1T3YA

Three crystal structures of human coactosin-like protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
131
structure length
131
Chain Sequence
ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three Crystal Structures of Human Coactosin-like Protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 46
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1t3yA00
1NM1G 2VILA 1F7SA 3FFNA 3FG7A 3EGXB 4S10C 1VKKA 1C0GS 2LXXA 1T2LA 1T3YA 4CBWG 2W0IA 2FH2A 5KYWB 2MOTA 1M4JA 5KYNA 1PCXA 5KYXB 1V6FA 1T3XA 2FH4A 1SVQA 1X67A 3EH2A 2QTVA 1SVYA 2XFAA 5IVUA 1D4XG 5KYUB 1AK7A 5FAEA 3CJCG 1WNJA 1AHQA 3A5MS 4BEX1 5DD2A 4PKIG 1EQYS 2XF1A 3FFKA 3CI5G 5A1MA 5HVKD 1M2VA 1PD0A 3EFOA 3EH1A 1ESVS 1C0FS 2LJ8A 5KYXA 2NUTA 4CBXG 4KEFA 2FGHA 3A5LS 3A5NS 1P8ZG 1YAGG 2MP4A 3A5OS 1P8XA 2VIKA 1MDUA 1YVNG 3EGDA 2MV2A 1NMDG 1M2OA 2FH1A 5KYYA 1J72A 1VFQA 1JHWA 3CJBG 1TVJA 5L6WC 5HVKB 3EGXA 3EG9A 3L50A 2NUPB 1KCQA 4KEDA 2FF3A 4LIZA 2NUTB 3EGDB 1UDMA 1D0NA 4KEEA 2FF6G 5KYYB 2VACA 1CFYA 1H1VG 1SVRA 3DAWB 2D8BA 1WFSA 3EFOB 1RGIG 2I2QA 1CNUA 1NPHA 1TMWA 1COFA 2KVKA 5KYWA 4Z94G 1T44G 1Q8XA 2FH3A 1AK6A 2HD7A 1DEJS 4JD2H 2LLFA 2NUPA 1PD1A 1Q8GA 3EG9B 3FG6A 1HQZ1 1NLVG 1QPVA 3CIPG 4PKHB 3TU5B 1M2VB 5FAFA 1WM4A 3Q2BA 4CBUG 4PKGG 5KYUA 2L72A
chains in the Genus database with same CATH superfamily
1NM1G 2VILA 1F7SA 3FFNA 3FG7A 3DA7A 3EGXB 4S10C 1VKKA 1C0GS 2LXXA 1T2LA 1T3YA 4CBWG 2W0IA 2FH2A 5KYWB 2MOTA 1M4JA 5KYNA 1PCXA 5KYXB 1V6FA 1T3XA 2FH4A 1SVQA 1X67A 3EH2A 2QTVA 1SVYA 2XFAA 5IVUA 1D4XG 5KYUB 1AK7A 5FAEA 3CJCG 1WNJA 1AHQA 3A5MS 4BEX1 5DD2A 4PKIG 1EQYS 2XF1A 3FFKA 3CI5G 5A1MA 5HVKD 1M2VA 1PD0A 3EFOA 3EH1A 1ESVS 1C0FS 2LJ8A 5KYXA 2NUTA 4CBXG 4KEFA 2FGHA 3A5LS 3A5NS 1P8ZG 1YAGG 2MP4A 3A5OS 1P8XA 2VIKA 1MDUA 1YVNG 3EGDA 2MV2A 1NMDG 1M2OA 2FH1A 5KYYA 1J72A 1VFQA 1JHWA 3CJBG 1TVJA 5L6WC 5HVKB 3EGXA 3EG9A 3L50A 2NUPB 1KCQA 4KEDA 2FF3A 4LIZA 2NUTB 3EGDB 1UDMA 1D0NA 4KEEA 2FF6G 5KYYB 2VACA 1CFYA 1H1VG 1SVRA 3DAWB 2D8BA 1WFSA 3EFOB 1RGIG 2I2QA 1CNUA 1NPHA 1TMWA 1COFA 2KVKA 5KYWA 4Z94G 1T44G 1Q8XA 2FH3A 1AK6A 2HD7A 1DEJS 4JD2H 2LLFA 2NUPA 1PD1A 1Q8GA 3EG9B 3FG6A 1HQZ1 1NLVG 1QPVA 3CIPG 4PKHB 3TU5B 1M2VB 5FAFA 1WM4A 3Q2BA 4CBUG 4PKGG 5KYUA 2L72A
chains in the Genus database with same CATH topology
1NM1G 2VILA 1F7SA 3FFNA 3FG7A 3DA7A 3EGXB 4S10C 1VKKA 1C0GS 2LXXA 1T2LA 1T3YA 4CBWG 2W0IA 2FH2A 5KYWB 2MOTA 1M4JA 5KYNA 1PCXA 5KYXB 1V6FA 1T3XA 2FH4A 1SVQA 1X67A 3EH2A 2QTVA 1SVYA 2XFAA 5IVUA 1D4XG 5KYUB 1AK7A 5FAEA 3CJCG 1WNJA 1AHQA 3A5MS 4BEX1 5DD2A 4PKIG 1EQYS 2XF1A 3FFKA 3CI5G 5A1MA 5HVKD 1M2VA 1PD0A 3EFOA 3EH1A 1ESVS 1C0FS 2LJ8A 5KYXA 2NUTA 4CBXG 4KEFA 2FGHA 3A5LS 3A5NS 1P8ZG 1YAGG 2MP4A 3A5OS 1P8XA 2VIKA 1MDUA 1YVNG 3EGDA 2MV2A 1NMDG 1M2OA 2FH1A 5KYYA 1J72A 1VFQA 1JHWA 3CJBG 1TVJA 5L6WC 5HVKB 3EGXA 3EG9A 3L50A 2NUPB 1KCQA 4KEDA 2FF3A 4LIZA 2NUTB 3EGDB 1UDMA 1D0NA 4KEEA 2FF6G 5KYYB 2VACA 1CFYA 1H1VG 1SVRA 3DAWB 2D8BA 1WFSA 3EFOB 1RGIG 2I2QA 1CNUA 1NPHA 1TMWA 1COFA 2KVKA 5KYWA 4Z94G 1T44G 1Q8XA 2FH3A 1AK6A 2HD7A 1DEJS 4JD2H 2LLFA 2NUPA 1PD1A 1Q8GA 3EG9B 3FG6A 1HQZ1 1NLVG 1QPVA 3CIPG 4PKHB 3TU5B 1M2VB 5FAFA 1WM4A 3Q2BA 4CBUG 4PKGG 5KYUA 2L72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM1 G;  2VIL A;  1F7S A;  3FFN A;  3FG7 A;  3EGX B;  4S10 C;  1VKK A;  1C0G S;  2LXX A;  1T2L A;  1T3Y A;  4CBW G;  2W0I A;  2FH2 A;  5KYW B;  2MOT A;  1M4J A;  5KYN A;  1PCX A;  5KYX B;  1V6F A;  1T3X A;  2FH4 A;  1SVQ A;  1X67 A;  3EH2 A;  2QTV A;  1SVY A;  2XFA A;  5IVU A;  1D4X G;  5KYU B;  1AK7 A;  5FAE A;  3CJC G;  1WNJ A;  1AHQ A;  3A5M S;  4BEX 1;  5DD2 A;  4PKI G;  1EQY S;  2XF1 A;  3FFK A;  3CI5 G;  5A1M A;  5HVK D;  1M2V A;  1PD0 A;  3EFO A;  3EH1 A;  1ESV S;  1C0F S;  2LJ8 A;  5KYX A;  2NUT A;  4CBX G;  4KEF A;  2FGH A;  3A5L S;  3A5N S;  1P8Z G;  1YAG G;  2MP4 A;  3A5O S;  1P8X A;  2VIK A;  1MDU A;  1YVN G;  3EGD A;  2MV2 A;  1NMD G;  1M2O A;  2FH1 A;  5KYY A;  1J72 A;  1VFQ A;  1JHW A;  3CJB G;  1TVJ A;  5L6W C;  5HVK B;  3EGX A;  3EG9 A;  3L50 A;  2NUP B;  1KCQ A;  4KED A;  2FF3 A;  4LIZ A;  2NUT B;  3EGD B;  1UDM A;  1D0N A;  4KEE A;  2FF6 G;  5KYY B;  2VAC A;  1CFY A;  1H1V G;  1SVR A;  3DAW B;  2D8B A;  1WFS A;  3EFO B;  1RGI G;  2I2Q A;  1CNU A;  1NPH A;  1TMW A;  1COF A;  2KVK A;  5KYW A;  4Z94 G;  1T44 G;  1Q8X A;  2FH3 A;  1AK6 A;  2HD7 A;  1DEJ S;  4JD2 H;  2LLF A;  2NUP A;  1PD1 A;  1Q8G A;  3EG9 B;  3FG6 A;  1HQZ 1;  1NLV G;  1QPV A;  3CIP G;  4PKH B;  3TU5 B;  1M2V B;  5FAF A;  1WM4 A;  3Q2B A;  4CBU G;  4PKG G;  5KYU A;  2L72 A; 
#chains in the Genus database with same CATH topology
 1NM1 G;  2VIL A;  1F7S A;  3FFN A;  3FG7 A;  3DA7 A;  3EGX B;  4S10 C;  1VKK A;  1C0G S;  2LXX A;  1T2L A;  1T3Y A;  4CBW G;  2W0I A;  2FH2 A;  5KYW B;  2MOT A;  1M4J A;  5KYN A;  1PCX A;  5KYX B;  1V6F A;  1T3X A;  2FH4 A;  1SVQ A;  1X67 A;  3EH2 A;  2QTV A;  1SVY A;  2XFA A;  5IVU A;  1D4X G;  5KYU B;  1AK7 A;  5FAE A;  3CJC G;  1WNJ A;  1AHQ A;  3A5M S;  4BEX 1;  5DD2 A;  4PKI G;  1EQY S;  2XF1 A;  3FFK A;  3CI5 G;  5A1M A;  5HVK D;  1M2V A;  1PD0 A;  3EFO A;  3EH1 A;  1ESV S;  1C0F S;  2LJ8 A;  5KYX A;  2NUT A;  4CBX G;  4KEF A;  2FGH A;  3A5L S;  3A5N S;  1P8Z G;  1YAG G;  2MP4 A;  3A5O S;  1P8X A;  2VIK A;  1MDU A;  1YVN G;  3EGD A;  2MV2 A;  1NMD G;  1M2O A;  2FH1 A;  5KYY A;  1J72 A;  1VFQ A;  1JHW A;  3CJB G;  1TVJ A;  5L6W C;  5HVK B;  3EGX A;  3EG9 A;  3L50 A;  2NUP B;  1KCQ A;  4KED A;  2FF3 A;  4LIZ A;  2NUT B;  3EGD B;  1UDM A;  1D0N A;  4KEE A;  2FF6 G;  5KYY B;  2VAC A;  1CFY A;  1H1V G;  1SVR A;  3DAW B;  2D8B A;  1WFS A;  3EFO B;  1RGI G;  2I2Q A;  1CNU A;  1NPH A;  1TMW A;  1COF A;  2KVK A;  5KYW A;  4Z94 G;  1T44 G;  1Q8X A;  2FH3 A;  1AK6 A;  2HD7 A;  1DEJ S;  4JD2 H;  2LLF A;  2NUP A;  1PD1 A;  1Q8G A;  3EG9 B;  3FG6 A;  1HQZ 1;  1NLV G;  1QPV A;  3CIP G;  4PKH B;  3TU5 B;  1M2V B;  5FAF A;  1WM4 A;  3Q2B A;  4CBU G;  4PKG G;  5KYU A;  2L72 A; 
#chains in the Genus database with same CATH homology
 1NM1 G;  2VIL A;  1F7S A;  3FFN A;  3FG7 A;  3DA7 A;  3EGX B;  4S10 C;  1VKK A;  1C0G S;  2LXX A;  1T2L A;  1T3Y A;  4CBW G;  2W0I A;  2FH2 A;  5KYW B;  2MOT A;  1M4J A;  5KYN A;  1PCX A;  5KYX B;  1V6F A;  1T3X A;  2FH4 A;  1SVQ A;  1X67 A;  3EH2 A;  2QTV A;  1SVY A;  2XFA A;  5IVU A;  1D4X G;  5KYU B;  1AK7 A;  5FAE A;  3CJC G;  1WNJ A;  1AHQ A;  3A5M S;  4BEX 1;  5DD2 A;  4PKI G;  1EQY S;  2XF1 A;  3FFK A;  3CI5 G;  5A1M A;  5HVK D;  1M2V A;  1PD0 A;  3EFO A;  3EH1 A;  1ESV S;  1C0F S;  2LJ8 A;  5KYX A;  2NUT A;  4CBX G;  4KEF A;  2FGH A;  3A5L S;  3A5N S;  1P8Z G;  1YAG G;  2MP4 A;  3A5O S;  1P8X A;  2VIK A;  1MDU A;  1YVN G;  3EGD A;  2MV2 A;  1NMD G;  1M2O A;  2FH1 A;  5KYY A;  1J72 A;  1VFQ A;  1JHW A;  3CJB G;  1TVJ A;  5L6W C;  5HVK B;  3EGX A;  3EG9 A;  3L50 A;  2NUP B;  1KCQ A;  4KED A;  2FF3 A;  4LIZ A;  2NUT B;  3EGD B;  1UDM A;  1D0N A;  4KEE A;  2FF6 G;  5KYY B;  2VAC A;  1CFY A;  1H1V G;  1SVR A;  3DAW B;  2D8B A;  1WFS A;  3EFO B;  1RGI G;  2I2Q A;  1CNU A;  1NPH A;  1TMW A;  1COF A;  2KVK A;  5KYW A;  4Z94 G;  1T44 G;  1Q8X A;  2FH3 A;  1AK6 A;  2HD7 A;  1DEJ S;  4JD2 H;  2LLF A;  2NUP A;  1PD1 A;  1Q8G A;  3EG9 B;  3FG6 A;  1HQZ 1;  1NLV G;  1QPV A;  3CIP G;  4PKH B;  3TU5 B;  1M2V B;  5FAF A;  1WM4 A;  3Q2B A;  4CBU G;  4PKG G;  5KYU A;  2L72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...