1T38A

Human o6-alkylguanine-dna alkyltransferase bound to dna containing o6-methylguanine
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
151
Chain Sequence
EMKRTTLDSPLGKLELSGCEQGLHEIKLLGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPSHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*CP*AP*TP*GP*(6OG)P*CP*TP*AP*GP*TP*A)-3'
publication title DNA binding and nucleotide flipping by the human DNA repair protein AGT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 32
structure length 151
sequence length 171
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2004-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01035 DNA_binding_1 6-O-methylguanine DNA methyltransferase, DNA binding domain
A PF02870 Methyltransf_1N 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1t38A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 1t38A01
1TQMA 4N9HA 2P4WA 3LFKA 4HQMA 3ABUA 3IKTA 3ZMZA 3J7AO 2DAOA 4RB2C 1GXQA 4G7OF 1WWXA 1SD4A 3GEZA 3HRTA 3R0JA 4GXOA 3SZTA 3CLOA 1O3QA 3DP7A 3E5UA 5KVRA 4ESJA 4KIGA 4HX8A 3D0SA 1KYZA 2LDUA 2VODA 5IT9Z 3TQNA 5DCMA 1ZAOA 4OMZA 1P4XA 3V7CA 1ZG3A 4NHJA 3H92A 3N97A 4IHTA 5TRDA 1QGPA 2Z5UA 2X0LA 5CVUA 5LRRA 4GCVA 5D8LB 1O7LA 5JVTA 5D5WB 2Q8KA 3LWFA 1GVJA 4JQFA 1TNTA 4LFUA 4P55A 5FLXZ 5AIPA 5J8CA 2OZ6A 1G3WA 4MNUA 1TW3A 3DKWA 2K27A 3VB2A 1OYYA 2QZ8A 3R60A 4UVBA 1Z6RA 2K86A 3I0TA 5LGNA 2MH9A 2VBYA 4UV8A 1KQ0A 4EGYA 3FF5A 3ULQB 3WTWC 1BOAA 6PAXA 3DQVC 2AS5F 1HW5A 2QQBA 3OV8A 5EEGA 3GZ6A 3SQNA 1ZRCA 3L7WA 1YS6A 2BEOA 4P5OA 1HQCA 4FHTA 5JR3A 1IRGA 3V8LA 3F22A 3HRSA 3FX3A 3J81K 3BJAA 4RGXA 1R7JA 2FF4A 3F8BA 1QO0D 3ZPLA 1FWZA 2RGVA 5LHGA 1KQ8A 3HRUA 3BZ6A 2R3SA 1HW1A 3WU1B 2A61A 2EK5A 3Q5FA 3RYPA 2MA3A 4A0YA 1R1VA 3BWGA 2G7HA 5CLSA 1TQIA 3TGNA 5ERIA 2EFWA 1S7OA 4HF2A 1Z05A 5DCFA 3ECHA 2HQRA 1TW2A 2IP2A 4LK1F 5LRSA 3KLNA 1I5ZA 2NYXA 1RNLA 1MJAA 1QZYA 1EH8A 2FMLA 2ZFWA 2VOOA 1W7PB 5D8KB 4I0BA 5DEQA 4KN4X 1U5TC 4MHGA 3RDIA 3K1NA 1USTA 3OOPA 2W84A 5F6FA 3QPHA 2O3FA 3GWZA 4FT8A 5CYVA 4ENNA 2F5DA 2XKOA 2BBYA 2F5FA 3MCZA 2O6GE 2L54A 5AONA 1A04A 2HYFA 1SMTA 4HDUA 2F2EA 5LHIA 1V4RA 2QYOA 4LLGF 1ZGJA 1MD0A 2IA1A 4WXDA 4XLPF 3KE2A 3HYIA 1XB4A 2HFHA 4XRFA 4G6DA 1HXDA 2NAZA 3GO5A 3I71A 2XAFA 4Y17A 4I02A 2VBZA 1T2KA 2OQGA 5BMZA 2FE3A 5D5XB 5FFZA 2FBKA 4M72A 1FLIA 5E1ZB 2MBFA 1PUEE 1R22A 1OYIA 1UFMA 1XN7A 3QRFF 1G3SA 3WE3A 5F1RA 1YFHA 5A2QK 2MH2A 1BM9A 2FRHA 2JSCA 2LF8A 1BN5A 2KIFA 2YPRA 2GIVA 2CSOA 3ZMSA 3E3VA 1IN7A 2DI3A 4U88A 2DTRA 2WWYA 1W5SA 4U7BA 1QPMA 2ZO4A 3QP6A 4LJZF 1IXSB 3MZHA 3MWMA 1XGOA 1MJBA 4MGRA 3LA3A 3H3ZA 3KEQA 1LVAA 1X3UA 4FX4A 3WE2A 3F3XA 3G3ZA 3F6OA 1OMIA 5DUIA 2LF7A 3F8FA 2D1VA 3CDHA 4CZZA 2EV5A 5K1YA 1XSVA 4U0VA 3M8EA 1FPQA 3L09A 3HOTA 2DPUA 1B59A 2OBPA 3ZP5A 4XSXF 3ZMDA 2XASA 5ILVA 2CW0F 1IN6A 1BI0A 4HLXA 3KP3A 3WTXC 3QPTA 2RKHA 5DUKA 1BBYA 2P5VA 3I4PA 1R36A 4I09A 3SXYA 4EV0A 2FNPA 1K6OA 2V9VA 1YW9A 2O03A 1PP8F 3PQKA 4HZFA 4ESFA 4B09A 5JFRA 1XDSA 4Y13A 1MJ9A 2FNAA 3IHUA 2ESNA 3SZPA 2D45A 3DPTA 5CJ9A 1SD5A 3U1DA 3HTUA 5LBQA 4KA4A 4HF0A 3QU3A 1WQ2A 3ECOA 1FYLA 5HLHA 4PDKA 2ZNYA 1UHWA 4MEXF 4R1HA 4HAMA 1B1BA 3NEUA 4A6DA 2M5WA 3MEXA 2DK5A 3MQ0A 1AOYA 2RV8A 4BHPA 1W4MA 5FFXA 1FOKA 2HKXA 2L4AA 1IUYA 4WWCA 5DCMB 2Q0OA 2RVCA 4EQQA 2KIMA 3HTSB 4IVNA 4KT5C 4K2EA 2E1CA 3E6CC 1LQ1A 5CVRA 1C0WA 1G6NA 1SFEA 1TTYA 4WX9A 3LA7A 4UUVA 2HEOA 1YS7A 3DXJF 4QWQA 1R5HA 1ZARA 4WXHA 3BJ6A 3RYRA 1K78A 3V7SA 1P4AA 3J81Z 3GFMA 3CUQA 3FXQA 3V8JA 5J8FA 1XMKA 1F5TA 2QQ9A 2ZMEA 1BIBA 2W57A 2RNJA 3J80K 4M9SA 3FWEA 1SFUA 3HRMA 4M9XA 4CHUA 2EWNA 5EEHA 1YTYA 4CXFA 4Q47A 3KP5A 1FBSA 3TDZC 2GZWA 3E6BA 2BV6A 5FO5A 3COAC 5ICEA 3EYYA 2UXNA 2EA4A 3CUOA 3BOQA 2BGCA 3QP5A 4LMYA 4AIHA 2XAJA 4M74A 2Z99A 3WGHA 4LK0F 2DPDA 2ZKZA 4BNCA 3T8RA 1U5TA 4LB5A 4RB1A 1USSA 2Y48A 1LEAA 4PGGA 1O7FA 2HOEA 1B9MA 1Z1DA 2EFQA 4A2UA 5D6FA 2ISZA 1KGSA 4RAZA 3WU0A 1F4KA 5ILSA 4LG0B 4WXCA 2K7LA 3T8TA 4UHTA 2RC4A 3HSRA 3C7JA 4AWXB 4R8HA 5E8IA 3I64A 4ETSA 5TJJA 5H6RA 3F21A 4L9VA 2XVCA 1ZREA 1KQ9A 3HIFA 3DV8A 1T38A 3K9TA 3B02A 3HHGA 3SFZA 2OU2A 4IRGA 2A6EF 4N0BA 2MLGA 2XIGA 1Y0UA 2B0LA 3KZYA 1LB2A 3T5XA 3FMSA 2KJCA 1LDJA 2D2WA 1J7KA 2V1UA 4RB0A 1HKSA 2HTJA 4RB3C 2J5PA 3U2RA 2XRNA 5D4RA 4EGZA 2OD5A 2P5KA 2VBXA 2YSRA 3MAJA 2LNBA 4I0AA 4MTEA 4EMSA 2FOKA 2DT5A 2HTSA 1FSEA 4RGRA 4OOIA 3V8KA 4ENJA 1FP1D 5A2QZ 4EJOA 5AIQA 3NRVA 4XLNF 4L0YB 4R79A 2KKOA 4ZYGA 1K79A 5BPDA 2RDPA 1BJAA 3GVAA 1JGSA 2PN6A 4S05A 4KYWA 2O61A 3P9IA 2FBIA 3GF2A 2QBYB 3CUQC 2VN2A 3WGGA 4LB6B 2PFBA 1Z7UA 4ZYEA 3PFIA 5L3FA 1XGNA 4BHCA 4A5MA 2E7WA 4UV9A 5BS6A 2GQQA 4OIQF 2FBHA 3F8NA 3WODF 4HX4A 2M30A 4L9JA 4NB5A 4M9ZA 2FEZA 2ADUA 5JHUA 1JHHA 3ZMTA 5HDKA 2FQ3A 4Q4ZF 2O0YA 4G7ZF 1ZGAA 2XAHA 1BC7C 3K0LA 2XROA 3S2WA 2COMA 4O5VA 3M8FA 5DV5A 1I1GA 2RQPA 3EETA 4H0EA 3KP4A 4EM2A 1NHAA 4ZZLA 4CDGA 2ESHA 3W6JB 4CYDA 4EM0B 4Q48A 3WTZA 3LAPA 3HOSA 2CG4A 5LEJA 1YQAA 5J6XA 4A5NA 2EFNA 2NRAC 4U7DA 2IRFG 2EV0A 3GLXA 2JZYA 2HKOA 2MD5A 5ED4A 2P7CB 1Z91A 5E1XA 1QBJA 4FX0A 1W5TA 5DYMA 4EJWA 1TQPA 1I27A 1Q1HA 1P4WA 4E70A 1O3SA 4Z2YA 4BYYA 5FD6A 3PQJA 1KYWA 4LLLA 3ZMVA 1IZ1A 5HOOA 5HLGA 4KMUX 2L3DA 1JXSA 1S3JA 4IPAA 1IXRC 2DBBA 4O6JA 2P6SA 2H94A 4U0WA 1H9TA 2NNNA 2ACJA 5BPIA 2HWVA 2VC1A 1GXPA 1ZRDA 2TDXA 3QU6A 1P6RA 3KP6A 2STWA 1BC8C 4TV7A 3CO6C 4G94A 1IW7F 2D1HA 3V4GA 2FXAA 1MDMB 2HS5A 3NQOA 4L9TA 2IT0A 3BPVA 1ONVA 5DDGA 3P9KA 1R1TA 3HSFA 1O3TA 1FYMA 2JTVA 3FHZA 4MQ9F 4RS8A 2M8EA 1JE8A 3ZMUA 5HS7A 2F5CA 3T1BA 1ODDA 3TO7A 3V7RA 4KFCA 1MZBA 3FXUA 3ROUA 1YW8A 3FXRA 2PLYA 1R1UA 1YG2A 3R4KA 3SHFA 3K1MA 3TOBA 4L0ZB 3HUGA 5LGUA 1W7PA 3C1DA 1ZHFA 3K1PA 3WTVC 2P5LC 1DUXC 3GUDA 4EJUA 2NNYA 3J80Z 5BOXA 1BIAA 1BI3A 4PGHA 4BXUA 1OKRA 3GZ5A 2L01A 2AXLA 4U0YA 1L3LA 4AD9A 2KJBA 1BI2A 5HS9A 2LKPA 3FMQA 4HX7A 3L2CA 4LLNA 1J75A 3JTGA 1UB9A 1SD7A 5CVIA 1E2XA 3CJNA 3O2PE 5ICFA 3GW2A 2GXBA 5KK1A 1KU3A 1ZN2A 4HYEA 5ICCA 2PEXA 1S6LA 2ZMEB 4ZZDA 1LNWA 1YYVA 2XAGA 2R7DA 2HQNA 5H6QA 2VE9A 2E7XA 2PBIA 4JBAA 2JPBA 2PMUA 1B9NA 4MQVA 3KFWX 4HV5A 3O6BB 1HW2A 1ZRFA 1F1ZA 3BJOA 4OIOF 1HKTA 1MGTA 2W25A 2DFIA 1LJ9A 5L3BA 1YIOA 5L3DA 2BYVE 3WGIA 1U5TB 3TDUC 4HV6A 2H27A 2Z9OA 5HLIA 3RKWA 1EH7A 5D4SA 2NS0A 1KU7A 2V1DA 4IRHA 4P96A 5CVVA 4AVPA 2ZBKA 2OQRA 2G7UA 1R5GA 1PP7U 1OPCA 2F5EA 4EVIA 2STTA 3R6SA 2VC0A 3I5UA 4CO8A 4EJTA 3LA2A 3TO9A 4HBLA 3I59A 2BE5F 2XAQA 3F8MA 1WI9A 4HQEA 4UVAA 2ZNZA 3IC7A 4JK1X 2EV6A 5FGMA 4M6XA 2JRTA 2V79A 1CF7A 2MC3A 3U9GA 1IF1A 3L9FA 4M6YA 2J5OA 4P9UA 4I2OA 2GWRA 2QENA 3F6VA 3IRRA 3FM3A 4ENKA 1G4DA 3ABTA 1U3EM 3R0AA 1P92A 1WSUA 1I6XA 2FSWA 1RIOH 3VOEA 3P9CA 4Y15A 3TOAA 3TO6A 3KCCA 1P2FA 2DQRA 2YX4A 2WV0A 1G3TA 4HLYA 3RIRA 3O3KA 2QWWA 4ZH4F 4I7HA 2CO5A 4A6EA 2H6CA 2V6CA 2DW4A 3WG9A 4ZYHA 3K2ZA 3FM5A 1SFXA 2M45A 2HDCA 1RZ4A 4LGWA 4YFNF 1IN4A 3LQQA 1RUNA 1B6AA 4M73A 2UXXA 1MKMA 3F23A 4YIIA 2OZUA 5IT3A 1OYWA 3W6KB 2OA4A 1TBXA 3WTUC 5L3EA 4L5IA 1FZPB 3LSTA 5D5UB 1L0OC 4P9FA 2DU9A 4LD5A 3LAJA 2PG4A 2GAUA 3IWFA 3I53A 3GYHX 3IL2A 4IRIA 1XSDA 2A07F 4PCQA 1J59A 3RTRA 5HDNA 1RI7A 1J5YA 4BQAA 3WTSC 1SMYF 2A5YB 2YU3A 2ZJ2A 1U2WA 2KRFA 1QZZA 4PZJA 4GGGA 4YFKF 1H9GA 4KIBA 4G7HF 1DP7P 2ZXJA 2UZKA 2EA2A 5H20A 5HVQC 4I98B 4YIFA 4GO1A 4ASNA 4RGSA 4HOBA 3T0YA 2V1XA 1S7AA 2CFXA 2HYGD 3FZVA 2IW5A 2IJLA 2X4HA 3I54A 4IHSA 5HDGA 2EB7A 4KN7X 3KLOA 1REPC 4G6QA 2JT1A 2DK8A 4L5JA 3IKVA 5F64A 1U8RA 3QOPA 1D8JA 3AAFA 3BPXA 3EQLF 4DQ2A 1CGPA 1FSHA 1ZG1A 4RGUA 1K7AA 1O57A 1U78A 2A68F 2GA1A 2K4JA 2VBWA 3RKXA 4HF1A 2RN7A 3CO7C 2Q2EA 3G73A 3M9AA 4DNCA 5LHHA 4MEYF 2GXGA 4Q5SF 4IF4A 4KICA 4WF2A 3JTHA 1JHFA 2YR2A 4OIPF 3RKYA 2GA2A 3ELKA 3JAMK 2H6BA 4BAYA 3M7GA 3D5LA 4L9NA 1ON2A 2EFOA 1VTNC 4LG0A 1XD7A 4IJAA 3BROA 1DPUA 3MFKA 3ZN0A 3GXOA 3BP8A 2OAZA 1ULYA 3JW4A 1F9NA 1LDDA 3DPLC 4F7ZA 3IRQA 1BI1A 2P7VB 1AWCA 3LQRA 2KIUA 1HBXG 1FY7A 2M1BA 1FYKA 1IRFA 1J2XA 5L3CA 1XCBA 1O3RA 2CQKA 2L4MA 1HSTA 2Y75A 1FBQA 3K69A 2VE8A 3QAHA 2QQAA 5IT9K 2JPCA 3KZZA 4OINF 2HGCA 2PMHA 1T6SA 2FA5A 3N4MA 2EFPA 4KMFA 3E5QA 1ZG5A 3BY6A 3JSOA 5LEKA 1QQIA 4KIFA 3ZQ7A 4A12A 1DDNA 4A0ZA 4XSZF 3VEPA 4YFXF 5FLXK 1SD6A 4KUMA 2Z33A 2VXZA 4EM1A 3MZYA 3GFIA 3E5XA 3EDPA 1YLFA 2PQ8A 4HA8A 1H0MA 2QM3A 2XKPA 3C3WA 4GYGA 2QBYA 1Z6TA 2E1NA 5D6EA 2ZCWA 4OIRF 3KP2A 4B8XA 1FNNA 2XV4S 4OMYA 1WRJA 3WTTC 1KU2A 2YX7A 2K4BA 1FT9A 2IA2A 1STZA 2FMYA 2XUBA 1IN8A 1D5VA 1FBUA 4RAYA 2WC2A 3KEOA 4MTDA 2IPQX 4KDPA 4O3MA 3H3UA 1YO5C 4WK8F 2C6YA 1IN5A 1TNSA 4AIJA 4S04A 1HSJA 4WCGA 3GFJA 4UXNA 1U6GA 3ML6A 3WTYC 4G8XA 1I1SA 1SAXA 2IA0A 4CICA 5CVJA 1ZLJA 3I59B 1R23A 1UCRA 3RI4A 1LDKB 1T0FA 5E8GA 3E6MA 2QUFA 1OR7A 1CF7B 2QVOA 2ETHA 3E97A 1GHCA 1ON1A 3KETA 1K78B 4CGZA 2WTEA 3JSPA 2G9WA 3CUQB 1KU9A 5DD4A 4ESBA 3BDDA 1LEBA 4ENMA 4QLCU 1XCVA 3L00A 3FMRA 1QNTA 1WKMA 3E6DA 2DQLA 3TKYA 1RUOA 1XMAA 1D3YA 1KA8A 4D0PA 1E17A 4L18B 2Y0MA 1TLHB 2XHKA 2O8XA 4HDVA 5E17F 2L02A 5E18F 2DLLA 2HR3A 1S8NA 3DEUA 1W7PD 3GFLA 5ICGA 1S29A 5FD5A 3IWZA 4M71A 2HZTA 1T98A 3RPUA 4YG2F 2IVMA 1G3YA 5JI6A 5LGTA 2A3SA 3Q9SA 2P8TA 4HW0A 4OU0A 3VFZA 3REOA 1MDMA 5E20A 2VT2A 3KP7A 3F72A 2LSOA 3I58A 2FU4A 3Q9VA 1UHMA 1V3FA 1FP2A 2P6TA 3DF8A 1XGSA 4G9YA 5L3GA 1YW7A 1XGMA 3CTAA 3C18A 1HKQA 2VONA 1R00A 2CYYA 2EJRA 2M87A 2XGXA 3F8CA 3HHHA 5DD8A 3GX4X 2H09A 1IAWA 1ZYRF 2QLZA 4A0XA 4BHBA 1ZH5A 1PDNC 2VT3A 2Z3YA 2DO7A 1FC3A 3VODA 4NQWA 1T39A 5K5OA 5FB2A 2ELHA 1ZLKA 4XBFA 4N9IA 2W24A 1B4AA 2MLKA 3ZN1A 3EYIA 1XSXA 4GYIA 2K02A 4BH9A 2A69F 4AIKA 4UNOA 3HSEA 4IXAA 5BQTA 2CGPA 3R61A 1J0RA 3ISPA 5K5RA 3B73A 1Z9CA 2PJPA 1DPRA 1J9IA 2A6HF 1FX7A 3RJPA 3M1EA 5ILUA 2UWMA 5D5VB 3DFGA 3P7NA 2W85A 3ERED 2ISYA 2PI0A 3EUHA 5K5QA 3RPQA 4UVCA 5LLQA 2CWEA 1EV7A 1R58A 5HS8A 2VOPA 4KNYA 3JAMZ 2R7FA 4ZYDA 4EJVA 5E1WA 1IXCA 4I01A 1D8KA 4ON0A 1EH6A 1XDUA
chains in the Genus database with same CATH superfamily
1TQMA 1Q1VA 3G1LA 2R7RA 4BE0A 4N9HA 2P4WA 1S9HA 3LFKA 4HQMA 3ZOBA 3ABUA 2PX9A 4JI3E 1DI2A 2Q1ZB 4QPOA 3IKTA 5IPAA 4L5EA 4BKXA 1ZELA 3LNQA 2LMDA 4R8OA 1TL8A 1WJPA 3ZMZA 5J47A 1IGNA 4R03A 3J7AO 2DAOA 4RB2C 3LSPA 1HLVA 2KPMA 3HPSA 1GXQA 4G7OF 2NVYJ 2CV0A 1WWXA 1SD4A 3GEZA 3HRTA 3R0JA 3RMPA 4GXOA 3SZTA 2K9LA 3FK6A 3G71I 4IZZA 2K7IA 4IHWA 2M34A 2FTXB 2NABA 2DMUA 2H1LA 3CLOA 1O3QA 4CH7A 1RKTA 3DP7A 4IHXA 3A2KA 2IAIA 2YTEA 1XTAA 3E5UA 4X62E 2HDWA 1R5ID 3ABLH 1N34E 2EM8A 2DDBA 5KVRA 3LOCA 4ESJA 5CQEA 3DBRB 4KIGA 2YTDA 3M3YJ 4IOAF 3J7AY 2AO9A 3RZDJ 1KZHA 4HX8A 3BR1A 5J3LA 3D0SA 5AASA 1KYZA 4C2UA 3HL2A 2EMCA 3ONQA 2LDUA 2VODA 1VQMI 5IT9Z 1AHDP 2IEKA 3THNA 1IDZA 2I5UA 3TQNA 3QOEA 4RLFA 3HQ1A 1PUFA 5DCMA 1ZAOA 4BDZA 4OMZA 1P4XA 4KT6A 5FKNA 3V7CA 4B1RA 1ZG3A 2N8GA 4NHJA 2OJED 3H92A 3ZQIA 3SJMA 3N97A 2MC5A 4IHTA 5TRDA 1WHUA 4LF5E 3JR9A 1QGPA 1MMGA 2K85A 2Z5UA 2EN1A 3OR2C 1TWHJ 2X0LA 5CVUA 5LRRA 1EJ9A 4GCVA 3ADJA 1AAYA 3S8PA 5D8LB 1O7LA 1QU3A 3CJTB 5JVTA 5D5WB 2Q8KA 1WFXA 2F4IA 2N8XA 3LWFA 4R2DA 1GVJA 2EP3A 1MMDA 1TNTA 4JQFA 2NUEA 4LFUA 2ZXWH 4P55A 1WH5A 1RKWA 5FLXZ 3RKQA 4HPQA 5AIPA 5J8CA 1TWFJ 2OZ6A 3HBLA 1G3WA 1Y6IA 2M4GA 4IL6C 2MKDA 1DP3A 1WJBA 2E1MC 4MNUA 1TW3A 3DKWA 4AM3A 2E2JJ 2K27A 3VB2A 1W5CC 4FTHA 3MMYB 3DCFA 1E3OC 2EINH 1OYYA 2QZ8A 2X6OA 3R60A 2LV2A 4UVBA 4GKJE 1Z6RA 2K86A 2AHQA 2LOOA 2ZSIB 2Z2SB 3I0TA 4XR6A 2KQRA 3FIGA 2R7OA 1JKPC 2Q8UA 4JYAE 2EM5A 4L8NA 5LGNA 2MH9A 1DU6A 2VBYA 4UV8A 1KQ0A 4EATA 3FF5A 4EGYA 3H35A 3ULQB 3WTWC 2GPIA 1BOAA 3ECRA 5AE1A 6PAXA 3DQVC 5H2FC 2AS5F 1HW5A 2R5YB 2QQBA 2EZ6A 3OV8A 3OYDA 2N3GA 2E5NA 1D1BA 5EEGA 4B44A 3GZ6A 1VQKI 2L7KA 3SQNA 3TMOA 1ZRCA 4DUZE 3L7WA 1YS6A 1HA8A 2BEOA 4P5OA 1HQCA 4FHTA 5JR3A 2EMWA 2EMZA 3A0BC 3I4MJ 5FJ8J 4Y4RA 1IRGA 3V8LA 2JVAA 2QF7A 3F22A 2DB2A 2RS6A 3HRSA 1YX5A 1TP4A 3KYLA 2R5ZB 4E7KA 1WHNA 3FX3A 1IG7A 3J81K 3BJAA 3CQZJ 5T6JA 4RGXA 1R7JA 2FF4A 5M3MJ 3F8BA 1WI3A 1QO0D 1OCZH 4CCLA 1JJ8C 4CUGA 5HNFA 3DF6A 3ZPLA 1FWZA 3E7LA 3FKJA 2ENAA 2ZMEC 2RGVA 2MDRA 4K0KE 2A05A 5LHGA 3CESA 1KQ8A 3HRUA 5E3OA 3HKZA 3BCAA 3BZ6A 2R3SA 3UK3C 1HW1A 4NUBA 3WU1B 4FETA 4PJNA 2A61A 2EK5A 1WJAA 1I94E 3Q5FA 2OPTA 3RYPA 3OS2A 2BY0A 2MA3A 3OYCA 4A0YA 1R1VA 2WY8Q 3BWGA 2G7HA 4OAZA 1J26A 5CLSA 2ZXHA 1TQIA 3TGNA 5ERIA 2EFWA 1S7OA 2EMFA 4HF2A 1Z05A 5DCFA 3ECHA 2HQRA 1TW2A 3KEYA 5FLMJ 2IP2A 4LK1F 1U9NA 5LRSA 2KZVA 3KLNA 1GQEA 1I5ZA 1IJWC 2NYXA 1AU7A 4JX4A 4D7NA 1RNLA 2LJUA 2JSPA 1MJAA 1QZYA 1EH8A 2VKVA 4A3JJ 2FMLA 3QODA 2ZFWA 3HUGB 4F3QA 2VOOA 1W7PB 2R7XA 5D8KB 4I0BA 5DEQA 4KN4X 1MSEC 3JREA 1LUJB 1U5TC 4MHGA 3RDIA 3G1MA 3K1NA 3S2DJ 2KRHA 1USTA 2VIXA 2EN7A 2EZLA 3S17J 2EOHA 3OOPA 2W84A 5F6FA 2CSHA 2EZKA 2UUBE 1ETKA 3QPHA 3JU0A 1WCMJ 1NG6A 1R4NB 2A5WA 2K40A 2MG4A 3MKWB 3KIOA 2O3FA 5J4VA 3GWZA 4FT8A 5CYVA 2X85A 1A1HA 4ENNA 5DM7F 2IBDA 2DT6A 1YRNB 2EMBA 2F5DA 2XKOA 4ZDPA 2BBYA 2F5FA 3MCZA 3Q0VA 2O6GE 2R93J 2L54A 5AONA 5HLTA 4RBOA 4G12A 1IO2A 3F6HA 3NWSA 3F0CA 3UKGA 1A04A 2DMPA 3V42A 2HHHE 1UG2A 2BBGA 2HYFA 1ZQ3P 1SMTA 5F04A 4HDUA 4X6AJ 2F2EA 5LHIA 1V4RA 2QYOA 3A1YA 3AG1H 3KPHA 2YU9J 4LLGF 1ZGJA 5J1UA 5A69A 2L2NA 2ICWG 3AUZA 3DPUA 5IOZA 2X6XA 1PJRA 2WAFA 1NCSA 3BF2A 2R92J 1BJZA 4JI7E 4CSWA 1LKXA 1MD0A 2W48A 1T56A 2IA1A 1X47A 4DR4E 2AQFA 1H89C 5F08A 4WXDA 2EOYA 4XLPF 2DA7A 3H0GJ 1EA3A 3KE2A 2EPPA 3HYIA 1GT0C 4XIDA 1HF0A 2ADRA 1MNEA 2JN6A 2EZIA 1XB4A 2X1CA 2HFHA 4JI6E 4BACA 4XRFA 4E4HA 2VJ5A 4G6DA 1HXDA 4XLEA 3OWTA 4DYRA 2NAZA 4W1UA 2JA7J 2F8BA 3GO5A 3I71A 2XAFA 4Y17A 5IYBJ 2X51A 2KDZA 4I02A 2EM7A 2X1DA 1FIPA 2VBZA 1RR7A 2TCTA 4DV1E 1T2KA 4DW6A 2OQGA 5BMZA 3IWDA 4LF7E 4QIWN 2FE3A 3UNGC 5D5XB 5FFZA 4BL0B 1FOWA 1YUJA 1YUIA 2FBKA 4M72A 3LSKA 1WVRA 1FLIA 5E1ZB 2MBFA 2JK3A 1R22A 1PUEE 1OYIA 1UFMA 1XN7A 3QRFF 4O43A 1G3SA 3TBIA 3PO3J 3WE3A 2UXBE 1WJFA 5F1RA 4XICA 1YFHA 2M1SA 2NUGA 4HNUA 5A2QK 4BEHA 2UU9E 2MH2A 1BM9A 4PJMA 1R49A 2FRHA 2JSCA 3S2HJ 2LF8A 1BN5A 2VXDA 5IP7J 3LMLA 5A6BA 2KIFA 4X64E 2YPRA 4X8WA 1GZ6A 5GADJ 2QSGX 1YPNA 2GIVA 2CSOA 2HU9A 3LSHA 3ZMSA 3E3VA 1ETXA 1UJ8A 1N75A 3SFIA 2X48A 1IN7A 3C6KA 2M2EA 3J7YJ 3L2UA 2DI3A 4U88A 1QVTA 2DTRA 2XRLA 3SZGA 4ZDOA 3K2AA 1FMVA 1HCRA 2WWYA 1W5SA 4U7BA 1FEXA 1FTTA 1X1BA 2DIXA 2V8QB 2B63J 1QPMA 2ZO4A 5FKMA 2VE7C 1JT6A 4E7LA 1AKHB 2EPKX 3QP6A 1X2NA 4EEFG 4LJZF 3TW7A 1IXSB 4GEQB 5C44J 4LG3A 3MZHA 1SVLA 3MWMA 3CF2A 3U1KA 3G1OA 3MKLA 1YITI 1RETA 1POGA 1XGOA 5GP9A 3S15J 1MJBA 2DJNA 2DFFA 4MGRA 1OCRH 2VB6A 3LA3A 1FTZA 1ZBQA 3H3ZA 3KEQA 1LVAA 3OL4A 1X3UA 4FX4A 4FK5C 2E2HJ 3WE2A 5EGOA 4A3FJ 3K4CA 3MVPA 3F3XA 3G3ZA 5E3LA 1XNRE 3F6OA 1OMIA 5DUIA 2LF7A 3AV0A 4TUIA 3OTOE 3W3CA 3O8HA 3F8FA 3FXJA 5F0FA 1UHZA 5BNGA 4CCOA 4PFOA 3MHSC 2D1VA 4JI8E 3CDHA 1ZK8A 4B3TE 4CZZA 3NWTA 3EPJA 2EV5A 5K1YA 4IX7A 2EMIA 1MIJA 2CS3A 2VQCA 3CC7I 1XSVA 1RMDA 4U0VA 3M8EA 4J00A 1FPQA 2LK2A 3L09A 3BZKA 3HOTA 2DPUA 2HOSA 4DYCA 1B59A 2OBPA 4Z6YA 4BE1A 3ZP5A 2JMWA 4XSXF 4I6ZA 3ZMDA 1VQOI 1SANA 2XASA 5ILVA 5DS9A 3AG2H 2CW0F 1HOMA 5A6BD 1IN6A 1BI0A 3W2AA 4HLXA 3SDBA 2EN6A 5A6JA 2QQ8A 3KP3A 3WTXC 1G2DC 3IV5A 2LH9A 3QPTA 4MLQA 1F43A 2RKHA 4PJ0C 5GTIC 5DUKA 1BBYA 5C3EJ 4JV5E 3SDGA 4BBRJ 2P5VA 1IBLE 4AQYE 1UHSA 3I4PA 1OCOH 1R36A 4I09A 3SXYA 4EV0A 2FNPA 2A6TA 1T95A 2HDDA 2L6MA 4AC0A 3SEQA 4J01A 1K6OA 2V9VA 1YW9A 3FDYA 4LTYA 4WSGA 4XORA 4D7MA 2O03A 1YJ9I 3K4MA 3CCEI 1PP8F 3PQKA 4HZFA 3GTKJ 2V9PA 3W2WA 3K10A 4B09A 4ESFA 5JFRA 1XDSA 4BE2A 4Y13A 3MD2A 1N32E 2D5VA 4I8OA 2HYJA 2ODRC 2Y30A 1WJ5A 3HKZN 1JI8A 3HPHA 3ZXSA 1O4XA 1MJ9A 2E19A 2FNAA 4XRSA 3IHUA 2ESNA 2K9MA 3SZPA 3DPTA 2K3FA 2D45A 5CJ9A 2R7UA 1SD5A 5GPAA 2EMXA 1A1KA 1DU0A 3U1DA 1NTCA 4DZPA 3HTUA 2YTQA 5LBQA 4X0GA 3K4LA 1UG0A 3CMMA 1ZKGA 1JK2A 4KA4A 2LE2A 4HF0A 3QU3A 1BB8A 5FRNA 1WQ2A 3ECOA 1FYLA 5HLHA 1VQ6I 1T8IA 4R2RA 3RZOJ 3M4OJ 1EF4A 4PDKA 4XNFA 1W36C 2ZNYA 3I55I 4WFTA 4DR6E 2K3PA 2ZJPF 3CCUI 1UHWA 4IO9F 1ZR2A 4MEXF 4YHHE 4R1HA 4HAMA 4LF8E 4DR7E 1TT0A 2CUEA 1B1BA 3NEUA 4A6DA 2V86A 2M5WA 2QCOA 4O24A 3C2BA 2VKDA 3VSLA 2ECBA 3JRCA 3MEXA 1OLTA 2DK5A 4BUPA 3MQ0A 4F93B 1AOYA 2RV8A 1UELB 3BTIA 4IQ4A 4BHPA 1ETWA 1W4MA 2GM4A 2OV7A 2L9RA 5FFXA 1MH4A 1QHHD 2YSOA 3GTGJ 5KL5A 4BY7J 1I6HJ 3ZRGA 2HKXA 2L4AA 2E60A 1FOKA 1IUYA 3H1CA 4JP0A 5K7FA 2LRSA 1PUFB 4WWCA 5DCMB 2Q0OA 2YTIA 2RVCA 4EQQA 3OYNA 3HTXA 2KIMA 3HTSB 4IVNA 3PNVA 4KT5C 4K2EA 3RPUD 2BOLA 4XKCA 2E1CA 3E6CC 1LQ1A 5CVRA 1C0WA 1G6NA 1K61A 1SFEA 1TTYA 2KP6A 4WX9A 1RR8C 5EG0B 5AC5A 3JAMC 1X2MA 3LA7A 2DLQA 4UUVA 1HC8A 4LIUA 1H88C 4JYKA 4WSPA 4CZCA 4E7IA 4M3BA 2HEOA 2VI6A 1N77A 3DLLF 1YS7A 3DXJF 5F3WA 2DA2A 4QWQA 1QZEA 1OQYA 4JX6A 1SVMA 1R5HA 2ENCA 2WZOA 1ZARA 4WXHA 3BJ6A 2WBMA 2L7ZA 1ETQA 3QPSA 3RYRA 5A6KA 1K78A 3HOYJ 3V7SA 1P4AA 1LE8A 5CPRB 3J81Z 4UUSB 2XC7A 3GFMA 5EJCA 3CUQA 2L7MP 3FXQA 2JVHA 4FASD 3DKXA 3V8JA 5J8FA 1XMKA 4RAFA 1UN6B 1F5TA 1ZU1A 2LYCA 2QQ9A 5TSEA 2BZTA 2ZMEA 1BIBA 2EZHA 2W57A 2RNJA 3BQZA 1GVDA 3PSFA 3FWEA 4M9SA 3J80K 1SFUA 2EPFA 3A02A 5J4YA 3HRMA 4M9XA 3HDDA 3B6CA 4CHUA 1KONA 3CLQA 2B7EA 3M8JA 3A01A 4BQNA 2EWNA 2YS9A 2H1KA 5LL6R 5IXMB 2UXCE 5EEHA 3OS0A 1YTYA 3DU6A 4CXFA 4Q47A 3KP5A 3LL7A 4N4OB 1YI2I 1FBSA 4MLVA 3TDZC 1VFCA 1IRZA 2GZWA 3E6BA 1FOYA 4CYCA 2BV6A 3I4NJ 5FO5A 3COAC 4DR2E 5ICEA 2L0KA 3EYYA 5IT9C 2UXNA 1JTYA 2YRHA 3BIDA 2EA4A 3PSIA 3S3MA 5B5EC 3CUOA 3BOQA 2BGCA 3QP5A 5ADZA 2HGHA 3DTEA 4LMYA 4AIHA 3TP3A 5GPCA 1JKQC 2Q2EB 2XAJA 4M74A 4XN0A 4Y3OA 5LMNE 2RNGA 1LFBA 2Z99A 3WGHA 4RHBB 4LK0F 2R7SA 2DPDA 1X6HA 2ZKZA 2EM2A 2ZFUA 1RESA 3BG9A 4BNCA 1DQ3A 3T8RA 2DA1A 2EMAA 1U5TA 2O5RA 2YUSA 4LB5A 1WGXA 1ETVA 3JRAA 4RB1A 2CPNA 1WXRA 2BY2A 3CCSI 1USSA 4A3MJ 3DTKA 3C2HA 2Y48A 3A4CA 3HG9A 2X6YA 1RPWA 1IV6A 2HJJA 5FLXC 2NVQJ 4IHYA 4BJ5C 5IY5H 1LEAA 4PGGA 4C3IJ 1O7FA 2HOEA 3PFYA 2QGUA 2EOQA 4KJZA 3ZQGA 1B9MA 2HXIA 4NNJA 1X1PA 1Z1DA 2EFQA 2W82A 1R71A 4A2UA 3K70C 5D6FA 2L3JA 3ADGA 1PJQA 1HNZE 2ISZA 1KGSA 4HSRA 4RAZA 3WU0A 1QA6A 1F4KA 3HEFA 5ILSA 4LG0B 3CJQB 3BR3A 5IOYA 2HVRA 1E3PA 2VKEA 4HTGA 4WXCA 4II2A 1TWAJ 4RDUA 2I13A 1HR0E 2OF7A 4DR3E 1BR2A 2K7LA 2HOAA 4UHTA 2RC4A 3T8TA 2M3AA 5DM6F 4HRIA 4BMJA 2B9DA 3HSRA 3C7JA 4AWXB 4R8HA 5E8IA 1MSFC 3I64A 1WZ2A 4XQFA 5TJJA 5H6RA 4ETSA 1Z67A 3F21A 4L9VA 2XVCA 3SYTA 1ZREA 2CV2A 3G2BA 1KQ9A 3HIFA 3DV8A 3TEDA 1T38A 2ZXIA 3K9TA 3GTMJ 2EIMH 3QQAA 1ETYA 3B02A 4BC7A 3HHGA 3SFZA 2LJHA 2OU2A 2O9LA 3T1HE 3AG4H 4IRGA 1WJDA 2A6EF 4YY3E 2DOEA 4JOMA 4N0BA 2MLGA 2XIGA 1Y0UA 2B0LA 2ZSHB 3EPHA 4II3A 3KZYA 1LB2A 5EF6A 2EH3A 3T5XA 3FMSA 2R7ZJ 5CFFE 3JRBA 3CC2I 2E1OA 3L2WA 4HEA2 2KJCA 1LDJA 1K83J 1XMXA 2D2WA 1J7KA 2OTLI 2V1UA 4RB0A 1HKSA 5LD2C 2FV4B 2RPCA 2HTJA 1LFUP 1J5EE 4RB3C 1X48A 2J5PA 2DTZA 3U2RA 2IHR1 2RQQA 3OIOA 2XRNA 3ZOQB 2ELJA 4JI1E 4JI0E 5D4RA 4EGZA 2OD5A 2P5KA 2L3CA 2VBXA 2YSRA 4C9YA 3MAJA 2LNBA 4I0AA 4MTEA 4EMSA 5GAEJ 2YSPA 2FOKA 2XGCA 2DT5A 1U9OA 4D5CA 2M9HA 2BHZA 5FLVA 3JTZA 2L92A 2HTSA 1FSEA 4RGRA 3PUBA 4OOIA 2Y69H 2LG4A 3FXMA 3V8KA 1FP1D 4ENJA 2CV1A 4ZDLA 5A2QZ 4EJOA 4UY8I 2MSYA 3ZQCA 1N33E 5BR8E 4C2MJ 5AIQA 3D5SC 3NRVA 4XLNF 2Z1DA 2YTGA 1TZLA 2LY9A 4Y52J 4L0YB 4R79A 2WAEA 4V2FA 4L5NC 2KKOA 4ZYGA 1KJKA 2HVQA 5BPDA 2RDPA 1K79A 4GFBA 1BJAA 3GVAA 2NXNB 1JGSA 2PN6A 4S05A 4KYWA 2O61A 3P9IA 2P81A 3WG7H 1T4OA 2FBIA 2VPRA 2CH0A 2BW3B 2M7QA 3GF2A 2QBYB 4R2QA 2G0EA 3AL0B 3CUQC 4GDFA 1ITYA 2VN2A 3WGGA 4LB6B 1AA7A 1A5JA 2PFBA 1QVUA 1Z7UA 3VYRB 3HGGA 4ZYEA 2HI3A 2WBSA 3PFIA 5L3FA 1MEYC 1XGNA 5KAIC 4BHCA 5TGTA 3OYFA 4A5MA 1XX5A 2L8TA 2F6CA 2E7WA 1S72I 4UV9A 2QKMB 4XMYA 1W0TA 3FBIB 2J7JA 1R6RA 5GAHJ 5BS6A 2GQQA 4OIQF 2MC4A 1QHGA 2FBHA 5KCMA 1O0WA 2EOMA 3F8NA 1GLNA 3WODF 2KZGA 4HX4A 3OYBA 2M30A 2W4SA 2JPAA 4L9JA 4NB5A 4M9ZA 2FEZA 3OOUA 2ADUA 2ZJRF 4JI5E 1Z77A 5JHUA 2X1EA 2B7TA 1JHHA 3ZMTA 2EOJA 5HDKA 2FQ3A 1HNXE 2LO3A 2RSMA 4KZSA 3H09A 3PUFA 4NXME 4J19A 4LOCA 1RRJA 1FIAA 2R4GA 2O0YA 4QPQA 4Q4ZF 4G7ZF 1VQLI 3DJWA 1ZGAA 2XAHA 2CUFA 3ABKH 1BC7C 2WY7Q 3K0LA 2XROA 2WBUA 3S2WA 1XMQE 2EPMX 3CD6I 2COMA 4O5VA 2I8DA 5FKKA 4F9CB 3M8FA 5DV5A 4E7JA 3DEEA 4S0HB 1I1GA 2RQPA 3EETA 4B3RE 4H0EA 3KP4A 2LC2A 4EM2A 2IGOA 1K4TA 2LT7A 1NHAA 1JUSA 4ZZLA 2DLKA 1PJTA 4CDGA 2EL6A 3KZIC 4HSTA 2ESHA 4RA2A 3W6JB 1MW7A 1YX3A 1Z3XA 1P9QC 3HPZA 4CYDA 4EM0B 2DDAA 2LTRA 4Q48A 3WTZA 2LY2A 2CG4A 3LAPA 3HOSA 2RTXA 4FE4A 5LEJA 1YQAA 4DR1E 2ZJQF 5J6XA 4A5NA 2R7WA 2F4MB 2EFNA 2NRAC 2CMPA 3MN2A 2EPAA 4U7DA 1D0ZA 1Z3YA 4NZVA 2IRFG 2EV0A 3HB9A 3GLXA 2JZYA 2R7QA 3CF5F 2K9QA 4A69C 2EOXA 2HKOA 4X1EA 2MD5A 4H4KC 2XB0X 2L9SA 3E0JB 4IJDA 2KLOA 2M0MA 1BR1A 3IAS2 3E1SA 5ED4A 4XRMA 3CMAI 1XPXA 2P7CB 1Z91A 5E1XA 1UAAA 3KWRA 2EOFA 1QBJA 4FX0A 3PM1A 1W5TA 4XKBA 5KAFC 3F6GA 5DYMA 4EJWA 1OJLA 3C2GA 4LFBE 1TQPA 1I27A 1Q1HA 1P4WA 4E70A 1O3SA 4NC6A 4Z2YA 4BYYA 5FD6A 3S3OA 3PQJA 1KYWA 4LLLA 4E7HA 4YELA 1IZ1A 3ZMVA 5HOOA 5HLGA 4KMUX 2NVUB 2OCCH 4BQQA 2L3DA 2EOIA 2DRPA 1JXSA 1SAUA 1Z0XA 1QRYA 1S3JA 3L2RA 3K4KA 4IPAA 1IXRC 2DBBA 4CCNA 2R5YA 4O6JA 2P6SA 2H94A 2YT4A 1M1EB 2IS2A 4U0WA 1H9TA 4M2ZA 2NNNA 2ACJA 3S32A 3HJEA 2DMYA 1Y1VJ 5BPIA 3CDIA 2HWVA 2VC1A 1GXPA 1G2FC 1X4OA 1K6YA 1ZRDA 2TDXA 3QU6A 1P6RA 3KP6A 2STWA 1Y39A 3MZ8A 1PYVA 2ME6A 1F2IG 5FROA 3K6GA 3H5NA 1BC8C 1YJNI 1QU6A 1ZR9A 3OYIA 1STUA 2XB5A 1FOXA 1XMOE 4TV7A 4OWRB 1G59A 3CO6C 2YRKA 5B3SH 4G94A 2DYSH 2KDOA 3C4TA 2R5ZA 2ID3A 1IW7F 3S1RJ 3AG3H 2D1HA 1TF3A 3V4GA 5IYCJ 2CJJA 2FXAA 2ID6A 1ZTRA 2MABA 4FE7A 3OL3A 4A3EJ 5TISC 1MDMB 3C4BA 1BL0A 2HS5A 3NQOA 4L9TA 2YTOA 2IT0A 9ANTA 1Y0NA 3P5JA 4AVZA 1B69A 3BPVA 2LP0A 1ONVA 5LMUE 5DDGA 5FRMA 3P9KA 5EDNA 4B43A 1KYQA 1D1CA 2JXPA 3VHTB 1WH7A 3OYAA 1R1TA 3HSFA 1P7JA 2LRDA 3ZQHA 1O3TA 1U8BA 1V5FA 1FYMA 3FBNB 2XSDC 2JTVA 5IYDJ 3FHZA 1IBME 2ODRD 4MQ9F 1DGRM 2JA2A 4RS8A 2M8EA 5KHDA 1B72A 5F0CA 1LVKA 1X4PA 1JE8A 3ZMUA 4OOGC 1YYOA 2HNHA 2Y0SA 5HS7A 2F5CA 3T1BA 3GLLA 2VLAA 3VYUB 2FD5A 1ODDA 3BT9A 3TO7A 3V7RA 4KFCA 1MZBA 2E1MB 2VJJA 3FXUA 5M3FJ 3ROUA 1YW8A 2QSFX 3BBGA 5A6AA 3BR6A 4UB6C 1OCTC 3FXRA 3GMEA 3W2VA 2PLYA 1R1UA 1YG2A 3R4KA 3SHFA 3BGHA 1V5EA 2FJ1A 3K1MA 3TOBA 2XF6A 1NH3A 2YU5A 2CTDA 4L0ZB 3HUGA 3LSMA 5LGUA 1W7PA 1W36D 2R76A 3C1DA 4RAGA 1ZHFA 3K1PA 3WTVC 2CW8A 2P5LC 1VI0A 1DUXC 3GUDA 4EJUA 2NNYA 3J80Z 1A35A 5BOXA 3EPLA 3K4JA 1UMQA 1Y56A 1BIAA 1BI3A 1W1WE 2F48A 4NQWB 3OY9A 3H3VK 4PGHA 4BXUA 4ABZA 2ZM6E 2DFEA 1OKRA 4Q35B 3GZ5A 2L01A 3DBHB 2GLIA 1N78A 2AXLA 2IXSA 3BG3A 4U0YA 4NHRA 3M99B 2FQ4A 2JA6J 5F0HA 4AD9A 1L3LA 2KJBA 5C4JJ 1BI2A 3ADIA 4NBQA 2HZDA 3OMYA 4RM3A 5HS9A 3CC4I 2LKPA 2WAQA 1IC8A 2EIJH 3FMQA 4HX7A 1VF9A 2HPMA 3L2CA 4LLNA 3DKYA 4A3BJ 4BS9A 1J75A 4GRIA 3JTGA 1UB9A 2DOFA 5KL4A 1SD7A 3ASNH 4XN3A 5CVIA 1E2XA 1A1JA 1TWCJ 2L33A 3CJNA 3O2PE 2HVSA 3ADLA 5ICFA 1LE8B 1IRXA 3GW2A 5FKLA 2GXBA 5KL2A 5KK1A 4ON0A 1KU3A 1ZN2A 4HYEA 4AYBA 2PEXA 5ICCA 1S6LA 3H9JA 2V89A 3ASOH 2EM4A 2ZMEB 4ZZDA 1OFCX 1HNWE 2R7VA 2EL5A 1D0XA 3M07A 1ZGWA 4M0VA 1LNWA 5E79C 1YYVA 1A1FA 3VYTB 2XAGA 3OIPA 3VSKA 2DA3A 3A01B 4GZNC 2R7DA 2EMYA 4DV3E 2HQNA 3OSFA 5H6QA 3S14J 4A3KJ 3BTCA 4UUTA 2VE9A 2E7XA 5JHFA 2PBIA 3VWBA 1N3GA 1A31A 4J8ZA 4JBAA 3L2QA 3OSGA 2JPBA 2E5ZA 4CYCB 4F54A 2PMUA 1B9NA 1JKRC 4MQVA 1SFKA 3KFWX 2JRMA 5KL6A 4HV5A 3O6BB 2ELYA 1HW2A 2Z16A 4V2GA 3LSJA 2JYAA 4R2PA 2KMUA 2VUMJ 1ZRFA 1F1ZA 2GBYA 3BJOA 4OIOF 3D1NI 2PJRA 1HKTA 4JI2E 4X65E 2EPLX 4F9AB 4LF9E 2TRTA 1MGTA 2W25A 2DFIA 4M3DA 1LJ9A 2KRCA 5L3BA 1YIOA 4A3DJ 3ZCOA 3T1YE 5L3DA 2BYVE 3WGIA 1U5TB 1MNDA 4D9JA 4IOCF 2OTJI 2EM6A 1LFPA 2EM0A 3TDUC 4HV6A 2H27A 2ECCA 4HEIA 2Z9OA 1VQ5I 2M4IA 1UILA 4QSHA 5JVGF 2EOOA 2EPNA 5HLIA 3U21A 1JKOC 3RKWA 1EH7A 5D4SA 2EWLA 2NS0A 1KU7A 1J09A 2V1DA 4IRHA 4P96A 5CVVA 2JUGA 4AVPA 2ZBKA 3HOWJ 2OQRA 4BXXJ 2NA2A 2RQLA 2G7UA 1R5GA 1PP7U 3J81C 4ITVA 1OPCA 2F5EA 4EVIA 2WCC3 2V7FA 3R6SA 2STTA 2VC0A 3S93A 3BQYA 4BQOA 1Y8RB 5F27A 2MW8A 3I5UA 4CO8A 1XC5A 2CQ7A 4OAYA 3AKZA 4EJTA 1WHQA 3LA2A 3TO9A 5IWAE 3VPRA 3GTQJ 4HBLA 1S5LC 2QEXI 2RS7A 3I59A 1ZR4A 2BE5F 1IDYA 3OR1C 2XAQA 3F8MA 4A3GJ 3IUOA 3K70D 2H8WA 1WI9A 2R1FA 4HQEA 1A1LA 4HNTA 1BOBA 2EM3A 3MKZA 3K7AJ 4UVAA 2ZNZA 4F6NA 3IC7A 1JUPA 4JK1X 3CCLI 2K4VA 4KITB 2EV6A 2M4KA 3LMMA 5FGMA 4M6XA 2JRTA 2V1NA 2V79A 3ZGKA 1UZCA 1CF7A 2MC3A 1I3QJ 4CA0A 3U9GA 2CT1A 1IF1A 4M30A 2EQ0A 3L9FA 4M6YA 2DMNA 3QYFA 4XKWA 2J5OA 2L2OA 4BXFA 4P9UA 4I2OA 1S7EA 2GWRA 2QENA 2GOXB 2V4JC 3F6VA 4R2AA 2CRGA 1D1AA 1SR9A 3IRRA 4YEJA 4M9VC 3HC7A 4I76A 3FM3A 2M9AA 3NARA 1N36E 4ENKA 1G4DA 4IKFA 3ABTA 2Y9YA 4F91B 3R0AA 1U3EM 1P92A 2DMTA 3CCRI 1WSUA 2DN0A 1X58A 4XOTA 1VZ0A 1I6XA 2FSWA 1RIOH 3VOEA 3P9CA 4PSWA 2KOUA 4Y15A 3TOAA 2F5VA 2WB1N 1LPQA 2XGEA 4ZTFA 3TO6A 3KCCA 2NVXJ 1P2FA 3RQ4A 5KL7A 4DV6E 2KT0A 3HZJA 2DQRA 2AXTC 3CP2A 2KFDA 3LSIA 2YX4A 1MMNA 2WV0A 1T0FC 1Y8QB 1G3TA 4RLQA 2V85A 2F4VE 5F1JA 2RREA 4HLYA 3RIRA 3O3KA 1DQUA 2QWWA 1W0UA 1MNMC 2XPWA 4ZH4F 4B3AA 2EPUA 1BBGA 4I7HA 1IQSA 2CO5A 3CCQI 2HOTA 4XLAA 3EPZA 2H6CA 4A6EA 4D5FA 4LF6E 4BCAA 2V6CA 3Q0WA 2DW4A 4AUXA 3WG9A 4BJ6C 4ZYHA 2V9KA 2IGNA 4IQJA 4DKKA 2XF7A 3K2ZA 3OYLA 2L7FP 1SFXA 2M45A 3FM5A 2HDCA 1RZ4A 4LGWA 3HPGA 2NS8A 1ZAAC 2Y2ZA 2KHMA 1IN4A 3ERMA 3LQQA 4YFNF 2EOSA 1RUNA 1B6AA 4M73A 1IQOA 2WBTA 2UXXA 2YTPA 1MKMA 3F23A 4YIIA 2OZUA 5IT3A 1OYWA 1NEIA 3W6KB 3PNTA 2OA4A 1FJLA 1X6EA 1TBXA 3WTUC 1FJGE 2I10A 3BTLA 5L3EA 4L5IA 1FZPB 3LSTA 5D5UB 4WYQB 1L0OC 4P9FA 2DU9A 2EMKA 2EPOA 4B3SE 2YWQA 2Y9ZA 2XPUA 4LFAE 4HG2A 4LD5A 3LAJA 3HOUJ 2PG4A 3QG5C 2GAUA 2LUPB 3IWFA 3H5AA 1A6QA 3I53A 3M1CA 3OYEA 5KL3A 3GYHX 3NAUA 4PJLA 3IL2A 2LD5A 4IRIA 2Y0SN 1XSDA 4R2CA 2A07F 4PCQA 1J59A 4WPYA 3RTRA 2DJIA 2LKSA 5HDNA 5J40A 3GTJJ 1RI7A 3O8GA 1X1AA 1J5YA 4DIQA 2VPLA 4BQAA 1YE9A 2QSHX 3WTSC 4TUGA 1SMYF 2A5YB 3WHCA 2YU3A 1BW6A 2ZJ2A 1A6IA 1OCCH 1U2WA 3OYHA 2KRFA 2V26A 1X49A 2YRMA 5HODA 2DGCA 1YSAC 4F92B 4CCJA 3J7ZI 1QZZA 2V6EA 2XGDA 4PZJA 3H36A 4ANJA 1B8IA 4BC9A 1WJCA 2W7NA 4GGGA 4YFKF 3QWLA 5E3NA 1H9GA 4KIBA 4G7HF 4BJTA 3PJRA 2YTFA 2P0WA 4DBQA 5A2QC 2YU8A 2HPIA 4MFDA 3LFUA 1DP7P 5EEAA 2EL4A 4LIVA 2VQLA 2UUZA 1CQTA 4XM3A 2ZXJA 2UZKA 3ZQLA 3KX2A 1T08B 2EA2A 2BB8A 1Z7LA 4AIDA 4O5GA 3B6AA 1Z21A 1I39A 5H20A 2WAQN 5HVQC 1VQNI 2LCEA 2M7BA 2JA5J 2EORA 4I98B 1X1CA 3L2VA 3W6VA 4YIFA 2GIZA 2BY3A 2CU7A 2NUFA 1MBEA 4GO1A 5EG0A 1PJSA 4BBSJ 4ASNA 4DYQA 4JX5A 4HOBA 4RGSA 2XAUA 1I50J 3T0YA 2CW7A 2V1XA 1A1GA 1S7AA 2CFXA 2HYGD 1ZBTA 4AYBN 2JUCA 3FZVA 2IW5A 2IJLA 2EQ1A 2YPNA 2H8RA 2X4HA 3I54A 5CQGA 2PMZA 4IHSA 2ELZA 2MDGA 5HDGA 2EB7A 4KN7X 3KLOA 1REPC 4UUSA 4G6QA 2LTSA 2JT1A 2DK8A 4L5JA 3BR0A 5AE2A 3IKVA 5F64A 4M3EA 4LF4E 1U8RA 2JP9A 2IS1A 2NOGA 3GBGA 5AE3A 2VQFE 3CCYA 3QOPA 2LY1A 1OISA 3BLYA 2DMQA 2KONA 2DCEA 3VYXA 1EKEA 2VQGA 1D8JA 3AAFA 4G6TB 3BPXA 3EQLF 4DQ2A 1G2HA 3I56I 2FGGA 1GV5A 4Y33A 1CGPA 1FSHA 1ZG1A 1TWGJ 5EZGA 4A3LJ 3CCVI 4RGUA 2PRTA 3A03A 2UUAE 4XOPA 1K7AA 5LFAA 2M8GX 2EMHA 1O57A 1NK3P 1YHQI 2OUMA 1U78A 2I9IA 2A68F 2GA1A 2K4JA 2DOAA 2VBWA 4X9JA 2WV1A 2JY9A 2ZB9A 2LBFA 3RKXA 4HF1A 2B9SA 2RN7A 4DV4E 3CO7C 2EE8A 3EQ1A 3FXKA 1AH5A 4PUSA 1IBKE 2M7AA 2Q2EA 3G73A 1NK2P 3M9AA 4XRSG 4F52A 2MD0A 2LLKA 3QPLA 4BEHB 1T33A 2E35A 2DYRH 3ZQFA 1IMUA 3H5RA 1SC7A 1VQ8I 4DNCA 5LHHA 3MSWA 4MEYF 3GTOJ 2JWTA 2GXGA 5EZHA 5B66C 1ORKA 1BR4A 1X19A 2GHFA 4Q5SF 2E71A 4IF4A 2DA4A 3BG7A 3PL8A 4KICA 4WF2A 4IS1C 2N3HA 3JTHA 2YTJA 1JHFA 2YR2A 2BVMA 3JCUC 4YRVA 3L1PA 4OIPF 2CUJA 3EUHC 3RKYA 2GA2A 1TT5B 3ELKA 2E2IJ 3JAMK 2H6BA 4BAYA 1B72B 3M7GA 1DGWY 3D5LA 4L9NA 3P1XA 1ON2A 2EFOA 3TQMA 3G4SI 4DGWB 1VTNC 4LG0A 1XD7A 4IJAA 3BROA 1XG1A 1DPUA 2EIKH 1JTXA 5M5XJ 3MFKA 3ZN0A 3GTPJ 3GXOA 3GTLJ 3BP8A 3H0DA 3EUAA 2OAZA 3KYCB 1ULYA 3JW4A 3DU5A 2GOMA 1VNDA 2K9NA 3OYMA 5FKOA 1F9NA 1LDDA 3DPLC 4F7ZA 3IRQA 3FXLA 1BI1A 1I3AA 2P7VB 3HM5A 1AWCA 3DLAA 5C4XJ 2L9NA 4ZC3A 2E5LE 3LQRA 2KHXA 4BU2A 4PSXA 4D1QA 2ZC2A 3JRGA 1MH3A 2KIUA 3OIQA 3I9V2 3BTJA 3BR5A 5EGOB 2W00A 5HNHA 4KWYA 4F2JC 1HBXG 2JOBA 2LVSA 1FY7A 2B3TB 4E7ZA 3KYDB 1ENHA 1HDDC 1PKPA 2EN8A 2E36A 2LVHA 3A0HC 2EMLA 5K7ZA 1LLMC 2M1BA 2VQHA 1FYKA 4P78A 1IRFA 1J2XA 2VKHA 5L3CA 4JI4E 1XCBA 2K9SA 2QA4I 4MLOA 1O3RA 2CQKA 2L4MA 1HSTA 2Y75A 3IH3A 2LBSB 3CDLA 1FBQA 1H8AC 2EBIA 3I3LA 3WU2C 5B1AH 1YJWI 2EPZA 1TN9A 2JWOA 2DFHA 3K69A 2VE8A 3QAHA 2QQAA 5IT9K 2JPCA 3KZZA 4OINF 3RQIA 2HGCA 3X2QH 1T4NA 2PMHA 4RH8A 2LTPA 1NG7A 4AU7A 1U0JA 2LKXA 1T6SA 1SVOA 3K4BA 3RCOA 2FA5A 3UR3C 3N4MA 2L5QA 1RQ0A 1YYKA 2EFPA 4E7SA 4KMFA 2BVLA 3E5QA 1ZG5A 2NVTJ 1V5GA 2COBA 4O4KA 3BY6A 4DZJA 3JRIA 4U87A 2XDVA 3JSOA 2WB1A 5LEKA 2AQEA 1QQIA 3CP8A 4KIFA 2EILH 1P7IA 2KIQA 1V54H 4M6VA 3IWBA 1Y1WJ 3ZQ7A 4A12A 1DDNA 2L2KB 1YZ9A 4A0ZA 4XSZF 3VEPA 3Q3SA 4YFXF 5FLXK 1FMWA 1SD6A 3H9QA 4B3XA 1JT0A 4KUMA 4ZYAA 2VXZA 1X3ZB 4B48A 2Z33A 4XLCA 4EM1A 3MZYA 4MFEA 3GFIA 1VQ4I 1VQ9I 3E5XA 3EDPA 3S1NJ 2D9HA 4DV0E 2CUZA 3FHNA 4LITA 1VQPI 1YLFA 2PQ8A 4HA8A 1H0MA 2X6WA 2BW3A 2QM3A 3C3WA 2XKPA 4GYGA 4XLHA 3OYKA 2QBYA 1Z6TA 2E1NA 5D6EA 2E72A 1EKZA 1K4SA 2ZCWA 2DXIA 1YIJI 4OIRF 5GAGJ 3KP2A 4KHPE 4B8XA 1SFOJ 4F9BB 2WADA 2DA6A 1E3HA 3LSGA 2JA8J 3OS1A 1FNNA 2XV4S 4OMYA 3J80C 1MBFA 1WRJA 3WTTC 2PJRB 1N25A 1KU2A 3FXOA 4UB8C 4E6KG 2YX7A 2K4BA 4DV2E 1FT9A 1XS9A 3EUKL 2KL4A 2IA2A 1STZA 2FMYA 2XUBA 5GTHC 1IN8A 4A93J 1D5VA 2UXDE 3S16J 1FBUA 4RAYA 2RSIA 4GKKE 1PDAA 3IAM2 2WC2A 4Y7NJ 3HOVJ 3KEOA 3THOB 1MBKA 3JRFA 1X5WA 4MTDA 2IPQX 4KDPA 4O3MA 4V19K 3H3UA 1YO5C 1OCPA 3IH4A 3OYGA 4WK8F 2C6YA 4BY1J 2VQEE 1IN5A 1TNSA 2HQAA 2KISA 1P47A 4AIJA 4S04A 1HSJA 2Y31A 3H9GA 3HGYA 3J7AG 2EQRA 4WCGA 3BZCA 3GFJA 1TC3C 3CMYA 4UXNA 2EQ3A 4X66E 3VYSB 3CCMI 2R0QC 1ERDA 1BBOA 1U6GA 3ML6A 5JLWA 3WTYC 2VRDA 4G8XA 2M0CA 2VJ4A 4M3FA 1MMSA 1I1SA 4MIMA 3PNYA 2BHYA 1SAXA 3FISA 2FX0A 2IA0A 4CICA 5CVJA 4R2SA 2OCEA 4B47A 2MYSA 4DOZA 1ZLJA 3I59B 3Q0UA 1R23A 2ELKA 5IV8B 3VK6A 1Z1BA 1GDTA 1UCRA 4XLFA 2MC6A 2CQNA 3S1MJ 5IP9J 3RI4A 4FISA 1LDKB 2L2MA 3MKYB 1YRNA 5DNYA 1T0FA 4CCMA 2DODA 5E8GA 3E6MA 1BW5A 3CMEI 2QUFA 1OR7A 2YTNA 1CF7B 2VL8A 2PMZN 2VJIA 3ESWB 2QVOA 3ZQQA 4KISA 4DR5E 2ETHA 3TL4X 3D5RC 1MBHA 3E97A 5JLXA 1SEUA 1GHCA 2BY1A 1ON1A 3KETA 1WJEA 3F9KA 2MGQA 2EM9A 3BG6A 3DEWA 4RM2A 1K78B 4CGZA 2WTEA 5EYRA 3JSPA 1HDPA 2G9WA 1D5YA 3CUQB 4NC7A 1KU9A 5DD4A 3DWLE 4B4CA 4ESBA 3BDDA 1LEBA 2O7OA 2NOJB 4ENMA 4QLCU 1XCVA 3L00A 2R7TA 4N4RB 3FMRA 3FIWA 4W97A 1ACIA 4Q28A 4DV5E 1QNTA 4CCKA 5J1YA 1WKMA 1X1DA 1RC7A 3E6DA 3JRHA 2DQLA 3TKYA 1RUOA 1XMAA 1D3YA 1KA8A 4D0PA 1E17A 4L18B 1X3WB 4XONA 2Y0MA 3GZNB 4NDLA 4LU9A 1TLHB 2XHKA 1JJ6C 2QKLB 1GTKA 3ABMH 2EN2A 1VQ7I 1WPKA 2O8XA 4FCYA 1APLC 4HDVA 5E17F 2L02A 5E18F 2EN3A 2DLLA 2HR3A 1S8NA 1QPIA 4P1WA 3DEUA 1W7PD 3GFLA 5ICGA 1A36A 1S29A 3ZR8X 4DUYE 5FD5A 3IWZA 3HOZJ 2EPXA 4F6MA 3IP4B 4LFCE 3BG5A 5IP6A 1F36A 5B1BH 4M71A 2BXYA 1IUFA 2HZTA 1T98A 2GXAA 4A3CJ 3HXLA 4NC8A 1JGGA 3RPUA 3IH2A 4YG2F 3K4NA 2IVMA 5DTDA 1G3YA 1G8XA 5JI6A 5LGTA 2OC6A 4HNVA 2A3SA 3Q9SA 2P8TA 4IEJA 4HW0A 4OU0A 2A25A 2JVGA 3VFZA 2MFZA 1UBDC 1L4SA 3REOA 2FOWA 4PJJA 1D0YA 1MDMA 1JUMA 5E20A 3DTIA 3CJRB 5M5WJ 2LMZA 1R9TJ 3DBLB 3SEZA 2VT2A 1ETOA 3KP7A 3F72A 2HQ5A 2MKNA 4C30A 2LSOA 2NS7A 4QTRA 2RAEA 3I58A 3PIOF 2DA5A 4N4NB 2FU4A 2CQQA 5M5YJ 3Q9VA 2V87A 1UHMA 2VASA 3G6EI 2XF5A 1V3FA 4PFPA 1FP2A 2P6TA 3BC8A 3DF8A 2EOEA 1XGSA 4G9YA 4BGDA 2XSJC 2YZTA 5KNLA 4OX9E 5L3GA 4C2TA 2XPVA 3AL0C 1X6FA 5AC4A 4BDYA 3AFHA 1XNQE 1YW7A 2LR8A 1XGMA 1AKHA 3CTAA 2JOXA 3VDXA 4XK4A 4R2EA 3C18A 3IWCA 1HKQA 1PVEA 2E34A 2VONA 1BA5A 1R00A 2CYYA 2UUCE 2EOZA 2EJRA 2E1MA 3OMLA 1B8IB 2M87A 2F4OB 2XGXA 1IV8A 1TF6A 3F8CA 3HHHA 2VF1A 5E3MA 5DD8A 2WA0A 3OYJA 3GX4X 2FUG2 4C3HJ 2K5CA 2H09A 4F55A 2X9DA 1IAWA 1ZYRF 2DMIA 2IGMA 2QLZA 4A0XA 3GCMA 4BHBA 3JRDA 1ZH5A 1PDNC 1E0EA 3EPKA 3QYEA 4FQGA 2EPRA 2HC5A 1YOVB 2BXZA 2JR1A 2VT3A 2Z3YA 2DO7A 1FC3A 4ZJZA 3VODA 4NQWA 1T39A 3PO2J 2L9VA 5K5OA 2LREA 5FB2A 1YYWA 2LFBA 4C3JJ 2ELHA 1ZLKA 2V88A 4XBFA 2IS4A 4I99C 3QYBA 4N9IA 2W24A 1B4AA 2MLKA 3ZN1A 3EYIA 1XSXA 2V83A 3CCJI 4GYIA 2EPCA 2K02A 4YIRX 2EN4A 2IGKA 3BR2A 1FKAE 4BH9A 2GLOA 2A69F 4AIKA 2LUQA 4UNOA 2O8KA 3HSEA 4MO7A 2ME0A 4IXAA 3VYYA 1T4LB 5BQTA 3LSRA 2CGPA 2DT7B 3R61A 4A3IJ 1J0RA 2JQ7A 4DBRA 4ZTJA 1A1IA 3ISPA 5K5RA 3B73A 1Z9CA 2PJPA 1DPRA 1J9IA 4DJAA 5K7HA 1MBJA 2A6HF 3C6MA 3CZ6A 4M3GA 4IHVA 2CQXA 2B7VA 1FX7A 3RJPA 2ENHA 5CKTA 2DSYA 2UV1A 2IS6A 3M1EA 3TW6A 3TP0A 3PIPF 5ILUA 2UWMA 1OR7C 3S1QJ 5D5VB 1MMAA 1MBGA 2H36X 3DFGA 3K6QA 3P7NA 4B3ME 1DGCA 4PK4A 2JJ7A 2W85A 3ERED 2ISYA 2PI0A 2CFOA 3EUHA 5K5QA 3RPQA 4UVCA 3RSNA 3WHBA 5LLQA 2CWEA 3BCBA 3J7Yp 1EV7A 1R4MB 3FK7A 1R58A 4XL9A 5HS8A 2VOPA 4RMNA 1GV2A 1V55H 3JAMZ 4KNYA 5J1RA 3N05A 2R7FA 1GUUA 4ZYDA 3MHHC 3LLHA 4P7DA 4EJVA 5E1WA 2EJ4A 1X3CA 1IXCA 4I01A 4XKVA 4DMIA 3S3NA 1JK1A 4NXNE 4DV7E 3HOXJ 2W1OA 1D8KA 4BBYA 2HXOA 2LBFB 3FKIJ 1RC9A 1EH6A 2EMGA 1XDUA
chains in the Genus database with same CATH topology
1TQMA 4N9HA 2P4WA 3LFKA 4HQMA 3ABUA 3IKTA 3ZMZA 3J7AO 2DAOA 4RB2C 1GXQA 4G7OF 1WWXA 1SD4A 3GEZA 3HRTA 3R0JA 4GXOA 3SZTA 3CLOA 1O3QA 3DP7A 3E5UA 5KVRA 4ESJA 4KIGA 4HX8A 3D0SA 1KYZA 2LDUA 2VODA 5IT9Z 3TQNA 5DCMA 1ZAOA 4OMZA 1P4XA 3V7CA 1ZG3A 4NHJA 3H92A 3N97A 4IHTA 5TRDA 1QGPA 2Z5UA 2X0LA 5CVUA 5LRRA 4GCVA 5D8LB 1O7LA 5JVTA 5D5WB 2Q8KA 3LWFA 1GVJA 4JQFA 1TNTA 4LFUA 4P55A 5FLXZ 5AIPA 5J8CA 2OZ6A 1G3WA 4MNUA 1TW3A 3DKWA 2K27A 3VB2A 1OYYA 2QZ8A 3R60A 4UVBA 1Z6RA 2K86A 3I0TA 5LGNA 2MH9A 2VBYA 4UV8A 1KQ0A 4EGYA 3FF5A 3ULQB 3WTWC 1BOAA 6PAXA 3DQVC 2AS5F 1HW5A 2QQBA 3OV8A 5EEGA 3GZ6A 3SQNA 1ZRCA 3L7WA 1YS6A 2BEOA 4P5OA 1HQCA 4FHTA 5JR3A 1IRGA 3V8LA 3F22A 3HRSA 3FX3A 3J81K 3BJAA 4RGXA 1R7JA 2FF4A 3F8BA 1QO0D 3ZPLA 1FWZA 2RGVA 5LHGA 1KQ8A 3HRUA 3BZ6A 2R3SA 1HW1A 3WU1B 2A61A 2EK5A 3Q5FA 3RYPA 2MA3A 4A0YA 1R1VA 3BWGA 2G7HA 5CLSA 1TQIA 3TGNA 5ERIA 2EFWA 1S7OA 4HF2A 1Z05A 5DCFA 3ECHA 2HQRA 1TW2A 2IP2A 4LK1F 5LRSA 3KLNA 1I5ZA 2NYXA 1RNLA 1MJAA 1QZYA 1EH8A 2FMLA 2ZFWA 2VOOA 1W7PB 5D8KB 4I0BA 5DEQA 4KN4X 1U5TC 4MHGA 3RDIA 3K1NA 1USTA 3OOPA 2W84A 5F6FA 3QPHA 2O3FA 3GWZA 4FT8A 5CYVA 4ENNA 2F5DA 2XKOA 2BBYA 2F5FA 3MCZA 2O6GE 2L54A 5AONA 1A04A 2HYFA 1SMTA 4HDUA 2F2EA 5LHIA 1V4RA 2QYOA 4LLGF 1ZGJA 1MD0A 2IA1A 4WXDA 4XLPF 3KE2A 3HYIA 1XB4A 2HFHA 4XRFA 4G6DA 1HXDA 2NAZA 3GO5A 3I71A 2XAFA 4Y17A 4I02A 2VBZA 1T2KA 2OQGA 5BMZA 2FE3A 5D5XB 5FFZA 2FBKA 4M72A 1FLIA 5E1ZB 2MBFA 1PUEE 1R22A 1OYIA 1UFMA 1XN7A 3QRFF 1G3SA 3WE3A 5F1RA 1YFHA 5A2QK 2MH2A 1BM9A 2FRHA 2JSCA 2LF8A 1BN5A 2KIFA 2YPRA 2GIVA 2CSOA 3ZMSA 3E3VA 1IN7A 2DI3A 4U88A 2DTRA 2WWYA 1W5SA 4U7BA 1QPMA 2ZO4A 3QP6A 4LJZF 1IXSB 3MZHA 3MWMA 1XGOA 1MJBA 4MGRA 3LA3A 3H3ZA 3KEQA 1LVAA 1X3UA 4FX4A 3WE2A 3F3XA 3G3ZA 3F6OA 1OMIA 5DUIA 2LF7A 3F8FA 2D1VA 3CDHA 4CZZA 2EV5A 5K1YA 1XSVA 4U0VA 3M8EA 1FPQA 3L09A 3HOTA 2DPUA 1B59A 2OBPA 3ZP5A 4XSXF 3ZMDA 2XASA 5ILVA 2CW0F 1IN6A 1BI0A 4HLXA 3KP3A 3WTXC 3QPTA 2RKHA 5DUKA 1BBYA 2P5VA 3I4PA 1R36A 4I09A 3SXYA 4EV0A 2FNPA 1K6OA 2V9VA 1YW9A 2O03A 1PP8F 3PQKA 4HZFA 4ESFA 4B09A 5JFRA 1XDSA 4Y13A 1MJ9A 2FNAA 3IHUA 2ESNA 3SZPA 2D45A 3DPTA 5CJ9A 1SD5A 3U1DA 3HTUA 5LBQA 4KA4A 4HF0A 3QU3A 1WQ2A 3ECOA 1FYLA 5HLHA 4PDKA 2ZNYA 1UHWA 4MEXF 4R1HA 4HAMA 1B1BA 3NEUA 4A6DA 2M5WA 3MEXA 2DK5A 3MQ0A 1AOYA 2RV8A 4BHPA 1W4MA 5FFXA 1FOKA 2HKXA 2L4AA 1IUYA 4WWCA 5DCMB 2Q0OA 2RVCA 4EQQA 2KIMA 3HTSB 4IVNA 4KT5C 4K2EA 2E1CA 3E6CC 1LQ1A 5CVRA 1C0WA 1G6NA 1SFEA 1TTYA 4WX9A 3LA7A 4UUVA 2HEOA 1YS7A 3DXJF 4QWQA 1R5HA 1ZARA 4WXHA 3BJ6A 3RYRA 1K78A 3V7SA 1P4AA 3J81Z 3GFMA 3CUQA 3FXQA 3V8JA 5J8FA 1XMKA 1F5TA 2QQ9A 2ZMEA 1BIBA 2W57A 2RNJA 3J80K 4M9SA 3FWEA 1SFUA 3HRMA 4M9XA 4CHUA 2EWNA 5EEHA 1YTYA 4CXFA 4Q47A 3KP5A 1FBSA 3TDZC 2GZWA 3E6BA 2BV6A 5FO5A 3COAC 5ICEA 3EYYA 2UXNA 2EA4A 3CUOA 3BOQA 2BGCA 3QP5A 4LMYA 4AIHA 2XAJA 4M74A 2Z99A 3WGHA 4LK0F 2DPDA 2ZKZA 4BNCA 3T8RA 1U5TA 4LB5A 4RB1A 1USSA 2Y48A 1LEAA 4PGGA 1O7FA 2HOEA 1B9MA 1Z1DA 2EFQA 4A2UA 5D6FA 2ISZA 1KGSA 4RAZA 3WU0A 1F4KA 5ILSA 4LG0B 4WXCA 2K7LA 3T8TA 4UHTA 2RC4A 3HSRA 3C7JA 4AWXB 4R8HA 5E8IA 3I64A 4ETSA 5TJJA 5H6RA 3F21A 4L9VA 2XVCA 1ZREA 1KQ9A 3HIFA 3DV8A 1T38A 3K9TA 3B02A 3HHGA 3SFZA 2OU2A 4IRGA 2A6EF 4N0BA 2MLGA 2XIGA 1Y0UA 2B0LA 3KZYA 1LB2A 3T5XA 3FMSA 2KJCA 1LDJA 2D2WA 1J7KA 2V1UA 4RB0A 1HKSA 2HTJA 4RB3C 2J5PA 3U2RA 2XRNA 5D4RA 4EGZA 2OD5A 2P5KA 2VBXA 2YSRA 3MAJA 2LNBA 4I0AA 4MTEA 4EMSA 2FOKA 2DT5A 2HTSA 1FSEA 4RGRA 4OOIA 3V8KA 4ENJA 1FP1D 5A2QZ 4EJOA 5AIQA 3NRVA 4XLNF 4L0YB 4R79A 2KKOA 4ZYGA 1K79A 5BPDA 2RDPA 1BJAA 3GVAA 1JGSA 2PN6A 4S05A 4KYWA 2O61A 3P9IA 2FBIA 3GF2A 2QBYB 3CUQC 2VN2A 3WGGA 4LB6B 2PFBA 1Z7UA 4ZYEA 3PFIA 5L3FA 1XGNA 4BHCA 4A5MA 2E7WA 4UV9A 5BS6A 2GQQA 4OIQF 2FBHA 3F8NA 3WODF 4HX4A 2M30A 4L9JA 4NB5A 4M9ZA 2FEZA 2ADUA 5JHUA 1JHHA 3ZMTA 5HDKA 2FQ3A 4Q4ZF 2O0YA 4G7ZF 1ZGAA 2XAHA 1BC7C 3K0LA 2XROA 3S2WA 2COMA 4O5VA 3M8FA 5DV5A 1I1GA 2RQPA 3EETA 4H0EA 3KP4A 4EM2A 1NHAA 4ZZLA 4CDGA 2ESHA 3W6JB 4CYDA 4EM0B 4Q48A 3WTZA 3LAPA 3HOSA 2CG4A 5LEJA 1YQAA 5J6XA 4A5NA 2EFNA 2NRAC 4U7DA 2IRFG 2EV0A 3GLXA 2JZYA 2HKOA 2MD5A 5ED4A 2P7CB 1Z91A 5E1XA 1QBJA 4FX0A 1W5TA 5DYMA 4EJWA 1TQPA 1I27A 1Q1HA 1P4WA 4E70A 1O3SA 4Z2YA 4BYYA 5FD6A 3PQJA 1KYWA 4LLLA 3ZMVA 1IZ1A 5HOOA 5HLGA 4KMUX 2L3DA 1JXSA 1S3JA 4IPAA 1IXRC 2DBBA 4O6JA 2P6SA 2H94A 4U0WA 1H9TA 2NNNA 2ACJA 5BPIA 2HWVA 2VC1A 1GXPA 1ZRDA 2TDXA 3QU6A 1P6RA 3KP6A 2STWA 1BC8C 4TV7A 3CO6C 4G94A 1IW7F 2D1HA 3V4GA 2FXAA 1MDMB 2HS5A 3NQOA 4L9TA 2IT0A 3BPVA 1ONVA 5DDGA 3P9KA 1R1TA 3HSFA 1O3TA 1FYMA 2JTVA 3FHZA 4MQ9F 4RS8A 2M8EA 1JE8A 3ZMUA 5HS7A 2F5CA 3T1BA 1ODDA 3TO7A 3V7RA 4KFCA 1MZBA 3FXUA 3ROUA 1YW8A 3FXRA 2PLYA 1R1UA 1YG2A 3R4KA 3SHFA 3K1MA 3TOBA 4L0ZB 3HUGA 5LGUA 1W7PA 3C1DA 1ZHFA 3K1PA 3WTVC 2P5LC 1DUXC 3GUDA 4EJUA 2NNYA 3J80Z 5BOXA 1BIAA 1BI3A 4PGHA 4BXUA 1OKRA 3GZ5A 2L01A 2AXLA 4U0YA 1L3LA 4AD9A 2KJBA 1BI2A 5HS9A 2LKPA 3FMQA 4HX7A 3L2CA 4LLNA 1J75A 3JTGA 1UB9A 1SD7A 5CVIA 1E2XA 3CJNA 3O2PE 5ICFA 3GW2A 2GXBA 5KK1A 1KU3A 1ZN2A 4HYEA 5ICCA 2PEXA 1S6LA 2ZMEB 4ZZDA 1LNWA 1YYVA 2XAGA 2R7DA 2HQNA 5H6QA 2VE9A 2E7XA 2PBIA 4JBAA 2JPBA 2PMUA 1B9NA 4MQVA 3KFWX 4HV5A 3O6BB 1HW2A 1ZRFA 1F1ZA 3BJOA 4OIOF 1HKTA 1MGTA 2W25A 2DFIA 1LJ9A 5L3BA 1YIOA 5L3DA 2BYVE 3WGIA 1U5TB 3TDUC 4HV6A 2H27A 2Z9OA 5HLIA 3RKWA 1EH7A 5D4SA 2NS0A 1KU7A 2V1DA 4IRHA 4P96A 5CVVA 4AVPA 2ZBKA 2OQRA 2G7UA 1R5GA 1PP7U 1OPCA 2F5EA 4EVIA 2STTA 3R6SA 2VC0A 3I5UA 4CO8A 4EJTA 3LA2A 3TO9A 4HBLA 3I59A 2BE5F 2XAQA 3F8MA 1WI9A 4HQEA 4UVAA 2ZNZA 3IC7A 4JK1X 2EV6A 5FGMA 4M6XA 2JRTA 2V79A 1CF7A 2MC3A 3U9GA 1IF1A 3L9FA 4M6YA 2J5OA 4P9UA 4I2OA 2GWRA 2QENA 3F6VA 3IRRA 3FM3A 4ENKA 1G4DA 3ABTA 1U3EM 3R0AA 1P92A 1WSUA 1I6XA 2FSWA 1RIOH 3VOEA 3P9CA 4Y15A 3TOAA 3TO6A 3KCCA 1P2FA 2DQRA 2YX4A 2WV0A 1G3TA 4HLYA 3RIRA 3O3KA 2QWWA 4ZH4F 4I7HA 2CO5A 4A6EA 2H6CA 2V6CA 2DW4A 3WG9A 4ZYHA 3K2ZA 3FM5A 1SFXA 2M45A 2HDCA 1RZ4A 4LGWA 4YFNF 1IN4A 3LQQA 1RUNA 1B6AA 4M73A 2UXXA 1MKMA 3F23A 4YIIA 2OZUA 5IT3A 1OYWA 3W6KB 2OA4A 1TBXA 3WTUC 5L3EA 4L5IA 1FZPB 3LSTA 5D5UB 1L0OC 4P9FA 2DU9A 4LD5A 3LAJA 2PG4A 2GAUA 3IWFA 3I53A 3GYHX 3IL2A 4IRIA 1XSDA 2A07F 4PCQA 1J59A 3RTRA 5HDNA 1RI7A 1J5YA 4BQAA 3WTSC 1SMYF 2A5YB 2YU3A 2ZJ2A 1U2WA 2KRFA 1QZZA 4PZJA 4GGGA 4YFKF 1H9GA 4KIBA 4G7HF 1DP7P 2ZXJA 2UZKA 2EA2A 5H20A 5HVQC 4I98B 4YIFA 4GO1A 4ASNA 4RGSA 4HOBA 3T0YA 2V1XA 1S7AA 2CFXA 2HYGD 3FZVA 2IW5A 2IJLA 2X4HA 3I54A 4IHSA 5HDGA 2EB7A 4KN7X 3KLOA 1REPC 4G6QA 2JT1A 2DK8A 4L5JA 3IKVA 5F64A 1U8RA 3QOPA 1D8JA 3AAFA 3BPXA 3EQLF 4DQ2A 1CGPA 1FSHA 1ZG1A 4RGUA 1K7AA 1O57A 1U78A 2A68F 2GA1A 2K4JA 2VBWA 3RKXA 4HF1A 2RN7A 3CO7C 2Q2EA 3G73A 3M9AA 4DNCA 5LHHA 4MEYF 2GXGA 4Q5SF 4IF4A 4KICA 4WF2A 3JTHA 1JHFA 2YR2A 4OIPF 3RKYA 2GA2A 3ELKA 3JAMK 2H6BA 4BAYA 3M7GA 3D5LA 4L9NA 1ON2A 2EFOA 1VTNC 4LG0A 1XD7A 4IJAA 3BROA 1DPUA 3MFKA 3ZN0A 3GXOA 3BP8A 2OAZA 1ULYA 3JW4A 1F9NA 1LDDA 3DPLC 4F7ZA 3IRQA 1BI1A 2P7VB 1AWCA 3LQRA 2KIUA 1HBXG 1FY7A 2M1BA 1FYKA 1IRFA 1J2XA 5L3CA 1XCBA 1O3RA 2CQKA 2L4MA 1HSTA 2Y75A 1FBQA 3K69A 2VE8A 3QAHA 2QQAA 5IT9K 2JPCA 3KZZA 4OINF 2HGCA 2PMHA 1T6SA 2FA5A 3N4MA 2EFPA 4KMFA 3E5QA 1ZG5A 3BY6A 3JSOA 5LEKA 1QQIA 4KIFA 3ZQ7A 4A12A 1DDNA 4A0ZA 4XSZF 3VEPA 4YFXF 5FLXK 1SD6A 4KUMA 2Z33A 2VXZA 4EM1A 3MZYA 3GFIA 3E5XA 3EDPA 1YLFA 2PQ8A 4HA8A 1H0MA 2QM3A 2XKPA 3C3WA 4GYGA 2QBYA 1Z6TA 2E1NA 5D6EA 2ZCWA 4OIRF 3KP2A 4B8XA 1FNNA 2XV4S 4OMYA 1WRJA 3WTTC 1KU2A 2YX7A 2K4BA 1FT9A 2IA2A 1STZA 2FMYA 2XUBA 1IN8A 1D5VA 1FBUA 4RAYA 2WC2A 3KEOA 4MTDA 2IPQX 4KDPA 4O3MA 3H3UA 1YO5C 4WK8F 2C6YA 1IN5A 1TNSA 4AIJA 4S04A 1HSJA 4WCGA 3GFJA 4UXNA 1U6GA 3ML6A 3WTYC 4G8XA 1I1SA 1SAXA 2IA0A 4CICA 5CVJA 1ZLJA 3I59B 1R23A 1UCRA 3RI4A 1LDKB 1T0FA 5E8GA 3E6MA 2QUFA 1OR7A 1CF7B 2QVOA 2ETHA 3E97A 1GHCA 1ON1A 3KETA 1K78B 4CGZA 2WTEA 3JSPA 2G9WA 3CUQB 1KU9A 5DD4A 4ESBA 3BDDA 1LEBA 4ENMA 4QLCU 1XCVA 3L00A 3FMRA 1QNTA 1WKMA 3E6DA 2DQLA 3TKYA 1RUOA 1XMAA 1D3YA 1KA8A 4D0PA 1E17A 4L18B 2Y0MA 1TLHB 2XHKA 2O8XA 4HDVA 5E17F 2L02A 5E18F 2DLLA 2HR3A 1S8NA 3DEUA 1W7PD 3GFLA 5ICGA 1S29A 5FD5A 3IWZA 4M71A 2HZTA 1T98A 3RPUA 4YG2F 2IVMA 1G3YA 5JI6A 5LGTA 2A3SA 3Q9SA 2P8TA 4HW0A 4OU0A 3VFZA 3REOA 1MDMA 5E20A 2VT2A 3KP7A 3F72A 2LSOA 3I58A 2FU4A 3Q9VA 1UHMA 1V3FA 1FP2A 2P6TA 3DF8A 1XGSA 4G9YA 5L3GA 1YW7A 1XGMA 3CTAA 3C18A 1HKQA 2VONA 1R00A 2CYYA 2EJRA 2M87A 2XGXA 3F8CA 3HHHA 5DD8A 3GX4X 2H09A 1IAWA 1ZYRF 2QLZA 4A0XA 4BHBA 1ZH5A 1PDNC 2VT3A 2Z3YA 2DO7A 1FC3A 3VODA 4NQWA 1T39A 5K5OA 5FB2A 2ELHA 1ZLKA 4XBFA 4N9IA 2W24A 1B4AA 2MLKA 3ZN1A 3EYIA 1XSXA 4GYIA 2K02A 4BH9A 2A69F 4AIKA 4UNOA 3HSEA 4IXAA 5BQTA 2CGPA