 1TNSA 3CMMA 3ABTA 2EN3A 3K70D 2WBSA 4Q5SF 5CFFE 1YLFA 1A6IA 2MW8A 3T5XA 2ECCA 4DBRA 3CCEI 3HPSA 4M6VA 1BR4A 4CZCA 2XSDC 4HX8A 1X2NA 1FOXA 1LNWA 1WJFA 3J7AG 1KU3A 1W1WE 5DV5A 2IS4A 2HVQA 5TISC 3S2WA 4X0GA 2VKDA 2JRTA 2NS7A 3ASNH 3CJNA 4F7ZA 2L0KA 5L3CA 2NS8A 4EJOA 1JTXA 3GCMA 3CQZJ 4XBFA 3WG7H 2LK2A 1ZQ3P 3AUZA 3CCYA 3NRVA 3HG9A 2XROA 1GVDA 1A31A 1ZG5A 5EGOA 2IGNA 2XF7A 2R5ZB 2CUJA 4WWCA 1RRJA 1UHZA 2DA1A 1FOYA 1E3OC 4UUVA 1TQIA 4IHSA 2E1NA 5JI6A 2NUEA 4Z2YA 2ZXJA 4B1RA 3R0AA 4LIUA 3QRFF 1WFXA 2DU9A 4XR6A 5L3GA 2B0LA 3L09A 4BCAA 4DV2E 4XLPF 1YRNB 1QHHD 4EEFG 3BG7A 3KZZA 2A6TA 1GV5A 2QYOA 3JRIA 4MQVA 2HDWA 5EZHA 2ZB9A 2E5NA 3OS0A 2B9DA 1YFHA 3ZMTA 4DV6E 2JA5J 1APLC 3VWBA 2VL8A 2FMLA 2QQAA 3CLQA 1I6XA 3Q9VA 2XC7A 3F8MA 5CVRA 2UXNA 5FD5A 2PJRA 3W2AA 2F4VE 3ADJA 4LLLA 1NG7A 1YW7A 4DR2E 2DA3A 4XM3A 2K7LA 2EMGA 2DT5A 4L5EA 1ODDA 3FDYA 3OYEA 3HSRA 2DCEA 4KT6A 5JFRA 4EQQA 3LL7A 1YIJI 1F2IG 2P5LC 1G3TA 3M1EA 2EZ6A 4GGGA 1TWCJ 3VYSB 2V8QB 3JSPA 1DQUA 4G9YA 2OCCH 2WB1A 5A6BA 5E3OA 1MMAA 1WI3A 3P7NA 3ZQGA 2JK3A 5ICGA 5J1RA 2ZJQF 1IMUA 3EUHA 3GTJJ 1BW5A 3V42A 5IYBJ 3CCMI 1U9OA 1BI0A 2MLKA 3L2WA 2V87A 5J6XA 3FHZA 2KKOA 2MSYA 2WBUA 2PRTA 1EH7A 4R1HA 5DDGA 3C1DA 4AVZA 4DUZE 2AHQA 2GXAA 1DGRM 2VI6A 2ODRD 4ENJA 3B02A 4MFEA 2YSRA 3RIRA 2JZYA 3DPTA 2XKPA 1KU9A 2HXIA 2LBFA 1B4AA 4L0ZB 1P2FA 1E2XA 4BHCA 1K61A 4ITVA 3RZDJ 5J8FA 3FBIB 2GA2A 1E3HA 3BG9A 4HSTA 3IV5A 1O3SA 1SFUA 2EV0A 1IDZA 3F6HA 1MSFC 1FSEA 4BAYA 1XB4A 4A0XA 3SZGA 5AASA 4NXNE 1T56A 2QBYB 3CJQB 3J7YJ 1FIPA 2HZDA 4BEHA 1BN5A 3K1PA 3I55I 1BC8C 2ELHA 2E2HJ 2Q2EB 4ANJA 4LF6E 4WXHA 3ZXSA 2L7FP 1CQTA 4BYYA 1V5FA 2K4VA 4OOIA 3K69A 5F1JA 5DUKA 4IVNA 1JGGA 2R7SA 9ANTA 3WE3A 2EMBA 4OMYA 1L3LA 1T98A 2J5PA 2O8XA 2EWNA 2CS3A 3ZMZA 2XAQA 3O8HA 5FLMJ 3C2HA 3IP4B 4LF7E 5BQTA 2YPNA 4XLHA 1U5TA 1TP4A 3RPUD 3OYBA 3H3ZA 1VQ8I 2IW5A 1JKQC 2HQNA 5DCFA 4KFCA 2IS6A 2LY9A 3AL0C 4MLQA 5BR8E 1PVEA 5DD4A 1SVMA 3HGYA 4MGRA 4UY8I 4DNCA 4B09A 1N75A 2O7OA 3K0LA 2E60A 2M87A 4CCJA 2RSMA 2HJJA 1KQ9A 2H1LA 2LNBA 4NNJA 2QQ9A 3KWRA 2ELKA 2EM2A 4ZDOA 3MFKA 2JSCA 4XKVA 4F91B 4BE0A 2DMPA 2VPLA 1T38A 3MHSC 2N3HA 1Z9CA 1ZKGA 5KL7A 1FNNA 2L3DA 3QODA 2HC5A 4I98B 4LFBE 2OQGA 4F9BB 5H20A 1V5EA 1MNEA 2BHZA 2HS5A 4C3HJ 3BTLA 4F92B 1REPC 4GXOA 2EA2A 1WZ2A 1JHHA 2CRGA 4ZDLA 4JYAE 4O4KA 1VQPI 2NOGA 2H8RA 2V85A 2XGXA 3JRGA 4NXME 2BY2A 3MEXA 3SXYA 5KNLA 4A5MA 2QM3A 2L3CA 3KLOA 2FA5A 3UR3C 1ERDA 3JSOA 4BACA 2M4IA 4IHXA 4LTYA 1H8AC 3HOTA 4KYWA 5C4XJ 2O8KA 1EA3A 1ON2A 4LG0B 4Z6YA 1IBKE 3KP5A 1DU0A 2M8EA 1W4MA 1J2XA 1G3YA 2L33A 3S3NA 1T4LB 3LAPA 2KFDA 3K6QA 2XB0X 4YG2F 2GM4A 1ETKA 3PNVA 3S3OA 1HXDA 2QVOA 3MKLA 4O5VA 4TUIA 2KONA 4OX9E 3IWBA 2Y0SN 1F1ZA 1OLTA 2FOWA 2GAUA 4UV9A 4XSXF 1HCRA 5AIPA 1E17A 3OOUA 1HSTA 4HX7A 3ZR8X 2BEOA 3IWZA 4BHPA 3GTOJ 1D1CA 3C2GA 3K1NA 2W48A 2VOPA 2EZHA 2J7JA 2MG4A 1QU3A 2LSOA 1OCRH 1ZR9A 1X2MA 2M1BA 1BL0A 2OV7A 2V79A 1OCOH 3CTAA 3LSGA 1RKTA 4HG2A 4XORA 5J1UA 4H0EA 2IHR1 1YJ9I 1KJKA 2YX4A 5JLWA 4WF2A 1FTZA 4CCLA 3EPLA 3SJMA 4IOCF 2DMUA 3IL2A 1G6NA 2P0WA 4PDKA 4JI2E 2LC2A 2DA5A 3R60A 1WRJA 2NUFA 5KAIC 4PGGA 2NVYJ 4F3QA 2KJBA 2DO7A 2K85A 2XGCA 2D45A 2PN6A 4L5IA 4RAGA 3K2AA 1K83J 3DKXA 1JTYA 2V26A 3JTZA 4LG0A 5FLXZ 2V9KA 4AYBN 1HSJA 2L7MP 5KHDA 4F6MA 4G6DA 4BE1A 2HVSA 3AL0B 1ZRCA 3GFMA 1NG6A 3QU6A 4PFOA 4JBAA 1J5YA 4XOPA 4ASNA 4HAMA 2UUAE 1FC3A 2V1DA 4V19K 2RC4A 2E1OA 4DGWB 1UB9A 5DUIA 3PO3J 1JHFA 4HTGA 4BH9A 5ICEA 1BC7C 1HDDC 3TL4X 3JTGA 2EH3A 2B3TB 1NK3P 1K4SA 2OPTA 3EUHC 1HW5A 4BC9A 4FT8A 1MDMB 1IN6A 2P7VB 5A69A 3FMRA 2E35A 2JN6A 2F5EA 2HWVA 5E3LA 2A5WA 3P9IA 2YUSA 2EJRA 3PUBA 4XLEA 3KFWX 1ZR2A 1PJRA 4YFKF 3HSEA 3FF5A 5EEGA 5F1RA 5IXMB 2ECBA 2L7KA 5GPCA 2HKXA 3AG2H 3D5RC 2EPFA 2L8TA 1JK1A 4FX0A 2DSYA 2YTEA 1WJDA 3M3YJ 4DV5E 2EL6A 3HUGB 1NTCA 3VYRB 1XCBA 1SVLA 3OL3A 3ZQHA 3ML6A 4PJNA 3HXLA 6PAXA 4Q28A 4XSZF 3M8FA 5EYRA 2FV4B 1W36C 2PLYA 5F0FA 2VXDA 1RNLA 5AIQA 2LTPA 1LB2A 3QP6A 3RI4A 1PDNC 1ETWA 4RM3A 2L2OA 2DLKA 3WHBA 3P9CA 2YR2A 1BI1A 2E1CA 1WHNA 1VI0A 4HDVA 3LSTA 2CPNA 3KYCB 3FMQA 3EQ1A 3CO6C 3RMPA 3W6VA 1B6AA 3F8FA 3J81K 3RKQA 4HEA2 1S6LA 2X51A 5ILUA 3ZCOA 2KJCA 1XS9A 2BBGA 4WCGA 5EZGA 2CQQA 3H09A 1B1BA 1G3WA 2W82A 4TV7A 2R7OA 4AIHA 2QBYA 1P47A 3DTEA 1XGOA 2Y2ZA 3E5QA 1LEAA 5FROA 1UHMA 1P6RA 1J26A 2HPMA 1P4AA 1UHWA 2R7WA 3HIFA 2DA2A 1O4XA 1J5EE 4AD9A 1IGNA 2R7DA 3K9TA 2UXDE 4A3IJ 2F8BA 3H0GJ 2L5QA 1W7PB 5KL6A 1RMDA 4JK1X 5TGTA 2CUZA 2LBFB 5AE3A 2I8DA 4KMUX 2L02A 1QVTA 2HPIA 3CUOA 3RDIA 3JAMZ 2PMZN 3HPHA 4ON0A 5LEKA 4D1QA 1WSUA 1D0YA 1IQOA 4Q48A 4XKCA 2VKHA 5FKNA 1U6GA 1R5HA 3HZJA 4HF1A 5CVVA 5TJJA 3VK6A 4NQWB 2DW4A 1Z0XA 1YW9A 2DYSH 3PJRA 2YTGA 2J5OA 1S29A 3GLXA 1ON1A 1OKRA 2DFEA 2MD0A 3L00A 3V7RA 3BTJA 2E1MC 3Q3SA 4BBSJ 1Q1HA 3WTYC 2QQ8A 4B3AA 3TEDA 1XMAA 2HQAA 3AG3H 1B72B 3I53A 2VE9A 1ACIA 1H0MA 5M3FJ 3TP0A 1IF1A 3J80Z 2EOFA 4I0BA 2EOEA 1YTYA 2R7UA 5FRMA 4JI7E 2Y75A 1Z77A 3NARA 3K2ZA 2EE8A 1DPUA 2VJJA 4E7HA 3W3CA 1BJZA 2BBYA 4ESBA 2KRHA 2IT0A 4P78A 1OQYA 1X1CA 1A1KA 2HNHA 4N0BA 5FLXC 2DTRA 2P7CB 3M99B 4DV0E 3ABUA 2DMYA 2VJIA 1JKOC 4PZJA 1XTAA 3CCLI 1MZBA 1ETOA 3BZ6A 1U9NA 3OOPA 4W1UA 4BDYA 1XMQE 1K7AA 2COMA 5D4RA 1UAAA 4ZTJA 1UFMA 3FXKA 1ZN2A 2L6MA 3W2WA 3OMLA 5EG0B 3F8BA 2JA2A 2FD5A 3CUQA 4E7ZA 2EK5A 5CLSA 2YSOA 1WI9A 5A2QC 4KICA 3QAHA 4B44A 4XK4A 4I76A 1KQ8A 2BY1A 2YX7A 2Z99A 3Q0VA 3VODA 4BE2A 4Y3OA 4YIIA 4YELA 3FISA 2A5YB 1FZPB 2M0MA 3HC7A 2MC3A 3BPXA 1CGPA 2EN4A 5K5RA 3FK7A 3SFZA 4AYBA 1H89C 2EFOA 2EFQA 2WBMA 3MZYA 4V2FA 1K78B 4CH7A 1WHUA 3R0JA 1EJ9A 4PJJA 5B3SH 4RA2A 3I56I 1R58A 4B48A 3BF2A 1YYKA 2LDUA 3PSFA 3CCVI 1NCSA 4BQNA 3MZ8A 2W00A 3KE2A 4G94A 4QIWN 4WSPA 1I1SA 1X6EA 1XNRE 2EPKX 2HKOA 2WY7Q 2FBKA 4I0AA 1VQNI 1X1BA 3O8GA 4LFUA 1YG2A 2DQRA 2GWRA 2V6CA 3GXOA 2PJRB 4KJZA 2WV0A 3TDZC 4RMNA 2K27A 2EN2A 1GXPA 1ZLKA 1U5TB 2A69F 3FXQA 3ZN0A 2EOIA 3H5AA 5CVIA 2JYAA 2ENCA 3ZQCA 2KRCA 3GTLJ 3DF6A 4O6JA 3DKWA 1YRNA 3I4MJ 2ELYA 3OYCA 2LMDA 3W6KB 2B9SA 2LV2A 5C4JJ 2EM7A 2YZTA 1PP7U 1YYVA 2Q2EA 4A3MJ 5T6JA 4V2GA 1JI8A 5KL4A 5ERIA 5J4YA 4LIVA 4XLCA 2EFNA 4BEHB 5TRDA 2H6CA 3FBNB 3IWFA 5K5QA 4DYRA 5FKMA 4HLXA 4XRSG 2R5ZA 1J75A 1EH6A 2EM4A 1GUUA 5FJ8J 4B3SE 4DW6A 1C0WA 4U0VA 4PGHA 3ZMVA 3BTIA 2JUGA 2EMLA 1RQ0A 1P7IA 5DM7F 1S5LC 1MW7A 2PI0A 2QGUA 1XPXA 2KQRA 2RDPA 1XGSA 2V83A 1KONA 3DP7A 5F6FA 2Y69H 1MJBA 2QCOA 3BJAA 2NVXJ 2M5WA 2TDXA 5F0HA 1V5GA 1LVKA 2EMIA 2RTXA 2DFIA 2ZO4A 4DYQA 2F48A 2CFOA 2K86A 5JHFA 1QZEA 4D9JA 2BY0A 1STZA 3BC8A 3M9AA 3IRRA 2XB5A 5IP9J 3DJWA 2UWMA 4UXNA 1T2KA 1VQKI 3HPGA 2E19A 1HR0E 2B63J 2COBA 1BOBA 2BY3A 4I7HA 4QPOA 4AUXA 1MSEC 1T4NA 3MAJA 3H9GA 1YW8A 2GHFA 3CF5F 1I39A 1TT5B 1ORKA 5E8IA 4XQFA 2R0QC 4EJWA 2CO5A 4HV6A 2ZSIB 4A0YA 1UZCA 2NXNB 2EBIA 3HQ1A 2L2KB 4MQ9F 3WU0A 1W36D 3OYLA 3G1MA 1X1PA 2MKNA 1IUFA 3I59B 2BHYA 3DTIA 3DBRB 3OYFA 2R7ZJ 2M30A 3OMYA 4EJUA 4LF4E 2V1XA 4DMIA 1W7PA 3M1CA 2TCTA 4QPQA 3WODF 3VB2A 1X3UA 1LKXA 4OIOF 2A05A 3OS2A 2KP6A 4II2A 3CCJI 3A4CA 4AIKA 1BBGA 2XRLA 3VHTB 4QTRA 4JX4A 1TTYA 2O3FA 3H0DA 3KP7A 4YIRX 4RAZA 4M0VA 3HEFA 1FTTA 2VBWA 1G3SA 3G3ZA 3ULQB 5E3MA 2KLOA 1JJ8C 3GF2A 4HBLA 2ZFUA 1BBOA 3QPHA 3VFZA 2RSIA 5IT9C 4ETSA 5D5UB 2IA1A 1ZYRF 3BJOA 1OYIA 4G7OF 1D0XA 1ZG3A 3F0CA 3Q0WA 2KHMA 1KU2A 4C2MJ 3VSLA 2CFXA 4M72A 1D8JA 2UZKA 1R4NB 3K4NA 2QUFA 2DMIA 4A3EJ 2EL5A 4WSGA 2F4MB 4F52A 3S14J 2K9LA 5GAEJ 5LGUA 3GTKJ 4AWXB 1AU7A 3JR9A 3QU3A 1IV6A 3HRSA 4IKFA 1S72I 1Y8QB 1IQSA 4OWRB 4U0WA 1PKPA 5GPAA 3IHUA 2RQQA 1XDSA 2GIZA 1V3FA 2JOBA 3TGNA 2EOZA 3FXOA 3LA2A 3JRHA 2DAOA 3CCSI 2JWOA 1BBYA 3OR1C 5JLXA 4OINF 3J7AY 3VEPA 1ITYA 2NNYA 3F3XA 3QOEA 2DB2A 1RR7A 1TT0A 4RGRA 2ZXIA 4P55A 4BQOA 3DXJF 3FHNA 2Z3YA 4RB3C 1X6HA 3H9QA 2MLGA 4BL0B 3F8CA 2DXIA 1RETA 3PO2J 4U7DA 5BS6A 3RKWA 2MC4A 3ZQIA 2ZMEB 4A2UA 5E79C 1SD4A 2Z16A 3DLLF 1WJEA 2KIQA 4CGZA 4YEJA 3BR3A 2PJPA 2EM5A 2OU2A 3GW2A 4NUBA 1RR8C 1XSVA 1X3CA 3KETA 4DR6E 5F08A 3OS1A 2CV1A 2CG4A 3D0SA 3GO5A 4RLQA 1LVAA 1ZRDA 2H36X 1KU7A 3A0HC 3H35A 4B47A 3OIPA 4JOMA 4NBQA 2NS0A 4OOGC 4X64E 3HOYJ 2LKXA 3PQKA 4C3JJ 1RC9A 2HEOA 5D5WB 5DS9A 1YJWI 2YTQA 1N32E 3F22A 5F0CA 3P9KA 1N36E 3T8RA 2EPNA 3V7CA 1B8IA 3DEEA 4J01A 1G4DA 4YRVA 1POGA 4KT5C 4BY1J 5LBQA 4D0PA 3A01A 2MKDA 3KLNA 2K40A 2V1UA 2VIXA 4HNUA 1JJ6C 1WJ5A 2DPUA 4R2CA 2LREA 1SD5A 3TBIA 4E6KG 3WTSC 3ZPLA 1MIJA 3ERMA 4M3EA 3CDLA 3IWDA 1IBME 1N77A 2DMNA 1N34E 1YS6A 5J4VA 3S3MA 2PMHA 4P7DA 5FLXK 4RAYA 5LGNA 2O6GE 1IDYA 2EOOA 2HYJA 1FSHA 1I27A 3LSHA 3K4CA 4BJ5C 1HW2A 2GOXB 4DR3E 4IJAA 2JY9A 3MSWA 3K7AJ 2FQ3A 4IQ4A 2DT7B 4G12A 2JJ7A 3DKYA 1XDUA 4OIQF 1ZHFA 3K10A 1YIOA 3THNA 4K2EA 2CYYA 4NHJA 4HW0A 3IWCA 1LFBA 5ILVA 2X85A 4J00A 3BGHA 2X1EA 3ZQQA 2ISZA 3HHHA 5IOYA 5D8LB 1PDAA 5IT9Z 4XRSA 2EPZA 2DA4A 2X6YA 4MLOA 1BI2A 2RREA 1FBSA 3JRFA 3OYNA 2YTIA 1NK2P 2AS5F 3MZHA 3KEOA 1LEBA 3BPVA 4NC7A 4KIGA 5IP6A 5E18F 3S1QJ 1T33A 2MC5A 3C6KA 4A3DJ 2BYVE 5FRNA 2DLQA 2DOAA 3MWMA 4DR5E 1VTNC 4BJTA 2M0CA 1YITI 5A6AA 2R7TA 1QPIA 5JVTA 3HRUA 1A1FA 3E7LA 4GYIA 3OYIA 2Q8UA 1O3TA 4Y17A 3L2VA 2FX0A 2Z2SB 2HTSA 4KNYA 2UXBE 2F6CA 4HNVA 1AHDP 4MTEA 4FCYA 3S8PA 3A03A 3WU2C 4XNFA 2XIGA 4G8XA 2D9HA 5HS7A 3MQ0A 2H6BA 1S7AA 4ZDPA 3HDDA 1SR9A 1WQ2A 1D5VA 4BU2A 4YFNF 1JUPA 1ETXA 1HNWE 2OZUA 5KL3A 2DMQA 3KYDB 4ZZLA 5D6EA 1N25A 3OYGA 2OBPA 2LJHA 2EZIA 4LF8E 2WAQA 1TBXA 1IN7A 4RB1A 4A3JJ 1QVUA 1Y56A 4B3XA 4BBYA 1YOVB 3TO6A 1UCRA 2EOXA 3FXLA 3Q0UA 3MKYB 4RB0A 3O3KA 5KL5A 1XC5A 1A6QA 2VONA 3DEUA 4DR1E 2ZNYA 2I13A 2YS9A 2M3AA 3L7WA 2LF7A 5K1YA 2NA2A 3M8JA 2M7AA 1RUOA 2N8XA 1IW7F 4BY7J 3S2DJ 3GFIA 3SEQA 1JE8A 1FWZA 1TW3A 2VLAA 1X49A 2L4MA 2HOAA 5HS8A 1V54H 3TMOA 5JR3A 3CMYA 4L0YB 3RQIA 1AAYA 3FK6A 1DGCA 3OSFA 1A04A 3JCUC 5HDKA 2PG4A 4FK5C 1XMXA 2BGCA 2ME0A 2IGMA 2EMKA 1V55H 1YQAA 3U21A 1D3YA 2FBIA 1UG2A 2DODA 2ISYA 3FXRA 1IBLE 1FY7A 2R7VA 4F93B 1H88C 1U8RA 2HXOA 4BXFA 4A0ZA 2E72A 2I5UA 3G1OA 4XOTA 2CTDA 4Y33A 4CO8A 3KIOA 3HHGA 2F5VA 1ENHA 3BCBA 2ADRA 4IL6C 1X3ZB 1UN6B 2FEZA 2ME6A 4IO9F 2TRTA 4DV7E 3LAJA 1YE9A 2YTFA 3LQRA 1A1GA 1GHCA 4W97A 5HNHA 3QPTA 2GQQA 2VASA 3LFUA 4KISA 2QA4I 4ENMA 2R7FA 3PFYA 3FZVA 2EP3A 2E34A 1IV8A 4E7JA 1Z6TA 3OR2C 2EN7A 4KN7X 2RNJA 3NAUA 2XSJC 5A6JA 2JUCA 1ZGJA 2V86A 2VF1A 3GMEA 4A3FJ 4IHYA 2GXGA 3R61A 3OV8A 2W84A 5E1WA 2DFHA 1BOAA 1D8KA 2R7XA 1T4OA 2EM6A 3G6EI 2E5LE 3F8NA 5JHUA 2Q0OA 4UUSB 4P9FA 4UNOA 3CLOA 2YRMA 4AC0A 1EF4A 2FU4A 2W4SA 3I3LA 1LDKB 4G6TB 4KUMA 2DK5A 3HOZJ 3GYHX 3CJTB 2X6XA 1HNZE 4WXDA 2X6WA 4XL9A 2LOOA 5FKOA 3IUOA 1VF9A 3AG1H 1WJPA 1JGSA 3CC7I 2E7XA 4EM0B 2FXAA 1IRFA 1PJTA 2A68F 3CESA 2EPOA 2VQCA 1PUEE 1R00A 2P81A 2OAZA 4R2RA 3L2RA 2GZWA 4IXAA 3FKIJ 2EMWA 2YTOA 2P4WA 2PQ8A 3F6OA 4L9NA 4G6QA 1OCCH 1GT0C 2EIMH 2HGHA 4HDUA 2FOKA 2KDOA 3EETA 1MGTA 3OL4A 2VT3A 1RC7A 3IC7A 5DM6F 1DDNA 1TF6A 5BPDA 2HFHA 1ZBTA 4NZVA 3QQAA 4KA4A 2M9AA 4DOZA 3H5NA 2X9DA 1K78A 4IHWA 4BBRJ 4IJDA 2K4JA 2L01A 1DUXC 2CWEA 4LLNA 2L2NA 2E1MB 1LUJB 2EN8A 2DDAA 3DU6A 3WTTC 1HDPA 1DGWY 1LDJA 1SFOJ 3K4MA 4Y15A 4CHUA 1FEXA 1STUA 1I50J 4P96A 4A3KJ 1CF7A 2EPMX 4GRIA 4IRGA 5LHHA 2R7QA 4DIQA 2EN6A 1W0TA 3GEZA 2VPRA 5EG0A 2AQEA 3V4GA 3RCOA 5IYDJ 3VYUB 5IYCJ 2MD5A 2QZ8A 1VQOI 3L2UA 2K4BA 5CKTA 4CCOA 2PFBA 1O3QA 3FMSA 1HLVA 4JI5E 1W0UA 4FASD 1X5WA 3N4MA
chains in the Genus database with same CATH topology
3RTRA 3FM5A 1J59A 1F9NA 2VXZA 1IN4A 1TNTA 3WTXC 3JAMK 2UXXA 2Q8KA 2EV5A 4CICA 1AOYA 4M9ZA 4LB5A 2Z5UA 2P6SA 2QENA 4LLGF 4EVIA 1I5ZA 4JQFA 5E1ZB 3M7GA 4EJVA 2KRFA 3BJ6A 1IXRC 5DYMA 2ZCWA 3I71A 4I2OA 1MJ9A 3F6VA 2FBHA 4EMSA 4UV8A 2ADUA 4BNCA 2XV4S 2W57A 1FLIA 4ZZDA 2GXBA 2W24A 2VBYA 3O6BB 4QWQA 1YS7A 2P6TA 5LLQA 1T39A 4O3MA 2STWA 3ZMUA 3I58A 2DBBA 5EEHA 5D4SA 1MJAA 3G73A 2OZ6A 3U2RA 4RGUA 5FO5A 3WGHA 2XRNA 1TQMA 3DF8A 2XKOA 2D1VA 1TW2A 3ZN1A 3TOAA 3JTHA 4XLNF 5E17F 4L18B 2VE8A 4ZYGA 5HS9A 1QNTA 1SMYF 4RB2C 1DP7P 3RYRA 1FT9A 2H27A 2RKHA 3J80K 1RZ4A 1KQ0A 4UVCA 4U0YA 4KN4X 4HLYA 2IVMA 3TQNA 1Z1DA 2RVCA 4GYGA 3LA3A 3H3UA 1RUNA 1USTA 4A6DA 1QBJA 5IT3A 4CDGA 1IRGA 3I0TA 2F5FA 2DPDA 3H92A 2LF8A 2HOEA 5CVJA 4LJZF 1FYMA 2R3SA 4YIFA 4KIBA 1BJAA 3V8LA 4U88A 3DV8A 5E20A 5LHIA 1LJ9A 4EGYA 1BIAA 3V7SA 5H6QA 1ZRFA 2O61A 2X4HA 1O7FA 3RJPA 5HLIA 1R7JA 3IKTA 3BOQA 4A5NA 2D1HA 1JXSA 2XVCA 3CO7C 1OYYA 2VC0A 3PQJA 4LD5A 3ZQ7A 2LKPA 4EM2A 5CYVA 3ISPA 5KVRA 2EFWA 5L3DA 4WK8F 3LWFA 1QZZA 4EJTA 5HOOA 1EH8A 2CW0F 3HRTA 3KCCA 3U9GA 1FBQA 2BE5F 4MTDA 2ACJA 3GWZA 5DD8A 5DEQA 2XAJA 1SFXA 2GA1A 1ZAOA 1LQ1A 4HF2A 4R79A 2IRFG 4RGSA 1AWCA 2K02A 1BM9A 2L4AA 4ESJA 4A6EA 3KP2A 3AAFA 1O57A 3F72A 1WKMA 4IHTA 5E8GA 1BIBA 3F23A 2VT2A 2VBXA 3TO9A 2DK8A 2HR3A 2Y0MA 2STTA 5HLHA 2GIVA 1OPCA 1IXSB 2WTEA 4ZYEA 4IRHA 1TQPA 2OD5A 4HQMA 2EB7A 1IN8A 1K79A 3FXUA 1P92A 3F21A 1YO5C 5IT9K 1GVJA 2HQRA 1XGMA 2A6HF 2VN2A 1H9TA 1FP1D 3BWGA 2G7HA 4IRIA 5CVUA 3MCZA 1T0FA 3GX4X 3HOSA 2VBZA 4OIPF 4BQAA 5KK1A 3ZMSA 4LGWA 1R23A 3HRMA 3SHFA 3W6JB 1Z91A 5HDNA 4WX9A 2OA4A 5D5XB 1O3RA 3FX3A 4M6YA 2E7WA 4LB6B 4XRFA 2ZMEA 3C3WA 2MBFA 1R1VA 2FF4A 3GZ5A 1XCVA 4ESFA 3DQVC 3WGGA 2PBIA 3E6DA 5L3BA 3WTVC 3RKXA 3V8JA 1WWXA 3Q9SA 5ICFA 2O0YA 3ELKA 4BHBA 4N9HA 3GVAA 1R1TA 4MEYF 2CSOA 2P5VA 2FNAA 4NQWA 4I09A 3QOPA 3SZTA 3QP5A 5D6FA 3KP4A 3KP6A 1OYWA 2W25A 2Y48A 3LFKA 2H09A 4ENNA 1B9NA 4B8XA 3ERED 1ZGAA 1TLHB 2QLZA 5F64A 2PEXA 1Z7UA 2A07F 4E70A 2A61A 5BMZA 1QO0D 3I5UA 1ZREA 1J7KA 4L5JA 5LHGA 2G9WA 4M71A 1IUYA 1XMKA 1J9IA 4HA8A 1F5TA 3HUGA 3BP8A 1NHAA 5BPIA 2WWYA 1IAWA 2HDCA 1T6SA 1XN7A 1P4XA 3E97A 2EV6A 2F5CA 2NAZA 2ZJ2A 3BDDA 2P5KA 2F5DA 1U78A 2OQRA 2YU3A 1RI7A 3O2PE 1P4WA 1XSXA 1IN5A 4IPAA 1R22A 3EQLF 1LDDA 4G7ZF 4HF0A 3WG9A 2EA4A 3I54A 4L9VA 4LK0F 5LEJA 1XSDA 4EGZA 1R36A 2ZKZA 3ROUA 2X0LA 4WXCA 3COAC 2ZBKA 4DQ2A 4CYDA 1ZH5A 2IA2A 3WGIA 4Q47A 2ETHA 2VC1A 3E6CC 3HSFA 4QLCU 2G7UA 2NNNA 1OR7A 3LQQA 1FOKA 5FGMA 3BROA 3C7JA 3REOA 1QZYA 1Z05A 2MH9A 2MH2A 4IF4A 3FWEA 4I01A 5D5VB 3Q5FA 2DLLA 2JPBA 2BV6A 3CUQB 4RGXA 4RS8A 1SMTA 3U1DA 1QGPA 3T0YA 2RV8A 1U5TC 3NEUA 2ZFWA 3E3VA 3BY6A 2XUBA 1IZ1A 2YPRA 4ZYHA 1PP8F 3GUDA 3IKVA 4HV5A 4ZYDA 5ILSA 2DI3A 2AXLA 3CUQC 1U3EM 2VODA 3J81Z 3E6BA 4R8HA 1U2WA 3EYYA 4GO1A 5FD6A 3D5LA 3HTSB 1ZLJA 3C18A 1KA8A 1MDMA 4HOBA 1S7OA 4GCVA 1USSA 4LK1F 4P5OA 5FFXA 4ENKA 1ULYA 3ZP5A 2H94A 4M6XA 2KIFA 1BI3A 1FP2A 1ZG1A 3RPUA 1FYLA 3IRQA 2JT1A 4KMFA 1FPQA 4Q4ZF 4LMYA 3HTUA 3TKYA 2IA0A 1CF7B 5ICCA 1SD7A 4FX4A 3TDUC 4HZFA 5H6RA 3WTZA 3GZ6A 3FM3A 3TO7A 1W5SA 1W5TA 2XASA 3L9FA 1HQCA 3WTUC 1QQIA 2P8TA 3WTWC 2CQKA 3R6SA 1S3JA 3KP3A 5ED4A 3T1BA 5HLGA 4HQEA 3E5XA 3GFLA 3NQOA 5BOXA 4NB5A 2RN7A 2VOOA 1HW1A 4BXUA 3ECOA 3K1MA 2QQBA 1FX7A 1KGSA 5A2QZ 1H9GA 4M9SA 4HYEA 3B73A 4EV0A 1HKSA 5HVQC 3WU1B 1S8NA 2XAHA 5K5OA 1O7LA 3E6MA 5L3FA 3WE2A 2HZTA 3I4PA 3M8EA 4CZZA 2JTVA 4OIRF 5J8CA 1SAXA 4OMZA 2IP2A 2W85A 4L9JA 1OMIA 1W7PD 1HKTA 1K6OA 1Z6RA 2IPQX 1XD7A 1IXCA 1DPRA 5A2QK 2A3SA 4UVBA 1MD0A 1FYKA 2KIMA 2RGVA 4I02A 2ESNA 1KYZA 3L2CA 2RQPA 1EV7A 1I1GA 1MKMA 3I64A 3HYIA 2XAFA 4ZH4F 5AONA 3VOEA 5DCMA 4MNUA 1J0RA 5LGTA 2EFPA 2Z9OA 1ONVA 4M74A 5L3EA 4UVAA 3TOBA 5FB2A 3RPQA 3RKYA 2HTJA 2V9VA 2HYFA 1SD6A 5D8KB 3N97A 4YFXF 1SFEA 2FMYA 1KYWA 3DPLC 3V8KA 4S04A 1HKQA 5LRSA 4OU0A 2IJLA 4CXFA 4A12A 2FNPA 3E5UA 4U7BA 2CGPA 4FHTA 1R1UA 2QWWA 4AIJA 2HGCA 5CJ9A 2JPCA 1Y0UA 4HX4A 3ZMDA 1XGNA 2FE3A 1F4KA 2PMUA 3DFGA 4KIFA 1QPMA 4AVPA 3I59A 2FSWA 4KDPA 2XHKA 1ZARA 2D2WA 4L9TA 1B59A 2XAGA 4PCQA 4G7HF 3EDPA 4S05A 2C6YA 2MA3A 1V4RA 4MHGA 2L54A 2KIUA 4Y13A 2NYXA 3KZYA 3SZPA 2O03A 1L0OC 3T8TA 2ZNZA 4M9XA 3CDHA 4N9IA 2WC2A 3RYPA 3GFJA 2M45A 3JW4A 2A6EF 5HDGA 4M73A 1R5GA 2DQLA 1HBXG 5DCMB 1B9MA 1RIOH 4EM1A 2F2EA 2ESHA 5FFZA 3SQNA 2Z33A 3R4KA 2FRHA 2NRAC 1FBUA 3KEQA 5LRRA 3PFIA 4UHTA 3LA7A 1GXQA 4MEXF 3EYIA 4P9UA 2HYGD 3J7AO 5E1XA 3ECHA 1TNSA 3ABTA 4Q5SF 1YLFA 3T5XA 4HX8A 1LNWA 1KU3A 5DV5A 3S2WA 2JRTA 3CJNA 4F7ZA 5L3CA 4EJOA 4XBFA 3NRVA 2XROA 1ZG5A 4WWCA 4UUVA 1TQIA 4IHSA 2E1NA 5JI6A 4Z2YA 2ZXJA 3R0AA 3QRFF 2DU9A 5L3GA 2B0LA 3L09A 4XLPF 3KZZA 2QYOA 4MQVA 1YFHA 3ZMTA 2FMLA 2QQAA 1I6XA 3Q9VA 3F8MA 5CVRA 2UXNA 5FD5A 4LLLA 1YW7A 2K7LA 2DT5A 1ODDA 3HSRA 5JFRA 4EQQA 2P5LC 1G3TA 3M1EA 4GGGA 3JSPA 4G9YA 3P7NA 5ICGA 3EUHA 1BI0A 2MLKA 5J6XA 3FHZA 2KKOA 1EH7A 4R1HA 5DDGA 3C1DA 4ENJA 3B02A 2YSRA 3RIRA 2JZYA 3DPTA 2XKPA 1KU9A 1B4AA 4L0ZB 1P2FA 1E2XA 4BHCA 5J8FA 2GA2A 1O3SA 1SFUA 2EV0A 1FSEA 4BAYA 1XB4A 4A0XA 2QBYB 1BC8C 1BN5A 3K1PA 2ELHA 4WXHA 4BYYA 4OOIA 3K69A 5DUKA 4IVNA 3WE3A 4OMYA 1L3LA 1T98A 2J5PA 2O8XA 2EWNA 3ZMZA 2XAQA 5BQTA 1U5TA 3H3ZA 2IW5A 2HQNA 5DCFA 4KFCA 5DD4A 4MGRA 4DNCA 4B09A 3K0LA 2M87A 1KQ9A 2LNBA 2QQ9A 3MFKA 2JSCA 1T38A 1Z9CA 1FNNA 2L3DA 4I98B 2OQGA 5H20A 2HS5A 1REPC 4GXOA 2EA2A 1JHHA 2XGXA 3MEXA 3SXYA 4A5MA 2QM3A 3KLOA 2FA5A 3JSOA 3HOTA 4KYWA 1ON2A 4LG0B 3KP5A 2M8EA 1W4MA 1J2XA 1G3YA 3LAPA 4YG2F 1HXDA 2QVOA 4O5VA 1F1ZA 2GAUA 4UV9A 4XSXF 5AIPA 1E17A 1HSTA 4HX7A 2BEOA 3IWZA 4BHPA 2VOPA 3K1NA 2LSOA 2M1BA 3CTAA 2V79A 4H0EA 2YX4A 4WF2A 3IL2A 1G6NA 4PDKA 3R60A 1WRJA 4PGGA 2KJBA 2DO7A 2D45A 2PN6A 4L5IA 4LG0A 5FLXZ 1HSJA 4G6DA 1ZRCA 3GFMA 3QU6A 4JBAA 1J5YA 4ASNA 4HAMA 1FC3A 2V1DA 2RC4A 1UB9A 5DUIA 1JHFA 4BH9A 5ICEA 1BC7C 3JTGA 1HW5A 4FT8A 1MDMB 1IN6A 2P7VB 3FMRA 2F5EA 2HWVA 3P9IA 2EJRA 3KFWX 4YFKF 3HSEA 3FF5A 5EEGA 5F1RA 2HKXA 4FX0A 1XCBA 3ML6A 6PAXA 4XSZF 3M8FA 2PLYA 5AIQA 1RNLA 1LB2A 3QP6A 3RI4A 1PDNC 3P9CA 2YR2A 1BI1A 2E1CA 4HDVA 3LSTA 3FMQA 3CO6C 1B6AA 3F8FA 3J81K 1S6LA 5ILUA 2KJCA 4WCGA 1B1BA 1G3WA 4AIHA 4TV7A 2QBYA 1XGOA 3E5QA 1LEAA 1UHMA 1P6RA 1P4AA 1UHWA 3HIFA 4AD9A 2R7DA 3K9TA 1W7PB 4JK1X 4KMUX 2L02A 3CUOA 3RDIA 3JAMZ 4ON0A 5LEKA 1WSUA 4Q48A 1U6GA 1R5HA 4HF1A 5CVVA 5TJJA 2DW4A 1YW9A 2J5OA 1S29A 3GLXA 1ON1A 1OKRA 3L00A 3V7RA 1Q1HA 3WTYC 1XMAA 3I53A 2VE9A 1H0MA 1IF1A 3J80Z 4I0BA 1YTYA 2Y75A 3K2ZA 1DPUA 2IT0A 2BBYA 4ESBA 4N0BA 2DTRA 2P7CB 3ABUA 4PZJA 1MZBA 3BZ6A 3OOPA 1K7AA 2COMA 5D4RA 1UFMA 1ZN2A 3F8BA 3CUQA 2EK5A 5CLSA 1WI9A 4KICA 3QAHA 1KQ8A 2YX7A 2Z99A 3VODA 4YIIA 2A5YB 1FZPB 2MC3A 3BPXA 1CGPA 5K5RA 3SFZA 2EFOA 2EFQA 3MZYA 1K78B 3R0JA 1R58A 2LDUA 3KE2A 4G94A 1I1SA 2HKOA 4I0AA 2FBKA 4LFUA 1YG2A 2DQRA 2GWRA 2V6CA 3GXOA 2WV0A 3TDZC 2K27A 1GXPA 1ZLKA 1U5TB 2A69F 3FXQA 3ZN0A 5CVIA 4O6JA 3DKWA 3W6KB 1PP7U 1YYVA 2Q2EA 5ERIA 2EFNA 5TRDA 2H6CA 3IWFA 5K5QA 4HLXA 1J75A 1EH6A 1C0WA 4U0VA 4PGHA 3ZMVA 2PI0A 2RDPA 1XGSA 3DP7A 5F6FA 1MJBA 3BJAA 2M5WA 2TDXA 2DFIA 2ZO4A 2K86A 1STZA 3M9AA 3IRRA 2UWMA 4UXNA 1T2KA 4I7HA 3MAJA 1YW8A 5E8IA 4EJWA 2CO5A 4HV6A 4A0YA 4MQ9F 3WU0A 3I59B 2M30A 4EJUA 2V1XA 1W7PA 3WODF 3VB2A 1X3UA 4OIOF 4AIKA 1TTYA 2O3FA 3KP7A 4RAZA 2VBWA 1G3SA 3G3ZA 3ULQB 3GF2A 4HBLA 3QPHA 3VFZA 4ETSA 5D5UB 2IA1A 1ZYRF 3BJOA 1OYIA 4G7OF 1ZG3A 1KU2A 2CFXA 4M72A 1D8JA 2UZKA 2QUFA 5LGUA 4AWXB 3QU3A 3HRSA 4U0WA 3IHUA 1XDSA 1V3FA 3TGNA 3LA2A 2DAOA 1BBYA 4OINF 3VEPA 2NNYA 3F3XA 4RGRA 4P55A 3DXJF 2Z3YA 4RB3C 2MLGA 3F8CA 4U7DA 5BS6A 3RKWA 2ZMEB 4A2UA 1SD4A 4CGZA 2PJPA 2OU2A 3GW2A 1XSVA 3KETA 2CG4A 3D0SA 3GO5A 1LVAA 1ZRDA 1KU7A 2NS0A 3PQKA 2HEOA 5D5WB 3F22A 3P9KA 3T8RA 3V7CA 1G4DA 4KT5C 5LBQA 4D0PA 3KLNA 2V1UA 2DPUA 1SD5A 3ZPLA 3WTSC 1YS6A 2PMHA 5FLXK 4RAYA 5LGNA 2O6GE 1FSHA 1I27A 1HW2A 4IJAA 2FQ3A 1XDUA 4OIQF 1ZHFA 1YIOA 4K2EA 2CYYA 4NHJA 4HW0A 5ILVA 2ISZA 3HHHA 5D8LB 5IT9Z 1BI2A 1FBSA 2AS5F 3MZHA 3KEOA 1LEBA 3BPVA 4KIGA 5E18F 2BYVE 3MWMA 1VTNC 5JVTA 3HRUA 4GYIA 1O3TA 4Y17A 2HTSA 4KNYA 4MTEA 2XIGA 4G8XA 5HS7A 3MQ0A 2H6BA 1S7AA 1WQ2A 1D5VA 4YFNF 2OZUA 4ZZLA 5D6EA 2OBPA 1TBXA 1IN7A 4RB1A 3TO6A 1UCRA 4RB0A 3O3KA 2VONA 3DEUA 2ZNYA 3L7WA 5K1YA 2LF7A 1RUOA 1IW7F 3GFIA 1JE8A 1FWZA 1TW3A 2L4MA 5HS8A 4L0YB 5JR3A 1A04A 5HDKA 2PG4A 2BGCA 1YQAA 1D3YA 2FBIA 2ISYA 3FXRA 1FY7A 1U8RA 4A0ZA 4CO8A 3HHGA 2FEZA 3LAJA 3LQRA 1GHCA 3QPTA 2GQQA 4ENMA 2R7FA 3FZVA 1Z6TA 4KN7X 2RNJA 1ZGJA 2GXGA 3R61A 3OV8A 2W84A 5E1WA 1BOAA 1D8KA 3F8NA 5JHUA 2Q0OA 4P9FA 4UNOA 3CLOA 2FU4A 1LDKB 4KUMA 2DK5A 3GYHX 4WXDA 1JGSA 2E7XA 4EM0B 2FXAA 1IRFA