1T3OA

Solution structure of csra, a bacterial carbon storage regulatory protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
84
structure length
84
Chain Sequence
b'HSSGHIEGRHMLVLSRKINEAIQIGADIEVKVIAVEGDQVKLGIDAPKHIDIHRKEIYLTIQEENNRAAALSSDVISALSSQKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon storage regulator
publication title A model for RNA binding by the bacterial carbon storage regulatory protein, CsrA
rcsb
source organism Bacillus subtilis
molecule tags Rna binding protein
total genus 8
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02599 CsrA Global regulator protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t3oA01
1T3OA 1Y00A 4K59A 4KRWA 4KJIA
chains in the Genus database with same CATH superfamily
1UETA 1RHMB 3PZPA 1O8BA 3HVRA 3RUBL 1RA7A 1XR6A 2BE2B 1R27B 3HHLA 2LVWA 3MEGB 5KFRA 3OTBA 2HPUA 2I6WA 4PZVA 1QAYA 1X8DA 5AE3A 3QZ7A 4JOUA 4RWWA 4C6AA 4Z37A 3WQPA 2FLNA 4EBCA 2CJBA 1CG2A 2DXEA 3U1NA 1QD1A 1KC8T 4OV6A 3QSYB 3BDPA 4K4SA 1FVQA 2ZHBA 4P2MA 4ZPCA 2WVBA 1WF1A 1FTCA 4B3TF 4K8RA 1HWKA 2HWIA 3SV3A 5HJYA 5HMWA 4ID8A 1DURA 1VQ4S 1S72S 5J2PB 3R2DJ 1HYSA 3CCLS 4JBCA 3JB9k 4DQSA 2RHSB 3W9HA 4DPWA 1FD2A 3VAKA 2NXNA 1PC5A 1LV5A 4EO8A 1HLWA 1GX6A 3G96A 3MR2A 1LFPA 3DC2A 4CH0S 4KBIA 2K7JA 2XMJA 2ASJA 3TJ9A 5D0RA 4WP9A 3EVWA 3TAQA 5B0GA 4DZ6A 1LOUA 3B4MA 3GYXB 3MDFA 5CYMA 3IM8A 4HH0A 4E0DA 4CLTA 1IJEB 4KJIA 1F5AA 3DXBA 4I69A 1HBUA 3QO9A 4GKKJ 2XNQA 2DHGA 3EGNA 2H51B 4NMLA 1QSSA 1IBMJ 1RWNB 2VDHA 2XSJA 4KHRA 2DNLA 2WB4A 3MR3A 1Q0NA 5EX0A 2J8AA 2R7WA 4WFXA 5M2RA 2ACYA 3PIOQ 4RUBA 2V2ZA 2CQGA 1XMQJ 3LPYA 1SJ4P 3JQJA 2VZ9A 2JOQA 2NUHA 2LXFA 3LH2S 4WP8A 2HRYA 4LF6J 6FDRA 4R5PB 3A4TA 2LU2A 2FLLA 1TU0B 1X4DA 3N9UC 3KHHA 4C3MA 5CCLA 4X4VA 1SJ1A 4DG1B 2FVQA 3IG1A 2RKIB 3ICLA 2BOAA 4PXDA 4RW6A 3TX0A 3MM7A 3T1YJ 2ALZA 3PG9A 2W25A 1DHMA 3LGMA 1QE1A 4ES3A 4DU7A 4FNIA 2NR0A 4DQIA 2QT7A 1RT5A 2XWXA 1RT3A 4KV8B 4Y2IA 1OY9A 1XMOF 4CLKA 3GFZA 4DR7J 4ZN3A 1U1LA 1HQ2A 3N6MA 1VC5A 2MPUA 3I6PA 4LFAF 1YJRA 3KDNA 4AQYJ 4DS4A 4UTGA 4KGXB 2H9ZA 5E2QA 3AY0A 3R3TA 1LWFB 3ZTQA 1G6BA 3ILLA 4DHVA 2KFNA 2F8MA 1WORA 4M5NA 5FDLB 2ZKUA 5G0RB 1RLCL 1T94A 3DOLB 1FFWB 4RL1A 5KTQA 1FFSB 4J9PA 4ZVQB 2CG4A 3Q2SC 2BQ3A 2G2ZA 1JXVA 1B0VA 1XQIA 2G1DA 1S9FA 1D9FA 3LA0A 5GVQA 5B0CA 3MCOA 1S12A 3POTB 1OY6A 2GMHA 1YJTA 3HHKA 4O4GA 3W2WA 2QA1A 1PBUA 2ASLA 2J7UA 2SXLA 4PWDA 2NS1B 2OEJA 3R1HA 1SC3B 2CZ4A 3QYYA 4LJMA 1RWVB 3IRWP 1WSVA 4YHHF 2DYAA 3KLFA 4DX6A 4RPFA 3KK3A 1SJ3P 4RW7A 5AXKA 1T05B 4H4KC 3JSMA 4ED8A 5KFGA 4RNFA 1HQEA 3SCKE 3AQOA 1VQ6S 3IBWA 3ZXWA 1FKPB 4QPTA 1R6YA 1DRZA 4KHPJ 1YVFA 1FNMA 2A18A 3UVJA 3MMBA 2BRKA 4A47A 1B7FA 3MUMP 2NUUG 1IKXB 2OPQA 3G9CA 1V6HA 2PD1A 4PG5A 1SBRA 3MAHA 3A3PB 2VHGA 4XPEA 1ACMB 2Y1JA 3R5GA 4ZVTB 1NCLA 3KLEB 1E6YA 3U1LA 2VH7A 2CNLB 4NZ0A 3K8VA 1S6PB 3T9ZA 4KGVB 4KGKA 1Q5VA 3VQTA 2BV3A 1ELOA 2DGVA 4G6VB 2LYVA 4CQ1A 1VGYA 1QJHA 1FRHA 3NGKA 2CQ4A 1TR0A 3M2VA 2MQLA 3PYDA 4PUOB 1N4LA 3ZZZA 1UA1A 1KFDA 3Q8RB 5CD4H 3LWLA 1SH3A 3DGPB 1ZS6A 4P2FA 3LP0A 4MAKA 4XK8C 3GCWP 3TA1A 4IRCA 1REGX 1CC7A 4K2XA 3GJSB 1Y3KA 4LFBJ 3K57A 3DMJB 1IKYB 4MH8A 4CRJA 3OR2A 1VRTA 1SJRA 1LW0A 3PNIA 4E8UA 3KK2A 1Q8KA 1NB2A 1UMJA 1V5IB 1KVKA 4RW9A 3OJSA 5KG2A 1XC9A 3GMGA 4F67A 1U1PA 1JIHA 2PDAA 1XR5A 2H4YB 1IKWB 4L6V3 3VAGA 4LF1A 2K1RB 3BBBA 1FJCA 4ELUA 4EBEA 2OPRB 3PKYA 2QFIA 3L7OA 4CIOA 3GJTB 4Q2LA 2YWEA 2GVZB 4ECWA 1LNQA 3CCUS 3NP5A 1HNWJ 1D3WA 3KLGB 1X0PA 4JI6J 1TKXA 4H4OA 3CGIA 2E9RX 2OEMA 1UTAA 2H4WB 3CJRA 4DV3F 5U47A 3KG1A 1RA6A 2M7SA 4OL8A 1QAXA 4U9RA 2XY6A 2ZNZA 4DLGA 2ZDPA 2VQEF 3GB0A 2FB0A 3DLBA 4K59A 4EU0A 3NEKA 1DTQB 4HTJA 2HG4A 4NE9C 4DV2F 1JJ4A 2OAUA 2Z56B 2EFPA 5F8IA 3D6FB 4HDGA 1NK5A 5HVHA 2BQUA 3M6WA 5HLFB 3UO0A 2XZTB 3QLHA 3MTKA 1GXTA 3CNQP 2XLIA 3MM9B 4OHXA 5LSOA 4LIRA 3CJTA 2YWWA 5MLCV 1YJNS 3D0HE 5LT5A 1IBCB 3MI7X 1S0NA 5JMNA 4KSEB 4ZN1A 4KFBB 1PG5B 3GU0A 4WFAQ 3NMAA 4PXBA 4RZRA 4ZP8A 4O0IA 4ECRA 2IHR1 2X3GA 2FTRA 2WONB 3W65A 2BW2A 3P3DA 1FJGF 2XYHB 3C19A 4I6YA 4KIAA 3W2VA 4OJGA 5BR8F 3FBBA 3DHXA 2OPPA 4NA3A 3FBCA 2OTLS 4X4RA 3Q0AA 4DLEA 4ZCLA 2P9GA 3HHEA 2C1EB 5A2QU 4K4WA 4I2PA 3G6ES 1RHQB 4DSFA 1RTDB 5IV4A 4YY3J 3UN5A 5D3GA 1P27B 5DLGA 4DR1J 3VV2B 1RWOB 1YJUA 3C14B 1U6BA 1BWVA 5LSLA 2NXJA 1JJCB 4P71A 4YQWA 5HO4A 4ECVA 1H3DA 4H54A 2IJFA 4JV5J 1Y5NB 3GP9A 2XEXA 1S1TB 1NB7A 1MLAA 2OHDA 5T7LB 2UU9J 1FDBA 3CB4A 2D3ZA 4R0JA 1AZSB 3DDNA 1SPBP 3O6QA 5FIIA 4OYBA 1GNKA 1GH8A 4NZ6A 1IR1A 1RYSA 3NAIA 5AJ3F 3BPDA 3HD1A 2G0CA 3TNVA 3AH6A 4DV4J 3R9LA 2V50A 3R7BB 2ZD1A 3BF4A 2C22A 5A8KB 4MK8A 2IY5B 4ELVA 1WHVA 4FDFA 3IXQA 3PW5A 4NMXA 3BGLA 4I6AA 1NU4A 2FZKB 4C8MA 1ZZNA 2EPIA 3N79A 1XNQJ 4NLYA 2DPJA 5AT1B 2HSEB 1U24A 3D1HA 4PXEA 2BVZA 5F8HA 2CQ2A 1X4EA 2F7VA 2PFDA 3NCPA 1SCJB 2MZJA 1VIOA 2QFJA 1N33J 3R5BA 4ECZA 1A6LA 4KPYA 2UXCJ 3OLBA 3LAKA 5K8PA 1SIWB 3HHLD 1RAIB 1VQ5S 3WHIA 4PAAA 2QA2A 2B3TB 3H2VE 3M2RB 5HQLA 4D3GA 1VHFA 3MUTP 1SC1B 4YDDB 2YNGB 3KDOA 1RAJA 3ZNJ1 1IR2A 3AXMA 4LREA 4TU9A 2XMTA 2I8EA 3DLGA 2D7SA 2HGMA 2HBZB 5F8NA 1YITS 3TZXA 2CPYA 4UOCA 2KJWA 3ZTSA 5KG5A 2YWKA 2W4PA 1N8RT 2JVOA 1OPIA 2AZ1A 2GHWA 3BR9A 1NH8A 4ES2A 1S1VA 2IVFB 5I3UA 1NAQA 1OSCA 4ZKAA 4XDCA 4NASA 2BJ1A 3Q24A 1S1WA 5IZHA 3K59A 5E3CA 2ZH6A 2UVVA 1GQEA 1CS4B 2BX6A 2WAQD 5DZ6A 1ZA2B 3X3UA 2MTLA 1RXOB 3H2LA 1XMBA 3M6XA 3DRXA 1I6JA 3KJVB 1I51B 2DNKA 2UUAJ 2KXFA 2CPZA 1HARA 4R8UB 4DCPB 2HAFA 1BQNB 2JH3A 3J7YU 5GAGU 1ZAVA 3TUZC 5CYMB 4A8YA 1XN9A 3OVBA 4GKJF 4LR7A 2IVYA 4RW4A 2IA6A 1R0AA 4JI4J 1N52B 4CLLA 2EC0A 1KOOA 3SCLE 2XSJB 5D0HA 4J9VA 5A8WB 3K5OA 2RUSA 4B17A 4P74A 2CDQA 1Q16B 1JQGA 3CUNA 3BYPA 3D1QA 2XSFA 2UV8G 2G0JA 4OZ0A 2KO1A 4AL5A 1VISA 1EIYB 2H65B 1WELA 2E7VA 2AJFE 1FXDA 2F5GA 3NGUA 2D9OA 2MKYA 3MOJB 2PFFB 3SSQA 3FKBA 4DSJA 1EETA 2ZNYA 3OFEA 3ZZOA 1ZAXA 5DO2A 2YNHB 4JI7J 4M95A 3LUYA 3A12A 4C3KA 4N41A 2ZH9A 3FK4A 1QE1B 4MFBB 2BMBA 2C3YA 1RT5B 2HFZA 1UVLA 1HNXJ 3B54A 1NSPA 4NCGA 3VGVA 4F7VA 1BE4A 2CDRB 1IBLJ 3GTYX 2QLXA 4QYZK 2HYIB 3QT8A 1S49A 4ZHRB 5IC6B 1KLMA 5J2QB 2OSRA 2MQ8A 3DKDA 3IA0A 3IWLA 7AT1B 4M5JA 1H7XA 1U1QA 3AOBA 4CO5A 2HIYA 3UD4P 2UUCJ 2IRYA 3GLJA 4DEZA 2OH2A 4MK7A 3LGHA 3GWCA 3DRPB 2VQFJ 1T9VA 3HKZD 1Q8LA 1L3SA 3FZBA 2KL8A 4HT5A 2V69A 2YKMB 2OFHX 5CYQA 4KPCA 4NWBA 2Q1LA 2N4CA 2DO4A 1N32F 2CQHA 1RTZA 4OHVA 4LSLB 1DJ0A 2DEJA 1J5EF 2V68A 1UEVA 2Q66A 2LMIA 1C4AA 3KJNB 4X62F 2M5YA 3FNNA 4PKDB 2LXIA 2NYIA 1FXRA 1D9AA 5JUMA 1VFJA 4L74A 4EFAC 3ZZPA 4Y0FA 3GIKA 4RNNA 3ITHA 3WC0A 2RRAA 4RW7B 3DNCA 1VBYA 5B09A 2XMWA 3D5MA 2X1AA 4JI3J 3JSMB 1G3OA 2IBOA 4EUVA 2HQCA 1HQEB 1HHTP 2I0XA 3H5UA 3CCQS 3MMBB 4LF4F 4I7FA 4DX8H 4ILMA 2BKPA 2OPQB 2DNZA 2YPZA 2B9YA 3OTOJ 2QLJB 1W2IA 2RDIA 1BQMA 4DPTA 4UF4A 4F0HA 1HI8A 4Q2MA 2MQQA 2V4QA 1U8WA 2V34A 5D4NA 4N8NA 1SH0A 3PJXA 3C6UA 4DR2J 3J81U 2B7CB 2LQ5A 1U26A 2YWGA 1U8SA 4LR8A 4DL0C 4Y65A 3DOKA 1RHUB 5M2UA 2JDJA 1OYDA 4OI6A 2CQBA 3M2VB 3RW7A 2J8SA 4O3SA 3CEDA 3I5AA 3D3CJ 2XCAA 4CO0A 2DNNA 1FJEB 2DNRA 2VBXA 4HEA9 3WIUA 1HW8A 2Q6BA 1X4GA 1NJWA 4FS2A 5KFJA 4ERDA 1PJ7A 3WC2A 2BM1A 2K3IA 5DJBA 2CPIA 4JI2J 3JSRA 3OR2B 2FJAB 3H59A 3T3FA 1FDDA 1HBNA 3C46A 2LQBA 3RZAA 3UN2A 1UKUA 4KKOA 3KK2B 2BKOA 2W7PA 3Q22A 5K20B 4OYMA 1N5TA 3GIRA 1TMMA 3OT9A 4RW9B 5HVFA 1HWIA 3JTNA 1DZ5A 1CPZA 2IAJB 3NOGA 3DLEB 2YQ3A 4ZA1A 3CD7A 4D3HA 4NLSA 1F5CA 5H9FJ 3VQSA 1WC1A 5DQGA 5LJ5Y 3MR7A 1F2GA 5K8MA 2OPSB 1LWEA 1WC0A 3S7RA 4OYXA 3LQVA 3OXGA 4KAIA 2M88A 2F1FA 3OV7A 4O44B 4JI5F 5HQ8A 2DH9A 4C8LA 3O3LA 2BOPA 3G6XA 4DV5J 4P72A 4WWSA 3G8QA 2HHWA 3UFCX 4NXNF 1UPPA 2HW3A 2IMOA 2K3KA 1TFWA 2B7BB 4BWMA 1N5YA 4M8LA 1UJ5A 1VQ7S 4WF9Q 1REVB 4UY85 2JRSA 2PIIA 3TZWA 3V4MA 7FDRA 5HMXA 4TQRA 5CXTA 2ZH1A 3OD2A 1RWPB 2MGZA 2CNNB 5CCMA 4QR2A 2FPHX 1HWUA 2HMIA 5I3PA 1JNZB 4DUTA 3GQCA 5A8RB 2CUYA 5JVHQ 1WOOA 4Q7AA 3AD9C 2X1FA 1NDCA 1IUJA 4U96A 4F36A 3IWNC 5C42A 2JC1A 4NCAA 4NXMF 4F50A 4Y2CA 4MKVA 2XYGB 3HM9A 2B4UA 1QSYA 1WC6A 3IWXA 4HTIA 4DR5J 3EICA 1UW9A 2BRLA 2NXUA 4OI4A 3IMQJ 4B3TJ 2XS7A 1B7YB 3M1VB 4CCHA 1JLEB 5E3PA 5KFFA 2EK6A 1MROB 3KNGA 1FHTA 2IM1A 4OZ5A 2KKHA 2WRMA 2MSTA 5F8JA 4URQU 2BZ2A 1VRUB 4NLDA 2WVFA 3DGVA 3PKMA 3LOUA 4WZQA 2YX7A 5K9FA 3SFGA 2PC6A 5D3GB 1DQ8A 4CO4A 5HATA 3M8WA 2DRBA 3GPAA 4OX8A 4QWAA 3GV8B 1NO8A 1SKSA 4H4MB 4LT6A 1HBMA 1HMVA 5J1EA 2DO0A 5D0GA 3K8WA 4IKAA 1EKSA 2PEBA 2VV5A 3OL8A 3OFGA 2HNYB 1IBKF 4CYUB 4M5HA 1M5OC 5GAEU 2F9JA 4ED0A 4B9MA 3MECB 3FFIB 3H42A 2H54B 4B3SF 5HANA 5L9NA 3MEEA 3AB2B 2EEYA 2E5IA 2ZD1B 2MHEA 2A3JA 3RW6A 2KT2A 1SL2A 2VF3A 3L9ZA 1WNEA 4I2QA 4F25A 3MCNA 1WG1A 3OL7A 1UJ4A 1HWJA 3BV8A 4IR1A 1IR0A 1R8CA 2DIUA 4C9DA 2BJ7A 3KOAA 4USTA 4C48A 2VBWA 3MPDA 3CJ8A 1AFIA 1Z1ZA 1MWZA 3PYGA 1T11A 1B64A 5B08A 2HURA 1K1SA 3PY8A 3BZQA 3GILA 1L3TA 4CTAA 4ZVSB 2MJNA 3MMCA 2JC0A 5C25B 1XMOJ 3EJMA 1FE0A 3FRYA 3VZIA 4HI1A 4X65F 4EZ9A 2X1GA 4LFAJ 3DLGB 1WSRA 1HHSA 2MQMA 4DX5A 3HSJA 2H48B 2AKWB 3S1TA 5DDPC 3WX8A 3I0RB 2B6AA 3M8QA 1VR6A 1FRMA 4M5IA 2MQOA 1CBKA 1B0PA 1LWCB 4DV0F 3PYFA 3I55S 3MD3A 4W92B 2GO9A 3CCWA 1Y3JA 4KGMA 4GC6A 3PIPQ 1RHJB 3FCHA 3HVWA 3NRBA 3HVTA 3NNHA 1X7VA 3Q8SB 1R8AA 1NZ8A 5J1PA 4IUFA 2DITA 2A2CA 3IP0A 4DFJA 2ZBRA 1RQ0A 4EI2A 3D9BA 2XGPA 3KLHA 4C8OA 3AD8C 5RUBA 2AP6A 4DQQA 2EFQA 5KT5A 4B3OB 3N4WA 1DLOA 3D6HB 2JVRA 4YHHJ 2XO7A 4WXOA 4N7TA 5KFPA 1WI8A 2QC3A 2VBYA 2AQ4A 1VQKS 2AX0A 4UOGA 2XMUA 4CNYA 1RABB 2GHPA 2QA4G 2VPZB 1JK9B 5HAOA 4BDPA 1ZTWA 2J7KA 3TEGA 3W5ZA 2FY8A 2AF6A 1R0AB 3QWUA 3IAS9 1HQUA 2YWFA 3FJ2A 3RBXA 3HJVA 3KK1A 4J9LA 2E5LF 1R3NA 3CULA 2BA9A 4MKAA 1GMVA 4RR5A 4R0EA 3JTOA 4CO3A 3CC2S 3PJ9A 3K58A 1NKCA 1U7LA 3DOMA 1S1UA 1UW4A 5FLXY 1SB6A 1LFWA 1CQMA 5KFXA 3RAQA 1M1GA 2DNOA 2ZEJA 2W24A 3W9JA 4TQSA 1TZ0A 2OFGX 4KR0B 2Q43A 3C15B 3M8YA 3I0SA 2WBMA 3E01A 4JI1F 1E6VB 1TELA 4JP8A 1WWHA 2QSFA 2GIFA 3CD5A 3BBCA 1IVZA 4KO0A 4PYAA 4NCGB 2HZAA 1Y00A 1RWMB 2DVIA 2VFUA 2KHCA 3RJMB 4AE5A 2RS2A 2P9EA 1KLMB 1EHWA 3R5JB 2ZFHA 5BYSA 1W2BR 2CIMA 3CDWA 3FRZA 3BPSP 2XC9A 3GSIA 2I9SA 2OD6A 1C2PA 3BGFA 1C0TB 3HZGA 4FVCA 5F3TA 1S10A 3OTCA 2ZJQQ 4KE5A 2VG6A 3OSPA 3QJPA 5D15A 4YR2A 4HHUA 3CVKA 2ZM6F 3BGRA 3NXZA 1YIJS 1OWXA 2HHHJ 3CJ3A 2KI2A 5E3AA 4MT1A 4J37A 1TVRA 3V6DA 2LKZA 2ZZTA 4XAKA 5ETKA 3BQ0A 5T14A 2QO3A 4FS1A 1VBZA 2LQ9A 3D4JA 1RBLA 3KWMA 4Q0BB 3CCSS 3T1HJ 2QMXA 4IR9A 2WZ1A 5HBMB 3GYGA 4Y2AA 4URSA 1CJKB 1WDTA 3HF5A 3GR0A 2KN4A 3ZZTA 1C1CB 5MAOA 2E5GA 1PYOB 4GVBA 3G82A 2UZAA 4DV2J 5A6WA 3ZTPA 1SKRA 1W7WA 2B9WA 1KBRA 1NBEB 4WXWA 4C98A 4CLPA 2CZVC 4OZLA 3VTIA 4LFCF 2XNRA 2DHHA 1BD6A 1PC4A 4QR1A 4UQTA 2CQ3A 3BSAA 1T7PA 3IBCB 2DY1A 2IC3B 2QE5A 4RKUC 4DX7A 1SV5A 1FJ7A 2R42A 4M63A 3KTQA 1Q95G 2HEKA 1K1QA 3H5XA 1WKJA 4FPRA 4O3NA 3B82A 4PCQA 1ZZFA 2QLFB 1FJGJ 2W9BA 1MW7A 3SCJE 4ID5A 2CPHA 4RW8A 2FZGB 4PABA 4WFNQ 4DV1F 3DRYA 1R0BG 1FEEA 2O66A 4DN0A 2DGXA 1O0PA 3AAWB 3CCTA 3NWRA 4FKXA 2P2CB 1HBOB 1P8GA 4TU7A 2LXUA 2VKZG 2E5HA 4EO6A 4DV6F 1HW9A 3M32B 3LTOA 2CKWA 4AL6A 6FD1A 2GHVC 3H40A 1TUGB 2ZKTA 2HNZA 1ZM9A 3OUYB 1C4CA 4OI3A 5F0UA 3PDNA 4DR4J 4DCJB 1EQ0A 4URGA 2XS5A 4OYAA 4KKOB 1EX8A 4IDKB 1PAEX 4ZP6A 3PRBA 2NCKL 2CWKA 1KQKA 2Z4PA 3T41A 1S99A 4CLSA 1TL7B 5HSPA 1YWXA 4K4ZA 3NBPA 1RE1B 2PEHA 3SV4A 2G9OA 2KM8C 5B0FA 3HVAA 2W9AA 2JLFA 4ZPWR 2FY1A 5CD4A 4FYXB 5AJ3J 3SDEB 3ELHA 2DHSA 4PG4A 2Y8YA 2CPJA 2KM8B 1D1UA 1FNOA 4P10A 3DU6A 2X51A 4B3MF 4KC5A 4QWCA 3ISZA 3JSBA 1ROFA 3CJKA 2IFXA 3WZ0A 1HFEL 3H20A 2XZWA 1V3ZA 2KDOA 3TAMA 4DU8A 1N5YB 3ZZYA 1FFGB 2JL9A 2I2YA 3ET6A 3FUYA 4FYDA 1WC4A 2OEKA 2YTCA 5KFDA 3MZIA 4OHWA 1A9NB 3E51A 4TXSA 5LL6d 2V8PA 3M05A 3OJUA 5KG6A 5AXLA 3DI6A 1QVGR 3MM5A 2VPXB 4USJC 4FF4A 3MGJA 2J6UA 2OSQA 2EI5A 4LRFA 5LMUJ 2HS4A 3QMQA 4LF7F 2DGTA 1Q4RA 1PAUB 4X66J 4CLWA 2BJ8A 3G71S 1OJ4A 2QEXS 3F44A 2FJDB 3IAM9 2Q6CA 2VFRA 4F4ZA 2UV8A 3HHDA 4P2SA 2WVDA 1N6QB 3DM2B 3GJQB 4TY8B 2B8PA 1ZAWA 1VBXA 4TU8A 3ILJA 4DUYF 1F6TA 4PPDA 2YKOA 3NNAA 2HHQA 3VAFA 3L3CA 4G65A 5C7PA 3EGVA 2MLXA 1S76D 1NSKL 3FC9A 1OYEA 3F73A 2N3OA 2V0NA 1K44A 2CPDA 2W9CA 3U7JA 2BE7D 2Z8QA 4K7QA 2F8HA 5BYQA 1M0SA 5J1EB 1LW2B 1X5OA 3HZEA 4RNOA 4LF9F 4F3OA 1ZM3A 1NM2A 4Y28C 1HNVA 4OV1A 1C0UB 2UXBJ 3GFYA 2R8IA 1BHNA 2AGPA 1X4HA 2VDIA 4LSNB 1U1RA 1HNIA 3BKFA 3DRRB 4Y2MA 2CPXA 1CEZA 4EBDA 2J9EA 2FVRA 1ZBTA 1UVIA 3W63A 2OTJS 2A10A 4F04B 4PQUB 1HI0P 5F9LA 2KT5A 2ROEA 4RJVA 3HXMA 4WK3A 3FSIA 2WW8A 1RBAA 2BQRA 1JKHA 2GFFA 2RU9A 2M8HA 4RU2A 3QPIA 1NJZA 1M5SA 3RRGA 4Q43A 2CNKB 1TKTA 2DXDA 5AE2A 4XO0A 2WHOA 3OHAA 1SJQA 4EWTA 4QYZJ 3MFHA 4GO5X 2BM0A 3QT5A 1RT6B 3MMCB 1JLQA 1U25A 2P5VA 4MYTA 3VZHA 5F8GA 1YBTA 3BYRA 3FBFA 2ZZNA 3C16A 2YKNA 1HNZJ 2R7SA 2BJ9A 1SQFA 4ANDA 2A0FB 1YRXA 2KYXA 3H2UB 4RUCA 1R6VA 2R2TA 2W7OA 3BQ2A 2HQIA 4QU6A 4JI8J 3MAAA 3U1MA 1U2CA 4A8QA 3M2UB 1P9QC 2MZ1A 5H1SV 2B43A 3LPEA 4OJ3A 4QW9A 1N32J 1RHKB 4GKKF 1F1BB 3QATA 2GX8A 1J5EJ 2DBBA 4ITSA 5JVGQ 4J9KA 1RACB 4DQRA 2HBYB 3C8YA 2XYPB 1YHQS 3J80U 1YX2A 4X62J 4IO9Q 2V8DA 2RSQA 4C0BA 2N3LA 5LMNF 4KY3A 3UCUP 1XMQF 2DNPA 4FYVB 2UP1A 2RS8A 4IRKA 4LIWA 2C2RA 1AYEA 3QT7A 4ZVFA 1S1XA 4OYIA 2E44A 4ZPTR 3FCVA 1U1OA 3NOCA 3ETOA 4QIGA 4DR3J 1D8ZA 4BC7A 4ED4A 2VG7A 1VJQA 1Q79A 3KYLA 4I4BA 4I0WA 3T1YF 4X4NA 2RMLA 2MSSA 3KK1B 2W8KA 5LXRA 2R2UA 1QM9A 5D78A 2ZJPQ 2UXDF 4FXVA 1XERA 1S6QA 2ROPA 2EG2A 2KB2A 1UEUA 1KHVA 4OLPA 3HHNB 2JLEA 4OX6A 4NYOA 4ETZA 4Q5VA 4DR7F 3A8EA 3OVSA 4MIAA 2ATCB 5CZVA 3ENAA 2XHWA 3F56A 3AJDA 4AQYF 1UZDA 4JV0A 2YXLA 3UI3A 5KG4A 4EYHB 3HK2A 1TAQA 1O6XA 3OXLA 3ZO7A 2ZBQA 3R97A 3E01B 3MM8B 3QZ8A 4TNOA 3O1LA 4PPZA 1NKBA 1VQSA 1K73T 3BN4A 4FYWB 2XI2A 5HI7A 3U27A 1Q82T 3CCVS 1GK8A 1T3NA 3I9ZA 2AX1A 5GAHI 1DBDA 1B4SA 3BB5A 3JAMY 4F4KA 1R43A 3OW2R 3LP1A 1F0XA 3OBIA 1OS5A 1VCTA 4NL5A 4QIFA 3EVMA 3ENWA 2HVIA 1H2UX 2MZTA 1TTHB 4J9NA 2J0SD 2FZCB 5L9XA 1KKHA 5D8HB 4OX9J 2HVDA 3ILIA 4NEZA 2MQPA 4NZ7A 3KLIB 5HROA 2CZ9A 3RBEA 1VDHA 1NK7A 3KHLA 4MKYA 1QDUB 1EQMA 4DFPA 1TP7A 3UDEA 3L95X 2IPOB 2EBEA 3BS9A 1YGYA 3Q8PB 2HNDA 1RT2A 4FF2A 2GVDB 1XTZA 1VQOS 1YJ7A 2FHOB 5DM7Q 1F9HA 3MAQA 1U1MA 4QBUA 2QIFA 3OVAA 4QW8A 1UWAA 2HHTA 3VCDA 4KHPF 2HIQA 3BSNA 4ANEA 1B70B 3GYNA 3V6DB 4P73A 3V81A 1HR0F 4ZMMA 4NLUA 5BXIA 1CULA 1NJXA 1L5UA 2HHSA 4JI5J 2QA4S 2GIRA 1KTVA 3T6BA 1QUPA 2CJQA 2FIUA 3PR5B 3KMSA 2J0WA 2QN6B 2V2QA 3MM6A 3RB4A 2FVPA 2GIQA 4NXNJ 4OJ1A 1JJHA 2VFSA 4F2RA 2M4MA 3AJ2A 3QGIA 2E9ZA 4NI2B 3CCZA 2IJRA 5IT4A 3G82B 3G8SA 4ZS6A 4IG3A 3KNAA 3EE3A 3FEZA 1YRUA 2F3JA 4C0HA 2WVCA 2KTQA 3NY0A 1S6UA 2MHNA 1NSAA 3BO3A 1SV5B 2QGFB 5J1NA 1I1GA 1CLFA 1AB8A 3CIZA 2OO4A 1NNDA 1Z4UA 4EZ6A 4FBTA 4Y2KA 2GNKA 1MSWD 4B9UA 5A0YA 2L3MA 5DG9A 5LM7E 3TZYA 4B9VA 2KT3A 4DSIA 4IH5A 3SBMA 1F9EB 1Z2LA 2J9CA 1U0SA 1KQSR 2XWYA 1WKKA 1RAFB 2V67A 1SC6A 4BBYA 3FZ2A 2FLPA 1Q53A 4K5SA 4NLVA 3LO3A 5I42B 4C8KA 1PKUA 2DNMA 2DH8A 1U02A 1FK9B 4TYBA 2QMUB 3RB0A 1YJ9S 5IC4B 3DRSA 1XNRJ 2B5JA 4IG0B 2YBVA 2FJBB 1RT1A 5T41A 1AROP 1FKAF 1R89A 3V4IA 5KG3A 1C1BA 2HNZB 3DLKA 4OJHA 1HNWF 1X5PA 4JI6F 2MZSA 3ENVA 2YNFB 1LK5A 5CYJA 5DG8A 4YOEA 2JEGA 5C24B 2R8KA 4JYAJ 2VG5A 1L3VA 1VQPS 4TLQA 4LQ3A 3TANA 1W26A 3NBPB 2KZZA 1FRLA 1EAYC 3HSDA 2MQNA 4M5DB 2VUGA 3KHRA 2WBRA 4ZLLA 3N5FA 1TV6A 4MYUA 3CCRS 4ZJQA 3NCRA 3HT0A 1FRIA 3V2UC 3FMBA 5D4OA 4O3OA 3K5NA 3MEGA 1URNA 3N5BA 2BDPA 1HIYA 3OFFA 3GIJA 3WIVA 5DGAA 4TYAA 2WOMA 3JQKA 3TAMB 4RO0A 2R7RA 1N34F 2B9EA 1R8PA 2BE9B 5KT2A 4IQXA 1H38A 2IJNA 2JX2A 1KWMA 2V63A 5L1KA 5B0AA 4F2SA 4U7UD 1RWKB 3IS9A 1VIXA 3CJQA 2OLWA 2AYMA 1ZETA 2JHEA 3SIPB 4F3MA 1OQ6A 5DM6Q 4FKYA 3AODA 4UUXA 3TVZA 2JEJA 2X3DA 2ZOMA 3NGRA 1TMJA 1R8HA 2HZVA 1UWBA 4YY3F 2AJ1A 1VC0A 4HDHA 1SI9A 2LQ8A 3CDUA 4DR1F 1MMDA 3QRPA 4F26A 4C11B 2QJ3A 3HCXA 3FDSA 2BACA 1JX4A 1OMSA 1WACA 2O5DA 4V19J 3M8PA 2I5JB 4L75A 2VASA 4A8WA 2VD3A 2ZBPA 2XLJA 3DYAB 1NJIT 2W01A 2UU9F 2R8GA 4NCBA 2HFUA 5AXNA 1IM6A 3KLVA 2CJXB 3AA8A 1QAJA 4ECTA 2XTJP 4ECQA 1RT7B 3W9IA 4KGZB 3CCJS 2KH9A 5A76A 1IKVB 4PWUA 2C2DA 5IT9U 4DV4F 4A8KA 5KFYA 1M1HA 4KYZA 2CVIA 3TRGA 2CQ0A 4P7TA 3WBZA 4R5PA 3IN5A 3QAEA 3TP2A 2C2OB 3NMRA 2V4JB 4HVZA 4PYDA 4CT8A 3TUPA 2ZZMA 1XNQF 4DG1A 1CC8A 3KXDA 1CJTB 5ETVA 1J5OA 2RKIA 4ED7A 3R5AA 1R31A 1LXNA 4WKYA 1QLNA 4IFYA 4F02A 5ETNA 2E5LJ 1N33F 2RB7A 4MIWA 3LANA 2D74B 4DSLA 2UXCF 3TA2A 1SQEA 1RI7A 4IRDA 1B99A 1DQAA 4W98A 2QL7B 4J9MA 4Y34A 2UUTA 1JLCA 4GO7X 2IBKA 3QSIA 4WYLA 3L7UA 3EXCX 3UDCA 1XBWA 3PO4A 1P9YA 1WOSA 2K7KA 3UD3P 3BJYA 1T8EA 1JKHB 1IN0A 3I4PA 2R2SA 1U6ZA 3TQ1A 4F3QA 1DTTB 1H2VZ 2WVEA 5FDLA 5G0RA 1QTNB 2PI5A 2DT9A 1EP4B 1HPZA 2EFOA 4CLZA 1X9WA 2DD8S 4NLXA 3KG0A 2JJ4D 1TKZA 4YB7A 1RU1A 5KFIA 3OSNA 5HN0A 2OELA 3PVXA 3POTA 2HRUA 3EDQB 5THWA 3HSZA 1K9MT 5A6PA 2ZE2B 3TJ8A 3TQEA 2K8GA 2YKNB 1Q1KA 2YH1A 4ZITA 3IBFB 4TY9A 3MMJA 2AJ0A 4QWEA 1KOHA 3SSSA 5LXYA 1ITPA 4JI0F 4EGLA 1WD6A 3ISND 3EM1A 1VQNS 4CI0B 4RUAA 1XWLA 5B0DA 1H2TZ 5KFBA 1FTRA 3JYTB 2MZRA 4ZOSA 4DL2A 2ZM6J 1RK8A 1NK8A 7FD1A 1B0TA 2CADA 2RF2B 5KFSA 1V9OA 2NSCA 2GC8A 1NUEA 2IMWP 2ZC3A 4U7UK 1FKPA 3T9NA 3HFKA 1F9FA 3RGIA 5E3QA 2GZOA 3T5HA 1FDNA 4JI4F 4WU3A 3M30A 4H4KA 1IKXA 5E41A 3D54A 1WHYA 5D0EA 3DDKA 3W8PA 2V9KA 2M2BA 2CPFA 2VONA 3PXGa 3OXFA 3P45B 1B3TA 2LP4A 4LBIA 2GAGC 3LP2A 1RTHB 3BGUA 4B9SA 1S1XB 1S6PA 2CQCA 4LVNP 3J7YI 2RVJA 1BLUA 4ZLNA 4IOBA 3D1OA 3H98A 4J9RA 3D6MB 4M94A 1T0TV 4PUOA 2E1PA 3S8SA 1NPPA 3W1YC 1N56A 2BBEA 3C3LA 1NJYA 4G3IA 1S9EB 4WYWA 3DGPA 3CW2C 4KRWA 1R8BA 1VS3A 4MMOA 3NCQA 3NS7B 4FZVA 2C2MB 1FWLA 3ZTOA 3GIIA 1KVIA 3F0NA 2FGCA 4AXIA 2B9XA 5K5MA 3R27A 4PG6A 2OD4A 1IKYA 2IRXA 1G7CB 2Z58B 4ZCMA 2MEWA 4LRBA 3G4SS 4FXDA 1XIQA 4UW2A 5HL7Q 3C2PA 1WHXA 2B8QA 2VBZA 2ZH2A 1U48A 2UUCF 5L38A 3T5JA 4ES1A 2VQFF 3M7VA 1MMNA 1F3VA 1NDLA 2C28A 4YMEA 2ZH8A 3Q8YA 1JLFA 2W4CA 2LDYA 3QIPA 3FMWA 5KFLA 2C3PA 4B3RF 3R7SB 2OPRA 1QAIA 3TOQA 2GW8A 3T1AA 1PJ6A 2ABYA 2GVZA 3HI9A 3D6TB 1RAOA 2WCXA 2LLZA 1KFSA 3KLGA 4W90B 2H5EA 1CJUA 1S4FA 3MXHP 1K8AT 1NHUA 3P8BB 4DQPA 5DLFA 3IR5B 1XJWB 3HHLC 2XG8A 4XPCA 1HHQA 4IFVB 4DV7F 4HHJA 5B0EA 1WTBA 4DSKA 4WP3A 4P52A 2HNDB 3PHEA 2VPYB 1DTQA 4HKQA 3R2CJ 3RRKA 1TK8A 3HHLB 2XQCA 3CMES 2B51A 1RB0A 2ZOFA 4GRSA 5HLFA 2OGUA 4CT9A 5IT0A 1KRPA 4LBPA 1AUDA 2VODA 3MM9A 3SQGA 5C2GA 2BR0A 4NLWA 2B4VA 3BH7B 3OTOF 1YLXA 2Y0SD 2DJWA 4U95A 2G4BA 1A0OB 4K4XA 5CA5A 4DSEA 4KH1B 4KFBA 3W3SA 1Q7LB 1UJ6A 2Y1LB 3AOCA 5ETQA 5DETA 3GFHA 3R6GB 3CJ4A 2R9LA 4DR2F 3EDRB 3O44A 3PFEA 2WONA 1A7GE 4I1TA 3M8RA 2Z2ZA 1JXEA 1PCAA 3WDOA 2HRTA 2AZ3A 1HYSB 2W7AA 1JXLA 4K0KF 2XGQA 4LMZA 4FNHA 4DUZF 3W62A 4AUKA 1ZM2A 4IH7A 1ZTTA 2LQJA 4HACA 1GTHA 4X4UA 4ED6A 5SZTA 3TEHB 3D2WA 4WJBA 4N76A 1UAWA 5KFVA 3J7A1 5A0YB 1WUUA 2ZOGA 2LU1A 1SQGA 1HBUB 3QO9B 2N82B 2POKA 3W8GA 1TK5A 2E1RA 3C14A 4NLGA 4FYYB 2DGOA 1U47A 4N47A 4U6PA 1NKEA 3DHWC 4NLPA 3RG6A 4ATNA 5IWAJ 2AU0A 3JS9A 1S1TA 3MWBA 1S48A 4HI2A 5T7LA 4DUYJ 1AZSA 2ERRA 1NDPA 2RAQA 1ICEB 2CVEA 5DDOC 4X4SA 1D0EA 4QIWD 4A8MP 5CABA 3NKYA 3QWPA 3THVA 3V4IB 1WOPA 1C1BB 4B9TA 4PG7A 4XTTA 3IG1B 5H9FK 3PM9A 4RW6B 3SSRA 3MM7B 1TL3A 3ILOA 2EFVA 1WF0A 3TI0A 2HQDA 2C2EA 2CNOB 2RIJA 1F3FA 3R8YA 1RCXB 4ED5A 2DNGA 2IA0A 1NMEB 1RT3B 4USMA 3CCES 4DZDA 5EDWA 3V5RA 1L3KA 2Z57B 2PMZD 3G86A 1I94F 3D7SB 1TV6B 2L48A 1H74A 4MJKA 4NOHA 1X4CA 1G1XA 2EC2A 3BH6B 1RHRB 2W2OP 4DR6F 4FXWA 1M90T 1WF2A 5F8MA 1F5BA 3MFIA 4CP5A 3M2RA 5F0WA 3QNWB 3PX4A 4ZLPA 2YNGA 1NEEA 3S6EA 5DRKA 2XMVA 4ZK7M 2HHVA 2Z2YB 1TL4A 2LEAA 1HKAA 4N56A 1IJFB 3VAIA 2WOMB 1H0HB 3SCIE 1J27A 1ULRA 4UZBA 4B08A 5EUHA 4O4GB 3W2WB 4ZCIA 3M8ZA 1G4CA 5HP1A 4PWDB 3O2IA 4DR5F 5BJRA 2LFVA 2HGNA 1AT1B 3M8SA 1RDRA 2C3MA 1RAAB 3VR1A 3KLFB 3VAHA 3IS9B 3QJLA 2KZMA 3MD1A 2V5HG 3KK3B 2F9DA 3BKUA 2WSFC 1RLDA 3CC4S 2YVSA 3Q23A 2RJZA 1CS4A 1KDNA 3N01A 1S5ZA 3HX9A 1KEKA 1RGVA 4EEYA 2YKQA 2GQCA 4ZP9A 3KJVA 4DL3A 3CMQA 1M1KT 1UWBB 3EYZA 3GJRB 3NG8A 4YEAA 4R8UA 1PGZA 3UVJB 2UUBJ 9RUBA 4C7QA 5GMDA 1BQNA 4G1QA 1T9TA 5DGBA 1RADB 5GADI 2GMJA 3M8PB 2Z30B 2UVWA 3RU0A 4BLGA 5A2QY 1SIZA 3HP6A 3QGHA 3DXSX 2VJVA 2VOOA 1E6YB 1D8YA 1FI4A 5A8WA 2GS8A 2ZVIA 4A46A 2F65A 3T5KA 2Y0BB 2CJAA 2Z0GA 1NK9A 5LMNJ 3C66A 1UFKA 1AA1B 4NLQA 2RRNA 4RNMA 2ZC4A 3PRVA 2R7OA 1TAUA 2YWHA 4QIEA 2KHDA 3L09A 2Q3PA 1F2HA 4OI2A 5IV3A 4P9SA 3Q8QB 2WSCC 4JUZA 3A1YG 4G1IA 5SUHA 1S59A 4YR3A 3LP0B 3K7RA 1JMTA 2YNHA 1J5OB 2R8HA 1JWWA 1M5HA 3AJ1A 2QX0A 1PBAA 4IFYB 4E98A 1YG0A 2OMOA 2X7IA 1FNXH 2Y1IA 3EX7B 4MFBA 2FJEB 5GAEI 1VRTB 5GAHU 1KVJA 2VA2A 2UXDJ 2CWXA 4I56A 1LW0B 1H98A 3LAMA 5BYRA 1S9GA 2MMYA 1WC3A 1JLCB 2I1RA 1FX4A 1MWYA 3AB4B 4M5KA 3H5YA 4IH6A 4ZHRA 4FN5A 2L9WA 3M9MB 5J2QA 2MB0B 2N7YA 1DY3A 5DDRC 2FLOA 4X4TA 4QJVA 5CQGA 3A8KA 3UR3C 2LECA 4ELTA 2M9KA 2FD2A 3BSCA 2XMAA 2Y3YA 3DRPA 4C8YA 2N7CA 3GFXA 1HPZB 5KT6A 3ADAC 1H7WA 1TKXB 4H4OB 2RH3A 2YKMA 1TKZB 5E5NA 4PQAA 3NGDA 2J0QD 2O01C 5H9EK 2LCWA 2DHXA 5EHHA 4Z2XA 2GJFA 4LSLA 1JLGA 1X4AA 5L1JA 5EWGA 3MMAA 2J7WA 2RUGA 3FSYA 1FKOA 1SXLA 5J2NA 2AGQA 2LEPA 4N8OA 4X64F 2AEMA 4CO2A 4QYRA 3LF0A 1SKUB 2ZBIA 4CLFA 3NS6A 3ZTRA 4F4XA 3N6NA 3DLHA 3FGVA 2YKAA 1N5VA 3QLHB 3IM9A 4HL9A 2RT3A 4WE1A 3A8IA 1SL0A 4IO1A 3N0VA 3PTWA 2DPIA 5KFKA 1N36F 5GMEA 2PT0A 1UVNA 3BREA 2YPYA 2CA9A 2VA3A 1HR0J 3LGNA 1Y4ZB 3BQ1A 3M30B 5CH7B 3G2XA 4RBVA 3CMAS 3J81j 1TFYA 1W25A 1WG4A 2D3O1 3HFVA 1TKDA 3W2VB 3KMQA 2OPPB 4A4JA 3T5LA 3LP2B 4RNHA 2ZUAA 4YUDA 3PHTA 2AEJA 2BANA 3MUVP 4G1PA 4I2PB 2X1BA 3IR7B 1WEZA 4J9QA 2YNIA 3BKTA 3B6BA 3THPA 5KG0A 1VHIA 1CJVA 2UUWA 2RILA 3RB6A 3PW7A 3GCXP 2G2OA 2GA7A 1SVDA 3WX4A 4NEYA 3O8WA 1Y5IB 5D6GA 1VYAA 2AJ2A 3H5SA 2Y9HA 2E7XA 1NLKL 4AFFA 4BHQA 1DQ9A 4WK1A 1PJ5A 4OQJA 5DS7A 2WTFA 2AW0A 3L7PA 2LDIA 1VRQC 3EGWB 2D41A 4ALZA 2MKJA 4P6QA 4DBQA 5F8LA 2IAJA 2AT1B 3DLEA 2R3VA 1T02A 1JLFB 1UVJA 1U2RA 4XDDA 3QIPB 5ADZA 1SC4B 2HHHF 3QGGA 4C0OC 3J7Z5 3EUNA 2A1BA 4USWA 4J9UE 3HSGA 3CE8A 2F4VF 1X31C 1RKIA 1P1LA 2OPSA 3H25A 3TX8A 2FYXA 3R7NB 1CJUB 1UP1A 4ZJOA 4YFUA 4O44A 2FC8A 3G6VA 3W66A 1APSA 3T1HF 5L46A 1VQ8S 1EZZB 1F60B 1NH7A 4ICLA 1S97A 1RTJA 2GV1A 4DN9A 3J7ZT 4A48A 2AYBA 3CWJA 2RD5C 2AJ4A 1FA0A 5KFUA 1T9WA 3E3XA 2XI3A 1REVA 1RKJA 5IM0A 4LF8F 5I4MA 4ER8A 4Y3CA 1Q81T 2HFSA 3VAMA 1BXNA 3SQGB 5A8RA 1T3OA 2CJYB 4U67Q 4GMKA 1RBOB 1QSLA 2V8GA 5IXUA 1S1VB 3I5CA 5DG7A 5I3UB 3PW0A 2EBGA 2XZDB 1AXQA 1RTIA 3AFGA 4WCEQ 2E7WA 4BC9A 2VFVA 3QFWA 2BEFA 1OO0B 1S1WB 4UOFA 3VHQA 3A3OB 4WFZA 3TO8A 1Q8BA 1N48A 2IDLA 1N34J 4DF4A 1Q78A 4CM2A 3AQPA 4MIBA 3ZZRA 3MCSA 4FVMA 2DR5A 2I38A 3M1VA 4CO1A 4DPOA 1JLEA 1MROA 2E29A 4L3KA 1FVSA 4C8ZA 2VIHA 2DKOB 5E33A 3FCWA 1M5PC 1X60A 1U0HA 1NPRA 1CSJA 4HACB 3K0JA 4F0KA 2MLZA 1VRUA 3J81Y 2DCLA 2XBPA 4DWIA 2FHJA 2DR9A 3H7HB 2FJVA 4QIVA 2MDAA 2L9DA 2CJKA 4RW4B 3HDSA 2GJIA 5KFNA 4DR4F 5AE1A 1FWKA 3FSXA 1WHWA 1ZPWX 4H4MA 5ETTA 1RUSA 2ZBCA 3K2YA 2QLBB 2LA4A 5M2PA 1EKRA 2AYGA 2KXHA 3E2EA 1Y0HA 4M5GA 2FJXA 2HNYA 2RQ4A 2JNJA 3JXOA 4CYUA 1YJWS 4DI6A 4OZJA 1N54B 3MECA 3FFIA 2RQMA 2W4DA 2IM2A 3HMJG 3R5DA 1EETB 1PILA 1YBAA 1PYTA 2DB1A 3SXLA 3K5LA 3MCMA 3D66A 3MEDA 1UFWA 3HJFA 3H8YA 2AJQA 1LEOA 4NRTA 1TL3B 4K5RA 2KYZA 3PYEA 2EFNA 2ASDA 1AUSL 2MY8A 1YZ7A 2ZH5A 2EFGA 4FBUA 3TUJC 1UCNA 3FQLA 4ECXA 4IQMA 2D1CA 2E1MC 1U6FA 1LK7A 1TL1A 2AIRB 1KQGB 2H3EB 4X4PA 2MJUA 3CDEA 2EVZA 2C2ZB 2BXJA 2ZWPA 1NHVA 4L73A 2DY9A 5C25A 1YTYA 1U09A 1N0VC 4WKRA 1IM4A 3RAXA 3SFUA 3W61A 2DNQA 4X4QA 2BKNA 2NREA 3VGUA 4EK2A 3HT3A 5D77A 1VK8A 2ACMA 3AXKA 5CYQB 4DL4A 5LMUF 1GTEA 1T03A 2HK3A 3GSDA 3EZUA 1ZOTA 5F3ZA 3X1LB 4LF5F 2CAJA 3I0RA 3BDEA 4X66F 2C2KB 4AD6A 3SYZA 4HLBA 1GMUA 3CDAA 4Q44A 1LWCA 2W1BA 3Q86A 3HD2A 5HP1B 2QL9B 3UQSA 3QT6A 1KN6A 4NPOA 3QIDA 4DV3J 2KG0A 2DNHA 2MZQA 1Q7YT 2D69A 2BYCA 3V6HA 2VQEJ 3PCOB 3ITHB 1VI7A 1LXJA 4YDXA 1URRA 3TA0A 3VWSA 3VALA 3D0IE 4OYZA 4FF1A 3OPKA 2DRDA 2IVMA 3G8TA 2W2NP 5ETLA 4U7CA 4JI0J 4B3OA 4ILLA 4RUHA 1ZPVA 3PX0A 3VF0B 4RWXA 1JLBA 3PV8A 3CJ0A 3FBEA 4OMFG 4DJBA 4I7FB 2ZHAA 2WK4A 4G1QB 3I82A 3GV7B 2QLWA 3UWTA 1YKWA 3UNYA 5DQHA 2UVRA 1X5SA 1BQMB 4DOZA 1WEYA 2QTWA 5B0BA 4OZ3A 1WC5A 3RB3A 4I64A 4E2FB 2FUG9 3LWMA 2UXBF 2AHOB 4OYWA 5C2CA 3O5TB 3MPVA 3C6UB 3P5TL 2FHMA 4TN2A 2CQIA 1YI2S 2M3DA 4YN3B 2M8DB 3CD6S 1VQMS 3DOKB 2D3OR 4QWDA 5BR8J 4LRCA 3OHBA 4MKBA 1Y7PA 4CNZA 1YZ6A 3OLAA 2OI2A 2HKEA 2R8JA 3EXYA 2IYIA 1CVJA 2YKPA 4DF8A 2DISA 3C15A 1N0UA 3T6JA 1YDLA 1E6VA 2QV6A 4Y00A 2KFZA 4YB6A 3BN7A 1WEXA 1HBNB 3UCZP 2DR8A 5HQMA 2YH0A 5C5JA 2KJVA 1I5OB 1S9GB 3P49B 1EJ7L 2AD9A 1M5KC 4DDFA 1KD1T 2FC9A 1R0CB 2DGSA 1FO1A 4JV2A 1Z2ZA 4ZVGA 2DXFA 9ATCB 2RNEA 1HNZF 2DR7A 1Y11A 2MLYA 3CJSA 3EVOA 3DN9A 4O3QA 4ECSA 2XY5A 1Y10A 2HLUA 4USKA 2CRLA 2K2PA 3JQMA 4WIIA 1C0TA 5ETOA 2O67A 2KRBA 1WJ9A 3T19A 4JI8F 2HS0A 4JB8B 5F41A 3TWZA 4ANCA 3RR8A 1LWEB 5KFCA 4WFYA 5HMZA 4DL5A 2PO4A 3D0GE 3MR5A 4OI0A 2U2FA 4B3RJ 2YX1A 1JLGB 1O51A 2GO8A 5K8NA 3D67A 1OIAA 1VBKA 3AD7C 3PEHA 3MMAB 1FKOB 5J2NB 4CWBA 2MYFA 1V3SA 3GE9A 1RWUA 4QR0A 2HFOA 3VAJA 4Q0BA 4X84A 4LRDA 6AT1B 1X4BA 1TK0A 1RT4A 5HBMA 4Q45A 4K2JA 4DPYA 1RAEB 5DZ7A 1CJKA 3P6YC 4DV7J 1S7HA 2MGZB 5K14A 2HMIB 5CHCB 4JV1A 2HHPA 2HHUA 3UNGC 1C1CA 4WE1B 4ETXA 3RAMA 1X0FA 3P4UB 1VLOA 3NS5A 4DL7A 1LKZA 2EK1A 2KXNB 4P7VA 4DR3F 2G1HA 4ENOA 8AT1B 1T9XA 3J7AN 2E9TA 2HQFA 5C42B 4P75A 3UCGA 4K50A 4KHMA 2JSXA 3QQCD 2IC3A 1DFDA 1WI6A 2DGQA 2NYHA 4ZPVR 1GMWA 4LVOP 3HKWA 2EG1A 4A8FA 1HWLA 1SJFA 4C8NA 4PWWA 4Q8FA 5KOXA 5KFWA 4J9SA 3KG4A 3DDIA 2QYCA 3RTVA 2EKYA 4HH1A 4EYIB 2RHQB 2HZCA 2NQPA 3THTA 5E7OB 5CZXA 4DXLA 4PEOA 1KP6A 3BO4A 2BANB 3UDLA 1L3UA 2XM3A 2VB6A 4K0KJ 3GG0A 3HULA 2XY7A 3B4DA 4DUZJ 2QYGA 3TUIC 2YNIB 1HBOA 2VL1A 5ETSA 1CJVB 3V6KA 2FGOA 3RBZA 3AOAA 3OTEA 1MU2A 2EW9A 3M32A 1HMVB 1HBMB 2RQKA 5FLXU 2DEIA 4O0NA 2ILZA 1S6OA 3PO5A 4GKJJ 3W7BA 4ECUA 1VMBA 2QMWA 1X4FA 2NPIA 3OUYA 1JLAA 2R7VA 4DPUA 3I56S 1KQFB 4OX9F 1EB0A 4A8XA 3US5A 2R7QA 3EMTA 4IDKA 3ZFVA 1JJ2R 3QJJA 1S0OA 3H4DA 1PYSB 3NL0A 3C6TA 3MEEB 2FQQB 3OL6A 3PW2A 1TL7A 2Z2LA 4WTYA 2IM3A 3SI8A 4F0MA 3D3BJ 3TVYA 3IR6B 3CPWR 4L72B 3VVTA 4X2BA 1QVFR 3PR4A 3Q2TC 4I2QB 2F63A 8ATCB 2G0IA 1KTQA 3SDEA 4K4YA 1ZM4A 4KQZA 3UR0A 4M5LA 2J76E 1TQLA 5ETPA 1UVKA 2E1AA 2ZUGA 4F4AA 4LQ9A 4YP3A 4CH7A 2VPWB 1NXIA 4KH0B 4PXCA 1WG5A 2YX4A 5FJ4A 4YR0A 3CIMA 3GZ7A 4ICLB 1RTJB 1NK4A 4HHHA 4CTAB 2ALYB 4LBHA 4QQBA 2EKNA 4NLRA 1QY7A 2XLKA 2DRAA 5KFEA 4W4MA 2VJUA 1I94J 4C2MA 1U1NA 1V5VA 1VC6A 3TR5A 2M0GB 3UDVA 2ATLA 3HFZB 1HD1A 4B9LA 5IM0B 4DR6J 3CXCR 1RP5A 1N5SA 4CM0A 4HYKA 3UE2A 1YQHA 3QAUA 3MR6A 4ZVOB 1RU2A 2B6AB 3HO1A 3H4BA 3M8QB 1T9YA 5KG7A 4UUWA 3ZZUA 3JSYA 1JNRB 2DR6A 3P96A 3LW5C 1RTIB 2RDDA 2OMLA 4UY8T 2F4FA 2ZHOA 4DMZA 4IYQA 2C3OA 3HVTB 2WSEC 2W2QP 3IRXA 4ED2A 2GGPA 3Q8UA 2XMKA 2M70A 3OR1A 2HGLA 2ADBA 1IBMF 5GADU 4NA1A 1I3OB 1U49A 1MNEA 3KLHB 5KG1A 4HT7A 1T95A 2XHCA 2ZJRQ 1DLOB 1N6QA 1U4BA 2OUGA 4Z7YA 4LRAA 3DM2A 4TY8A 3H0PA 3ULHA 4Z7CA 2CG8A 4I68A 2FHJD 1TL5A 1U0HB 1IQTA 4LF6F 1FXLA 1OY8A 2AEFA 3CO9A 2GAHC 3PJWA 1UA0A 1RWXB 1XNRF 4ZPDA 1YJVA 4PG8A 1AFJA 4QZVB 2HWTA 3D68A 1TUWA 1HQUB 3ONQA 3M6VA 1FT8A 4LF4J 3DCAA 1VQYA 4ED1A 2RU3A 1VQLS 1X9MA 4JYAF 1LW2A 3W5XA 3PFOA 1JB0C 2A6MA 1LWXA 1KNZA 1X5TA 3H90A 3V6JA 2W2PP 3DOMB 4N5SA 1S1UB 1NK6A 4I67A 1C0UA 3NGTA 1KHWA 2A6OA 1WTFA 2DHAA 3NNCA 2C2NA 3R5CA 4LSNA 4OHZA 3SMZA 3GR1A 2RDJA 3VVUA 4CLUA 2XS2A 3DRRA 3SEOA 4RLEA 3I0SB 4BS2A 3MEDB 2KVQE 3ENQA 4ZIVA 4WU2A 4PQUA 3PX6A 1SKWA 5IQ6A 2IRUA 1NK0A 4KO0B 4ZP7A 2W2MP 5HVGA 2BABA 1NDKA 3MEKA 1UL3A 1G2EA 4LSZB 2FVCA 5E0OA 2H1YA 2VC0A 1OPZA 3NWGA 3MOZA 5KT7A 2Q79A 3DU5A 2PE8A 1TL1B 2JZ5A 2XCPA 1GX5A 2HFVA 4USUA 5EWFA 1VLYA 3TARA 4ZPBA 1IQZA 1RT6A 5HMYA 2DK2A 1KLNA 4L3NA 4O23A 4UQGA 2DCUB 3W5YA 5KFZA 2C3UA 2D3UA 2E5JA 2VG6B 2PI4A 3I32A 1DARA 3BGRB 3BR8A 1MWQA 2KRRA 1T03B 5L8RC 1GT8A 4YB1P 4ZPAA 4WBFA 3N28A 1TVRB 4OYPA 5H9EJ 3QBCA 2AV5A 3M2UA 2PMHA 4B02A 5IQQA 2IIHA 5HJXA 4ZVHA 3TW0A 2CXEA 1XR7A 2RE1A 3D28A 4J7CA 3I31A 2F40A 1VJWA 3CTRA 1KS2A 5KFHA 3KUGA 4C4WA 2PA8D 4X64J 1UVMA 2HWHA 4ECYA 4GVBB 3B78A 2J6TA 2MKIA 3NLCA 4OYOA 3M4XA 1EARA 2MXYA 3RBDA 4FF3A 1JLBB 3E8OA 2M52A 2J9DE 1BGXT 1FRJA 1OQ3A 4ILRA 3FEYB 1Q5YA 2CQ1A 4ED3A 2PGCA 2O1PA 1SUQA 1N36J 1RAHB 2JFKA 5JXSA 2UVUA 4ZCKA 1IXKA 1YRTA 5KT3A 1RWWB 3CCMS 4NXMJ 4LFBF 4OZ2A 2AWZA 2JFDA 5J2MA 4J91A 2W9BB 2V8VA 4O3RA 4ID5B 2R2RA 4RW8B 4J5OA 2IM0A 1ZH5A 1N88A 2GQQA 2B56A 1GXLA 4IOAQ 3TAPA 2V4RA 2VFTA 5IS2A 4M5MA 3KJFB 4TVAB 2R7TA 4NLTA 1K0TA 2ZWOA 2QG9B 4GVLA 3MM8A 1UZHA 4WFBQ 2V8HA 5EX3A 2P9CA 3NGSA 4DS5A 2GMLA 5E3RA 3R1LA 2BJEA 2ZVSA 3CJ5A 3L4BC 2GCFA 2W8LA 5KFAA 3F41A 2OKQA 1NZAA 5GMKa 3AHPA 3EZ5A 2CQDA 2CQPA 3CO0P 1FCAA 4V1Ak 1RYRA 4ZJLA 1IBKJ 2PSZA 4DFMA 2QSWA 1BC6A 3KLIA 2NLWA 4B3SJ 1FRXA 2GQ2A 4R25A 4O4RA 4O3PA 5D4LA 3KFWX 1QUVA 1K0VA 1N5QA 2GVDA 4ZVRB 2VU5A 2BE2A 1GFWB 3R6LB 1FE4A 2PA3A 4KB7A 3EPIA 3M6UA 5EWEA 3OL9A 5AXMA 3IGNA 3CJKB 3BGOP 3CD0A 2F4VJ 2BJDA 4M1KA 4UOHA 2BUNA 4LUBA 3FVYA 3UN3A 2L41A 3W60A 1NHKL 3FQKA 3ET6B 4OX7A 5LOQA 2ADCA 2FDNA 4K4TA 1O5JA 1R7IA 1RT4B 4ZVPB 1S57A 2HS3A 5K14B 2VICA 2MY7A 2ZDOA 2J6SA 1XK8A 4NI2A 3EPGA 2ZH4A 3DI6B 4FPIA 5CAAA 5J2PA 1S77D 3MM5B 4B9NA 5LJ3Y 4X65J 2LEBA 4LF8J 3J80Y 2CFXA 2YQ1A 1GMWD 1J2VA 1P1TA 3OTDA 2YQ0A 4L76A 4U8VA 5D4PA 4DV0J 2L08A 4AYBD 2J9DA 4JV5F 3Q89A 1U2FA 4A8OA 4AXJA 3LALA 1PO6A 2DH7A 2H5JB 1S4EA 2OIHA 1WDDA 2QZ8A 2DNYA 2NXCA 4RX6A 1Y5LB 3SQOP 4USHA 2G2YA 5KFOA 1P6TA 2NSBA 5LSRA 4OI1A 5I42A 1PIEA 1RZMA 2D9PA 2KFYA 3K5PA 2DGUA 1FD8A 3DFEA 1FK9A 2W9CB 4AT1B 3SZ2A 3OQ2A 1RSCA 2Y8WA 5KAKA 4MTPA 1MU2B 3AT1B 5G4DA 1M5VC 4IG0A 4C97A 4RBTA 5IFMA 2FJWA 1DAXA 4V19X 3PW4A 5DQIA 1HNVB 3ZNUA 1BWEA 3FEXB 4QOTA 1JLAB 2V94A 2YNFA 4DCOB 1LQ9A 2AGOA 1BUXA 1RCOB 4CDIA 2ZH7A 5C24A 4BWJA 4FP9A 3G6YA 4X4OA 3HLUA 3ETMA 2ASYA 2JWNA 2FHKA 5KOWA 3C6TB 2EXUA 1HNIB 1T9UA 2HLTA 1H6KX 1FX2A 3UW1A 5EN1A 1UFLA 3VGTA 4KV8A 2P6SA 4M5DA 4J9OA 3DLJA 1HA1A 3KJQB 3OFHA 3N6LA 3JAMU 3I96A 5EGYA 1BMQB 1S0MA 1SH2A 1RAGB 3RYLA 2EWHA 1LWFA 2ZH3A 3DLLQ 4JI1J 1NSQA 3RRHA 1H72C 4ZVUB 2IYGA 3AA9A 3Q8VA 2ZITA 3DOLA 1TKTB 2PMWA 4WTOB 2KU7A 1SL1A 3NAHA 1H73A 4KT0C 3QRQA 1BQXA 5JJBA 2MKSA 1JLQB 3CC7S 8RUCA 4Q8EA 2CYYA 3MHYA 3C16B 3KHGA 2O3DA 3UD5A 3EGZA 2PN6A 3IO1A 1S79A 4TKTA 1VOMA 3TVKA 2B4OA 3ISNC 3M9OB 2UUAF 3MPWA 3TZZA 4QWBA 3CSKA 1U1KA 4YB5A 1D09B 3MAAB 3BM7A 3I87A 2MKCA 1T05A 1MG7A 3K89A 2DGWA 4LF5J 3I9V9 1QTMA 3ZZ0A 3IRXB 5ITHA 3MURP 2GGPB 3OR1B 4C11A 3A8JA 1HI1A 2AYEA 2OJ3A 5ETRA 2BJ3A 5K8OA 2I5JA 1FERA 2J5AA 2N4DA 4KTQA 5KFMA 5IWAF 3DYAA 4J90A 1GXUA 3A3NB 1UPMB 3KLEA 1V3RA 2B0GA 1FWPA 1CQNA 1RT7A 2YY3A 5GAGI 2NZ4A 3IGVA 4Y6IA 1IKVA 2VG7B 4LFCJ 3KUHA 4JI7F 4OHYA 2V4JA 2NZCA 2U1AA 4WZMA 4NX9A 4RBUA 1NPKA 4UZCA 1S6QB 1IWAA 2HQGA 1HNXF 1CJTA 3U02A 4WPAA 4DFKA 4K4VA 1MN9A 1IBLF 2E66A 1U45A 2F8EX 3G87A 3DMJA 3QFHA 1Q86T 2KG1A 2VOPA 4USIA 3PEJA 2WW4A 4DV1J 2COLA 2V2VA 1KR4A 2CJ9A 2QL5B 3K17A 4TLRA 3GIMA 1FRKA 4F4YA 1AW0A 3P5BP 4OIXA 1IKWA 3MPYA 2GJ2A 2A2DA 3BBFA 5HK4A 2P8IA 1Q8IA 2ROGA 4DV6J 3VGSA 2K1RA 3I5BA 2B4PA 5FD1A 4EMDA 1DTTA 5KT4A 3LP1B 2E1CA 2HK2A 3CDBA 4NYZA 1FEHA 2HBQB 2HVHA 1EP4A 2JEFA 5L1IA 2V2KA 3EWGA 4LR9A 2CPEA 3JTPA 4DPXA 4AL7A 4S0MA 5ETMA 3RR7A 1FESA 3KKFA 3PACA 1YK9A 5HROB 3Q83A 4ZDNA 2RQCA 2Z2MA 1HL6A 4I6WA 2ZE2A 4PR6A 2C42A 4BCAA 4K4UA 5KFQA 3TJAA 2J0XA 1K47A 1IWGA 1UEKA 4NA2A 2RRBA 1RT2B 4RU9A 4JI3F 3MF5A 4LF2A 1GAOA 3KUEA 4MK9A 4XIUA 3W64A 3CT9A 1KSPA 2HBRB 3IFEA 3V81B 2UUBF 2L9NA 3JYTA 4F4WA 4ZLJA 1MN7A 1ZYQA 1CULB 4OFZA 2R7UA 2HAIA 2HVZA 2AMCB 2RF2A 2V9WA 4B3MJ 1YSJA 2WB1D 4CZCA 3PRDA 3MM6B 3BSOA 5L1LA 4OZ1A 1FDAA 1BY9A 3QRRA 2LA6A 4CH1A 1RJJA 2HQ3A 2JEIA 3BO2A 4PRFA 2R7XA 3A13A 2G13A 4IG3B 3I4HX 4QCLA 2OP5A 3GONA 1HD0A 5IOLA 1RISA 3QGPA 4N77A 1X9SA 2HVEA 3ZC4A 4F8RA 5L39A 3BEGB 5KFTA 1Y9OA 2BW7A 2V6AA 1RTHA 5F9NA 1NRKA 3B8HA 4C3LA 4YS2A 4P2XA 4OZNA 3K5MA 1SUQB 2XO6A 1GEHA 2HFNA 2K06A 2APOA 2R4FA 2HHXA 3GG1A 1YBUA 4QPXA 1RTDA 4LF7J 5DDQC 1FF2A 1PSDA 5IT9Y 5J2MB 2XMMA 4JI2F 1S9EA 2DIVA 4QU7A 4ZIWA 1MMLA 3CF5Q 3S01A 1VK3A 3MPUB 3MTJA 2IDEA 2DTJA 3IC1A 5B7WA 4ZVEA 3UPFA 5I3QA 1XEZA 2JLGA 1KONA 4GC7A 2XULA 3CJ2A 1VQ9S 4CLYA 4OLOA 2XB2D 4U8YA 1D9DA 1S7IA 3DRSB 4NRUA 2B5JB 3TYTA 2VKRA 1RT1B 3DLKB 2VC1A 5A8KA 4USVA 2P6TA 2Y1RI 4HR2A 3M9NB 1S0VA 4DV5F 3GV5B 2VG5B 4DL6A 1TUVA 4LF9J 1OSDA 1WKLA 3EZOA 4UT4A 2ILYA 2KVIA 2QRRA 2H5IB 4IOCQ 2NXEA 4NYPA 2NPFA 2MKHA 2MKKA 3HPOA 2FVSA 4A8SA 4NLOA 4WIQA 1ZA1B 4IFVA
chains in the Genus database with same CATH topology
2HS0A 1UETA 2EFOA 3PY8A 3BZQA 3RR8A 1LWEB 1X9WA 2DD8S 5KFCA 3GILA 1L3TA 4NLXA 3KG0A 2JJ4D 4CTAA 1TKZA 4YB7A 2MJNA 4WFYA 5HMZA 4DL5A 3PZPA 1O8BA 2PO4A 3D0GE 2JC0A 3MMCA 5C25B 5KFIA 3HVRA 3MR5A 3OSNA 1RA7A 5HN0A 1XR6A 4OI0A 2BE2B 1R27B 2U2FA 3PVXA 3HHLA 2LVWA 3MEGB 5KFRA 1FE0A 3POTA 2YX1A 3FRYA 2HRUA 3OTBA 1JLGB 5THWA 1K9MT 1O51A 2GO8A 5A6PA 2ZE2B 3VZIA 4HI1A 5K8NA 2HPUA 1OIAA 4X65F 2K8GA 4EZ9A 3PEHA 2YKNB 3MMAB 1Q1KA 2X1GA 1FKOB 2YH1A 4TY9A 1QAYA 1X8DA 3MMJA 5J2NB 2AJ0A 5AE3A 3DLGB 4QWEA 2MYFA 1HHSA 1KOHA 2MQMA 3SSSA 1V3SA 3QZ7A 3GE9A 1RWUA 4QR0A 5LXYA 4JOUA 2HFOA 4RWWA 3VAJA 4Z37A 2FLNA 4Q0BA 4EBCA 4JI0F 2CJBA 3S1TA 4X84A 1CG2A 5DDPC 3U1NA 3I0RB 2B6AA 4EGLA 3M8QA 1KC8T 1X4BA 1TK0A 1RT4A 5HBMA 1WD6A 3ISND 4Q45A 3BDPA 1FRMA 4K4SA 1VQNS 1FVQA 4CI0B 2MQOA 4RUAA 3P6YC 2ZHBA 1S7HA 2MGZB 5K14A 1B0PA 1LWCB 4ZPCA 4DV0F 1XWLA 5B0DA 1H2TZ 5KFBA 1WF1A 1FTRA 3I55S 3MD3A 5CHCB 1FTCA 2MZRA 3JYTB 2HMIB 4B3TF 2HHPA 4JV1A 1HWKA 2GO9A 3CCWA 4ZOSA 3UNGC 1Y3JA 2HHUA 1C1CA 2HWIA 4KGMA 4DL2A 1RK8A 4GC6A 3SV3A 3PIPQ 4WE1B 4ETXA 1NK8A 7FD1A 3FCHA 1B0TA 3HVWA 3NRBA 2RF2B 3HVTA 5KFSA 5HMWA 3NNHA 1V9OA 1X7VA 2NSCA 3Q8SB 2GC8A 3RAMA 1X0FA 2IMWP 1R8AA 2ZC3A 5J1PA 4ID8A 1DURA 3NS5A 2DITA 4DL7A 4IUFA 4U7UK 1VQ4S 1LKZA 1FKPA 3T9NA 1S72S 5J2PB 3HFKA 2EK1A 2KXNB 1F9FA 4P7VA 5E3QA 4DR3F 3T5HA 2A2CA 1FDNA 4JI4F 1HYSA 4DFJA 1RQ0A 2E9TA 3CCLS 5C42B 4JBCA 3JB9k 4DQSA 4WU3A 2XGPA 3KLHA 3M30A 4H4KA 1IKXA 3UCGA 4C8OA 2AP6A 4DQQA 5E41A 1FD2A 2EFQA 5KT5A 3VAKA 3D54A 4B3OB 1WHYA 3N4WA 4K50A 4KHMA 2JSXA 1PC5A 1DLOA 2JVRA 3DDKA 2XO7A 1LV5A 4EO8A 2V9KA 2IC3A 2M2BA 1DFDA 1GX6A 4WXOA 3MR2A 3G96A 2CPFA 1LFPA 1WI6A 2VONA 2DGQA 3DC2A 4ZPVR 4CH0S 4KBIA 5KFPA 1WI8A 3PXGa 2K7JA 2XMJA 2ASJA 3OXFA 4LVOP 2VBYA 2EG1A 3HKWA 4A8FA 2AQ4A 1HWLA 1SJFA 4C8NA 3TAQA 5B0GA 2AX0A 1VQKS 2XMUA 4Q8FA 1LOUA 3B4MA 3GYXB 3LP2A 4CNYA 3MDFA 1RTHB 3BGUA 5CYMA 5KOXA 5KFWA 4J9SA 3KG4A 1S1XB 4B9SA 1S6PA 4HH0A 2CQCA 2GHPA 2QA4G 4E0DA 2VPZB 1IJEB 2QYCA 1JK9B 3RTVA 2EKYA 1F5AA 1ZTWA 3DXBA 4I69A 4HH1A 4LVNP 4BDPA 1HBUA 2J7KA 2RVJA 3QO9A 3J7YI 4EYIB 2HZCA 2XNQA 2NQPA 3THTA 2AF6A 5E7OB 1R0AB 1BLUA 5CZXA 2DHGA 4IOBA 3QWUA 3EGNA 3D1OA 3IAS9 3BO4A 1HQUA 3H98A 4NMLA 1QSSA 2BANB 3UDLA 4J9RA 1L3UA 4M94A 2VB6A 2YWFA 2XSJA 4KHRA 3FJ2A 2DNLA 2WB4A 4PUOA 3GG0A 3S8SA 5EX0A 3MR3A 3KK1A 2XY7A 4J9LA 2J8AA 2E5LF 1R3NA 3CULA 2R7WA 4WFXA 3B4DA 2BA9A 4MKAA 3TUIC 5M2RA 2ACYA 2YNIB 3PIOQ 4R0EA 1N56A 2BBEA 3C3LA 2CQGA 1NJYA 1HBOA 4G3IA 1S9EB 4WYWA 2VL1A 3DGPA 3JTOA 3LPYA 4CO3A 4KRWA 1R8BA 3CC2S 3K58A 1VS3A 1SJ4P 3V6KA 2VZ9A 2JOQA 2NUHA 4MMOA 1NKCA 2FGOA 1U7LA 2LXFA 3DOMA 3NCQA 1S1UA 3LH2S 2HRYA 4FZVA 1UW4A 6FDRA 5FLXY 3OTEA 1MU2A 3GIIA 2EW9A 3M32A 4R5PB 1KVIA 1HMVB 1HBMB 2RQKA 2LU2A 1SB6A 2FLLA 1LFWA 1CQMA 5KFXA 2FGCA 3RAQA 1X4DA 3N9UC 3KHHA 4AXIA 2B9XA 2ILZA 1S6OA 3PO5A 2DNOA 5K5MA 4C3MA 3R27A 4PG6A 3W7BA 2OD4A 4ECUA 1IKYA 2IRXA 1G7CB 5CCLA 1VMBA 4X4VA 2QMWA 4ZCMA 2W24A 1X4FA 4TQSA 1SJ1A 1TZ0A 3G4SS 4DG1B 2NPIA 2OFGX 3OUYA 4FXDA 1JLAA 2R7VA 2FVQA 4KR0B 3I56S 3IG1A 2Q43A 2RKIB 1KQFB 3I0SA 3ICLA 2WBMA 4PXDA 4RW6A 4UW2A 5HL7Q 3E01A 4OX9F 1E6VB 3MM7A 4JI1F 2ALZA 4A8XA 3C2PA 3US5A 2R7QA 4IDKA 1WHXA 2W25A 2ZH2A 2VBZA 3ZFVA 1U48A 2UUCF 1JJ2R 5L38A 1DHMA 3QJJA 3LGMA 1S0OA 1QE1A 3T5JA 4ES3A 3H4DA 1WWHA 2QSFA 3NL0A 3C6TA 3MEEB 4ES1A 3OL6A 2VQFF 4FNIA 3PW2A 2NR0A 4DQIA 3CD5A 1MMNA 3OLBA 2Z2LA 4WTYA 2QT7A 1RT5A 4KO0A 2C28A 2IM3A 4YMEA 3SI8A 2ZH8A 2XWXA 3TVYA 1RT3A 1JLFA 3IR6B 4KV8B 3CPWR 2W4CA 4L72B 2LDYA 3QIPA 4Y2IA 3FMWA 4NCGB 1XMOF 1Y00A 2DVIA 4X2BA 2VFUA 2C3PA 5KFLA 3PR4A 2KHCA 1QVFR 3Q2TC 4B3RF 3GFZA 4I2QB 1U1LA 2OPRA 1QAIA 3TOQA 4AE5A 2RS2A 2GW8A 3T1AA 3N6MA 1KTQA 2ABYA 2MPUA 3SDEA 4K4YA 1VC5A 3I6PA 3HI9A 2P9EA 4LFAF 2WCXA 1KLMB 1YJRA 1ZM4A 2LLZA 4KQZA 3UR0A 2ZFHA 4DS4A 1KFSA 2J76E 1TQLA 3KLGA 5BYSA 1W2BR 2H5EA 2H9ZA 5E2QA 4W90B 3AY0A 1UVKA 3R3TA 1LWFB 2CIMA 3CDWA 3FRZA 2E1AA 2XC9A 2ZUGA 1G6BA 2I9SA 1S4FA 4DHVA 3MXHP 4LQ9A 4YP3A 1K8AT 1NHUA 2OD6A 1C2PA 2KFNA 2F8MA 4CH7A 2VPWB 3BGFA 1C0TB 4DQPA 3HZGA 5DLFA 4FVCA 3IR5B 5FDLB 2ZKUA 5G0RB 4PXCA 3HHLC 1WG5A 2YX4A 2XG8A 4XPCA 1T94A 5F3TA 1S10A 3DOLB 3OTCA 2ZJQQ 4IFVB 4KE5A 2VG6A 4YR0A 3CIMA 5FJ4A 4DV7F 3GZ7A 4ICLB 3OSPA 3QJPA 1RTJB 4HHJA 5KTQA 5B0EA 4J9PA 1NK4A 2CG4A 4YR2A 4CTAB 3Q2SC 3CVKA 4QQBA 1WTBA 2BQ3A 4NLRA 2ZM6F 4DSKA 1QY7A 2HNDB 3PHEA 2XLKA 1B0VA 2G1DA 2VPYB 3BGRA 1YIJS 1DTQA 2DRAA 5KFEA 1OWXA 1S9FA 1D9FA 4HKQA 3RRKA 5GVQA 5B0CA 1TK8A 3CJ3A 4C2MA 3HHLB 3CMES 2KI2A 2B51A 3POTB 5E3AA 2GMHA 1U1NA 1YJTA 3HHKA 4O4GA 4J37A 1VC6A 3W2WA 3TR5A 2QA1A 2ZOFA 1TVRA 2M0GB 3V6DA 2ATLA 2LKZA 1HD1A 2ASLA 4B9LA 5IM0B 2J7UA 4XAKA 3CXCR 3BQ0A 1RP5A 2SXLA 5HLFA 4PWDA 5T14A 2QO3A 4FS1A 2NS1B 4CT9A 5IT0A 1N5SA 1VBZA 1AUDA 1KRPA 3R1HA 2VODA 2CZ4A 3MM9A 3UE2A 3QYYA 4HYKA 3SQGA 2BR0A 1YQHA 2LQ9A 4LJMA 3KWMA 3QAUA 3IRWP 4Q0BB 4NLWA 2B4VA 3MR6A 3CCSS 2QMXA 4YHHF 3KLFA 4IR9A 3OTOF 2B6AB 3HO1A 3H4BA 3M8QB 3KK3A 5HBMB 1SJ3P 4Y2AA 2Y0SD 2DJWA 5KG7A 4UUWA 4URSA 3ZZUA 2G4BA 3JSYA 1JNRB 3HF5A 3P96A 3GR0A 4K4XA 5CA5A 2KN4A 3LW5C 4RW7A 4DSEA 4KFBA 3W3SA 1RTIB 5AXKA 1Q7LB 1UJ6A 3ZZTA 2OMLA 4UY8T 1C1CB 5DETA 3GFHA 3T19A 1T05B 3CJ4A 2ZHOA 4H4KC 5MAOA 2E5GA 4DMZA 2R9LA 4IYQA 3JSMA 2C3OA 3HVTB 4DR2F 4ED8A 3O44A 5KFGA 3PFEA 2WSEC 2UZAA 2WONA 3IRXA 4RNFA 1HQEA 5A6WA 3SCKE 3AQOA 1A7GE 1SKRA 1VQ6S 4I1TA 3M8RA 3IBWA 1FKPB 2B9WA 4ED2A 2GGPA 1R6YA 4QPTA 1DRZA 1YVFA 4WXWA 1FNMA 2M70A 2XMKA 4C98A 1JXEA 2CZVC 3OR1A 2HGLA 4OZLA 2A18A 3WDOA 2ADBA 3MMBA 2BRKA 4A47A 1IBMF 1HYSB 5GADU 3VTIA 4NA1A 4LFCF 2XNRA 1B7FA 3MUMP 1BD6A 2W7AA 1PC4A 1MNEA 3KLHB 1U49A 2NUUG 1JXLA 4K0KF 1IKXB 4QR1A 4UQTA 2CQ3A 2OPQA 3G9CA 1V6HA 5KG1A 2XGQA 2PD1A 4LMZA 4HT7A 1T95A 4PG5A 3BSAA 2ZJRQ 1T7PA 4FNHA 4DUZF 1DLOB 1SBRA 3MAHA 1N6QA 1U4BA 4AUKA 3DM2A 1ZM2A 2IC3B 4TY8A 4XPEA 4IH7A 1ZTTA 3ULHA 2QE5A 4RKUC 2LQJA 2Y1JA 1SV5A 4I68A 2FHJD 1FJ7A 1TL5A 1IQTA 1GTHA 4LF6F 4M63A 1FXLA 3KLEB 1E6YA 4X4UA 3U1LA 3KTQA 3CO9A 4ED6A 2VH7A 5SZTA 3D2WA 3PJWA 1UA0A 4NZ0A 4WJBA 1K1QA 3H5XA 4N76A 1XNRF 1UAWA 3K8VA 1S6PB 4FPRA 4O3NA 5KFVA 4ZPDA 3B82A 4PCQA 5A0YB 2ZOGA 3T9ZA 1YJVA 3J7A1 2LU1A 1HBUB 3QO9B 4KGKA 4PG8A 3VQTA 2N82B 1ZZFA 2BV3A 1ELOA 2DGVA 2POKA 4G6VB 1AFJA 1TK5A 2LYVA 4CQ1A 4QZVB 2HWTA 2W9BA 1VGYA 1MW7A 2E1RA 1QJHA 1HQUB 3ONQA 3M6VA 1FT8A 3SCJE 4NLGA 1FRHA 4ID5A 2CPHA 4RW8A 3NGKA 4WFNQ 2CQ4A 3DCAA 1VQYA 1TR0A 3M2VA 2MQLA 4DV1F 2DGOA 4PUOB 4ED1A 3DRYA 2RU3A 1N4LA 1U47A 4N47A 1FEEA 1VQLS 2O66A 4DN0A 4U6PA 3ZZZA 1UA1A 1NKEA 1X9MA 1KFDA 2DGXA 3DHWC 1O0PA 3Q8RB 4JYAF 5CD4H 4NLPA 3LWLA 1LW2A 3AAWB 3CCTA 4ATNA 3PFOA 1JB0C 1HBOB 1SH3A 2AU0A 1P8GA 1S1TA 1X5TA 1KNZA 4TU7A 3MWBA 1S48A 4HI2A 2LXUA 2VKZG 3V6JA 5T7LA 3LP0A 4MAKA 4XK8C 2E5HA 2ERRA 4N5SA 1S1UB 1NK6A 4I67A 4EO6A 4DV6F 3TA1A 1C0UA 4IRCA 1HW9A 2CVEA 3M32B 1CC7A 5DDOC 4X4SA 4K2XA 1KHWA 1D0EA 1WTFA 2CKWA 4AL6A 1Y3KA 2DHAA 4QIWD 3NNCA 4A8MP 3K57A 3DMJB 6FD1A 1IKYB 2GHVC 3H40A 3NKYA 3QWPA 4MH8A 3R5CA 4LSNA 3THVA 4OHZA 2ZKTA 3OR2A 2HNZA 1VRTA 3SMZA 3GR1A 3V4IB 2RDJA 1C1BB 1SJRA 4B9TA 1ZM9A 3OUYB 1C4CA 2XS2A 4OI3A 5F0UA 3PDNA 3DRRA 1LW0A 3PNIA 3SEOA 4PG7A 4E8UA 3IG1B 3PM9A 4RLEA 3I0SB 4BS2A 4RW6B 3SSRA 4URGA 3KK2A 3MEDB 3MM7B 2XS5A 3ENQA 4KKOB 4IDKB 1UMJA 1TL3A 4ZP6A 4RW9A 4WU2A 2EFVA 1WF0A 3OJSA 3PRBA 3TI0A 4PQUA 3PX6A 1SKWA 1KQKA 2Z4PA 5KG2A 1XC9A 3GMGA 5IQ6A 2C2EA 2RIJA 4F67A 1S99A 1EP4B 2IRUA 1U1PA 1YWXA 4K4ZA 1JIHA 1NK0A 3NBPA 2PDAA 1XR5A 4KO0B 4ED5A 1IKWB 4L6V3 2DNGA 4ZP7A 2PEHA 3VAGA 3SV4A 2IA0A 2G9OA 1RT3B 3CCES 2BABA 5EDWA 3V5RA 2K1RB 2KM8C 3MEKA 5B0FA 1L3KA 1UL3A 3HVAA 1G2EA 2PMZD 1FJCA 2FVCA 3G86A 5E0OA 2W9AA 2VC0A 1I94F 4ELUA 1OPZA 4EBEA 2JLFA 3NWGA 4ZPWR 2OPRB 3MOZA 3PKYA 2FY1A 3L7OA 4CIOA 5KT7A 1TV6B 2L48A 4Q2LA 4MJKA 4NOHA 2YWEA 2Q79A 3SDEB 1X4CA 3DU5A 1G1XA 2PE8A 1TL1B 2JZ5A 4ECWA 2DHSA 2XCPA 4DR6F 1GX5A 4PG4A 3CCUS 3NP5A 4FXWA 1M90T 1D3WA 3KLGB 1X0PA 1TKXA 5EWFA 4H4OA 2CPJA 1VLYA 1WF2A 3CGIA 3TARA 4ZPBA 2E9RX 1IQZA 1RT6A 2KM8B 1D1UA 5F8MA 5HMYA 1FNOA 1F5BA 2DK2A 3MFIA 3DU6A 4DV3F 1KLNA 4L3NA 3M2RA 5F0WA 5U47A 3KG1A 4O23A 1RA6A 2M7SA 4UQGA 2DCUB 4OL8A 2X51A 4B3MF 3PX4A 1QAXA 4U9RA 4KC5A 4ZLPA 2XY6A 2YNGA 1NEEA 2ZNZA 4QWCA 3ISZA 5KFZA 2C3UA 3S6EA 2D3UA 4DLGA 2E5JA 5DRKA 2ZDPA 2VQEF 2VG6B 2XMVA 3GB0A 2FB0A 3JSBA 1ROFA 3CJKA 4ZK7M 3DLBA 2PI4A 4K59A 2HHVA 2IFXA 3WZ0A 1TL4A 3I32A 1DARA 1HFEL 4EU0A 3H20A 2LEAA 4N56A 2XZWA 1IJFB 3VAIA 3BGRB 3BR8A 1V3ZA 2KDOA 1DTQB 3TAMA 4HTJA 2KRRA 2WOMB 1H0HB 1N5YB 3ZZYA 3SCIE 1T03B 2HG4A 1ULRA 4DV2F 2JL9A 2I2YA 4FYDA 1JJ4A 4B08A 5EUHA 5L8RC 1GT8A 2OAUA 4YB1P 4ZPAA 4O4GB 2EFPA 3W2WB 5F8IA 2YTCA 5KFDA 3N28A 4HDGA 4ZCIA 1TVRB 1NK5A 3MZIA 4OHWA 2BQUA 5H9EJ