1T3FB

Three dimensional structure of a humanized anti-ifn-gamma fab (huzaf) in p21 21 21 space group
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGAELKKPGSSVKVSCKASGYIFTSSWINWVKQAPGQGLEWIGRIDPSDGEVHYNQDFKDKATLTVDKSTNTAYMELSSLRSEDTAVYYCARGFLPWFADWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Huzaf antibody light chain
publication title Three-dimensional structures of a humanized anti-IFN-gamma Fab (HuZAF) in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2004-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t3fB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t3fB02
5EUOA 4MA8H 3G6DH 4UUJA 4RGND 4G7YH 4JPWH 1JNHA 3SE4A 3OSKA 5C0EA 1F11A 1H5BB 1QFPA 1U8OB 2VZ1A 4M93B 1A7OH 4PRDA 1YNKH 4PJ7A 3ET9F 2AV7A 3IDIA 3BZ4B 1EZVX 5DJDB 4G43A 4HIIA 5FIEA 1EBAA 1WZKA 12E8H 2FBJL 3HC0B 3AM8A 3B2VL 3DROA 2QBWA 4H1LG 3F6IA 4HIHA 3JVGA 4FN0A 2FSEB 1J1OL 4LU5H 3QRFM 4DVRL 2GITB 4L4TD 5T1DH 2ZUXA 5GRYA 2F8XC 4WUUD 4P23C 2HKHL 1EIBA 2P5EB 3ZDYE 1F4AA 4PREA 5C0GB 4UV7H 4FNLH 3GB7B 2H2SC 1YNTB 1KTDA 2RJMA 1CTOA 1KCUH 3IF1A 4IEFB 5E7BA 3QHZL 2EEDA 4DZ8A 4P4KA 2EDEA 4LSRH 1VPOL 4UOW1 2R4RL 4EIGB 4XP4H 5DHYA 3F58H 5CBEA 4FZ8L 4M48L 4NFDA 2R8SL 4LSPH 2X4NA 1SYSB 3OJDB 5D1ZA 4TVSa 3H0TA 5GRJL 1R5IA 4XNXH 3MR9B 4J1UA 1TIUA 2D0HA 2P4AB 4JAMA 3A6CH 2Q1EA 4QCIB 3C6SA 4HEME 5B38A 5IKCB 5MENB 1AKJD 1UM5L 4D8PA 2ZOLA 3FB8B 3OR6A 4KHXH 1I7UA 1QPPA 1BZ9A 5GJSH 3SCMB 5BZWA 1D9KB 3H3BC 4XGZB 4PRIA 1XZ0A 1E27A 1AHWA 5E8OA 5F7KC 1UACH 3VXUD 4JQVC 3WHXB 5DT1H 3RTQB 4WV1B 1FIGH 2XZAH 3DTXB 3H9ZA 4EEEA 1E6JH 5DVNA 1GJIA 4M7KL 2AEIT 3RGVC 2NY2D 1RULL 5KVDH 1KCLA 4Y5YA 1BD2D 3ABZA 5DFTA 1CFNA 2BNQB 2EYRA 3N1GC 4U1HA 3P0YL 3MOQA 5IFJA 3SE8L 3AY4A 4R3SB 4PTTA 3MSPA 4M4PA 4PG9B 1BX2B 2YRLA 5BV7H 4YWGL 2P46B 2ILLA 1RZJL 3MLZH 1WBYA 1BFVL 3H3PL 3L9RB 4OTXL 2X4OB 1FV1A 4K3EL 4BM7A 2GJZA 1CN4A 2BK8A 3KG5A 5B39A 3PL6D 3CLFH 1EGJL 1UWXH 3SE3C 2DQUL 3EJZC 3HZYB 2VLRE 3BIBX 3WSQH 4IDJL 1I9RH 4WW2F 4XP6H 1JUFB 5DD3H 1BJ8A 5F1KC 4P5TC 4QRQB 1DL7L 4OZGB 4MQ7A 2VMFA 5E94A 2NX5B 3VD9A 4W4OC 2QADC 1TJHL 1W72L 1K85A 1LO3L 3TBTA 1KYOJ 3GO1L 3K46A 4JPVL 2FHBA 3ARVA 3OXSA 4R90H 5B4MC 1OOAA 2HVJA 1UWEL 2Z35B 1JPTH 1Y0LB 2A77L 1I85A 1QFWH 1YY8A 4WW2C 3O2WH 4CU6A 4D2NA 2FHCA 4NWTL 5GRWA 3CU1A 5HHPA 4F7MA 3MV9B 1YEFH 4LVNC 4AL8L 5F7FA 4ZPVA 3IKKA 2F53D 4JFEA 2APTA 4OT1H 4OFDA 4XB7A 3TZVD 3IU3A 4UDTA 3S36X 2AW2A 1OT2A 2HKFH 3IXAA 4GMTL 2ARWA 3GMOB 4GG6A 4YFLI 5F1SA 4FQIH 4NM4H 3QJFB 2ORBL 4O2FA 1RZJC 2CPCA 4L8BA 5FYKL 1IEAA 2OK0H 2J8UB 4PJHE 4WU5B 1ZHKA 4Z7VA 2CRZA 5DEFA 5CSZB 4YDVB 4RNRB 4UT9H 1HINH 5DWUH 2EDKA 5CEZD 5HGAA 1YECH 5EU4A 2XNAB 3PP3H 1F4WL 1B90A 4FABL 3JWOL 1LEKB 3WFBH 1I3UA 4PGEB 1PG7H 1EO8H 4WIQA 4YHKH 1CG9A 3K1KC 4WFFE 5IHLB 3TBWB 2CXKA 2DQJL 3GSRB 4M7LH 1UWXK 3E8UL 1IM3A 2XPGA 3U9UB 3OF6A 2PO6B 3FFCE 3UYOD 1VA9A 2I25N 5DZNA 4MX7A 5EFIB 4LSSH 1E4XL 2F15A 2FX9H 3FFDB 2NXYD 1NUDA 4JR9L 4FOMA 1B4RA 3QWOB 5HHME 3D39A 3QCVH 2EO9A 4J7RA 4FQCL 1P2CB 5C08D 1CE6A 5DEGA 2H6PA 4X8JA 1G6RB 3MJ9A 4XVJH 4ESKA 1QG3A 1EAJA 5LBSL 4KJYB 3QIBA 1YY9C 2CMRL 3VGGA 5MEND 3GHEH 4HJ0C 3VFGL 3T0XA 2CIKA 4PV8B 2C3WA 3SCMD 5I1CH 3LB6C 1T5XB 1OLZA 5D1XD 3NBNA 5EZIL 1T7ZA 3BP4A 2IAMD 5J06A 4OD2A 1KN4H 4KK6C 4UTAH 3CK0H 2UZYB 4U6HA 4IRSA 2KBGA 5D7JC 3EYQD 4MVBD 4CADA 2GAZB 4O5LH 2BNQD 5E8EB 5EPMB 1Y18B 3MRQA 1GGCL 5DK3A 2L0DA 4YHPA 3KR3H 3D0LA 1H0DA 2JB6A 4Y5XB 5HDQL 5FUOL 4DGVH 3VFSB 5ADOH 4NZJA 4FFWD 2X4TA 4ZSOA 3O2VL 2IGFL 1NCWL 2BZDA 3MXVH 1FNGA 1YNLH 3LS4H 3DVGA 5GJTL 3FL7A 1DBBH 3FQUB 4UV4H 2Y5TA 1PKOA 3L3GB 4RFEA 3OX8B 4ZTOL 1WCBB 1I75A 4FXKA 3T3PF 4A2LA 4Y4FC 4AENB 2NX5D 4HF5L 3MJ9H 2JIXD 5LKNA 5GGVY 1U36A 3LS5H 1I1YA 2P24A 3BYTA 3HZKB 2IH3B 3PWVB 4J4PA 5AYUL 3TNMA 1KNOA 3WIHH 1RIUL 4LLWB 4Z6AT 2ZCKL 5DJAA 5B3NA 5FO9B 1Q72H 4KQ3L 2WIIA 1G7LA 1NAML 3K4ZA 1ZT7B 5CJQL 4PRIE 5JHDB 1ZGLM 5D7KD 1GAFL 4OQTL 4V1DE 5TE6H 1IGMH 4OCLC 4U6XB 1DUYB 5EA0L 5JXED 2J12B 4RAHA 4HV8A 3CXHJ 3B8YA 3MNZA 4BQ8A 1K4DB 4NCDA 3DHMA 3O2DA 1U8NA 3HZMA 5DC9B 1OSPH 3RWDB 1QLFB 4PR5A 1H15A 5DUPH 5F9AC 1QA9A 4PPTA 5HI4C 1T4KB 4M4RA 2X9XA 3ZYOA 3GSWB 3BN9C 3S5LG 5ITBL 4X80L 5GRUL 4J12A 3SGKC 5C0CE 5F8RC 1VGKB 2AXGB 3L95A 4DOHE 5DFWH 4MJIA 3DVNB 5I30H 5L8JB 2P8MA 1FC1A 1OW0A 1U58B 4NN6C 1A22B 4EN3B 2APWA 3DX6B 3FAWA 5MEQA 5EN2A 3QI9C 5K9JH 1RQ5A 5GZND 3ZE0E 2B0SH 4HH9B 1DEEA 1FSKB 1MRFL 4KMLB 5EH1A 1FZOB 4M7LT 2I5YH 2IQ9L 3R06B 2YD8A 1A3LL 2AEQH 1GVIA 3GRWA 4GBXC 3IDYC 4HJJL 1LD9B 5JW3L 3BUYA 1FNEB 2PO6D 1PGRB 4ZQKB 5BCAA 1OF2A 3JTSA 4PJBB 4NQXB 1RMFH 3VFWA 1J8HE 4FQLL 4XP1L 3EFFA 4AEFA 5K9KA 1SMAA 4IMKC 2JK5B 4GFTB 4JFEE 3W9DB 5JOPD 2C4XA 4LCCA 5JZ7D 1AFVL 3VXRB 3WHE0 1MUJA 1MEXL 2RCSL 1ZHLA 2HJLA 4WFHE 2AJ3A 5IBUB 1GIGH 5CKAA 4B41A 3REWA 3MPCA 4QHUA 4XBPB 4GG6E 3O2DH 1ZLSH 2CSPA 2ZCHL 3LN9A 4RWYH 5IESH 1OWRM 4PTUA 4HKZB 1C5DA 5AUMA 4EI6A 2CR3A 5DJ6B 1A7NL 2EYSB 2MQ3A 3TT3L 4HW6A 1KENH 2P48B 5DJZB 3ZT7A 1HSAB 2V2XB 3QB7C 4NKIL 4FQXB 1SY6A 1UQSA 5KTEL 2VDQH 3C8HA 5C9JB 1VACA 4KJQC 4D9QE 1JYXA 3ROLB 2XKNB 3QBTB 4ALAH 4G8GA 1NGQH 1U6AL 3BQUA 3NFNA 2X4PB 3WJLC 5CD5D 3GI8H 5DDHA 5F1OB 1X9QA 5JDSA 2YN3A 3HLAB 3HE6B 1S7SA 1XT5A 1RZGB 1FJ1A 3GRWH 1DJSA 4XCYA 4GRWF 1O7VA 5I8CB 1MFCL 2MQCA 1MFAH 2ZOKB 3VJ6A 2CLRA 3EGSB 4H88H 1KFAH 3TJHD 1FVDA 3NABL 3V4VL 3DI3B 4BZ2H 5IW6A 3MV7B 2BVPB 4KMTL 4XP5H 4DTGL 1JHTB 4TNVK 1ZGLP 5E03A 5I71B 1WJ3A 4MLSA 4UILH 3P77B 1KIUA 5JUEL 3PP4L 2NNAB 3SO3B 1FNSL 2EXWC 4K8RC 5F9OL 4ELMF 3PV7A 2H2PC 1QUNA 3ULVL 1P1ZA 3MRHA 4NNYB 3TN0C 1JCKA 3IDXL 4LASH 3PABA 2XACC 4KROB 4ONFH 5ETUA 4APQC 4Z95L 1BEYL 2P49B 2B5IC 1N5AB 2V17H 3L7FA 1FCCA 4PGCA 3GSNB 1SY6H 5K93A 5HYFA 4LDLB 1UYWL 4L9LB 1XR9A 4QYOB 3KNBA 5DJCA 5HYEA 4PJIF 2Q76A 3FTGB 3D25A 3ARFC 4HIXH 4OLXH 1PFCA 3KYOB 3BH9B 1NGPH 4NQSB 2I60L 5D8JH 5KG9B 4FHBD 5C1MB 4ZTPL 3T0VA 3ALPA 4XWGH 2FD6H 5L2KD 3DX8B 3KPSA 4P2QD 3VXSA 3QEQA 3G5ZB 4L3ED 1RV6X 4PRPE 5KVEL 4J6RL 4I48A 3GBLA 5MEPA 1XH3A 3B9KB 3MO1A 2ICWB 3WJJC 1U92A 2ZCLL 3ULVF 1RUKH 2JCCE 2FX8L 1QVOB 3KJ4B 3VW3L 4YO0B 1HWGB 3ZDZF 1H3XA 1XCTB 2VYRE 2GY7B 4FMFA 2QR0A 3K3QA 5E2TH 5I1GL 4Q9RH 4MJ6A 4ZFOL 1J5OH 2A0LC 3FB5B 1K4CB 1UM4L 2CIIA 2ERJB 2Z8RA 2FJGA 3BPOC 5D70L 4AEIH 1MI5B 1RFDL 5ALBL 4QRRA 1WC7A 4LMQE 4I2XA 1S8DA 1RJLB 3D3VD 4GKZB 4UOJA 2KQMA 1DBAL 2IFFL 3ZHLA 3ULVC 1VKXB 5J11C 2AJYH 4G8IA 1VFAB 2VDPH 1JGUH 4FP8L 1WUNT 1MHEA 3IFLL 3O81A 4JFHE 5IFHL 5CJ8A 3AB0C 4G42B 4Q97A 2X2YA 3BPLC 2C3VB 1XIWC 2H32A 5CEXA 3X12A 4D9RE 4HMDA 1N0LA 1CGSH 3IVKB 1YDPA 2VQ1B 4FFZL 1AP2B 2I9TA 4I0PD 3TYFA 5HPMA 1KYOK 1QRNA 2IPKB 1U3HC 3EHBC 1S9VA 4LDOB 1EVTC 1YQVH 1A6WL 4JFPB 4MD4A 1QFOA 3SBWC 2OZ4A 3K0WA 3ESUF 1QSFD 4P23B 3UAJC 3S96A 3EYSH 4OKDA 4CVZA 5F3HB 4F7CB 4ZAKA 1MJ7L 4L29B 4W6WB 3SOBL 2X4SA 3I6GA 2H1PH 3CFJA 3ROOA 1QBMH 3VA2C 3CCHA 3X14B 4CW1A 5IBTL 4GKSA 1YPZA 4FQXD 3MRJB 3VFUA 4P3CL 3H9SB 3QUYA 4XHJC 5B21A 5T3XD 3VRIB 1VESA 1J0IA 3U0PB 1BGXL 2ADGA 4BJLA 1WLHA 4ACPA 1WBXA 4QLRA 5EO9A 1BOYA 1M05B 4RMVA 5I1LB 4X6FA 3ULUH 3ULSA 1NBQA 3FOMA 2UZIH 4DKFH 4LLUA 2R4SH 1XGTA 3LRSA 3I2CH 3P0GB 2JJWA 4OUUB 2V2TB 4OLWL 4OLZL 1UGNA 2BCKB 4PG2C 2WANA 3RGVB 4DGYL 4Y4HA 4Y88A 5I76B 2BXYA 3IFNL 4JPIA 1MIMH 3U4EB 3EFDH 3THML 4U1SB 1I7RA 1XR8A 2DLFH 2H32H 2BHZA 1UZ6E 3MV7D 1OQXA 3DPBA 2FCBA 1RUML 1MCFA 3O41A 3FQXB 5TH2A 3ILPA 4KUCD 4OF0A 1OARH 5ISZA 3NIFE 5HDBE 1GZPB 4QXUH 5I73C 3MCG1 1MFBH 4MB4A 2XWBA 3MJ7B 5ESQB 1RHHA 3WS3B 2OZ4H 4DGIL 1IM9A 2EH7L 4XP4L 1OGAE 2DQFB 2ATPB 1FGVH 4PS4H 3EJJX 4NQDB 3H3KA 3WD5H 5C09B 4NO5B 4JLRA 4U1LB 3HPJA 2DI7A 5D5MA 4ELKB 3OJMB 4K3DL 1KIPA 1D6EB 4P5TB 3Q5TA 1CFSB 2YPKB 5JA8B 1SVCP 4MJ2A 4ERSL 4PRAB 2QADB 1NDMA 2IWGA 5L2JB 5TFSL 3WXWH 5L0QC 1MHHB 2KPNA 4KC3B 3SDDC 4L3CA 4HIJA 2ADJB 1FIGL 1NMCC 1TTUA 1C12A 4OLEA 2HLFD 4U1JA 4WW2B 3OGCB 3IJYB 4JKPH 3HR6A 4K7FA 3UC0L 1H3TA 1AR1C 1E6JL 4L5FH 1MCPH 1RJYA 3OPZH 3QG6B 1MCEA 3L3HA 4LHUG 3G04B 4TYUA 4LVNB 1JWUB 4X9BA 4BFBD 4OCSL 4TRPH 1AY1H 3AREC 5JOEA 1PEWA 1EXUA 2XY1A 4Q2ZA 5LQBL 3HR5B 4P57B 3EO0A 1OCWL 2AJXL 3CAFA 4NHCH 2XWJB 4NRXB 4LMQI 3UO1H 3HG1D 1E28B 4RDQF 1DUZA 5ENWA 3GUTB 4AK1A 3M1BA 1BIIA 1HILB 3I6LD 4OZFG 4X98A 5GISL 5DJXA 2Z31C 3QXAA 1QSZA 3MRDA 1VADA 1IAOA 1MI5D 2P5WE 4WDIB 5AZEH 4GRLB 4JPKH 1NCCH 4PBWD 1ZSDB 4WW1A 3N85L 1J05B 2FEDD 5ANMA 3SY0B 1IGYA 1EUUA 3C5ZA 3TPUB 5T1MA 3VWKC 2EYTB 1EFQA 5E24E 1K8DA 3G6AB 4X4XB 4UNUA 1J0KA 1URLA 2DF3A 3C87A 3VH8B 3GSUA 5BVPL 3FB7B 4HUXA 2CUIA 2FZ3B 1GL4B 5J56B 1TTGA 3O3BB 4YHOH 5DYOA 4CVXB 4LGRB 4X6DF 4PRHB 1NDGB 1HYSC 3TA3A 1W72B 4S1QL 3UROR 4KTDH 1WVZA 4M3KB 3SGDH 1XCQA 3IDJA 1K2DB 1B6DA 4L4VD 3MRNB 5I19L 4ZUUA 5KJRH 2PYEB 3TNNA 3MODH 4JVWA 1QLEH 4HJGA 1CL7I 4P23D 3FKUS 1YEGH 5HPOA 2EIEA 2E7BA 3VRJB 3ZSSA 4NO2A 5FV2A 1N0XL 1QRKA 5DFVC 4HK3N 4ZFZA 4PJGF 1A14H 5SWSB 2ARJQ 2DLIA 2H26B 1OM3L 5KSAB 1TPXC 2BY2A 4KI5E 1CZ8H 2BVUA 1HHJB 3H9SD 2BY0A 3CPLA 3V52L 3ME0A 3AFLA 4AYFA 4R4BB 4K94H 4OD3H 4XB8A 1JN6B 2X7LA 5F7NC 4K9EH 4OZ4B 4FXGA 1U8LA 2FR4B 1R24A 1T04B 4QRRE 2GK0B 1HDMB 3W9EA 4ONGL 3FT4A 2IMMA 1YEEL 4JM2A 3RIAK 3ULUE 3STZB 3MJ8A 4DKEH 1FO0L 1GGIH 5BS0A 2NY7H 3MFFB 2Q7YA 1QLRB 3RWCA 5GS0H 1MCBA 4OFPA 3MLRL 1ZWIB 3QUXB 4RAVA 4OD1L 3S36L 1MJJA 5IOPB 3RGVD 1W0WA 2WIMA 5D7JB 2F74B 2VXVH 3G5XB 5FGBC 4XPFH 2WLZA 4X4YB 3T4AB 2Q8AH 4O2EA 4JFOA 3WFDL 4WHTB 3PXJA 4NSKA 2Z4QA 2IAND 2AJSH 5CEYB 1F4XL 1QRNE 1JL8A 4LSSL 2VKWA 5F88A 4N9OB 1PVHA 4J3UA 1FZKB 2DBLL 2ZSVA 5E08H 3KS0J 2VQUA 5F7DA 2V7HA 4UINL 2ITCA 1KJ2L 3MRKA 4S11A 3UTZB 1MJUH 3LZFH 4NQDD 3SGJA 1F6LL 5I66A 3EJZD 3UBXG 5CZXC 5GRZA 3OG6B 3HE7A 5TF1L 5SX4H 2D9CA 4P5TD 5BMFL 4WEMB 5AZ2H 3DYPA 4Y4FB 5CS7A 2QADD 3V0WH 1LK2A 2C1PA 3PV6B 1T20B 3HNVL 4XC1H 4Z0BL 3QEHB 1LK3L 4KY1H 2BJMH 5EU5A 3WUWB 5K9QG 1F6AA 3SKOA 1P69B 4PJEA 3TJEH 3QNXA 4JZNB 1UB6A 4IIQA 1G1YA 5B4MD 3AS2A 1SYVB 3T77B 4UTAL 4Y4KC 2RB8A 4WEBL 1BBDH 2WM0A 3QQ4A 2FIRT 4HS8H 3W5NA 3QUKB 1ZMYA 3UJJL 4JGMA 4MNQB 4XNMB 1P7HL 2OSLA 2B4CL 2DB8A 2HYMA 3AXLB 2P1YA 1IZJA 5JXAL 3F5WA 4DVBB 1OAQH 5CGTA 3ZDXE 1S7UA 2XZQL 1A1OB 1P6FA 3IRPX 4DGVL 3IT8D 1QSEA 2BNUB 4PBXA 1MPAL 4YBLC 1JGVL 3FB6B 3O6ML 4HXBL 2GTZA 4JFFA 5ISZE 1A7PH 4G6KH 3CFKA 5DMIL 3DWTA 3C8KB 1YQ2A 3MLUL 5DLML 1KCRL 3MA7B 5JW4Q 1FNAA 2F5AL 3MOBH 3RKPA 4PY8I 1I8IA 3VGDA 2AERT 1L7IH 4F7PB 5GHWH 4HAFA 4LKCB 2YA0A 4NN6B 3JUYA 4NQEE 4RQQB 4WO4A 4HUUB 4G80B 4LIQL 3QI9B 5IM7B 3IGAB 3BZFB 4WWKC 3TGXA 3OR7B 3WIHL 4WJ5A 5E9DA 5AYQA 1KJMA 3QCUL 1WWCA 4GBXB 2G5BA 3IDYB 1F8TL 1TZGL 3ZE1E 3QT2A 3EDDA 1DE4A 2PYED 1NAMB 2LU7A 3PHQB 4XAKD 1KXVC 4HX1A 4YIQA 2GQHA 4NQUA 1SJHA 4WI7A 3MBEC 1SBSL 5IROC 4H5SA 2BNRE 3W82A 1UZ8B 1T21B 3W2DL 2YPLD 2B4CC 3MV8E 3DGGA 4BQCA 1MCIA 3RA7L 1TTFA 2VITA 2W60B 2X1PA 3A6BL 1DQMH 3MZTA 3GKWH 4K7PH 3OJVC 2EC9T 3PF2A 5DEZA 3V5KA 3IJHB 2JF1A 5IJKA 1QKZH 1ZHNB 4NRZB 4KKCC 1B6UA 4HEPG 4XRCB 1Z5LA 4NFBA 2DQHL 4L4TA 5IMOB 4XCNB 2K7QA 4P9HL 4HJ0D 4WUUA 2KKQA 3DV6B 5I30L 4OGYL 1EK3A 1NGYA 3LB6D 3GMLA 4OF6A 1LHZA 1LE5B 1KG0A 1DLHB 2HJFB 5DJ8A 1AXSA 4XBGB 4Z7UA 1TETL 4P3DA 3REVA 2BOCB 4KK6D 4DQOH 4F8TA 2PTVA 4CJ1A 1OSZA 5C86A 3SJVD 4HFWB 3SDXE 5D7JD 5C0BD 5DO2C 4HKBB 1NCNA 1G6VK 3KAAA 3KYMB 2C1OA 1QSVA 5E0QA 2WWKT 2DWDA 4TVPH 1RVFL 5I1JL 1AKJA 3QDGE 3RWJA 4R9HA 5CP7B 3QA3B 3EOAA 5IB1A 5J89A 5CZVH 1Q9LA 3DRQB 4S0SD 2Z8WC 2AV1A 5KBNC 3VXUA 1RIHL 5E2JA 4AMKL 4ODWA 3BYYA 1MLBA 4NOFA 3OL2A 1FORL 1JF1B 4FFYL 4PP2B 1Q9OB 1S7RB 1BD2A 5C9KA 5ALCL 1LO4H 1S9KC 1YEHH 2JCCF 2Z91B 4GRWB 4XMLL 5MP6H 3ES6A 1IAKA 4Y4FD 3HRZA 1MWAB 3NZ8A 4HHAA 5HJ3B 1JNLH 4PJDF 1KT2A 1I1CA 1NC4B 1S3KL 4HXAL 1S9YB 3OHXA 5CHNA 4P9HC 5DVLA 5I18H 2NW2A 3SHSA 3BWAA 4YBQD 2EIBA 5E5MB 3TFKC 5DK2B 1G9ML 1P4IH 3TN0B 3W39A 2GUOA 2ENYA 5DD0L 4JHBA 4WFED 3WN5C 2LE9A 2I07B 1NAKL 3PL6A 3P11L 3ZHDA 4NP4H 1CL7L 1U8QB 1BOGB 2YUVA 3BAEL 4APQB 1IQDA 3BSZL 2B5IB 2CKBA 2R1YA 3TIEA 4YE4L 4XNQB 3TC9A 5T3ZE 2DTMH 5JOFA 1CDIA 1EJOL 4ELMB 5GRVK 4GAJH 1BMGA 5F1NB 3TT1L 3ARFB 5DVMA 5EC1A 4DCQB 5KN5A 5IVNA 1A7QH 1WT5A 5SWZB 2F58H 5HI4D 4YLQT 4OLYL 3LN5A 4WVRA 4OSUH 3HMXL 2VIRB 3HMWL 3MUY1 3KPRE 2OTPA 1Z3GL 3DMMC 3LRHA 5LGJB 4QRTB 3QDJB 3MCLH 1L9NA 1EHLL 1FL5B 3CVIL 1E4KA 3QFJE 3VXNB 1ZGLA 3DIFA 1KJ3L 4PJIB 2F53A 1XGQB 1JGDA 5INCA 3TZVA 5D6DA 3PWLA 3V6BR 4ZFFA 5K9OA 1L6XA 4XH2B 1AGFA 5MEOA 3B6SB 4F7EA 2CUMA 1BVZA 3HAEB 1S7QA 2FL5A 5CBAB 3BPOB 2R2EB 5HY9B 3MCKB 4GBXD 1INQB 2AEPL 4JZOA 4GQPH 5ICZA 4ONFL 4QKXB 4CVUA 3IKCB 1QNZH 1G9MC 3CVHA 3HI5L 5J11B 3ZL4L 3RX7A 1F97A 2GK2A 1CLOL 1SEQL 3AB0B 1CDGA 2Y72A 3BZ4A 3BPLB 1OAXL 4MDIB 1XIWB 1FRGL 4QXGH 4NZTL 5FDYA 2XTJE 2CKBH 3RZWA 4PLJC 1JYWA 3NCJH 3HC0A 1DFBH 5JR1L 1AXTH 4WUKL 3VI4E 2YD9A 4U4BA 4XXCC 1U3HB 4D0DA 1UZ6F 2BRRH 4NZUL 3L7EB 4JFFE 5HGBA 2GITA 3NIFF 5HDBF 2VXUL 5FYJU 1UCTA 1JFQL 3IJSB 1NCDH 4KRMB 3G9VA 5FA4B 3GB7A 1YNTA 1MHCB 2SEBA 4OLUH 5LGKA 1RUQH 7FABH 3KWWA 2L7JA 1E6OH 1ODAA 1JV5B 4NRYB 1SYSA 3OJDA 1MF2L 3MZGB 1RZ8A 4KJQD 1IGCH 3VWJD 3ZYZA 4ZFOB 4EUPA 3MR9A 4TVPE 1ZS8A 1DBKH 2R2HB 1IKNC 3TH2T 4QCIA 3GMRB 3S88H 3LIZL 5MENA 1M71B 3FB8A 1ZT1A 3HNSL 1UG9A 2G75B 4RGNE 3SCMA 4S1DC 5SX4I 3K2MC 1XFPA 3WDHA 2CK0H 2AABL 1ONQB 4XGZA 1QOKA 3C09C 5D1XA 3BUTA 1RU9H 4Y8AA 4JRXB 4LCUB 3UJIH 3CVHH 2IAMA 1MQKH 5DJ0A 3WHXA 3KS0H 4F9PC 4KGLA 4EDWH 2KH2B 5CEZH 1G7HB 2X4UB 3RIFK 2W1NA 4LVEA 1S5HB 5IBUG 1ETZB 1RUAH 4UB0H 4JJ5B 2BNQA 4CUCA 3DO7B 1HH6B 1HKLL 5EIIB 1ZLVH 4X6CE 1ZVSB 3FMGH 4KXZH 4R3SA 3WUZA 2P7TB 4NJ9H 4Y19D 1DN0B 4PG9A 1BX2A 4KUZL 2H41A 5I73B 1XGYL 1NLBL 3CIQA 4HFUH 3EIFA 5DJ2B 1PSKL 2HFTA 2EXWD 1X6LA 3FN0L 3L9RA 3D5OF 5DRXB 4X99B 2X4OA 4Z0XB 3RGHA 3TN0D 2PKDA 3WKMH 3BMVA 1LWRA 1A6PA 4APQD 4J2XA 2NCMA 5L8KB 3VG0L 1JUFA 3RWFB 5JPMB 1NL0L 2R56L 5TQ0L 3N1FC 4P99A 4QRQA 5L88L 4OZGA 2E5EA 2NX5A 4PYGA 2JIXA 5L0QB 1J0HA 3QULA 2XXCB 4EUPH 3ARFD 3SDDB 1X4ZA 3T0EB 4M5YL 1NMCB 4P5MA 5E8NA 1H8NA 2GSIB 2G60L 2NR6D 2Z35A 1Y0LA 4JRYB 1BQUA 4KFZC 1XF1A 5CP3A 3O9WC 3VXUE 5D2NC 3CDCA 4PJCF 5M7QA 5FHAL 3ARQA 4YXKH 2AXHA 4YDKH 4HK0B 4B7LA 4YHLL 4L8SC 1JRHH 1AXIB 4F9LC 2V5TA 5JXEA 1ZV5A 4M5ZH 3B4NA 2A9NL 1BQLH 2V7NB 5BO1H 2IPTL 4G6AC 1CDCA 3SKNB 3V0VB 4XI5C 2Q86B 5IG7B 2BVYA 2VC2H 4Y0GA 3MLPA 3GMOA 1X5YA 3VDBA 2Z31B 3PWUB 2APXA 1NUFA 3QJFA 1FG2B 1FGVL 4I5BB 5B22A 4PJ8D 3DNKA 3ULVD 25C8H 2J8UA 4M62H 4WU5A 3UZEA 4CN4A 2O26U 2ZNWA 3VWKB 2X6MA 3PQYE 1JZ5A 5CSZA 4FG6C 2Z8VC 4XX1G 1FHGA 2XNAA 2OL3L 2A83A 1LEKA 1XIWD 3S98A 4E5XA 1FFNB 3C5SB 3V5DB 2VABB 5C0RL 4R4FH 1WBZB 2HG5B 4QTHB 2DKSA 4GUPA 3JV5A 3V6ZB 3TBWA 5E6ID 1U3HD 3EHBD 1AGDA 4X4MA 3GSRA 4ZODA 2IH1B 3U9UA 1RZFL 2PO6A 3DUHA 1IGFH 4G3YL 1F3DJ 3D9AH 5DURD 5HI3D 1YEJL 2OR9L 5I1AA 3K2UL 3B5GA 4X6DB 3KPTA 2HFGL 3FFDA 5CP3H 1EJ6A 1BF8A 4M6MH 2F53E 3WV0A 3QWOA 1TPXB 2A6IA 3O6LL 4MD5A 2JJSC 1PJ9A 2YPVH 3GMPA 3SKJH 1TQBB 1P2CA 4L3AA 4LRIA 4XHJD 4FQHB 4RFOL 1T7YA 2CDGB 3DARA 1DSFH 1XF5A 2VXTH 4XVUD 3LEXB 1F3RB 1RZIA 4MCYB 3BI9X 4DW2H 4PJGB 3WHE1 3B2UC 3TV3H 4K71C 1GCFA 3BDYL 2VLME 1LDPL 2XG4A 4ZOCA 4XC3L 5ELIA 4GMSL 4B0MM 1T5XA 3RPKA 1CLYL 2VLRD 3LKNA 3S9DB 3BP7B 4JRXD 1CGXA 4PJAA 1I9EA 2Y1VA 3GMMB 3K7UA 2V2WB 3DXAB 3QIWC 1U95B 1MCNA 4LSQH 1J0JA 4YDIH 5E8EA 1Y18A 5EPMA 2NY0C 4LCYB 3SE9L 3Q1SL 4JN2B 3ZDXF 4RAUB 3S34H 1ADQL 2QQNH 2IG2H 4OM0H 4Y5XA 2WSKA 3QJHA 4QEGA 3W0WB 3R1GL 3CDGB 2JJTC 2NLJA 2P5EE 2D3VA 2XRAH 15C8L 2OI9B 1C5BL 1RK0B 2FATH 1CZ8L 4ZS6C 2X4RB 5FF6B 4Z7QE 4Y7MA 3HS0B 4JFZL 1CK0H 3GSXB 3KYAA 2R9HC 4MQTB 2HH0L 3OX8A 5FCSH 1XGPB 1WCBA 5IEHB 2P42B 3ARUA 4F8QA 4MB3A 4O4YL 4AENA 1EV2E 2MQ0A 3O0RH 1G7QB 4Y5VC 5E56A 1U8KB 3HZKA 2IH3A 3SDDD 3U46B 5I1IL 3EOTH 4LAQH 4LLWA 4DOHB 3K8KA 4U6VL 1FO0B 2LVEA 2W91A 1CLCA 3RRQA 4Y4KB 4ZFGH 1S7VB 3SDCC 2YZ8A 5F6IC 1DUYA 3ARED 3FN9A 1A9EB 3L3DB 3T09A 3QZWA 4Q74A 3WO4C 5EU7E 1L7TH 2OXHA 1H8SA 5JDJA 2AI0L 1K4DA 1AD0B 4LLDA 4YBLB 1T0MB 3NAAL 3RWDA 1QLFA 4RMUA 2LFGA 1FH5H 5E1AB 4JFDB 3FFCD 2Z31D 3DSNA 3LPGA 3G5VB 2EDNA 2O5YL 1T4KA 3QHFL 4WI2A 4WU7A 5FV1L 4CMMB 2FX7L 1CF8L 2XOTA 3GSWA 2YD6A 3RX5A 5IQ7H 5L2KA 1JK8B 2ZKHH 3AC0A 4L3EA 1KJ2B 1VGKA 1D5IH 2AXGA 4H20L 5HHMD 3VWKD 3MUZ1 4KTEL 3DVNA 4FA8A 2HRPL 3CSBA 4G7VH 4RISH 5HYIA 1U58A 4LEXH 1W8NA 3FQWA 5ILTL 3TO4C 4WWKB 4MZ2A 1S7XB 4M9OA 1UA6H 4W6XB 2OP4L 1X3DA 3IXTA 4HH9A 4OZGE 3OMZA 3SDXF 5DQ9B 1HYSD 3IFPA 1M7DB 3CUPB 2YRZA 2NX5E 2R39A 1FZOA 3HZVB 3GIVB 5FKAB 3R06A 4NKDA 3BWUC 5DGQA 5CD3A 3WFEH 4G6ML 1RURL 1OQOA 2OM5A 3D3VA 4UTBL 1AJ7H 1I1AC 3GI9H 4ZQKA 1C16B 2AKRB 4PJBA 3TO2B 5D7KE 3MBEB 4L9DA 5DFVD 5EO0B 3MV9E 3PDOA 2XTLA 5T3ZL 1K9TA 2DQTH 3DSFH 4FZEH 2CLZB 3W9DA 1JBJA 3T3ME 5KOVC 3VXRA 4LSUH 4M1DL 3HPLB 4I0PA 3OKMB 4O9HH 3VGFA 5ICXA 1T22B 4E9LA 3UDWA 4XBPA 4GQ9H 5GGSA 1P6AB 3ZSTA 2VQTA 4K3JL 1QSFA 1VDGA 2ZG2A 2X1OA 1LP9F 2R0WH 1R3KB 4HKZA 1OTUC 2J8UE 4P4KD 5DJ6A 2VXSL 2MFNA 3ISWA 3VH8G 4YXLL 3LV3A 2EYSA 1ED3B 4LGPB 1CXLA 1MRDH 1CFTB 1BLNB 4KHTL 5DJZA 5ITFB 4U7KA 2V2XA 4JHAL 4FQXA 1MCHA 5IW3A 1CGUA 4NDMB 3M17B 1IC4H 3ROLA 2XKNA 2ZG3A 4NO3B 3TYGL 1GOFA 5FAAA 2Z93A 1NJ9B 1KN2L 3OKKA 4HWUA 2BC4B 3UYRL 1UH3A 1UXSB 4U6YB 3K81A 5TE4L 4X4ME 3C08L 7CGTA 1GOGA 5K59F 1GPOH 4G9DB 3KPPB 3OWEA 4KZEL 1F4YH 2WBKA 1MRCH 2C7UB 5I8CA 5INDB 1NBVH 4V1DD 3UBXI 1T3FB 3WEXB 1ZT4B 5IVXE 1F13A 2VL5B 2W9EL 3D18A 3NTCH 1WWAX 3BZDA 4MXQC 5DSCB 3HTLX 3ZO0A 5C0DA 4DK6A 3PGCB 5CZXD 4TOYL 1T0PB 2A6DB 1DQLL 5HYSB 1GHFH 1RZKH 3BKYL 3MV7A 3Q6GH 5K9QI 2BVPA 4ZOEA 1JHTA 3G9AB 2X1WL 2NZ9C 4GS7C 1OWWA 1N2RB 4PGJA 1VEPA 2Q8BL 5C0CD 4PRPB 1Y6KR 1S5IH 5FYJL 2C4FU 3GJFB 4NNYA 4Y4KD 3GNMH 1RZ7H 4UT7H 3WN5B 1HXYA 4UT6H 2MHAA 2JCCB 1L6ZA 5DA0B 2VB5A 1GGBL 5SV3A 1H3VA 2I9LB 1CGTA 4PJDB 1N5AA 1F3JB 5KSBB 4TVPL 3MLVH 3GSNA 3RVWD 3FCTB 2A6KB 4HUNB 3OB0H 2KL6A 3MRRB 4L9LA 1OB1B 5ECJE 2MNUA 3PHOB 5DHVB 1PX3A 4JG0L 3FTGA 3T2NL 4BZ1L 4PJXA 3GK8L 4Q0XL 1HNGA 3FRUB 3KYOA 5TDNA 3BH9A 1J8HD 4NQSA 2QQLH 5KG9A 3OKNB 3DMMB 5HYQA 1QD0A 3CDFA 4ODSL 3DX8A 5KS9F 2HMIC 1BFOB 3P40A 4KZDL 1IKFL 1FPTH 2J4WH 5L6YL 1YEHL 3NACH 2DJ4A 4K2UH 1G7PA 5E4EB 4WFHD 5L9DH 4OB5L 3GDBA 4CMHC 3ARGC 3EAKA 3HG1A 2FGWL 4H1LB 4LNVA 3R0NA 3QP3A 4WWKD 3RL2A 1TITA 1XCTA 3U7AA 2C3GA 3DURB 3FB5A 1AQKH 3WUWG 4OJFH 4XVSH 4NZRL 4JQIL 1MI5A 1HIML 1E4WL 4TUOB 5D71L 1CGYA 2CLVB 3GZKA 1RJLA 5E5RB 1VKXA 3LH2H 1PKQA 1VFAA 4DAGH 1MCOH 5JHDE 4TSAL 3MBED 5EUKB 4U1GC 2AGJH 3IS1X 3KPNB 4G42A 2DQCH 5I6XC 4JDTL 4YZFF 2VO5A 2C3VA 1DVFC 2FDBP 2X9WA 4M43H 3WFZA 3IVKA 1NFDA 3P2TA 2VQ1A 2O5ZL 4I3GA 5AG8A 5EUOF 3GSNH 1AP2A 4KKCD 4JY4B 5GGTA 4CU7A 2AJUH 2IPKA 4TUKL 2EDFA 4L4VA 4OI7A 2VDOL 4CJ0A 4X6CF 4P2OC 2P8PB 1T2QH 4P23A 5IV2A 4RCAA 4F7CA 5F89A 2DDQL 3BKJL 5AWNH 5C71A 3P73A 4L29A 1S9XB 1KLUA 4X6EB 1HKFA 3O3DB 1HSBA 1YYML 3SE4C 2EC8A 1N6QL 3X14A 3QUMA 5EORL 1TZHA 3MRJA 3QQ9C 3H9SA 1A4KB 3KYKH 4IRZL 3QAZC 5IFAH 5DO2D 3VRIA 3U0PA 2OX5A 2D7MA 3MRBA 2DYPD 3AM8C 3BGMA 1T03H 1M05A 4JREC 4JN1H 5I1LA 3VCLB 5IF0B 3B43A 4OIIH 3C09B 3MRPA 4C56E 3GHBH 2P45B 4WI3A 4U1MB 4DUVA 4JQVA 2OTWB 3O6KH 3FO0L 5E2WH 1A0QH 5SX5H 1CR9H 1NMAH 3NCJL 4KK8C 4R0LC 2V2TA 4M6OL 4OUUA 1KCKA 1IT9L 2BCKA 2J88L 3RGVA 5I8KL 1CFBA 3KYNB 1TENA 2XFXB 4OCWL 3VXRE 4U1SA 4JO1H 2YZ1A 1J10A 4P59L 2IANA 2F8VA 2KZWA 2V5MA 2X09A 1MNUL 2NY1B 3FQXA 1ZTXL 4L1HA 1IC5L 1T66D 4S1SL 5FK9A 5KOMC 3MJ7A 4PRPD 5ESQA 3WS3A 5E8PB 3BT2H 3TFKD 1V7ML 3S3SA 3RBGA 4Q9QL 1WTLA 1FZMA 1Z9OA 5ESVB 1UWGL 3SE3A 4NQDA 4NO5A 1F2QA 2XQBH 4U1LA 4F33B 4RIRB 2DIJA 5LWYL 2FEEI 4OUOA 2ZG1A 1NEZA 4N0UE 1ZHBA 1D6EA 4P5TA 1CFSA 3QPQC 4QT5B 3QUMH 4HS6B 4OGXL 1J1XH 2WINB 3CXDL 1PLGL 4I18B 1PQZB 4W4OA 2P5WB 4RX4A 4LPWA 5L2JA 4LK4A 2OLDA 2CK0L 1MHHA 4TSCH 1HN1A 2JE8A 5FEBA 3V7AG 2BVQA 4XNUL 1IBGL 4KV5F 3UJIL 3D85D 1EFXB 2ADJA 5HHXL 2EIZB 4WW2A 3OGCA 3IJYA 3DGCR 4JFHD 4R6UA 2VH5L 3DMMD 3O9WB 5D2NB 2BSTB 2NQCA 1J1PL 2Q6WA 4YR6B 5F70A 1CIDA 3G04A 4NOBA 4D9RD 4N1EA 1G7JA 5FGSA 1D5ZB 3PGFL 1M7IA 4DUXA 2BP3A 1VFBB 2XWJA 1KTKE 3TWCL 1E28A 3GUTA 4H26B 3D1MC 3MV7E 2B39A 4I1NB 4OGZA 1HILA 1JTPA 3B2VH 4K23L 2FBOJ 4CL7A 5EBLB 4GW5B 3LKOB 4PJCB 5SX5K 4HT1L 4YXHL 1J1OH 4OZIA 2GT9A 4WDIA 1U8PA 2DI8A 4DVRH 3NCYP 4LCWB 1OD7A 1PY4A 1GC1L 4HGMA 4R7DA 1X4YA 4ZDHA 1N8ZA 2HKHH 3SY0A 2FGZA 2EYTA 1EGJA 3G6AA 4X4XA 4EBQL 3VXQA 3OXRB 4S1RL 3VH8A 1UVQA 4BYHA 3QHZH 5CJOL 1VPOH 3MREA 2FZ3A 1ITCA 2R4RH 3WE6B 4FZ8H 4XX1E 4H8WL 4OFVA 3ALXA 4M48H 3O3BA 4PLJD 2R8SH 4CVXA 3KHQA 3C60C 3MC0A 1NDGA 4PJ9C 5C8JB 1KPRB 1W72A 5GRJH 4MDJB 4MS8D 4Z7OE 1I3GL 1T2XA 2VLKB 3PGDB 2BRQA 1Q9KB 5D7LE 5D7SL 1TQCB 1UM5H 1H5BC 2KZ1B 2PYEA 4JB9L 4YDKL 1UC6A 2GW5A 3I02B 1MFDL 1KTRL 4NO0D 3VRJA 3K4AA 2BY3A 1IJ9A 3I3EA 3IAPA 5K33A 3MLXL 2BMKB 1OAYL 2R1WB 5SWSA 4RRPG 4HD9A 1NQBA 2H26A 1JF6A 2D0GA 3VMOA 4M7KH 5IEKB 1RULH 5DD6B 5DI8B 4PJFE 3HAEG 3U4BH 1YUHB 4ORZC 5DMKA 4IM8A 3UX9B 3I6LE 4HDIA 3V79C 3P0YH 4R4BA 2V5YA 3IB4A 1JN6A 3SE8H 5CGYC 4OZ4A 1OGAD 1N64L 1EBPA 1T04A 4K71B 4NKOA 1HDMA 2WWMC 4YWGH 3CSYB 3STZA 1IGJB 1GC1C 1RZJH 4S1DD 1NC2B 4OFKA 1BFVH 3H3PH 4OTXH 1V3KA 4QOKB 1PAMA 1BVKA 2IC2A 3MFFA 4K3EH 1QLRA 1OAUL 3FT2B 3MNVB 2OL3B 3PXHA 1EGJH 3BJ91 2DQUH 4Z5RB 3SJVA 4H8WC 5D7JA 2F74A 5C0BA 4IDJH 4KU1A 3S35X 3KDMB 3QIWB 1D3CA 4P2RB 4WHTA 2BOBB 1DL7H 2J8OA 3QO1B 4XPAL 1A6UL 2NY0B 5DQDL 1TJHH 4K55A 4PV9A 1W72H 4OV5A 3PHSA 1LO3H 2AJZB 3GO1H 4C55A 1FZKA 4JPVH 4J3WA 3RTQC 2NY3C 4M6ML 1UWEH 4LLAA 2RGSA 2A77H 2ICCA 1KBGL 3AU1B 3VFMB 1J0YA 4NWTH 2W9DL 3UTZA 1GXEA 1BQHA 5EU7C 4AL8H 4XCEB 3AROA 4TSBL 43CAB 4A6YL 3S37X 3M8OL 4JEGB 4JFXB 4YC2C 4DW2L 3H9SE 4U1KB 1JZ6A 3G08B 4PB9L 2OTUA 4O02L 4Y4FA 1QBLL 3ARDC 2P5WD 4GMTH 4O58H 3NPZB 3PV6A 3CX5K 1T20A 2JJUA 4Y5VB 2R0ZL 3QEHA 2P44B 1LE9B 4AZ8A 4M1GL 4JZNA 5CCKL 2ORBH 1EFXD 1SYVA 3T77A 4JQXC 4GAGL 5FYKH 3SDCB 5J7CC 4NQEB 2FYYA 3O9WD 3AS0A 3O45B 5C6WH 3QUKA 3ZKQD 5HSFA 1WAAA 3HA0A 5F6IB 1A6ZB 1QQDA 3PWJB 4N9GB 4MNQA 2WBWB 2WUCL 4G8FB 1G9NL 3T08A 2DKMA 3AXLA 3O4LB 1F4WH 1DBJL 3HC4L 3WO4B 4FABH 3JWOH 5BVJB 3S34L 4G6AD 3NGBC 4OM0L 4XI5D 2J5LC 3NFPA 2BNUA 2D7TL 5C3LD 2XRAL 2GFBB 3C8KA 5DS8B 3RNQB 3E8UH 4DN3L 2E9WA 1SVZA 2BNRB 4NCC2 3MFGB 2XIDA 3SGKA 3D48R 3PWNB 1A4JB 4QXWA 1N4XL 2AQ3A 3LEYL 1X5LA 3U36B 1E4XH 1TCRB 3MRMB 4FG6D 4NQDE 4LKCA 4JR9H 5C09E 2IQAB 3B3IB 4RQQA 4G8EA 4HUUA 4G80A 1A7BA 3WIFB 1G6RL 3TO4B 3UYPA 5IJVB 5IM7A 4JANB 3BO8B 4FQCH 2DRUA 3EOBA 3OR7A 4ZG1A 4E42B 5F96L 5I8OL 1TVDA 4M6NL 2XN9B 5LBSH 1OAZH 2HFEB 4GBXA 4PGDB 2CMRH 2DLHA 1X6NA 1L4IA 2ICWI 1I1AB 3BD3A 3MYJB 1NAMA 2DICA 3VFGH 3GGWB 3PHQA 4OQTA 4ZPTB 2DMKA 4XWOC 4U49A 5EZIH 1YYLL 5IVXF 4U3CA 1T21A 1G9NC 4XZUB 5EBWB 5TGBB 4HWZB 3RUGF 4GSDL 4XNYL 3N06B 4YDLC 4HZAA 2W60A 1OP5H 1KIQB 3IJHA 1ZHNA 2A38A 4ZUTB 3CLEL 4N1CA 4WCYL 4KKAC 4XRCA 1GGCH 1P4BL 5A16A 3NCYS 2FJFB 2IF7A 3QXWA 1W0VA 3J7HA 3CH1B 5DD1L 5IMOA 1FLRL 3B2UD 1YEDB 4F37F 5I2IB 5HYJB 3E1F1 4LSVL 5HDQH 1FDLL 5FUOH 2EH8L 5FO8B 4RGOL 2GY5A 2KUTA 3O2VH 2IGFH 1NCWH 1LE5A 3Q3GB 4ZUSB 1H9VA 3DYMA 4XBGA 1CDJA 4R7NB 5GJTH 5EOQL 4NWUL 4HFWA 2CJUL 4CRPA 2VDKL 4R2GC 3N1QC 3QIWD 4JO4L 4P9ML 2X1QA 4ZTOH 1LP9B 3L6FB 4PRHE 2J2ZA 4WI5A 3WJLA 2LU4A 1A6AB 4N8VG 2NY0D 4Y1AE 2L7UA 4HF5H 3KPOA 5CP7A 1BZQK 5AYUH 3SEPA 2PYEE 1RIUH 3DRQA 3QNYB 4XP9L 4OI8A 3DUUA 2YXMA 4XAKE 4YX2L 4KQ3H 1I8KB 3RAJL 3RWEB 1NAMH 1G0DA 5CJQH 4ZS6D 1NUGA 5EOTA 3UJTL 1KPVA 4Y4HD 2VJXA 4LCIL 4OQTH 2PCPB 5JLZA 3BE1L 2QSQA 2XKUA 5SWSE 2NZIA 5J6HB 4O00A 1UB5A 2A74A 4PP2A 1EVUA 3P4MB 5EA0H 1Q9OA 2YMXL 2R9HD 4TTDD 3CFIC 4S0TD 1Q0YL 1I1FB 4IS6A 1FYHB 2EEBA 3RDTB 1KJVB 5IHUL 1T1YB 4E41B 4GS7B 4Y19A 5HJ3A 3KPRB 2HFFB 1NC4A 2Y23A 1S9YA 2FO4B 1J0ZA 3QFJB 5FYKE 1MHPL 5E5MA 1DBML 3W81A 5F7HA 5ITBH 3TN0A 4X80H 5GRUH 3SDCD 1FBIL 4NQED 3RZCD 2CDFB 1INEL 4AG4L 1U8QA 1P7KB 1BOGA 4APQA 2DJSA 3I9GL 1HHKB 4CVWA 2VOTA 5IBLC 3CFBB 3EW3B 3O4LD 4XNQA 5CSBA 3G5YB 4MAYC 5E8DL 1FE8L 4Z77B 5DRNA 5F1NA 1MRFH 3ARFA 4DCQA 5IHBA 5IIEB 3LHPH 2IQ9H 3NMEA 5SWZA 1A3LH 5C0IB 3LKSB 1C08A 1OPGL 4HJJH 1WZ1L 5JW3H 1I8LA 3BW9B 5E2VL 2BNRD 5EWIL 2EIDA 5LGJA 3F7YB 1DANU 3QIUC 1FL5A 4GG8B 1ES0B 3MV8D 4QHKI 4FQPA 4Z18A 3RVXC 3WLBB 4JY6A 4FQLH 3UTOA 3VXNA 4XP1H 4PJIA 4NFCA 2IPUG 1XGQA 3WJJA 1JNJA 3VGBA 4CMHB 1NBYB 1KF9B 3ARGB 4ODBD 3TO4D 1AFVH 5HBBA 3B6SA 1MEXH 1OAKL 2RCSH 4MNGB 5KS9B 5CBAA 4WEUD 1X5AA 4R8WL 1GGTA 3GMNB 4GRWH 3JZ7A 4N5EC 5GS1C 5HY9A 4F7TB 3MCKA 4XVTL 4GXVL 1INQA 4UT6L 3LDBC 1MWAH 2ZCHH 4YHML 4PJ8A 3LCYA 4ONHB 1I1AD 3IKCA 5H37G 5TQ2L 2JLLA 2ITDB 2IBZX 1DLFL 4M8VA 4EN3C 1AGCB 3PIQB 2VAAA 1TZIA 2EO1A 3U0TB 1A7NH 4U1GB 2ZUTA 5I6XB 2H9GA 3TT3H 4MNQE 4MDIA 1DVFB 1ERNA 1XIWA 1BAFL 4NKIH 2XV6B 2EE3A 4LARL 2XZZA 1P53A 3QDGD 3ARTA 4H25B 3L5JA 1WGOA 2PXYC 1HH9A 1U3HA 1U6AH 4Z7NF 4HZLB 3O3EA 3L7EA 4TULH 3WNMA 4MLIA 4DN4L 4ODHL 1Q38A 3SBWA 2D4DA 1NGWB 3FN3A 2UVFA 2R0KL 2W59A 4MA3B 4RMQA 3IJSA 1OTUD 4DKDC 1MFCH 4JVUA 5L9DL 3MLTB 5JNYB 4EOWL 1HQ4A 5EUOB 2PN5A 1MHCA 4UUJB 4G5ZH 4YQXL 1JWMB 4WTZA 3FZUD 3U9PL 1EPFA 1FNLA 1N6VA 3L3KB 4QRSB 3NABH 4GKOA 35C8L 4NRYA 4X6CB 3V4VH 1G9EA 2EDTA 2QKIB 5FCUL 3IDIB 1HQRB 4NHUA 4BKLB 4ZFOA 4KMTH 3NCEB 4DTGH 4G43B 2HA1A 4HIIB 5EZOL 1MIEH 1CXIA 1M71A 3BKCL 4TPRL 5JUEH 4N5UA 3PP4H 4QHMA 4YEFA 4HIHB 4WHYG 2G75A 1FNSH 2P43B 4FTVB 5F9OH 1ONQA 1CXEA 1EEUA 2VERN 1YPZF 2VLRA 1MAML 1WFUA 3ULVH 4JRXA 2HWZL 4M7JL 3P9WB 1YMHB 3IDXH 2DWEB 4R0LB 1TNNA 4PG2A 3ARWA 4ZAKC 5T3ZD 4Z95H 1BEYH 1G7HA 2AP2A 1CD1B 1KTDB 3BFOA 1ZEAL 2WMPA 1ETZA 4JJ5A 3ZTJG 4MQXC 5CBEB 1MLCA 1RIVH 3S4SA 1HH6A 5EIIA 3DO7A 1UYWH 1F45A 4KKBD 2NZ9D 1ZVSA 3GSVA 2P7TA 1NCBL 3RPIB 3H0TB 3KPRD 4AM0B 2A2QT 2MSPA 2E7LC 2X4QB 5DJ2A 2UVEA 2CRMA 5HDLA 4BSVB 3QFJD 2I60H 3TCLA 1HEZB 4Z0XA 4ZTPH 4D8PB 1OP3K 5CUSL 2E27L 3QUZC 2H3NA 5JA9A 2B7DT 4PJ5B 5KVEH 4J6RH 3RNKB 3UCRA 4NKMB 1N3NA 3RWFA 2G2RB 4JGUA 5JPMA 2ZCLH 1QO3B 2FX8H 4MA7L 4QY8A 3VW3H 2VDML 4BELD 4OZFB 2ESVB 5I1GH 1JZ2A 3QDHA 1UM4H 5D70H 3SDDA 1REIA 4U1HB 1I9IL 2APFA 5ALBH 5E2WL 3V7AE 5IFJB 2GSIA 1NH6A 4OM1L 4LSDA 1A3RL 3U1SL 1DBAH 2IFFH 2HMID 4N0CC 2PETA 2NY4C 4FP8H 2ZUWA 2XTJD 5E95B 3IFLH 3AREA 5IFHH 5C70A 1U2CA 3QXUA 5B39B 2V7NA 2J6EL 3PDDA 3S3JA 1OTTC 3SKNA 3TLRA 3V0VA 2WWKO 2Q86A 5IG7A 3HUJF 4GRWE 4PJFF 4FFZH 4KI1A 4WWID 4AEHL 2VZTA 2Z31A 3PWUA 1LEGA 4JY5L 4I5BA 3A0OA 1ZLUK 5FYJD 2XWTB 1KLGB 2DL2A 3MRGB 1IL1B 2M2DA 4WI6A 3VWKA 3IU4H 1MJ7H 2YKLL 3OXSB 3RVUC 3SOBH 5BXFA 1YY8B 4PRBA 2YA2A 3VFVB 3KJ4C 3BP5A 3VXOB 1B9ZA 3OAUL 4TVPD 1FFNA 2MKLC 1IEBB 5IBTH 3V5DA 2VABA 4P3CH 3VI3F 4PJ9B 4U0QB 3I6KB 4ELME 1M1SA 1WBZA 2HG5A 3LOWA 4QTHA 2WUBL 5IVOA 5I9QC 3IU3B 1BGXH 4LDEB 3WNLA 5SWZE 2IH1A 1XF3B 4P2OD 1MQ8A 4K9EC 1A64A 3ELAT 3VFRB 5J12C 4TQEL 3MV11 2MCPH 4I77L 2IADB 3QDJE 4O2FB 3ALWA 4X0KB 1JNNL 3V4UL 2OJZL 4RWHA 4PJIE 4S2SB 9CGTA 3WBDA 4OLWH 4OLZH 3FO9B 2VISB 3GBML 4DGYH 3ILQC 3IFNH 3MLSH 5HGAB 4FQHA 3THMH 1CD8A 2CDGA 3OKEA 1RUMH 3LEXA 1X7QB 2A9ML 3RQ3A 4ENEC 1FYTB 1CG9B 4M02A 3ULVE 4MSWA 3V8CA 4FTVD 3KLAA 4DGIH 2EH7H 4L8DA 2XPGB 3ZDZE 3BP7A 3M07A 2GKIA 3ARPA 3UBXB 3RJQB 1CBVL 1J8KA 4P46C 5IT2L 5FGBA 3O3AB 4K3DH 3DXAA 3I84A 1U95A 1X5IA 4N0RA 4ERSH 5MI0C 1A1MA 3D39B 3EYUL 3NA9L 4LCYA 4JN2A 5TFSH 2XKSA 4X8JB 4ONOA 4YUEL 3TIDB 1Z9SA 3W0WA 2Y7QB 2NY3B 4V1DA 3CDGA 1UKQA 1YN7B 3UC0H 4LHUD 2HVKB 1RK0A 2X4RA 4NN5B 4PJ5D 3U4BL 5DUML 1V7NL 3HS0A 2XZCL 4OCSH 4GLRI 4HWBL 5LQBH 1JI2A 2MJWA 3GSXA 4URTB 4YC2B 3BP4B 3AS3A 3STLA 1OCWH 2AJXH 1XGPA 3QPQD 5ABDE 5IEHA 2JB5L 3ARDB 1AC6A 4IOFC 2HTKC 1MVUA 4U6HB 3VFPA 2ESVD 3QWQB 4XCFH 1NUNB 5GISH 5C0CA 3U46A 1I3RB 3MRQB 4YHYC 3PQYD 3V7MA 1FO0A 2VDLL 4EKXA 4YHPB 3JUZA 4QTIL 4Y4KA 1S7VA 3N85H 2ADFL 3FO1B 3NIGF 1G84A 5A2IH 4JRXE 1A6TA 2EDHA 3U2SB 1IGIL 1R6VA 3T8XB 5BVPH 1A9EA 3L3DA 1FNGB 3EKCA 6FABL 2VE6B 2A73B 2PTTB 3JV4B 3NGBB 3B9EA 2J5LB 2DMBA 5A2LH 1AD0A 2CXGA 4FQQB 4RFEB 1T0MA 3HE7C 3LPWA 4S1QH 4AQ1B 5FM8A 1JPSL 3G5VA 1J8HA 3HN3A 1AI1L 2Y6SC 5I19H 2Q7NA 3EO1A 3T0WA 1JK8A 1A02N 2P24B 1KJ2A 1FAIL 4NQVA 3ECBB 1G7LB 3S35L 1N0XH 5GIRA 1GGYA 4A6YB 2D2OA 4O58L 2YEZB 1OM3H 4UBDC 4WWKA 1IC7L 4Q6IC 1S7XA 3GSQB 3C60D 4PJ9D 5DQ9A 1M7DA 3CUPA 3V52H 1J86A 3HZVA 3GIVA 4GRLC 1PX4A 3SO5A 2VLMD 2DQEL 1T1WB 3LQMA 2HT2D 1Z0NA 3STBA 3MJGX 2ZUQC 4I0CC 3T0EE 1U8NB 3MNWA 4ONGH 1YEEH 4PR5B 3P0VL 1NLDL 4KK5C 4AIXA 4U6TA 1C16A 4JRYE 2AKRA 1FO0H 4KMQA 3IFOA 2IEPA 3MBEA 5IROA 4IOIB 1SBBA 5A2KH 4Q58C 4MCZB 5EO0A 1WFOA 3S37L 1MSPA 2LVCA 5IMKB 3MLRH 3CZFB 1F2XK 4OD1H 3S36H 4BSWA 4KVCL 4KPHL 3V95A 2D31B 2UZXB 4YDLB 4MJIB 1L0YA 2W92A 4JKMA 4PP1D 3VFNB 3HPLA 3WFDH 5EN2B 3OKMA 2D0FA 1NGZB 1O5DT 1T22A 2EDRA 1F4XH 3I50L 5CGYD 1DEEB 1HCVA 2P5ED 4NPYB 5IVXB 2OJEB 2WWMD 1U93B 1FYTD 3I3BA 3HFML 2DBLH 1DR9A 1R3KA 3RUGB 4KKLC 1QPXA 4HMEA 4PY8J 4UINH 3ZZ1A 5KSAC 1ED3A 1KJ2H 3JTSB 5L7XL 1BLNA 4IRJC 2HP4A 5ITFA 2LV4A 3NIDF 3LQZA 4JFQB 4R2GB 4NDMA 1HHHB 1OAZL 3M17A 3WIHA 3HKFA 1JPFB 2P47B 5TF1H 3DBXA 5BMFH 3GM0A 1NJ9A 2FECI 4LF3B 3T0BA 3RU8L 4OCNC 3HNVH 2DYPA 4Z0BH 1UXSA 4U6YA 2FLBT 1D9KD 2AJ3B 4LLYB 3NCBB 1LK3H 2MTPA 3GBNL 3OJ2C 4G9DA 4Z7UF 3L3OA 3REWB 4BFEA 1IAIM 4QHUB 4BUHA 2C7UA 3RTQD 2NY3D 3FOLB 1T3FA 1QFWM 3OKDB 3QUXC 1A1NA 2DQDL 2IPUK 4WHYH 4WEBH 4X6DE 5H94B 2JKXA 5DMYA 3D87B 5DD5L 1RPQA 2CK2A 3QQNA 1AD9B 4Y2DC 3EDFA 4PUBL 3UJJH 3PGCA 4LPTA 3AS1A 2B4CH 2B1HL 2A6DA 5GGSY 1WF5A 5HYSA 5IR1B 1FGNL 2O61A 5KW9L 4ZD3L 3K8MA 5JXAH 1TJGL 2XZQH 3ARDD 3RY6A 4YHZL 1IEHA 1MPAH 1JGVH 3O6MH 4HXBH 4G8GB 5DMIH 4PJGE 5D2LE 4X5LA 4OCRL 4PRPA 3MLUH 1HHIB 4QWWC 2O5XL 2NYYC 5DLMH 2H8PA 5JDSB 3JWDC 1KCRH 3GJFA 3LKQA 3NOIA 2F5AH 3WN5A 3IRZA 2JCCA 1FJ1B 1FFOA 4Z9KB 1DDHB 4XPTL 2R69L 4HQQL 2G9HB 5JIKA 3L5WB 3MRCA 2LABA 4FQ2L 3BVNA 2CLRB 4LIQH 4QXTB 5I1DB 1X44A 3FCTA 4MAYB 1QHPA 2A6KA 2FWOA 1FVDB 3DXAE 3CC5A 1OB1A 3PHOA 2QSVA 3TP4A 2E3VA 3INUH 1RAMA 2WNGA 1IGTB 3QCUH 4PBVC 5J3HC 3D85A 3NH7L 5DMGC 1F8TH 4ODVL 1TZGH 3CFEB 4XXDB 3CMOL 3OKNA 3DMMA 3W0WE 4GRMB 3V0AC 3MV9D 3QIUB 4KRPC 2DAVA 1QBBA 1SBSH 2B2XL 3W2DH 2YD7A 2B20A 3PL6C 3RY5A 3RA7H 1ACYH 5BOZG 4H1LA 4LVHB 2NW3B 3A6BH 1HHGB 1I1RA 3DURA 5DRZB 2WZPD 1LNUA 4PGCB 3UPRB 5GS1B 8FABB 3LDBB 5HHNB 4TUOA 2CLVA 2DQHH 4DZBB 1MY7A 4P9HH 5LXGL 2Q76B 4F2MA 3CMGA 4NBYB 3D25B 4LLVB 5GGUB 1Q0XL 4PYHA 4OGYH 4KVNL 4HK3J 1QHOA 4HG4K 4ORGB 4JM4L 1VERA 3GJFH 5EUKA 1XGUA 3KPSB 3MGAA 3NZHL 1TETH 3BXNB 3QEQB 1S7WB 5FHBL 5FOJA 3FJTA 3LHPL 4KQ4L 1YMMB 3V6FB 1U92B 2PXYB 1AQDB 5BZDA 1NSNL 4XXCA 2YWZA 4JY4A 4KKAD 4I13B 2BY1A 1H3PL 1U8MB 2E6PA 4C56B 4JFDE 1RVFH 5DHVH 5I1JH 3C6LC 4WNQB 1PDKA 3HMXA 3UMTA 4UAOC 5C0JB 1XAUA 3W5MA 4KK9C 3T0DA 4NO0A 4NYLB 1JWSA 3D6GA 4XPHL 1S9XA 1RIHH 4AMKH 5JQHC 4X6EA 5DVKA 1S8DB 3O3DA 4X5XB 3MXWH 2O93L 1MCLA 1FORH 4BQ9A 4D3CL 2DQGH 4FFYH 1TDQA 3MV01 1A4KA 4R2GD 4LFHG 32C2A 5ALCH 1MWAL 1EO7A 2C3XA 3IYLW 4XPBL 4H1LH 1LVEA 1IKNA 4XMLH 5GSVB 5CEXB 4F80A 4U7SA 1MCSA 1WITA 1YDPB 1OGAA 4K8RL 3OKLB 1JHLL 1L0QA 5E99H 1S3KH 4HXAH 1R3IH 2VNCA 4XMPL 4F15C 1MCWW 5F21B 4M61B 3P9LA 2BHYA 3ZYIA 3VCLA 4GH7B 5DUBB 1U41A 5IF0A 1S9VB 3J8F7 2HLAB 2BVTA 2Y9RT 3BISA 4U1MA 1G9MH 2OTWA 5J0BA 1QEWB 1JGEB 4N0UB 5DD0H 3PG2A 4JHWL 1NAKH 1BJ1H 3P11H 4CVZB 1CL7H 4ZAKB 3BAEH 1BBJA 2GJ6B 1NBZB 2X4SB 3BSZH 3KLSA 3VE0B 3ARZA 2NXYC 4TULL 4P2CG 4YE4H 5I75C 3ROOB 4QNPF 2W65A 3CCHB 1VENA 3KLDA 1EJOH 1YPZB 3TT1H 3X17A 5C6TL 3GJFK 1M6OB 4MAUL 2X5PA 2Y07L 2ADGB 4G5ZL 3JTTB 3LEVL 4OLYH 4KRLB 4BFIB 3HMXH 5E8PA 1BM3L 3HMWH 3T2OA 1Z3GH 3QUZB 3X3FL 5EO9B 1EHLH 5ESVA 3CVIH 1KJ3H 3QNZB 3QDME 4XTRC 4RIRA 4EIZC 4F33A 4LIQE 5D1XC 4LLUB 5IBLD 1MIEL 4PFEA 2QQKL 2IAMC 4N90E 4OCXL 4QT5A 4HS6A 4MAYD 2I27N 2WINA 4JFYA 1PQZA 1CD0A 2P5WA 4I4WB 5CILL 4JPIB 1Z0MA 1TXKA 4OBSA 4GJTB 4POZC 5CKGA 1ORSB 1WEJL 1X4XA 1QTYT 1MJ8L 1EFXA 1G0YR 1CYGA 2AEPH 3O41B 3Q0HA 5JHDD 2EIZA 1RI8A 3CFCL 4TUJA 2BDNL 3O9WA 3HI5H 2BSTA 3QIUD 2NY4B 3ZL4H 1TFHA 4YR6A 3L5XL 3WL9B 3RVXD 1DQJB 1BVLB 5FO7A 4L8SA 4FFWC 1D5ZA 1CLOH 1SEQH 5JW4R 1RIVL 1VFBA 1OAXH 1DQTA 1FRGH 5AAWA 4NZTH 3UPAA 5MERB 4H26A 2I24N 3IAGC 2DMCA 2MKWA 5D7LB 5D5MB 1CU4L 3UXFA 5JR1H 4WUKH 5EBLA 1KIPB 4X7TB 3KJ6L 4GW5A 3SDYL 4AT6B 1AGBB 1PBYA 4PJCA 1CD9B 4NZUH 1SM3L 1NDMB 2VXUH 2FECL 3FQNA 3T65B 4KJWD 1JFQH 3DUSB 1K5NB 4CU8A 1JZ8A 1HWHB 4L1DA 3GIZL 4BK5A 3IDNA 4EN3D 1AIFB 3HUJB 4PJFB 3EYOB 3OXRA 1RJYB 3JWNC 4PJDE 5JORA 1V8HA 5KSBE 4HWEL 4PD4K 1MF2H 1AGEA 1EXUB 1YMMD 1KPRA 5D6CA 3EO0B 3LRGA 5I9QB 2PXYD 1F02I 1QYGL 1LO5A 3M1BB 1Q9KA 4C56D 1S7TA 3LIZH 5C07E 3UTTB 3HNSH 5AD0B 5J12B 2CH8A 2M1KA 4DEPC 3I02A 1VADB 2AABH 1JYVA 3QYCA 4J23A 1WIUA 4AIOA 3ARRA 4GKNB 4ZO7A 3VXRD 2R1WA 3H2WA 3LMJL 4HBQA 1ZAGA 5ANMB 2JJSA 5T1MB 1X5ZA 5IEKA 5DD6A 5DI8A 3F62A 4HS3B 5CLWA 5F7YC 4FQ1L 3GFUA 1YUHA 4C57C 3DX7B 1CE1L 5J4MA 3QISA 1N7ML 1HKLH 5F7LB 4MZ3A 2Q87A 3IU4L 4FQJL 4KUZH 1XGYH 1NLBH 1EHXA 3CSYA 1KEGL 1IGJA 1PSKH 2FJHB 2EDDA 1NC2A 1XCQB 3IDJB 3FN0H 4ZUUB 3TNNB 4HJGB 3T04D 3FT2A 2OL3A 4P46B 4BZYA 2ADIB 4Z5RA 4MJ4A 4NO2B 2GJ6D 3UTPD 3KDMA 3VG0H 3QIWA 5J1AB 1BF2A 2WLYA 1NL0H 2E7HA 2R56H 5TQ0H 5MI0B 4MQXD 5L88H 2YC1B 3QO1A 1JIBA 3HE6D 2VXQL 1Z2KA 3FQTB 3ARYA 4Z8FL 4CBPA 2MCPL 2AJZA 3GSOB 3QG7L 3I75A 5BRZE 4PJAF 2DOCA 4M5YH 2JJTA 2G60H 2VR5A 4EVNB 2ED8A 4U0RC 4FXGB 3WS6C 3C9NB 1U8LB 2APBA 5DC0A 5HHQA 1A6VL 1R24B 3O6FC 3TVMC 2GTWB 3QUZD 3W9EB 3AU1A 3VFMA 2ZPKL 5FOBB 3KPMB 3MLSL 5FHAH 5EU6B 4XCEA 4CDGC 4YHLH 5BS0B 2Q7YB 3RWCB 5CFHA 4JFXA 2A9NH 4RAVB 4ODUB 4U1KA 4ZUVB 4HKJA 3G08A 3RWGB 2IPTH 4G9FB 5IB5B 2BSRA 5D1QC 4D9LL 1FFPB 5AEAA 3HCVA 4KDTC 2CDEB 4Y5VA 2HTLC 4O2EB 1LE9A 5CINL 3S5LA 1OGTB 2D9QB 4YHYB 1B88A 4Q9CA 4C54A 5EOCL 3MRFA 4QF1A 4EDXB 4KROD 5DMJB 3SDCA 2HRLA 4NQEA 5F88B 3RZCA 5FUZL 4EQ2A 3O45A 3HI6L 2NY4D 3BD4A 4R97C 2ZSVB 1A6ZA 3PWJA 4N9GA 4YHNB 2A1WL 2V7HB 4G8FA 3BRDA 2M26A 3O4LA 2OL3H 1T80A 3TJHC 5C0RH 1U8IB 5D7LD 4OFIA 1K6QL 3VD5A 3T0EC 3OB8A 3HE7B 1ADQA 2K9UA 4LQFL 1UENA 1KIRB 2GFBA 5DS8A 3ARSA 4PB0L 3RNQA 5B38G 1CFQB 1RZFH 5IGXL 2BNRA 2JELL 1KCVL 2X1XR 3PWNA 1CVSC 5KAQG 4G3YH 3MV8A 3B9KD 1T89C 3SKOB 1I8MB 2AAVA 1P4LB 1YEJH 2UYLA 4NJAL 2R23B 2OR9H 5C7XL 5IMLA 3RVUD 3K2UH 5F7EL 2QQQA 3MRMA 2HFGH 4DWHA 1G1CA 3B3IA 5KVGL 5JPNB 3TO4A 3O6LH 3P4NA 4Q6IB 4XCFL 2Z9TA 4JANA 2E6JA 3ETBF 1OL0A 4E42A 4YAQB 3MUJA 4RFOH 4KTYA 3MMEB 3VDCA 3R4DA 2HFEA 3Q5OA 4N8CL 4PGDA 5SV4A 2ZUQB 1I1AA 1OLLA 5KANG 3SGEH 4X7SL 3UTTD 1OTSC 3BDYH 1LDPH 5KSVB 4XC3H 4ZPTA 4GMSH 5D2NE 5DGRA 1CLYH 3SDXA 1C8PA 2CRYA 3MLYL 3SQOL 4XZUA 5B39G 1I8IB 1NGXB 4HWZA 3QCTL 3L5HA 2FRGP 4Y1AB 3ILQD 3QDGA 1MREL 3VXTB 1ZXQA 4ZUTA 4YH6A 4HH8A 5I15L 1QR1A 3CFDB 3SE9H 1YEIL 2FJFA 3Q1SH 5C6PB 3CH1A 4PJCE 5D7IE 3HC3L 4XCCL 1ADQH 1YEDA 5E9DB 5HYJA 1S78C 1WQVT 4OLVL 5DTFB 2H2SD 1T7XA 5T5NG 5FO8A 3R1GH 4LCWE 5D2LF 2G5BB 3OKOB 3DOSA 1IMHC 2KQNA 5GGVL 15C8H 1DE4B 1ZVYA 1C5BH 2R2BB 3Q3GA 4D0BB 2R0LL 1D5MA 1TQBC 4IRJB 4R7NA 4HX1B 1QP1A 1VSCA 4OQ1A 4P46D 1R5WB 1EAPB 4JFZH 4MXVE 4X6BB 4NC0B 4U2ZA 2HH0H 4R26L 3L6FA 3DGGB 4BH7A 1A6AA 4MB5A 4O4YH 4KAQL 5J13C 3LPFA 3KLHC 3QPXL 2VLKE 3V5KB 4EZMA 2ENSA 1X5KA 4I0PC 5I1IH 5GGRB 3PWPE 2XG5A 4X7DC 1IVLA 4U6VH 4QO1A 3B83A 4L4TB 5HGHB 1I8KA 1Q94B 1BHGA 4MJ5B 4WUUB 2CGRL 1RK1B 2PCPA 5ACZA 3ZKMC 4HCRL 4Y2DB 4TTGA 4HGWB 1NGYB 5EU6D 5J6HA 2F54B 2LQRA 3GMLB 1UT9A 5E00B 1XF4B 4ZXBC 1KG0B 5DJ8B 4Z7UB 1OVZA 4O51A 3JXAA 3PJSB 1KJVA 3WNKA 1OSZB 4G9FD 1C1EL 2AI0H 1T1YA 3X3GL 1GOHA 1EMTL 4NUJA 3KPRA 4RMTA 2HFFA 3NAAH 5A2JH 3WDJA 2JTDA 1HOCB 5T1LB 2O5YH 3QFJA 2OI9C 3QHFH 2YN5A 4L4JA 3VXMB 2FX7H 3P4LA 1CF8H 1NCUA 4HBCL 3EOAB 2Y06L 1YEKL 5C09D 5A40E 5IB1B 4ZS7H 4QOKE 4KJPC 2CDFA 4H20H 1OHQA 3QFDA 1P7KA 1NFIA 4KTEH 3E3QC 4OZHE 4KUCF 1HHKA 2DLGA 1INDL 2HRPH 4ODWB 1U3JA 3CFBA 3TBYB 1JE6A 4RX4D 4HUWA 5ILTH 1FVCB 1DQQB 1F4HA 3LN4B 2Z8SA 2NY2B 4P2RE 2OP4H 2HN7B 3DLQR 2Q20A 4R96B 1JPGB 1BD2B 3FAXA 4YK4C 1CXKA 2FB4L 3QXVA 5TDPB 3WFHA 5IIEA 4X9HA 1LO0L 2VUOA 3LKSA 4G6MH 1A47A 1RURH 4F58L 5D72L 1IAKB 2BVOB 5I1HH 2Y6SD 3HRZB 3NZ8B 3BW9A 4UTBH 1K3ZA 4ETQB 1Z9LA 4KRPB 2B1AL 4GG8A 1ES0A 3B9VA 5B8CC 3BWAB 5HVFB 2PYFB 2WQ8A 3F7VA 3W39B 4LKXB 4PJXF 4XMKL 5T3ZH 3PL6B 1NKRA 1IFHL 1MFEL 1U0QA 4UBDD 2EE9A 4OF5A 1IQDB 1NCTA 4M1DH 1EEZB 4MNHB 5FDWB 4UIKH 1FL3B 2X89D 5KS9A 4NBZB 3GMNA 5F71A 4PY7A 5I17B 4GRLD 1YA5A 1JTTA 4F7TA 2XQYG 4RBPK 5IWLC 3JV6B 4K3JH 4ONHA 3MRIA 2ITDA 3FQRB 3LN5B 1AGCA 3PIQA 3U0TA 2EZ0C 2VDRL 2VXSH 4YXLH 4TNWF 4I3RL 1ZK9A 4OF3A 2D03L 5H35B 4KHTH 4Z76A 5M95B 1T0NB 5AG9A 4PRHD 4F57L 4JHAH 3O4LE 2GSGA 1HXMA 3INUL 3DIFB 4YFEA 4UU9B 3MGOB 2VLJB 4Y1AD 2DIAA 3N1MC 4QRPB 3WIIL 5INCB 4GXUN 3TYGH 5K9OB 3F7QA 4LHJB 1KN2H 4HZLA 3C6LB 3UYRH 4P2OA 4UAOB 5TE4H 1NGWA 1BQSA 2AJVL 2UWEF 3C08H 2V5RA 4N0FB 5ESAB 4MA3A 4KZEH 4KKLD 5FYLL 3SKMB 1CTNA 5CWSB 4JZOB 3DJ9A 3MLTA 5SWSD 4ZMAT 5ICZB 1NFDF 1ACYL 5KSAD 5LAXB 5FM5M 2W9EH 3L3JB 3CVHB 1JWMA 1U2HA 2FEDC 5H2BA 4CGTA 4IRJD 5KVMC 3HRPA 4QRSA 4NUGL 5E2UL 3L3KA 5FGRA 1UJ3A 3RWIB 2EICA 4X6CA 4TOYH 2QKIA 1DQLH 3BP6B 1T1ZB 1HQRA 2QSCL 1FIEA 4BKLA 2KDGA 1YY9D 5IK3B 3BKYH 2YD5A 2XI9A 5JHLL 5FYKD 2XN9E 4X8XA 3ZLQC 1I9JL 3HI1A 4P3WA 4F15B 1IQWL 2Q8BH 3G6JF 3ZYJA 4D0DB 4FTVA 5FYJH 1N6UA 3QUXD 5HGBB 3MGTB 3T1FB 1YMHA 2DWEA 2W0KA 4R0LA 3OAYH 1GGBH 4Y2DD 3EDKA 1WIPA 2RIKA 2F54D 2X70B 1CD1A 2NXYB 2SEBB 5I75B 2F8OA 2PW2B 1RUPH 3KWWB 3QXDB 5I1KL 2E9BA 5C08B 5F6HI 1CT8B 1RZ8B 4JG0H 3T2NH 3RPIA 4BZ1H 4AM0A 3GK8H 2BFVL 4Q0XH 4EUPB 1AR2A 3U4AA 1ZS8B 2X4QA 5T1LD 1NANH 3MXWL 5HYJE 4BSVA 4UQ2A 3VXMD 4QWWD 2FH6A 1HEZA 2NYYD 2MCG1 1JGLL 2DQGL 4LHUA 4ODSH 1ZT1B 2OCFD 2WK2A 4PJ5A 5BQ7B 4KZDH 2EDOA 1IKFH 3RJDA 4NGHL 3RNKA 4G6JL 5L6YH 4NKMA 5D1XB 2VZVA 3LQAL 2G2RA 2IAMB 3NN8B 5DJ0B 1QO3A 5CMAA 4OB5H 2FGWH 5E99L 5BJTB 2W38A 1R3IL 4OZFA 5KSBF 1LP9E 2AXJA 2ESVA 3L3IB 1ORQA 5JQ6L 4FFVC 3CDYA 4L8CB 4NIKB 5IVZA 5J3HD 3Q5YA 4NZRH 4JQIH 4KGJA 3PQYA 1HIMH 5DMGD 1E4WH 1FQ9C 5D71H 3MOAH 4WI9A 4OCYL 3BKML 1X5XA 3T1WA 1MAJA 1Y6MR 1L0XA 1GRWA 4MNQD 4KRPD 5JMRA 4TSAH 3WNPA 3R8BB 3TPKA 4QGYA 1IAMA 4JDTH 1NCAL 3SGEI 5FKPB 3ZTNL 5T1KB 2R1XB 4GAFB 5K59E 1UFUA 1YJDL 1V05A 2O5ZH 1TJIL 4XBEL 5BW7C 1B0RB 4CNIA 4E41E 3BN9D 2YK1L 3L5IA 4TUKH 5LG1A 3OAYK 2VDOH 4HUKB 2JIXB 3QULB 1W2KT 2XWTA 2VZUA 1KLGA 3BH8B 3MRGA 1IL1A 4JRWA 5EBMA 2OBGA 1PZ5B 2DDQH 3BKJH 5E4EC 4P5MB 5E8NB 1IAIH 3QI9D 3UTQB 4NQCE 3VFVA 1YYMH 1TVBB 3VXOA 3LQAC 4C59B 1N6QH 1IEBA 5EORH 4OZIF 3C60A 4PJ9A 2VLJD 4IRZH 4GW1A 3I6KA 4QRPD 1PG7X 1KULA 4A2MA 1ITBB 4HPYL 4OZFH 3ESVF 1K8IB 3V9FA 4G6FB 1H5BA 3C6LD 4BA8A 1U8OA 1XF3A 4JG1L 3VFRA 5ICYB 4DEPB 4KK9D 4UI2A 1F90L 2DQIL 5H8DA 5DJDA 2IADA 4X0KA 3NFSL 3FO0H 3H9HB 3S8WA 3MRLB 4POUB 4S2SA 4M6OH 4X7EC 3B8SA 3FO9A 2VISA 1IT9H 2J88H 5I8KH 3NVQA 5TPWL 1YJDC 2Y36L 2FSEA 4OCWH 3QEGH 4ODXB 3Q6FB 2A83B 4MNGE 4P59H 4E5XB 1WICA 2YUWA 5KS9E 3T2PA 1MNUH 5E5UB 1EZVY 1ZTXH 1X7QA 2P5EA 1IC5H 5C0GA 3P9MB 1FYTA 4DKAA 4GUPB 4LVOC 4S1SH 1NMBL 5FYJE 1AGDB 1V7MH 4LP5A 4Q9QH 3UBXA 1P9MC 1UWGH 5I1AB 5LWYH 2HAZA 3WFCL 3O3AA 5IKCA 4LP4A 4OGXH 2LTQC 5TE7L 2A6IB 4OKVB 4MD5B 3CXDH 1BZ7B 1PLGH 5C2BL 3GMPB 2LAAA 1D9KA 3HHRB 3Q48A 2CQVA 4XNUH 1IBGH 3TIDA 1XF5B 3O8XC 2Y7QA 3RTQA 4YZFE 5A3IC 4WV1A 1RZIB 3DTXA 3EZ8A 4U0RB 5HHXH 2NY5L 1FCGA 2VUYA 3O6FB 3TVMB 2VH5H 1YN7A 2HVKA 3BEVB 2E9IA 2DM7A 1J1PH 5EUOE 5TF0A 5DJYB 1N59B 4XTRD 3PGFH 3LKNB 1RHFA 3MUGB 2NY1C 4PJAB 2DLTA 4PJ7E 3BX7C 3TWCH 4FS0A 5I1EL 5HVGB 1NC4D 3ARDA 3JWOC 5D1QB 3OKYA 1KC5L 4YGVB 4K23H 4K8RD 2H2PD 4POZD 1ZKAA 4HT1H 1I3RA 4YXHH 2Y25A 5ADPL 3BGFC 4JQXA 2VLLB 4FTVE 1GC1H 3HZYA 4NM8L 5HXMA 4D94A 3FO1A 3QJHB 4R97B 3PP3K 2NLJB 3DRTB 3U2SA 4EBQH 5LJYH 5CIPB 4S1RH 3T8XA 5B3JE 5CJOH 4I18C 3VFTB 2VE6A 5T1KD 3TBSB 4H8WH 2A73A 2PTTA 3JV4A 5SWZD 3JV0A 4FQQA 3QO0B 4N68A 4MD0B 1A7RL 2DD8L 1I3GH 4OGAC 1WAAF 2PR4L 3FRPG 5D7SH 3QDJD 1N5YL 3ARBC 5D7IF 2NY5C 3MV9A 4JB9H 3TBVB 1FNFA 1RY7B 4YDJB 1II4E 1MFDH 4P5KB 3SDAC 2F5BL 3ECBA 4YBQC 4PJ5E 2VSDA 2ED7A 3MLXH 1OAYH 2BXZA 4A6YA 2ZNXA 3TH4T 3N9GL 1A9BB 3VMPA 2YEZA 2A0LD 5EZLB 4NT6B 3GSQA 4MXVF 2Y5EA 3U7WL 1C5CL 3QZWB 3FO2B 2ESVE 5A2FA 4Q6YA 1T1WA 2W07A 1AC0A 1EO5A 4NNPL 4G6FD 1N64H 4LLDB 4YDVA 1HE7A 1FL6B 4RNRA 4LLMB 2ZJSL 5LGHL 4WU7B 4Z78B 3VXPB 4EI5C 4IOIA 4MCZA 4YNYB 5L2KB 4PGEA 2W0FB 1S9WB 1OAUH 1EUTA 4P2QB 5EU3B 5IMKA 1CLZL 2X42A 3CZFA 4L3EB 4NNXB 4X5WB 2D31A 4KV5E 3MLWL 4HPOL 5DVOA 1LMKA 2XA3A 2F19L 4N8VB 3VFNA 3VD3A 2EDBA 1TQCC 3FQWB 1NGZA 4XPAH 1A6UH 4HC1L 3T0AA 5DQDH 3UAJD 5FGCB 2NTFB 3SPVB 3CSPA 1LO2L 2EDLA 3IXTB 3H9YA 4NPYA 3C5JB 4LSTL 1WZMA 5IVXA 5EFIA 3IFPB 2OJEA 4QRUB 1U93A 4XAWL 2Z92B 2V9TA 4NKDB 3RUGA 5CD3B 2MPAL 2VTFA 2XA8L 1AO7B 1CI5A 2VZSA 2VDNL 3D3VB 1KBGH 2HT4C 4B53A 1UM6L 1DEDA 1MCCA 2NY6C 2W9DH 5HHVL 1G6RA 4J3TA 2Q3ZA 1NANI 3RWHB 2QL1A 4JFQA 4TSBH 4KJYA 4OZHF 4A6YH 1HHHA 4OCMC 3M8OH 3PDOB 1JPFA 5IQ9B 1UCBL 3MA9L 4PB9H 5D2LB 4O02H 1EH9A 3EYFB 5J13B 1QBLH 4LF3A 4KDWA 5IHZB 4U2YA 4PV8A 4HLZG 2AXFB 1F00I 2R0ZH 3AAZB 4LLYA 4I0PB 1ROWA 2UUDH 2ICWJ 1Q1JL 1R0AL 3MACH 5ICXB 1D6VL 1KB5L 1SEBB 4M1GH 3U0WL 1MVFA 5CCKH 4NCC1 5GGSB 3FOLA 5I8EB 3OKDA 4GAGH 3O6FD 3TVMD 1QSFB 2CO6B 1A5FL 3RL1B 5H94A 2AVGA 1LILA 3CJJA 3MBXL 2GAZA