1T4KB

Crystal structure of unliganded aldolase antibody 93f3 fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
217
Chain Sequence
EVMLVESGPGLVAPSQSLSITCTVSGFSLSDYGVSWIRQPPGKGLEWLGVIWGDGSTYYASALKFRLTISKDSSKSQVFLNMHSLQTDDSAMYYCAKHTYGGPGDSWGQGTSVTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG1, KAPPA LIGHT CHAIN
publication title The Origin of Enantioselectivity in Aldolase Antibodies: Crystal Structure, Site-directed Mutagenesis, and Computational Analysis
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kB01
1DJSA 3RY6C 1OP5H 3UJTL 3VGEA 3BZEB 1KELH 5C08A 1ACZA 3RWEB 4JQVC 2R2CA 2YKLH 3VCLA 1C5CH 4F8TA 2NYYD 3IFPB 1K4DB 3WKML 2Q6WA 2B0SL 4PGDB 4LVHC 2NY0B 2EICA 4X6DE 3EHBD 1MCKA 1XGUB 4OCXH 3BQUB 5E8NB 1NBQA 1IAKA 5I8OH 4M1DL 2OL3A 4G6KL 1MWAH 3U4BL 1KT2B 5JOPD 1AI1H 3OX8A 2V2XB 3DV6B 3DMMA 3TT3L 1AKJD 3SDDD 4DUWA 4NJAL 4MWFA 3SBWC 5HHOB 3LKRB 5EZLA 1IFHL 4R3SB 5F7HA 3T0EA 5DRNB 4JFFD 3ULSB 1AIFA 1OTUD 5TPWH 4MMZC 3MUY1 4GW1A 1OTSC 4L4VB 4QTHB 4ZSOA 3ARSA 3HAEH 4JREB 2XRAL 2WWMD 3MCKB 3KLAB 1DUYA 2E9BA 2GCYA 3E6HA 3MROA 3C8KA 3VXRB 1J87A 1IEAA 2KZ1B 4R7NB 1TJIL 4Q9RL 1P7KB 2YZ1A 4KKLC 3PJSA 3VD4A 2R0KL 4P5TB 5FHBL 2F19H 1PKQE 2NY4B 1E6JH 4TYUA 4YBHA 1KUMA 5BXFB 4MLIA 2E6QA 5GJTH 3PIQB 4ZODA 5C0AD 5FGSA 1JP5A 2P24A 5DS8B 3P4NA 4PJ7E 2HFGL 1W72B 1S8DA 4XVSL 1KN4H 4LIQH 4FXKB 1TZGL 1Q0XL 1SY6A 3S98A 5DDHB 4TOYL 1FGVH 4JO2H 3WLBB 3KJ4B 2WBJD 5D7JD 5ICXB 4UU9B 3VCLB 4OZGB 2GIYA 1N0XL 5K9JH 5DWUH 4DJMA 4GRWB 5GSRA 4P48A 5JNYA 1U8PB 1RZ8A 1Y6NR 2FJHA 1LK2A 2JJSC 3FOLA 3DHJA 4X6BA 3DUHA 4HJGB 3ORJA 4JN2B 2MQ0A 1FH5L 1G7MA 1QACA 5KTEL 3N9GH 4QRPD 3BP5A 2YPLE 2J8OA 4XP6H 4LLVB 3CPLA 4KJYA 5E6ID 5D72L 3ROOA 3OX8B 1NJ9A 4I48A 3D39D 3TBTA 3RKDC 3DMMB 4Y19D 4OCSH 5J6GB 3KPOA 5C0BE 1H5BA 1LGVA 4HPOL 1QLFA 3WUZA 2HFFB 1CR9L 2VMFA 4XMKL 5E2VH 5EOCL 1AIFB 1P1ZA 3SPVA 4G8GD 4G6AC 4DTGL 5KVEL 4GW1B 1RUAH 4ZSOB 4Q9QH 3CXHJ 3L3OB 2AI0H 4S10A 5F9OH 3QFJA 4IOIB 3JWOC 1NH6A 2A77H 4M4RA 5I8EB 3C8KB 2CLRA 4NPYB 1XF3A 3IAQA 1RUPL 3L3DA 3TBVA 4M1GL 4NZDA 3SDCC 5L88H 1A21A 1J0IA 3QUXC 3TJEH 1DLFH 1QKZH 5EU7E 4MVBD 3W82A 2KPNA 2KQMA 1JNHA 1H3WM 1BEYL 4X6CF 4JB9L 2BVUA 5FV1L 1GOHA 3TNNB 3L7EA 1K8IA 4H5SB 5F96H 4MJIA 5F88A 4NHCL 1UFUA 3LKQB 4YHOH 2R0LL 2XA8H 1QOKA 3RJQB 4RA3A 2W9DL 4ZS7H 3HE7C 1X3DA 3AREA 4O4YH 2R0ZL 1EA9C 3NVQA 3GSUA 2J6EH 3ARWA 3PL6D 4Y4HA 4NO5A 2VQTA 3TO2B 3H9YA 5IFHL 4ZOCA 5JW4Q 4LAQL 5D5ME 3DX9A 3ZO0A 3WHXB 3RIFF 2J88L 3QUML 2VERN 3EW3B 3NCEB 3GJFK 4OF7A 3BSZL 1RVFH 4WFHD 4K7PH 4ZS6D 1MFCL 4LPTA 1UENA 4HFUH 1MRFH 4WUKH 5KG9A 3CFKB 3WDJA 1BWMA 3GMPB 4FQIL 1D6VH 3BXNA 2WV3A 3BKCH 2XZQL 2OSLA 2LU7A 2X41A 5E1AB 3T65B 2H26B 4OV5A 1NMCB 1MCNA 3ROOB 3PXHA 4I48B 3W39B 3FT4A 3W2DL 1UJ3A 1XGPB 1S5HA 3LD8B 1F4XH 2IAMC 5DC4B 4TNVK 5BMFH 3KPOB 3W0WA 2EEDA 4UAOB 1U95A 35C8H 3PDOA 4GBXA 5EORL 4M02A 5I19L 1DQTA 2XTLA 1Z5LA 1QBBA 2XN9A 3ZDYF 1P1ZB 4DGVH 2PYEE 1AGEB 4XPFL 3VDAA 3DJ9A 5K9QI 2EDKA 4PJFE 2JLLA 5DZOA 1UA6H 4M62H 4P5MA 3K2MC 4DZBB 4OJFH 1RZJC 3HUJF 3FQRA 4V1DB 3VXQA 3SJVA 1YPZE 4JFZL 4BSVA 1XF3B 3SQOL 3TBVB 1DEDA 1I1FB 2DLFL 1GC1L 4U1JA 1MHPH 4YHNB 1EUUA 3MLRH 1FRGL 4XGZB 4OLEA 1HHIB 3L3HA 4F9LC 3HI6L 3O6FA 5GS2H 1HYRC 2QJDA 3P4MB 3QUYD 1I3GL 4LIQE 4Z76A 4KY1H 3FRPG 5DUPL 1F2XK 2BY3A 1PKOA 2ZSVA 4M5ZH 3RA7L 2QQKH 3RUGE 2BNQA 2A6KB 3J7HA 1FFPA 3WIHA 3FHQA 4OCRL 1ED3B 2E7BA 4O9HL 3ULUH 3MRNB 4RQQB 2YSSA 2DBLL 3HNVL 5LQBH 4YDVB 3QNZB 4Y4HB 1A6ZB 1BD2E 4PJ5A 1R3JB 1N3NB 1H3TA 2A6DA 3HZMB 5J1SC 2Y5TA 4HX1A 4NZRL 3ARPA 2YD3A 3O41A 2QQNH 4QCIA 3TPUA 1QPXA 3FFCB 3OAZK 4UTAH 1F02I 1L4IA 3QBTB 1YEKL 3TO4B 5KG9B 2B2XH 2VKWA 1C5DA 5B3JF 4QHNB 2GAZA 2DLGA 4JR9H 3BXNB 4RMSA 1OPGL 2VXTH 2HJLB 3Q6GL 1JGEB 2ZJSH 5GS0L 1LDPH 1A6TB 4Z7UE 1NMBL 3THMH 3QR2A 5GGRY 1J1XH 1ZA6A 3I02A 1XH3A 2DQTL 5T1MB 2OP4L 3W0WB 3SE9H 4LVNC 3GB7B 2V5YA 3CUPA 5J7CC 5F9WC 1HH6A 3MJ9H 2B4CL 2M1KA 4E42A 3QUMA 2ESVE 3QPXL 5SWZA 1AQDA 4WVRA 2FIKA 5H35A 4P5MB 1A1OA 5EC2A 3KJ6L 3VXQB 4WWKB 5I30L 2F74A 4ODBD 1I8KA 2VDMH 4M7JH 5E8EA 4U1GB 2AKRA 5ILTL 1QFPA 4RWYH 3QHTC 2GK0B 5F1NB 4F7MA 1YEHL 4MSWA 1NEUA 5F6IB 5BVPL 4IHOA 2NTFB 1S9KC 4P9MH 4XNUH 2XIDA 4X7DC 3GK8H 3F12A 4S2SA 2ZSVB 3TVMB 4P4KC 1I1CA 1A7RL 1FFPB 1JF6A 1JHKL 3DRQA 2SEBB 4HEPG 5IWLC 1E4WH 4RFEA 4XAKE 3MLXH 3I75B 5DFVC 2BDNL 4K3HA 4NO3A 4WI3A 4WWKD 3Q1SH 2RBLA 1J8HD 3ALXA 4HWEL 4MA1B 2KUTA 1KPUB 2F5BH 3LB6C 2UZXB 1I1AA 4H88L 1BQLL 4Q58C 1HYSD 3ELAT 4KK9C 1AP2B 4U31A 3MLWL 2KBGA 2AJXL 3C60A 3MV9B 1IGML 4R26H 3MRDA 5DC0A 4P9HH 5I16A 3AS0A 1C5DB 4Q6IC 3RAJL 2X4QA 3UDWA 3UTZB 4F57L 1MIEL 5EBLA 1X5JA 4Y16D 3HE6C 4OZ4A 3F7PC 4LCYA 3T2PA 4K8RH 3QEQE 2HMID 4BZ1L 1EAJA 1PG7L 5C09E 1ZE3C 4KWUA 5D1ZD 1MEXH 1XF2A 1I85C 3C5ZA 3FRUB 1XH3B 3QIBB 5HVFB 2FATL 5DLMH 2CDFA 43CAA 5DQJB 3WO3B 3NA9L 1OAZL 1I8IB 1CFTB 5HYIA 4I18A 4UDUB 1F3DH 3CUPB 3H9SE 4R8WH 4K9EH 4KVCL 3U4EA 2XZZA 5E5RB 3RL2A 2ICCA 2Z8VC 1RHHB 3VXSB 4HQQL 1EBAA 5ANMA 5SWZB 3ULVL 5TDOA 2GUOB 5JW5B 5JHDE 2P7TB 2Q8AL 2E7LC 5FO8B 2WANA 1V7MH 4NZUH 4QOKD 1OWWA 4PIRF 3TV3H 3VD5A 1NSNH 1DTUA 1ZAGA 3P2TA 1F3DJ 3VXUD 1FLRL 3G04B 2AKRB 4LPXA 4WTZG 1KNOA 4QKXB 5I74B 2VXVH 3KYAA 4LLQB 4AIXA 1YMMB 1C5CL 4ODHH 4D94A 3RHWK 3VWKA 3ULUE 1ZEAH 1HEZB 3F12B 4D9RD 4F80A 2JJVA 2X7LA 3GSVB 2J4WH 3W9EA 3BT2H 3NN8A 1R3IH 4DEPB 4NKDB 3WXWH 4G7YH 1QNZH 4Z7OE 3CK0H 3T1WA 4HSQA 5J11C 3MA7A 5I8OL 4WW2A 2CR3A 2QADC 1MWAL 4NO3B 1HH9B 2VQ1B 1UB6B 5J56B 4E0RB 4YAQA 4JFHD 1MH5B 1GGUA 2HTLD 5GGSY 4Y88A 4QRRD 4BH7B 4XCNB 1MAJA 4L1DA 1PY9A 1RULH 2AEPL 2X2YA 4X9GA 2DQEL 4J3XA 3MRDB 5TPWL 4LL9A 5FKPB 4HDIA 1N64H 4ODXB 4HAGA 5CAYB 4FOMA 4MDJA 5J06A 1CFQB 1UWXH 4GXVL 4P4RA 4KI5C 7FABH 2Q86B 1CL7I 2F53A 4I3RH 2DM4A 3QP3A 5EO9B 1NDMA 5E94B 1G6RB 43CAB 2CRIA 4IIQA 2GJ6D 4K2UH 3QH3A 4I18B 3S7GA 1CDHA 2I24N 3DLQR 3VJ6A 3ZHKA 4D0DB 1QRNE 2VL5B 2VC2H 1X4YA 4QGYA 5ANMB 3MZGB 5BVJB 3LEYH 1KN4L 1WEJH 4ODUB 5JXEA 3G6AB 1G7IB 4JEGB 2EDFA 1L9NA 1M7DA 3VFWB 4M43H 5I1LA 4LSTH 1FGVL 4JO2L 3SE4A 1ZT1B 3BGMA 3QULA 1U8KB 1MFEH 3UEZA 1ROWA 3V5KB 2PW2B 5DRXA 4YLQT 3KHOA 2WUCH 1L7IL 2VLLA 3GMNB 1TFHA 5DWUL 5D9SB 3P73A 1JGLH 4OBRA 4CDGC 5DHVB 1YNLL 5HHNA 2X7LB 5HHOE 3N9GL 1KCRH 1T5WA 2F9BT 1P4LB 3QDGE 3VXTB 5TGBB 5EBMB 3F7YA 2YRLA 4L4VE 1EJOL 3FFDB 5T3ZD 5L9DH 2G75B 4LCWD 2LU4A 1CDYA 2HYMA 3G6JA 8FABA 5LGJA 1T2QL 4NQVB 2BVQA 4LPUA 4NUJB 4QGTA 5GRYA 4E5XB 5B4MD 1IKFH 3VRLF 1S5IH 5IMLA 3WLWD 1CXHA 1RUAL 3F58H 4OLZH 1NGYA 1CL7H 4GJTB 2AK4D 3GBNH 4Q9QL 5IB4B 1D9KB 1LD9A 1MVUA 2A77L 3MNZA 1HKLH 1OM3H 3JV4A 3ARFB 2QHLA 3ILQD 4Y2DD 1MY5A 5CP7B 4PP1D 3BAEL 3TJEL 1DLFL 1NDMB 2GSGB 1QKZL 1EFXD 2QKIA 3P4OB 4L4TB 1MWAA 1D5BB 1B88A 1MFBH 3LMJH 1CGUA 1YC7A 3VJ6B 1Q94A 3DYMA 2ARJQ 3QJHB 4OZGE 4YHOL 3MODL 4GRWE 2AXGB 1UWGH 3MRFA 4XNXL 4ZS7L 2CLZB 1M05A 2Z4QA 3L5XL 1IGTA 4LBEB 4NQTA 3WFHA 3QNYA 4OUUA 5E99H 2J6EL 1INQB 2LABA 4J8RA 4GO6B 4NQXB 4Y4KA 5FYKD 3ZT6A 5D1XA 4NFBA 4W6YB 1V7NH 5CBEA 2A2QT 1BM3H 4EOWL 4MMXC 2VZOA 4XNQA 5F44A 3OKNB 4OM0H 2XWBA 2EYTB 2CR6A 3LEXA 1RVFL 4K7PL 4JM2A 3LAFA 5D93C 4HFUL 1MRFL 1JZ6A 5KN5A 5DEGA 3WNKA 4ORGB 5C0GB 4TNWK 4FFZH 3MRQB 4PJ8C 4EN3C 3IDIA 5FF6B 1D6VL 2N7AA 1T5WB 3QIWD 3T0EE 1AO7D 4N0FA 3C6SB 3BKCL 1S7UA 4ZSOE 1B6UA 4AMKL 3Q2CA 3OXSA 1N59A 2VAAA 3G6JB 8FABB 4WTXA 2APVA 1FNLA 2YA0A 5LGJB 1Z6JT 5DA4A 3VG0H 4LHUA 1AR1C 4BFGA 1JTOA 4EI5B 1C08A 1HHHB 2G2RB 1JNNL 1A5FL 2WQRA 4PJAA 2C4XA 3L9RA 4XCFL 3LPWA 5ESQA 2WBKA 1UA6L 5KSBB 4WO4C 3KXFA 4LQFH 4OJFL 3IFOA 3R0NA 32C2A 1O5DT 1NCDH 1U91A 3CZFB 5DJCB 3EYUL 2JCCF 1QBAA 1MHPL 3A67H 4NBXB 4HXAL 3MMEA 1KB5H 3DX8A 4K3EH 4OB5L 4N5EC 3DX7A 1QVOB 4UQ2B 4X7CC 4KY1L 4AG4L 3IDMA 3ZKXB 4HJ0C 4M5ZL 3MREA 3QDHA 2JB5L 1HHKB 3VGAB 5CGTA 4MAYA 2YUWA 3O9WD 4P3WA 2W9EH 2Z4QB 3QDJA 1DEEB 1BQHB 3C8DA 5DJ6B 5HYFA 5KAQG 5LQBL 4Y4KB 1NCBH 1XF5A 1U8LA 1G9NH 4ODWB 2W60A 4PUBH 5DUBB 2MWCA 2X9WA 3O0RH 4N8VA 4AEFA 2XWBB 4YHPB 3ME0A 1FZOA 1RZ7L 2QQNL 1UXWB 4L1HA 4OFVA 1CDGA 5F72S 3H3PH 4UTAL 1KACB 2B1AH 4ZDHB 1QSED 4YC2C 2VDQH 2ZCHL 4NZJA 4L4JA 4M4PA 2B2XL 5DEGB 2Y6SC 2O5ZL 2X4RB 5IBUG 2GITB 2VXTL 3ZDZE 5GRZA 3THML 3VI4F 4Z7WF 2D4DA 1DBJH 4JO3H 5KJRH 1TPXB 2EDLA 2X4TA 4LARL 2P4AB 1XF1A 2J6EA 3DGGB 3SE9L 3LRGA 2VB5A 5L2KA 2J1KA 2Q87A 4XC1H 2CIIA 3LHPH 5EU7C 3MJ9L 4HZLB 4QWWD 3OKEA 4AT6A 4P2QB 4ZAKD 3S35L 2OJEB 3QDAA 5TE4H 3NFSH 1UACH 1DBKH 4LKXB 3IFOB 4GUPB 1CFBA 32C2B 5IR1B 1X5FA 3H3BC 4JCMA 3WHE1 1NGPL 4XVJH 4OTXH 2VDML 4CW1A 4GKSA 4K7FA 3CDFA 4ZUVB 2HTKC 3N1GC 4ZNCD 4RWYL 2PKDA 5IG7A 2AQ2A 1A7NH 5IVXA 3DX7B 1LO3L 1ZS8A 2B1HH 5I9QB 2ITDA 1MCQA 2BNRB 3OAUH 1GIGH 4GW5B 5DRWB 1UQSA 1JYXA 1JF5A 4MAYB 4LHQB 5SX4I 3FFCE 2Q7YB 1V5JA 5DK2B 3QDJB 3VA6A 3SY0A 1E4WL 4XCCH 3DO3A 3MLXL 4FABH 5ALBH 3EOBA 1OSZB 4X83A 5C6WH 4XAWH 1IEHA 3BH9A 5D7IB 3PV6A 5FYLD 3Q1SL 1QYGH 2X4NB 2HP4A 3V0WH 4MDIA 3TM6A 2NY3C 2F5BL 1OAXH 1ORSB 5LJYH 5MEND 5EU5B 3IJHA 3SDYH 3ZZ1A 4PJBB 1EHXA 3OGOE 4R26L 1EMTH 3W0WE 1J0KA 4PJEA 4P9HL 6FABH 3LS4H 4XT1C 1X5YA 2Z31B 3HRZA 3KG5A 3O3BB 5T1LD 1AXSA 5AG8A 4OI8A 1G6RH 1NBZA 5DJ8B 2VLRB 4GG6A 2J8UB 1T66D 2UUDH 3QDMA 4KV5F 5FECB 1DSFH 1QSFD 3MLUH 1RK0B 3V7MA 5JMOC 3BI9X 2R1WB 2PTVA 4UT9L 4NKIL 5DVNA 5FB8B 3A6OA 4NP4H 1MLCA 4HKBB 5F7YC 3VGGA 5JMRA 3TNMA 4R8WL 5CBAA 1A3LH 1ZHKA 4K9EL 4S1SH 1XGQA 3C9NA 5C07A 4PRPA 4WHYH 3BPLC 3QWRA 4GMSL 5E2TH 3SCMD 4QRTB 5C0JB 3JVGA 4APQA 4PGBA 1E4KC 3FTGA 4NZUL 1ZLVK 3QIUC 2YUVA 4MGXA 1SYSA 1T1WB 4HT1H 3INUH 1YUHA 5DHVH 4K7FB 1IGFH 4X7SH 3B9AA 4GRLC 2GT9A 1S7TA 1DR9A 1OQOA 1WLHA 5EO1A 4XC3H 5SX4H 4GQ9H 2VXVL 1ZS8B 2P5EB 4ODHL 2P1YA 3BN9D 2XOTA 1ZEAL 4AYFA 4WCYL 3C5SB 5MP6L 2Y23A 4I2XB 2J4WL 1R3IL 3F8UB 5CUSH 5CJBA 3WXWL 3U36A 3MV9E 3CK0L 2ZSWA 4ETYA 3PNWA 1JPGA 5EZOL 3BH9B 4NRYA 2X70A 3V6ZA 4DOHB 3SDDA 4P3CH 3R1GH 3BP4B 2UVEA 5LGHL 3MYJB 3LIZH 3VGDA 5FYKH 1UYWH 3NMEA 4JFFA 1RULL 1HDMA 5IQ9B 2EIZA 1OTTC 4WI5A 4X99A 3ARDD 1GRWA 2OS7A 3HNTH 1NGWB 4HKXA 4HWZB 1NBZB 3VXSE 4GG6B 5SWZE 1CDCA 2GQHA 3MO1B 3BPCB 2QLVB 2P8PA 2VO5A 1WZLA 4BK5A 7FABL 4I3RL 4JY4A 1NCNA 2F8OA 4HGWA 3T1FB 2MSPA 1FO0L 1OY3B 1JGDA 1MLCB 4DK6A 5C0AA 3DI3B 1HWGB 2HFEA 3BEWB 2VC2L 1I8MB 1YMME 4NM8H 4H0GA 3LEYL 5CJQH 1WEJL 4P23B 4ELMF 5IBUB 1T04B 1HI6B 3JWDH 1CGVA 1CVRA 3BPNB 3FTGB 4WEBH 4M43L 4GAGH 4OF6A 2EC9U 1J1OL 4GH7B 4KI5F 2WBJA 5JUEL 1YUHB 5IFJB 1OGAD 1V3MA 2QSQA 3TZVC 1FNGB 2FJGA 3AS3A 2ZOKA 2BVOB 4OIIH 5EO1B 3DI2B 5EBGA 5GIRB 5KSAB 1NFKA 4XVUD 1JGLL 2GJZB 5J9PA 4FXGB 3UTQB 3M1BA 1CXKA 1HILA 4P2OB 4ZPVA 3FO9A 1VGKA 1KCRL 3UAJD 1S78C 2AJZB 1CS6A 3OR7B 3PNWB 1Q9WA 2FHCA 2ENYA 5KVDL 2IPKA 3D39A 3RWIB 2HVKA 4NRYB 4Y19A 4QHKI 4HK0A 5J12B 4PGCA 2BX5A 1E4XI 2HRLA 2JJTC 5HGAB 4BSWB 4LDOB 2BSRA 3HC0B 2YHGA 3IXTB 4N0YH 1IKFL 1HDMB 4G8GA 4RGNB 1G7PA 1ZT4A 3DSFH 2VYRE 5ENWB 2VDOL 3Q3GB 3A0OA 2VLKD 3F58L 4OLZL 2VABA 5LCVH 1JNJA 1CL7L 3IDYB 4G8IB 3O4OC 3GBNL 4JDZA 2EDEA 1RJYB 2V7NB 1JPTL 4XVTL 1CWVA 1M6OB 3MLSH 1N6UA 3DSNA 5ANME 4PRID 1OM3L 5DGRA 1CTNA 3VFSB 4F3FA 1N26A 5HXMA 4TSAL 1OF2B 2LVEA 5CHNB 5BZWB 4BH8B 4JY4B 3RX5A 1NUNB 1R5IB 1AGBA 4Y8AA 3BW9A 2BY1A 2X6MA 1MFBL 3LMJL 5F3HB 3SO3B 4S1DD 2R0WH 1I3UA 1ZK9A 3CFBA 1RZKC 2DF3A 1NANI 1WITA 4LK4A 1FFRA 1M4KA 3FT3A 3VFGH 3BH8A 4IRJD 5CJ5A 5HHME 3ULUC 3PQYD 3NACH 4J3SA 2IAND 2UVFA 4WHTA 3PL6A 3QAZC 1JWMA 2Q76A 4PJIA 5EU6D 4OV6F 3RGVD 1OP3K 3S36X 4JQXA 5FDWB 1NQBA 2FX7H 1LO5A 1V7NL 4IDJL 2R29H 4RSVA 4UIMA 3QEUA 1FP5A 4OM0L 1EO8L 5KBNC 1A4JB 4S1RH 1QEWA 3EJZD 5KVFL 5C0FA 4FG6C 2Z91A 4JHBA 4NQEB 3D5OF 1Q8MA 4RRPG 4TUJA 5J9PB 3IKCA 3VFMB 1KTLB 3C8HA 1FO0A 3IAGC 3OKYA 1FJ1B 3FO9B 4UINH 4FFZL 1RHFA 1VGKB 1GGIL 3FN9A 5L6YH 4QT5B 3VXMD 4X6DF 4JFOA 3WNNA 4OLYH 2HJFA 5FM4A 1Z3GL 2HVKB 3I6LE 2XA3A 4OBSA 1V3KA 4AIOA 3FO0H 2O93L 4LLDA 4PJDA 4QHKJ 3RIAK 4CN4A 4I77H 1IGYA 1ODAA 4L4TE 5FYLH 5BZDB 4KHXH 2CMRH 3TP4A 4YNYB 2X4OA 3EFDH 1T6WA 4LQFL 3MGOA 1T83A 4U3HA 2DYPA 5IHUL 4Y5VB 5CSBA 4NM4H 2J3SA 2Q8BL 1NANH 4TVPD 2NY0C 4ZD3H 1FL5B 1AGBB 4TUKL 3BQUC 5H94A 2OM5A 4ELKB 2WIIB 3QUYA 4PJCA 3P9LA 3VFRA 1H8OA 3MRCA 4RDQF 4Z77A 2VZTA 3GSNB 2RGSA 4XCYA 2J5LB 4EBQH 1YEDB 2N56A 1ZSDA 1JCKA 1KG0A 2JF1A 1JTPA 4FQCH 3WFZA 3K4DA 1JWMB 1I8LC 4PJIB 5FOBB 4L8SA 1IGCH 2F15A 2NLJA 4PUBL 5HHVH 2IH1A 4LDEB 4B0MM 2FSEB 2OJZH 4B7IA 4KZEL 4NQCB 3G9AB 3O0RL 4ZTOH 2ADJA 1AXIB 4JREC 5C0FB 1ZVSB 4J3OC 3BP7A 1WISA 3G6JE 3DO7A 4ALAH 1A1MB 1BIIB 3H3PL 3IKCB 4KKAC 5DMJB 1FL3A 4Y89A 3OPZH 2VDQL 2CUIA 3O6KL 5HYJD 1RMFH 4P5TC 3MRKA 1TVDA 2NY4C 4LCUA 5LVEA 1MAML 1JV5A 2Y72A 4H8WC 3EGSA 4K8RC 3HCVA 4PY7A 4GRMB 5B8CA 4I9WD 1N5YH 3GMRB 1DQQB 5KSBE 2Z8RA 3QG7L 1NFDA 3KPNA 2ZNXA 3BUYA 4ZUSA 1G1YA 5JIPA 2Z93A 4LNVA 3DUSB 4XH2A 1ZHBA 2ARJA 5JQHC 1N4XH 1NAKH 4IRSD 4XC1L 4FFWC 2DI8A 1TNNA 4RRPA 1X5ZA 3LHPL 3IU4L 2PXYA 5FGBC 2DQJL 1IGYB 4TNVF 1DANU 4JVPA 1XIWA 1TMCB 2NY7L 4HMEA 4W68A 1MRCH 4KRPB 2A1WL 3ILPB 4U7SA 5CP3H 3NFSL 4YPGA 2H6PB 5HVWA 4AENA 5F1SA 5H2BA 2DYPB 2P8MB 5TH2A 2C1OA 3KNBB 4OTXL 1L0QA 4NWTH 1YEEH 4OZHA 4N0CC 4OLUL 5CS7A 4OLWH 1A14H 5GGRA 4U6XA 2B1HL 1MHCB 4Z77B 3BGFB 5E2JA 3F62A 1H15A 1GIGL 4M61B 3KYKH 3RNKA 1WF5A 3AB0B 4O51B 5EBWA 3DVFA 1ZGLM 4Y5XA 2EZ0C 5ERWA 2YRZA 5AWNH 1HINL 1Z0MA 3DMMC 1I7TB 4L29A 4OCMC 1OT1A 3OXRA 4KK5C 4HIIA 4NT6A 4XCCL 4OCWL 2DIBA 5ALBL 1QHOA 2DI9A 4IMLB 4PV8B 2P5WB 1INEH 3HLAA 4L8SB 1MJJA 1J8HA 5IHZA 1R6VA 5D7KE 2IH1B 3V0WL 2E3VA 1EFQA 2YA1A 5HI3D 1BJMA 1NLBH 1OAXL 1A3RH 2H1PH 4WFFD 3G5VA 5D5MF 1F4YH 5DSCB 3WIFB 3SDYL 3O4LD 1EMTL 3QXDA 4D3CH 4X80H 6FABL 2ZG1A 5FKAA 4Y16A 2A9NH 3G5ZA 3S9DB 3WEXB 1NCWH 5CWSB 1FPTH 4P2QE 1J05A 1D5MA 43C9A 4PTTA 5D1ZA 3CFJA 1QLRB 1DSFL 1FFQA 5TQ2H 1LEIA 5JLZA 4ZUSB 1S7RA 3MLUL 2HRPL 4TUOA 1MPAL 3NIFE 4ZXBB 3LKPB 1SEQL 4PJ9D 2AEQH 5ACLA 3EYOA 2PXYB 1R5WB 4S1SL 5T3ZL 1XIWB 1PG7W 4XPGL 1UM4L 1VKXB 4L5FH 4NDMA 1BVLA 1MHHA 4QOKA 1FNHA 4HIXH 2XTJB 1CGTA 4H0IA 1OHQA 1KF9B 5TH2B 5IM7A 2C1OB 3MR9A 4HT1L 3VXUA 3INUL 3QDJE 5GGQH 1MIMH 3QCTL 4OZHB 1KENL 2APFA 4JPWH 1S9VB 2HVJB 2XY1A 4XC3L 3B9KD 3NFPB 4GQ9L 2ICEA 2FO4A 1U8QA 5CINL 1NMCC 1X7QA 5KSVA 1TTGA 5ERWB 3AY4A 1NGXA 2AQ1A 3C09C 4PJBE 4O58H 3CC5A 4FP8H 2PYFB 4UAOC 25C8H 1NMAL 4ODVH 1A0QH 3RUGF 5D7LB 2KH2B 3QG6A 1A6PA 3FMGL 3OKLA 2JJUA 3CLFH 3UTTB 5IT2L 4XXDA 4QXUH 1T4KA 3DVNA 3ECBB 4G3YH 2VLRE 3WNOA 4KJWD 3L5HA 2EXYD 4QYOB 2BC4B 4QRRA 1LVEA 2FGZA 1CG9B 3AU1A 3UBXG 1S9YA 3LIZL 4C56B 5FYKL 1UYWL 1X5KA 3UMTA 3BRDA 4CU8A 5DEFA 3QXDB 2DMCA 3CFEB 5FKAB 4NBZB 1FFOA 3TF7C 3FB5A 3QT2A 3QB7C 1J05B 2IALA 2FHBA 4NRZA 4EIGB 4XBGA 3SKNA 1LEIB 5JLZB 3PWPD 1Z9MA 2BZDA 4JHZA 3EYQD 1S7RB 2M2DA 4Z7UF 1KJVA 4P99A 2GJ6A 4PLOB 1JZ8A 4PGEB 3R06A 1FVDB 4LASL 4Y4HC 5GGSA 2IMNA 2NY6D 3EYOB 4OZIB 3QO1A 2P5EE 4NN5B 1F5WA 4KKBD 4NM8L 4BZYA 1JK8A 1FVEA 1IJ9A 5INDB 5E8DL 3JWDL 2FB4H 5DI8B 4HLZG 1WSST 1NFIB 2VLMD 4GAGL 3BVNA 2UY7A 4L3ED 3MR9B 1N7MH 1QO3A 3HS0A 3TO4C 2XPGB 4ZFZA 4M7KH 4OIIL 3TIEB 5IW1A 3X11B 2YXMA 4DCQB 1GZPA 2ZWLT 1DN0B 2Y36H 1U8QB 4DOHE 4M3JA 1T1XA 1MELA 2E8ZA 1U3JA 3TFKC 1UGNA 4I1NB 4Q0XL 3O11A 1NGXB 5DJYA 2PR4H 4TVPH 1F11A 4MCZA 4Y4FB 4F37K 3C6LA 3OKMA 2IPUG 1H0DB 1QZ1A 5JORB 4PJEE 3IETA 3LKOB 2N7BA 4M7ZB 5T1KA 1LHZA 2CSPA 4LCWA 3IFLH 4XXDB 1YMHB 2Q7NA 2YD5A 3WFDH 5DMKB 1O7VA 4L8CA 3U30B 3T09A 5DJ0B 4YXLH 4Z8FL 4GG6E 1BFOB 1BGXH 3QDME 1P2CB 3VFPB 1ZWIA 5D1QA 3S34H 1G7QA 1YN7A 1U2CA 2OTUA 4HCRH 4OD1L 1NC2A 1QQDB 4H25B 4E41D 4YIQA 3OJ2C 3MBED 4LLYA 2QR0B 1MCRA 1DBAL 4LSPH 4HPYL 1U41A 1EK3A 4G8EA 5F6IC 4XMPL 5F1KC 4PRNB 3MLSL 4UUJA 5CZXC 4U1IB 1JMZA 4Y2DA 1MY7A 5SWSB 1WFOA 2BERA 4KTEL 3TVMC 5LKNA 3GSNH 1BZ7A 3QFDB 1C16B 1EFXA 5CEXB 3U0PB 3S4SG 5JZ7C 4U0QB 2VDKH 3R06B 1FG2A 5DRZA 1FYTB 3WUWA 3VDBA 4BQCA 2R0WL 1DE4A 4UIKH 4WUUB 4U0RB 1QFHA 3TN0A 1AC6A 3VFGL 4MA1C 5SX5K 4KXZI 3NACL 2ICWI 2KDGA 4X6EB 2HG5B 5DURB 5J4MA 4WENB 4J7RA 1I9RH 3H8NA 5K9OA 5FIEA 2FX7L 1TENA 4JDTH 5D6CA 3PWVA 1UADC 2O26U 1EUTA 4ZFZB 1UEYA 1U92A 4DGYH 3TBWA 2HJKA 4S1RL 5E8PB 1Y18A 2VH5L 1MFNA 5I1CL 4OAWB 4HHAA 4KFZC 4HD9A 4CVWA 3HG1A 1JGVL 1OTSD 4LPCA 5IKCA 3STZB 5E5MA 4UINL 3QIWA 2ZCLH 5D4QA 1RJZB 4MCZB 3ULUF 1AO7A 1I7RA 5CGYD 3C6LB 3CX5K 1T0NB 3LQZA 4KPHH 4RGNE 5DD1H 4ACPA 1E4XL 5C2BH 2R1XA 4RGOH 5L6YL 2D7QA 5T1KB 3ES6B 1WBYB 4KKLD 4OLYL 5TDPA 4Z7OF 3HZKA 4GG8B 3DXAD 3CLEH 3ESUF 1X6NA 3LQMA 2WW8A 4JRXA 1J18A 1ZWIB 5D1QB 1B0RA 1KEMH 4XCEA 1Q0YH 1G7QB 1YN7B 2OTUB 3MLTA 1NC2B 5ICYB 4I77L 5HHQB 3V6OA 3OQ3B 1AH1A 5FYLL 3I6GB 4KHXL 2NY5C 5C0AE 5D71H 1JF1A 5I74C 1P5UA 1FZJB 3EFDL 3QJFB 4UUJB 3GJEA 3FB7B 4OF0A 1XR9A 4TQEL 2BSSA 4NM4L 1IL1B 3ARTA 5CEZH 1ND0A 1UM5H 4ZD3L 3D3VB 4DEPC 2FHFA 5DMGC 3GSWA 3BD3A 1KJ2L 3Q6FB 1UVQA 4P46B 2PO6A 4W81A 4YGVA 5DRZB 1FG2B 3UBXB 4O2FA 5CD3A 5ID1B 3OKDA 1TVHA 4FQHA 4PGJA 5ID0A 1S9XA 3KYNB 4EUPB 3O2VH 1INDL 3UJJH 1KN2H 3O9WA 4NQEE 5GGVY 4EBQL 2XFXB 5F9DC 4DUVA 4FHBD 3ZYJA 4P57B 5IMMA 4FQCL 4DGIH 1IVLA 2XG5A 3SDCB 3QUXB 1Z9SA 1AD0A 3C60C 3RKDD 1U3HB 5F71A 1GC1C 1IGCL 1PSKH 5HHVL 1FE8H 3HNSL 4PJGA 4Z7VA 1DQDL 4JPKH 5F89A 3T0BA 2OJZL 4ZTOL 4ZUTA 1FC1A 4HF5L 1Y18B 1H3GA 2O61B 3R4DA 2BHYA 1L0YA 4ALAL 4GXUN 1QSEA 4G6AD 2E6JA 2D31B 2KQNA 3HG1B 1WAAE 3ARUA 3OPZL 4YQXL 1NCAL 5LWYL 2WUBH 4LHJB 1RMFL 2GK2A 1CICB 1NKOA 3LS5H 3LQZB 1YJDC 2FDBP 1XGRB 3IGAB 5GZNC 2AP2A 2R1XB 1MHEA 4HUXB 4PB0H 1N5YL 1FL6B 4I18C 3DROA 1G7HA 4ZOAA 4TNWF 2DTSA 2H2PC 4YFLF 5BW7A 4JY5L 1FZKB 4JN1L 4JRXB 5B3NA 4JRYB 5MERA 3F7RA 5C7XL 4CL7A 1TQCB 3CH1A 4JZJB 5ITFA 5DJAA 4UT7H 2IADA 4ZAKA 5IB2B 4R2GB 2V9RA 3HE7D 1VACB 1MRCL 1TVBB 1LE5B 1CGYA 1E27B 4LOUC 4R4NC 1O0VA 4I5BB 2DQGH 1ZLWH 5FK9A 3MJ7B 3HI5H 1C8PA 3G08B 4F9PA 1ND0B 4NWTL 1YEEL 4QXWA 5BQ7A 3ETBF 4PJIE 4F7CB 2EE6A 4GAYA 3GSWB 4OLWL 1EDQA 3EIFA 2PO6B 5I0DA 4YGVB 4PTUA 5CSZA 1WC7B 3U0TA 4O2FB 4NHUA 3KYKL 1TVHB 3ARGB 4NQCE 4M9PA 4M00A 5EPMA 2AJ3A 5AWNL 1XF4B 3MRIA 2VN4A 4PJHB 1OGTA 5E8OA 4IJ3B 5MHSD 1MI5B 3LKSA 4M3KB 3BJLA 2PTTB 5K33A 2D7OA 4OZGF 4K94L 5D96B 4M6MH 4QF1A 5HGDB 3RQ3A 1RZFH 1INEL 3D18B 4MJ6A 5L0QB 2IAMD 3QCUH 3ZKSD 1U93B 1U3YA 1EEQA 4MNQD 1CXIA 2GFBB 2VIRB 4ZUTB 5IB1A 4G9FD 3BKML 5MENA 3CXDL 2H1PL 1A3RL 1K3IA 3GFUA 3S4SB 1F4YL 5LBSL 5JPNB 3EJYC 4ZFOL 1Q9KA 3S5LG 3ARFC 1IBGL 3GGWA 3P0YH 2IF7A 5KW9H 1KJ2A 3RWCB 3CMOH 4D3CL 3X13B 5CJXA 1IAMA 1WCBB 5T1LA 2A9NL 3D2UD 1VFBA 1AC0A 1MHEB 2IBZX 3X3GH 1IILE 4ZUWA 1FPTL 5IHBA 2OLDA 1QSFA 3O45B 3MUJA 2C3XA 5TQ2L 3FOMA 4PYGA 3K1KC 1A6AB 1FN4A 4QHUA 3V5DB 3QRGH 2V2WA 1AGFB 5MERB 3G9VA 5DA0B 5DK0B 3D25A 1MCSA 2OI9B 4OD2A 3CH1B 1ETZB 1CDJA 3SDAD 1GSMA 3AM8A 1EO7A 3SCMA 3GMLA 4XXCC 1U6AH 5CEZE 4L5FL 4FNLH 1ZT7B 4HIXL 2I60H 5FK9B 3AXLB 2NY2B 1MFAL 4Q97A 4QXGL 3L6FA 2EKSA 1GHFL 4JPWL 1MJ7H 4ISVA 3SGKA 2P5WE 4Q2ZA 1WFUA 1ONQA 2VAJA 5FCUL 1URLA 4HKJB 4I8DA 5CSZB 4MHHI 3VXOA 3CIQA 4NHUB 1G0DA 4MB5A 1UWXK 5EWIL 3I2CH 4MJ2A 5T1DL 1BP3B 5E9DB 5FO9B 4GKNB 5EPMB 1CD8A 3GIVA 3MRIB 3QO0B 4O58L 4HWUA 3VI3F 5E8OB 1M71A 3HPJA 4ODVL 1A0QL 4WFGD 4CADA 4EI5C 5DYOA 4QF1B 4MJ6B 4RIRA 5EOQL 5MEPB 1JVKA 1OAQL 4QXUL 4G3YL 4I4WA 3VFNB 3V0VB 3BWUC 4ZPTA 4JJ5B 5KSUA 1F4AA 1EXUA 5K9KB 4L8BB 1NUGA 1J1PH 2E9WA 2BSED 4PLNC 5MEOB 5F9JA 2A0LC 1BQSA 4I3SH 4OI7A 3GGWB 3TYFB 3O8XA 3ARDA 4O2CA 4U6TA 3AROA 1DBML 4YHKL 3CVHH 1FVCB 1VFBB 3B5GA 4O5LH 1W0VA 5TFSL 2XYCA 5AUMA 2NW3A 1BPVA 1S9WB 5IEHA 3N85H 3CFDA 3ZKXC 2DQUL 3MCLH 2V5TA 3KPPA 3VGAC 4YUEH 3ZDZF 2NNAB 4NNXB 3VG9B 1FN4B 1UH2A 2V2WB 5IVZA 3FHAA 4OKVB 3WS6C 4P4KD 4OZHE 4Y4KC 1GOFA 4LDLB 3RDTA 3MOBH 4WRLA 4ZFGL 1KLGA 5EC1A 4MJ5A 4U6HA 1RIUH 3G5YA 4XBEH 5CEYB 2VZ1A 4BFEA 1A6VL 2G9HB 2FR4B 3V6FB 5I1AA 2FB4L 1UZ6E 4MQXC 4C54A 2EH7H 2AK1L 1IGJA 1RUML 1WGOA 5JIKA 1E0OB 1N7ML 2GSIA 4AQ1B 1KCVH 5D7LE 3LB6D 3VW3H 1MJ8H 1T0MA 2YD1A 1MCFA 4ISVB 4KK9D 3U7WH 2JB6A 3UTTE 1PLGH 5ITBL 4UQ3B 1J8HE 2AABL 2ENSA 5LAXA 2C1PA 3U83A 4F8QA 5ICZA 2FX9L 5HY9A 1FBIH 4C56E 4OSUH 1TPXC 2PR4L 1TETH 3HE6D 3KPMA 4TVPL 5EA0H 1IT9L 1LMKA 4B50A 5HYQA 3VWJB 3NIDF 5ISZB 4CADB 1SJHB 1SYVB 3TCLA 1MJUH 1GGCL 2VDPH 1PFCA 1U8JA 1TCRB 1JN6A 3U1SL 4XPTL 2VJXA 1HHGA 2DQIH 4YXLL 2KL6A 12E8L 4HIJB 1BGXL 4I0PB 1BLNA 4N0RA 2X4SA 3IJSB 3S34L 3MGTA 3IDGA 1CK0H 3L95A 5F9JB 4LEOB 2RHEA 3O8XB 3UC0H 2ORBL 1MCJA 4D0CB 1CE1H 1RZIB 4LSPL 4MA7H 5F7UA 2PW1A 5IOPA 5J6HA 4P0DA 4OZIE 4FMFA 4U6YB 1KCKA 5I9QC 2NW3B 4BFBD 4K23H 5B21A 5IEHB 3ARBA 3CFDB 1A1NA 3N0PB 1P9MC 3MJ8B 4P5KB 3P11H 4MAYC 4EUPH 3O2DA 1TDQA 5ACZA 3JWOH 4QY8A 3WN5A 3KLHC 1KIQB 3EO0A 1IAII 2FECI 3RDTB 2F8XC 3GUTA 3IDUA 4UIKL 4L9LA 3S5LB 1EZVY 1VDGA 3G5YB 2AAVA 2EDRA 1R3KB 2IANA 4N9GA 4PLKC 3L3GB 5IF0A 2QADD 4PY8J 4R0LA 3RGVA 3GSXB 5CIPH 2IGFL 4JDTL 1PGRB 4G5ZH 4WEUD 3H7BA 1KJMB 4HGKC 3ZTNH 2NMSA 4L9DA 2D9CA 2Z31C 2JB6B 5CLWA 1ZMYA 1F90L 2C1PB 4IS6A 4LNRA 2VWEE 2WINA 1G7LB 5E4IA 2XKSA 3PWJB 1CLOL 4JG1L 2JIXD 3FB6A 5EIVA 2H8PB 4KPHL 5DD1L 1LEGB 3SGJC 5C2BL 1IMHC 3VXMA 4RGOL 1YYMH 1AHWA 4KI5D 5EU4A 2AGJH 2DWDB 1ADQH 1U8JB 3IDXL 1N0LA 1B2WL 1BIHA 1HHGB 3CLEL 5FYJH 2YPKB 1R3HB 4LLUB 3D85B 4F2MB 3B83A 2FLRT 1PX3A 3NPZB 5SWSE 3A6BH 3J8F7 3PE9A 1CXLA 2Z92A 3IJYA 2M8XA 3MGTB 5JO5B 5FFLA 4HKZA 1KLUA 4D9QD 3O3EA 4ONGH 2E6PA 4X5WA 1FYTE 2CPCA 3PGFL 1WZMA 5DC9B 3GMOB 4WUUE 2VXQL 4FTVD 3RU8H 1IAOB 2WBWB 3LH2H 3ARBB 1IAIH 4JKKA 1CFSA 3H6JA 1D5XB 3IDJA 5C0CD 1HXYB 1UM5L 2IEPA 5AZ2H 1X5LA 4WDIA 2IQ9H 4JJHA 1RZJH 3BP6B 4EIZC 2GHWB 4AEIH 4LSDA 4JFXA 4TN9A 1CGXA 3Q5YA 1T80A 2XWTA 5AYUH 3GUTB 4G42A 1QA9B 1S7QA 2RCSH 5ADOH 2JELH 3CSBA 4N9GB 3ABZA 5EIQA 3QYCA 3BO8A 5IF0B 3MLVH 1KCSH 4PRHD 4JFEB 4J23A 2MFNA 1W0WA 4G6ML 1IEBB 5EN2A 1PSKL 3QQ4B 4X6CA 1FE8L 4JPKL 3TA3B 4X9BA 3GMMB 4PG2A 3KVQA 3AAZA 3UPRB 3PHQA 3S6CA 4CKVX 3KYMB 5CZKA 5BJTB 4X4XB 4LNRB 4GKOA 4XP4H 3B3IA 4LSSH 4PG9A 2WUBL 5E5UB 4EEEA 2B7DT 2DDQH 4QNPE 4GKZB 3MV8D 2B39A 4BFIB 4YFDB 3RWHA 2L0DA 4M5YH 3QWOB 1F4WH 4PB0L 1JWUB 1BOYA 1AHWB 3OAYH 4RX4D 5CMAB 1H3XA 2A74B 1TNMA 1C7SA 5I75B 1OL0A 5DD6A 1HCVA 4OKDA 3OKKA 3RBGA 2R69H 5J1AB 5D8JL 4ZUUA 1ZXQA 4P23C 3JVGC 4IRSA 2R2HB 4HW6A 2Z92B 3BPNC 3FCTA 3N50A 2XQBL 1F13A 1JPSH 4PRBA 4XRCB 4YR6A 3D1MC 3MV7B 1U9KA 3QUZB 4HS8H 1ZVYA 3E6FA 3O3EB 4PD4J 3ISWA 1HSAB 1EAPA 4NO0D 3BZDA 3TPKA 1F45A 5KSAC 1TTFA 2EDWA 4KMTL 1IC5H 2DQGL 1B0WA 3HI5L 1T7XA 1ZGLP 3IDJB 3H9HA 4XZUB 3HR5A 5I1KH 1SHMA 4FZ8H 3OB0K 4P2OC 5LXGH 4ONFH 3TBSA 5L2JB 2AS5M 1JNLH 3ZE1E 4JFXB 3VH8A 1MQKL 3BWAB 4WO4B 4HIEA 5JW4M 4PJ8D 4EN3D 4PJ7B 3EOTH 4DVRH 2NY1B 3HUJA 5J12C 4Z7NF 2QBWA 2Z8SA 3NAAH 1P4BH 3RNQB 3TEUA 4Y2OA 3HG1E 3HKFA 2NXYB 1HSBB 2H3NA 4M6ML 1KJ3H 3GNMH 1FAIH 2Z0BA 4N68A 4RGNC 3NABH 1S7WA 5DD3L 3T4YA 3REWB 1AR1D 3IDYC 2BRRH 2WWMC 2A9MH 4JPIA 2V7HA 4OZFG 3W9DA 3AAZB 3O4LA 3RPIA 1KYOK 1LDSA 4JRXE 3P0YL 4JRYE 4PPTA 2MCPH 3CMOL 4CNIB 4JE4B 2ICWA 1KLFA 1II4E 3PABB 4WY7H 1F42A 4DK3A 3KGRA 3V6OE 3KPSA 2CDGA 1U8NA 4WGVB 3V8OA 3X3GL 2YPLB 3SO3C 2H2SC 1QFWM 3E0GA 5B39A 1J12A 1MFDH 2EYSA 1N5AA 3QRGL 4PJ9A 3PWUB 3S37X 5L7XH 4HJ0D 3L3IA 4JZNA 3QZWA 2Y7QA 4LFHG 4Z5RA 4YR6B 3WS3A 4S1QH 1JHLH 1X5GA 1DQJB 4MA3A 3ALPA 1J0HA 4FNLL 5EFIB 4RCAA 4LGRB 2CXGA 1NLDL 3RX7A 3ZKMC 2O5XH 4PJHE 1H3PH 1Q38A 3PWLB 1DLHA 1MI5E 5I76A 1WTLA 3B9KA 4HS3A 5DJXA 1Z0NA 2ADFL 3WMSA 4Z7VE 5C0BD 1PY4A 4CVZB 1UH4A 3WHE0 2Y6SD 3JTTA 3I2CL 4RMVA 5IJVB 4HIEB 3B8SA 1CTOA 3O3AB 3LN4A 3RTQB 5DJZB 1A6WL 3BRFA 4XHJC 2AV7B 3VRIB 2ZUSA 1MCLA 3MUGA 2XICA 4WV1A 5I2IA 3A6CH 1IGIL 2ATKA 1LEKB 4M48L 1T5XB 2X1XR 5F21B 3W11D 1MUJB 1EEZA 4OFKA 2MCG1 3FONA 1XT5A 3WSQL 3PP4H 5E0QA 3ZYOA 3BZFA 2DMBA 4Y5VC 4I3SL 2HH0L 3T2OA 1S3KH 4TVSa 2VUYA 4NKOA 4MD4B 4ZNEE 3G6JF 3L1OH 4LSVL 3LQAH 2ICWB 1I9IL 1R3LA 3IAPA 3IF1B 2JK5A 3CVHL 3KPSB 4O5LL 2NX5A 4JAMB 3BJ91 5F1IA 5I1JL 1OB1B 3N85L 3PWPA 1UXSA 2HTKD 5DGQA 3MCLL 2GW5A 1JUFA 2J5LC 4JO4H 4P2CG 4QXTA 4RGMB 1IM9B 4XPAH 2YD8A 5KSBF 3HA0A 1QP1A 5FHAL 2VR9A 5GRWA 4AIZB 4DKFL 5I8CB 4N1EA 1F6AA 4BZ2H 3MOBL 4Z5RB 2CIKA 5T3XH 2W9LA 2A6IB 4S0SD 1G84A 3FB8B 1RIUL 2PYEB 4XBEL 3VFTB 1S7VA 2FH6A 4PJFB 3ARRA 4MS8C 2EH7L 4Z9KB 1YPZB 1BBJA 3KYOA 5A2LH 1PZ5B 1DLHB 4F33B 1KCVL 2NY3D 1V05A 1MJ8L 2V9TA 4EDWH 4HUVB 3NH7H 3QQ9C 2IG2H 5DJXB 1AGDA 4MHHG 3K2UH 5IJKA 1A7BA 3P0GB 3RBSA 3SDXB 1A9BA 4O2EB 1IQWH 1C12B 1F6FB 4EJ1C 3IRPX 1KPRA 4HH9A 5TE6H 1FBIL 5JDSA 1J5OH 4EDXA 1TETL 1R24B 5B22A 5EA0L 1IC1A 3FQUB 3CSYB 2IFFH 5C2UB 4QHMA 1MJUL 1J0ZA 4WV1B 2BVEA 2VZSA 3HHRB 2VE6A 5DJDA 1BD2B 5GGTH 3K7UA 1RUQH 4KDWA 3UCRA 5F7FA 4BQ8A 1XMWA 2M26A 4CMHB 4KRPC 3C5JA 3BZ4A 5FGRA 4MNGA 2CGRH 1FSKB 1ZHLB 2ERJC 1H8SA 1T83C 1CK0L 3BZFB 4RAUA 4E41A 2I9LA 1YYLH 4JFPA 3MBEA 2EDJA 3DOSA 2YC1B 4NKOB 1T7ZA 5BS0A 1CE1L 1FC2D 4UV4H 4MA7L 3ZDXE 3QIUD 3QUYC 1LNUB 4IRZL 2I5YH 2LE9A 2NX5B 5I1DA 1CF8H 3DGCR 4K23L 5F1IB 3OKOB 1C5BH 1UXSB 4GRLD 3JUYA 1JUFB 4RMQA 4NJ9L 5BCAA 1YEIH 3P11L 4YHLL 4MXWH 3JWOL 3U9UA 2AV1B 3QI9B 3QHZH 4OZFB 2HKHH 4HMCA 2OTWA 4OGXH 4HH8A 2X1WL 2ZG3A 5GGVL 5SV4A 4L8SC 3VFOA 3ZHDA 3RVTC 4AEHH 1D5ZA 4P3DB 4UV7H 4POZD 4OM1L 3PGCB 4YEEA 1LO4H 2W65B 1TJGL 2P8LB 1S7SB 3VE0B 2C3VB 4HC1H 2EH8H 2GJJA 4XNYH 5ISZE 3K8LA 3SBWA 1J7VR 3CVHA 5IP4A 4JPVH 5JHLH 3MRGB 1AGDB 5TF1L 3MNVA 4G6FB 4DFIA 3F7QA 3PUCA 1EEYB 3L5IA 1HQRA 3HC3H 2JJWA 2CKBH 1KPRB 5D7IF 5C8JB 3EO9H 2ESVD 3WO4B 4ZFFA 4X4MA 4ZXBC 3I6KB 3I9GH 2XY2A 4QHMB 1FHGA 1YYML 3JTSB 1XFPA 2VE6B 3EOAB 5M7QA 1ADQL 2DQCH 4PJBF 5DJDB 2PXYC 3DXAA 4F37F 1XIWC 1PYWA 3LZFH 4AH2A 2VITA 1DL7L 4M6NL 1P5VA 3WD5H 1UZ8B 5I0ZA 1AJ7H 4D8PB 2DM2A 3TBYA 2XTJC 1RJLA 2J8UF 3TYGH 5HDBF 1YA5A 5E2WH 4HIHA 3EO1B 1SVCP 4ONGL 1LE9A 2VDNH 5BS0B 5A2KH 1KIUA 3BHBB 1SJEB 2B20A 3GKWH 4Y5YA 5IFAL 3TESA 5CLTA 4HUWA 3G5XB 5I1DB 2X1QA 4P2YA 3TZVD 1IAIL 2FECL 1ZGLA 3IXAB 4NFDA 5FA3B 4OD3H 5AZ2L 3VFVB 5T3XE 3BKYH 4YXHH 3U6RA 1RZJL 5SWQB 2JJSA 3DRTA 4AEIL 1NUFA 3LKNB 4JCLA 4U1NA 2OTWB 5AYUL 1K8DA 3VFOB 3HN3A 3DIFA 4DKEH 4LRNH 1OARH 3MLPA 3FJTA 1S78D 4ONHB 4LCCB 5T5FH 5JR1H 2RCSL 1NC4D 2JELL 5ADOL 3MRBB 1A6UH 5JHDB 4XP1L 1LO2H 2V9QA 3FQNB 2VZVA 5BO1L 3GJFH 3TLRA 3QEQD 3B5HA 5HJ3A 5IB5B 1GYAA 2A73A 5C09D 4G7VH 2AQ3A 3NGBB 3KPQA 1AXTH 1LP9A 1QLEL 2MHAA 4C57C 4KKNA 1CFNA 3O6LH 1XR8A 3H9SD 4XP4L 3U7AA 4LSSL 4LSUH 5HI4C 4IOFC 3NCYS 2VDLH 2DDQL 3CSGA 5JOFA 1FGNH 3GSOB 1CE6A 4ZFFB 1AY1L 5ETUA 2VLJD 4M5YL 1F4WL 1F6LL 5BRZA 2XZAH 4FS0A 3NCJL 4C83B 2I9TA 1BJ1J 3PXJA 1WICA 2R69L 2XWJB 4GAJL 4AH2B 5MEQB 2FL5A 1QFUH 2C4FU 5CIPA 5ACMA 3WXVL 3MRRA 4AL8H 3SKOA 4OQTH 5KAQF 1JPSL 3FQTB 4MXVE 3RWGB 4GG6F 1DCLA 4HIHB 3HE7A 3ULUD 3RGHA 2H9GA 3LV3B 1LE9B 1WBZA 2D7NA 2EYRA 1WVZA 5DT1H 4Y5YB 4HFWB 2HLAB 3QEGH 2CO7B 4KQ4H 3MXVL 4NYLB 3O3DB 3WIIH 3UYOD 2EIBA 3CFCH 2IBGA 5HDLA 2DTMH 4DUXA 5LXGL 5IUSA 4FG6D 1C7TA 4JFEE 4ONFL 4Y4FC 1M7IA 4C58B 2QTEA 1FV1B 1JNLL 1TCMA 3EAKA 4K3JH 1ADQA 2E7CA 2OX5A 3DTXA 4W4OC 2DLHA 3NPSB 5DO2C 4HWBA 5TDNA 1QRNB 3EOTL 4DVRL 2QSVA 2F5AH 3U30C 3GMQB 4A6YL 2D03H 4X5XB 3U46A 2VWEC 5DTFB 3M8OL 1ZLSH 5JDJA 3KR3H 1SJVA 2JCCA 2LV4A 1GGYA 5H37H 1KJ3L 3GNML 3BIKA 4MD0A 3NABL 4XMLH 3QXAB 2EDNA 1I3RB 1ZV5A 4LQ1A 3OAZH 1DQLH 1KV3A 4G9FA 3QUKB 5GRVK 2A9ML 1X9QA 1N8ZB 1LP9B 4JFDA 3EYVA 1BVKB 2FO1A 3WL9A 1CN4A 1ZANH 4AM0A 3QQ3A 3EDEA 3VD3A 4KJPD 3F5WB 4WY7L 3D2UA 1KEGH 4FQJH 2Y5EA 3QDGB 3MV7E 5GGUA 1D7FA 1F3JB 5BRZB 4U1HA 4Y1AA 4MCYB 5HHPA 2NY0D 5B38A 4F9LA 4HV8A 4WFEE 3BQUD 5CD5C 4U0RC 1WFNA 4R4BB 2FL5B 1FZMB 1YC8A 1ZHNA 4MB4A 3SE8H 2AJSH 3SDAA 3VFUA 1CLCA 4LF3A 2GY5A 2VR4A 4S1QL 3KLSA 1WBZB 5HHOD 2BJMH 2CK0H 3DX6B 1NBYB 1JFQL 3L7FB 4FFYH 3QQNA 4GW4B 4L4VD 1VGEH 4PS4H 4OLXL 4RISL 3CDGA 5EOTA 4CU7A 2I25N 3C6LC 4HUKB 3VXRD 4KKAD 4OGAC 4XNMA 3BDYL 1HNGA 1PQZA 2D0GA 5C08B 1YY8A 4P5TD 2NY4D 4UTBL 4K8RD 3EDDA 1UJTA 2Q6WB 3OJMB 3BE1L 5D1QC 3B6SA 1T2JA 2EXWC 4Q74A 3P77A 1B9ZA 3B2UC 3A6CL 2BMKA 1N6VA 4RBPK 4URTB 3SO5A 4I9WE 5BV7L 1IAKB 3FN0L 5JA9A 3UZQA 2OL3B 1PD6A 5E1HB 4FFWD 3PP4L 1E28A 3T04D 4JFDB 3T4AA 5I15L 1V3JA 5F7DA 3WL9B 3GRWL 4AM0B 3CNKA 4MWFB 4UZGA 3L1OL 5EZLB 1EHLL 4P46C 4RZCA 1WAAF 3T0EB 4QRQA 5HI5C 4Y1AB 2FZ3A 5HHPB 2EIEA 4MQSB 4OZFH 4A6YA 1DUYB 1UM6L 2GCYB 2H32A 3TN0C 2EE9A 3E6HB 3K46A 4JO4L 1K4CA 3MROB 2DL2A 3QSKB 1IEAB 4KAQH 4XPAL 1U8HA 3NA4A 2R8SH 3IU3A 3LCYA 3R8QA 5D7SH 3PJSB 2EZ0D 1E4JA 1UCBH 1QFWI 1U3HC 4J3TA 3DMMD 3WE6A 1RURH 4GAFB 3ZDYE 1JZ7A 3NFNA 4KK5D 3HI1A 2VISA 1J8KA 2P24B 3P4NB 2BVTA 3HUJE 1S8DB 2QSTA 2EC9T 2FYYA 1X5XA 4Z7QE 3OG4B 5FEBA 2VOTA 4UNTA 2FJFA 4X0KA 4HBCH 1CICC 4EDWL 1KSRA 2IG2L 4WHDA 3K2UL 3RRQA 4N0UA 2MQCA 4PJIF 1MNUH 4Q6IA 4WFFE 3PGDA 1NAML 3FO2A 1U8MA 3T8XA 5TE6L 4D0BA 1J5OL 1G7JA 5GSRB 5JNYB 1RZ8B 2FJHB 1LK2B 3FOLB 1YDPA 2IFFL 3B6SB 4X6BB 1I85A 1TQCC 1G7MB 1UH3A 4JZJC 4Q6YA 2BMKB 2D0FA 3GIZL 3S88L 1RUQL 3V6OC 4KHTH 3KPSE 1CGWA 4R2GC 3RIFK 4NOBA 3BP5B 1SM3H 1NCCH 3CPLB 4KJYB 5F3BA 4YHMH 1NJ9B 2CGRL 4ODTL 3TBTB 3QCVH 1KGCE 4PGZA 3PHSA 3C09B 2HLFC 1YYLL 5F7DB 3DARA 1CLYH 4MX7A 1H5BB 1QLFB 4F7EA 5EIIA 5B3JE 1DDHA 4L3CA 1NGZA 3C2AH 4RZCB 4S0TD 5IVOA 4DZ8A 4WI4A 4CJ0A 4YEFA 3SPVB 2PO6C 3SOBH 3ARGC 5D70H 1RY7B 2LTQB 1QFWH 2X44D 3QFJB 1YEIL 4MXWL 4LP5A 1K4CB 2CLRB 4IJ3C 3L3DB 3PV7A 3OZ9H 3OR6A 4KMQA 3QA3A 5D96C 2HKHL 1LWRA 4I13B 4OGXL 3I3BA 5DXWA 5L0QC 2NXZB 5AYQA 1JNHB 1U8OA 2QQLH 3NFNB 4WJ5A 4UV7L 3SDXE 4B53A 5I66A 1J10A 3L7EB 1K8IB 1QSVA 3K74B 3MRJA 1HE7A 4F7TA 4MJIB 5F88B 5HPMA 1LO4L 5CCKH 2IH3A 2P49B 1RZKH 2GKIA 2YD2A 3GRWA 4U1MA 2HA1A 4BUGA 4HC1L 2WM0A 4TSCL 1YEGH 3IFNL 5F97E 3AREB 2RFXA 3ARXA 3GSUB 4NO5B 1K2DA 3STLA 4V1DD 5JHLL 3CGTA 5FO7A 4LPVA 3DX9B 5EULV 2CKBL 4ELMA 1JHTA 2ILLA 1MF2H 4WU5A 1U8MB 2JIXA 4FQ2H 4H1LH 1QBMH 2ZUVA 1G7JB 1QRKA 5TJWK 5ABDE 2EIDA 3EJJX 4FA8A 3I9GL 1I9JH 1YDPB 4XPBH 3DBXA 4Z95H 2OI9C 2FH8A 4YFLI 1KTRL 1GGBH 1JI1A 3ZTJH 2XKUA 1AQKH 2WLZA 2C9AA 2NX5E 3LZFL 2OSLB 4OV5B 4TRPL 3MOAH 4YDKH 5KANI 3WD5L 4Y4HD 3BKJL 3FT4B 1UJ3B 4NOFA 1K5NA 1S5HB 3TYGL 4NUGL 2NY2C 4N90E 4F9PC 1U95B 1CVSC 1FNEA 3RVUC 1CD1A 3T2NL 2VDNL 4Z78A 3PDOB 4GBXB 3L3KA 3HMXH 4GLRH 3FFCD 1Z5LB 4DZ8B 3GKWL 2XN9B 4FTVA 3JZ7A 3VA2C 3MV11 3TO4D 1NAMA 5C0CA 4ENEC 4R6UA 2IMMA 2K1MA 2F54A 1Z9LA 3FQRB 3BKYL 5I1HH 1BHGA 4YXHL 3RI5K 3SJVB 4BSVB 3HMWH 3TFKD 4U1JB 2Q3AA 3EDKA 1RV6X 3L3HB 5EUOA 1TJHH 3O6FB 3MX0A 1OARL 2LAGB 4YX2L 1AD9A 3W0WD 4KU1A 5JR1L 4OZHF 4Z76B 4PP2A 3VRJA 3LVEA 4NCDA 1KC5H 3LN9A 1HZHL 1LO2L 2IH3B 2CUHA 1I4FA 3BEVA 1HXMA 2BNQB 2X4PA 3KPTA 5E56A 2RFXB 3T3ME 2DQHL 4CMMA 2YSSB 1XGTA 3T77A 4G7VL 3VU2A 1K2DB 4PJ5B 3ET9F 4KK8C 4MXQC 3U2SA 4NQDA 4XPHH 3GKZA 5FUOH 1JBJA 1SEBA 2A6DB 2UYLA 5KZCB 5MI0C 3O6LL 1JHTB 2WIMA 2Y5TB 4HX1B 3MV8A 2VDLL 3O41B 4QCIB 3TPUB 4N8CL 4MA8H 4E41E 3L5WA 3VG9C 5CZXD 2PNDA 4RX4A 1L0XA 2X4UA 3FZUC 4DQOH 2ATPA 1UWEH 3TVMD 2XZAL 3DETC 5BS0E 2GAZB 4EI6A 4OIBA 2FGWH 1OD9A 3UPCA 5JZ7D 4H8WH 2GEEA 4DW2H 4NNPH 5FYJU 5IIEA 4HBQA 4M8QA 4HC1A 1P84J 2ZKHH 1ZA6B 2YEZA 1K5NB 3I02B 2X5PA 1W72H 2OQJA 1DANT 1W0YT 1T22A 3RWFA 3V79C 4NO0A 4Z78B 1R5VA 1SMAA 3SGKC 2DQDH 2E9IA 1FQ9C 1HH6B 4KVNL 4J3UA 5DT1L 4E42B 3QUMB 3MV9D 4NSKA 1AQDB 4KDTA 3WIIL 2FIKB 4OZIF 5H35B 1A1OB 4EVNA 2F54B 2DTML 5EC2B 1T89C 4J4PA 2AERT 3CDYA 1MCWM 4HS6A 5F7MC 2F74B 3GZKA 1I8KB 4GRWH 3VWJC 4K3JL 5E8EB 2R56H 1FORH 4PJ8A 2ZZUT 4EN3A 1KELL 1KIRA 3HPLA 5EUOB 1RU9H 4F7MB 3QIBD 3PP3K 1BBDH 2R1YA 3FAWA 4MSWB 2YKLL 3V52H 4X7TA 4IHOB 2F5AL 2IFGA 1LQSR 3LSOA 4I0PC 5HVGB 4S2SB 2D3VA 5GS1A 3KR3L 4X6FA 3WFEH 4OCXL 3VXSD 4PJXF 4X4ME 3O8XC 5SWZD 3S36H 3ARDC 3DRQB 4JKLA 4RFEB 2R2BA 2BVPA 1DQLL 1RIHH 1PKQA 1AI1L 4R96A 1AGCA 4NQDB 5K59E 5AZEH 5TQ0H 1GL4B 1SEBB 2APWA 2DKMA 2GTZA 5AD0A 3LQAC 1ZANL 1I1AB 5I71B 4LEXH 5J13B 3L5WB 1GPOH 1YMMD 2AXFA 3C60B 3BN3B 5J0BA 2P48B 5I16B 3E2HB 3LEVH 3RDTC 2X4QB 1PAMA 4BSJA 5EBLB 3S97C 5DMGD 5HYSA 2I26N 4OZ4B 4LCYB 1QSZA 2V5MA 1NDGA 1OAKH 5IIEB 4M8QB 3SE8L 2EDTA 2UZYB 1XF2B 3C5ZB 15C8H 2F19L 3TIDA 1E6JL 2CDFB 1T22B 5GJTL 4OF5A 1YEFH 3FN3A 1Q9OA 1SY6H 2R4SH 3U4EB 2BJML 3RL2B 2CK0L 5E4EB 3SGEH 5TDOB 1KULA 4LIQL 5E6YA 2DKSA 3KPRA 1VGEL 4PS4L 3MGAA 2OTPA 4R7DA 1JWSA 1JRHI 5C0BA 2VSCA 3P40A 1KNOB 4Z0BH 4XP5H 4LHUG 2R1YB 3NZHH 1VESA 2YUXA 1LP9E 2C26A 5GZND 3VXNA 5K9JL 4YE4H 4YHYB 3VWKB 5HHMB 3BIAX 1OD7A 3LSOB 5GS1B 3OGCA 2C7UA 3D0LA 3W9EB 3NN8B 2DJSA 4I0KA 2W0FA 2CD0A 4MLSA 3KWWA 3MA7B 3P9MA 2R2BB 5BRZE 5IV2A 4P2RA 4KJQC 4WW2B 3BGAA 1A7QH 1MRDH 4XP6L 3D69A 2ZCKH 1AGCB 1WWWX 2OXGA 3HZYA 4XBPA 4YAQB 1MCCA 3SKUD 4G8FA 3UJTH 4JKPH 3ARBC 4OCSL 5A1AA 4R4ND 1T1ZA 2E7HA 1XCTA 4LOUD 3WKMH 2YPVH 5E2VL 2B0SH 4JG0H 3V7AE 3MPCA 4HDIB 2N4IA 2AI0L 4MDJB 5F9OL 1Y6KR 4ZOBA 3REVA 4M1DH 2BXZA 3S3JA 4M7LH 4ZTPH 3U4BH 4P4RB 3OHXA 5D7SL 4CBPA 2F53B 5L88L 2IQAA 1KTKE 1UCBL 4N8VG 3OTTA 3TT3H 4K71B 4LKCA 2Y4SA 4IIQB 1RURL 4NJAH 5C0ND 3RWJA 1ZLVH 4WNQA 3QH3B 1P53A 3EJZC 4JHWH 2CUMA 5C08E 3TA3C 1UG9A 5F96L 1JRHH 4HGMA 1XCQA 5C1MB 2XA8L 3SE3A 5C0DA 3KPRB 5IROC 4O4YL 1M7DB 3ESVF 4HBCL 3IVKA 2YD7A 5I1LB 1D9KD 4R7DB 2YBRA 4JDVA 4CVXA 3EJYD 1TJIH 2HN7A 3NCFB 3BGMB 4Q9RH 3QULB 3ARFD 4PREA 4RFNB 5CILH 1PVHA 1AHWC 3HAEA 5EB9A 2R0KH 1MOEA 5FHBH 5DRXB 5I75C 1B0GA 2VLLB 3VXNB 4JFDE 4L4TD 3P73B 1CU4H 3FQXA 4WUKL 3BMWA 3X12A 5HHNB 2HFGH 1RSFA 2Z35A 4R4FH 3RZCA 3CD4A 3QUZC 1EHAA 2C3HA 3L5JA 4Y1AE 4TOYH 2L7UA 4P2RB 1SM3L 3F7YB 5A43C 5DVOA 1QR1A 5JPMA 3TWCH 1P84K 5M94B 2VSDA 4PRAA 1YQ2A 3D69B 4LSRH 4YHML 4GS7B 3QCVL 2HT4C 1F4XL 4G8FB 4OGYH 2BVQB 5BMFL 4HWNA 5C9JA 35C8L 5JTWA 3FQWA 1E4KA 3RUGA 1T1ZB 1N0XH 1XCTB 4OUOA 3QIUA 4OFYD 1A9EA 1T1YA 2YWYA 3C2AL 1EVTC 5JW3H 4X8JA 4DGVL 5IMLB 5E03A 3RP1A 3SOBL 3LRSA 5DR5H 1NGYB 1FH5H 4GRLA 2HAZA 3S96A 5D70L 2BXYA 3AS1A 4FQXA 4M62L 1X4XA 3VI4E 3ZHLA 1QFWL 1ZA3A 2NY1C 1LD9B 3V5HA 4A2MA 5I6XB 1MVUB 3MNZB 5IESH 2X9XA 3JV4B 2RIKA 4JZOA 2NXYC 1P7QA 2OK0H 3N1PC 3MLRL 1KTDA 1NCTA 2QKIB 2R9HD 3RWJB 1MWAB 1KCUH 3X14A 4WNQB 1F00I 3WIHH 1MLBA 4EI5D 1N2RA 4IDLA 1RZGA 1Q94B 5CCKL 4LVOB 2QQKL 5IW6A 3WFBH 4K07A 2QSCH 3MRFB 1YEGL 1TZHA 1M05B 1IGTB 3ULUL 4XB7A 3WFHB 4J12A 3QNYB 1G0YR 4OUUB 3ZKNC 4J8RB 3IVKB 1DVFA 1IC7H 1VADA 4WU7A 4ETQA 3LN5A 4PJHF 5D1XB 2MKLC 2A0LD 1RUPH 4G43A 5CBEB 4M1GH 3QEHA 4U33A 4XNQB 1MF2L 3LEXB 4FQ2L 1KIPA 1RAMA 2J8HA 3JSSA 4JM2B 5KN5B 1I9JL 4XPBL 3HR6A 2FNBA 2R0LH 3RZCB 3IDIB 3MLZH 4JR9L 2W9DH 5L8LB 1GGBL 5EO0A 4N0FB 2R0ZH 3V4PH 1AQKL 2WSKA 1LDPL 2ZJSL 2EDOA 2PUQT 3MOAL 1BZ9A 1S7UB 2CQVA 4HG4K 5JPMB 1QR1B 4Y4KD 2C3WA 5IFHH 1YN6A 3OXSB 1J1XL 1WBXA 1N59B 2VAAB 3QFJE 2J7LA 4PBXA 2J88H 3QUMH 4OCYH 4LHUB 3JV6A 2W91A 1C08B 1D6EA 4ZYKA 3WNMA 1T1YB 3HMXL 4MQXD 4HMDA 4PJAB 2I07A 5K9QG 3L9RB 3RL1A 5J89A 3TZVA 1Q9LA 3LRSB 3BMVA 5ESQB 3IS1X 5IMOA 2DIJA 4FQIH 1RK1A 4XWGH 4FQXB 4MJIE 3HTLX 3KXFB 4NKMA 2NY5H 2IBZY 3GDBA 5HSFA 5D7KD 1NPUA 1N6QH 1U91B 4MNHA 4ZO9A 3GM0A 1ZOXA 3RTQC 3RWDA 3HMWL 4M7JL 1P7QB 2HT3C 3U7YH 4HUUA 3W2DH 1KTDB 1FNSH 3MMEB 3DX8B 3T3PE 4HULB 1TQBB 3HZVA 3LPGA 4UDTA 3WJJC 1U8IA 3E3QE 1NC4A 4EXKA 3UZVB 1OP3H 5EORH 3FO1A 4P9ML 4XNUL 5I19H 3IDMB 1KC5L 3GK8L 1Z9OA 1DZBA 1K6QH 3MREB 5JW4R 5EZJA 1T20A 4JY6A 4P2QD 1I7ZA 1L6XA 1DVFB 1XF5B 1U8LB 4ETQB 4JFZH 1B6DA 4OFDA 2W60B 3SQOH 2DB8A 1U2HA 4G43B 4XPHL 3QEHB 1GC1H 4X9IA 3H9SA 4JLRA 2WK2A 4N8VB 1FZOB 3CZJA 5F7EH 1I3GH 2PCPA 4KUZH 4RGMC 2VLJA 2BNRD 5EDXA 3RA7H 4DQOL 3IKKA 3GSQA 4L8DA 3VDCA 3ZSSA 4MAYD 3UTSA 2XN9E 5KANG 1YJDH 3HNVH 3QDJD 4H8WL 4K8RL 4M8VA 4DW2L 3RFZC 3KLHD 4NNPL 2DLIA 5IQ7H 4WI2A 2MPAH 1RIVH 1WBXB 4U49A 3I3DA 1MEXL 3RY4A 2X4TB 3SJVE 3IS0X 3ROLA 1W72L 4R97B 5DLML 1TZIA 4PLKD 5GXBB 5L2KB 4UMGA 3OF6D 2LAAA 4PRDA 2CIIB 5EU3A 5IEKA 3RL1B 3STBA 2BHZA 5J8OA 3OKEB 4KK6C 5EUKA 4AT6B 4H1LA 2MOVA 3ZDXF 4CN1A 2Z31D 1V7ML 1T3FA 2A6JA 2BNQE 3NIGE 1EV2E 3TV3L 4MNHB 1NSNL 1KPVA 5GRUH 2VLRD 3DV4A 3RWDB 4CW1B 1RQ5A 3ARQA 4HUUB 2R56L 4GKSB 4WV1C 1EX0A 1BJ8A 5IG7B 4PJ5E 2HFTA 5IVXB 1BBDL 1J0JA 1U8IB 2ITDB 4CMHC 4WI8A 1T21A 1UQSB 2ZUQB 5A2JH 1FSKC 1F2QA 3BT2L 3QPXH 4MD5A 3WFEL 4U1LA 4G7YL 5EZJB 1QNZL 1VERA 3HMXA 3SY0B 4DVBA 3F7VA 3KJ6H 3MJ9A 3EOBB 2DWEA 3NZ8A 5GSVA 3PV6B 5TQ0L 2GYSA 2ZP0T 3KPLA 4MDIB 1AKJA 5ILTH 3BZEA 2LQRA 3RWEA 1YEHH 3LPFA 1MCDA 1F58H 4LEXL 3IFPA 3IJHB 1K4DA 1GPOL 2P5ED 5INCA 2FRGP 4BELD 5I1IH 2CJUH 4PGDA 4PJEB 3QI9C 4L8DB 2NY6C 3LEVL 1NKRA 3B9VA 4B5EA 1N64L 3H42H 3HRZB 5E8NA 3UTSB 4FTVE 1AXSB 2BDNH 2YUZA 3QDMB 4FFVC 1OAKL 5SV3A 2V2XA 2F54E 2JTDA 4H88H 4G80A 4K2UL 5HHOA 1YEFL 1I7UA 4WIQA 3MLWH 3TNMB 5CBAB 1ZHKB 1HKFA 2R4SL 3B43A 3M07A 5EUOE 1IGMH 4M1CC 5DRNA 3ULSA 5IJKC 1XGQB 3C9NB 5C07B 4PRPB 5I73B 4ZQKA 5CKGA 4F57H 4L4VA 3VGFA 2A83A 1ACYH 5DVMA 4APQB 4PGBB 3RPKA 4LSTL 3WO4C 3VXRA 1SYSB 4BZ1H 4R7NA 3Q5TA 2X89D 1P7KA 5D7JA 4DFHA 3WJLA 2FBJH 1MFEL 4P5TA 2GT9B 2OYPA 4XP5L 1S7TB 2FATH 5BXFA 2WUCL 4NQDE 3AMKA 1OAZH 2ZUTA 4YE4L 5JIHA 4EZMA 3PIQA 1HWHB 1T21B 5DS8A 7CGTA 3MV8E 3U36B 4QRPA 3QWRD 2MKWA 4FXKA 2Q8AH 2ZSWB 4P23D 5DDHA 5E6IA 1JPGB 1A7QL 1ZTXH 5L9DL 2ZCKL 2X70B 3T0DA 1FLRH 4RAVA 3V6ZB 1AKJB 5ICXA 3SDDB 4JKPL 4UU9A 4YDIH 5F6HJ 4OZGA 5KSAD 4JFFB 5INCB 2YPVL 1U8PA 2EIZB 1S5IL 2DOCA 4X99B 4JG0L 4HJGA 3R8BB 4JN2A 3MLYH 4P2OD 5DD5H 1X4ZA 3UTPD 4HKXB 4LCCC 4B7LA 4M7LL 1HKLL 1JYWA 4LLVA 4ZTPL 1SVZA 2P8PB 4HGWB 2YOCA 5J6GA 3T0XA 1G9EA 4G80B 1JGDB 1I7UB 4MXVF 5C0AB 4ODSH 5F8QC 1J0YA 2HFFA 3KDMA 4JHWL 2AEPH 3BOVA 3NGBC 5JA8B 1JRHL 2DQEH 4JRWA 4X9HA 2HFEB 3KAAA 1EO5A 4RGND 4ZQKB 3VXPA 4LRIA 5EH1A 1UWGL 2A83B 4XI5C 3L3OA 2VL4A 2FEDC 3U48A 3DYOA 4IOIA 4UB0H 5CGYC 5E99L 3KS0H 2DMKA 4GXVH 5I8EA 4NPYA 2VR5A 2WBJB 5D7JB 3IT8D 4QO1A 5CILL 4M7ZC 1BM3L 2FJGB 2ZOKB 2QQQA 5D6DC 5FM5M 3TNNA 1CU4L 3M1BB 4H5SA 2H2SD 3LKQA 3KS0J 1HILB 4ZPVB 4R4FL 2CKNA 5DHXB 3CJJA 4QRPB 1GJIA 3H2WA 3ZL4H 2J12B 5E6IB 5F7NC 2CO6B 1Q9WB 3TWCL 1UB5A 3EKCA 2IPKB 3D39B 3TO2A 5HD8C 4LSRL 4Y5YC 3GO1H 4Y19B 4RAVB 4HK0B 3WHXA 4OGYL 5BOZG 4PGCB 1OP9A 3VG0L 2BSRB 1L7IH 2F53E 1WT5C 4NQED 4G8GB 3ZKMD 1G7PB 5JW3L 2BY2A 1YNLH 1ZT4B 4N8PA 4X7FC 4N5UA 3CFKA 5DR5L 3TH3T 2VABB 3NPSC 3GMPA 4JDZB 1YQVH 4DN3H 1OWRM 5E1AA 3T65A 5IESL 2H26A 1NCDL 1EJOH 4F3FB 3KPRE 3W39A 2OK0L 1XGPA 1T2QH 3A67L 4YK4C 4K3EL 1KB5L 1D3CA 3BW9B 4KGLA 4WI7A 1KCUL 3BIBX 3JWNC 3WIHL 4NWUH 4XHJD 1MAKA 3KDMB 3CFBB 3BX7C 1AGEA 3VXPB 3FT3B 3BH8B 3WFBL 2QSCL 3MCG1 3TGXA 2W9EL 1A7PH 4PJ7F 4WHTB 1YY9C 3PL6B 4DZBA 4LP4A 2Q76B 4V1DA 1IC7L 1NCBL 1HN1A 1G9NL 1LO5B 2APBA 1CCZA 2UZIH 4TTDC 1I1FA 3BAEH 4YHNA 4P2RE 4UIMB 3QEUB 4XGZA 1HHIA 1HCFX 1QEWB 4DWHA 3ULVE 2Z91B 3P4MA 1G9MC 3G6DH 2R4RH 4TUJB 2B1AL 4XTRC 5F1OB 3ZKQD 3ZSTA 1FO0B 2VDRH 3MODH 2A6KA 3BD4A 3MLZL 4XNXH 2OXHA 4FZEH 1ED3A 3L5XH 3V4PL 3MRNA 1ZLUK 4RQQA 4WTWA 4JFOB 4YDVA 3QNZA 1UB5B 1A6ZA 2HJFB 1R3JA 1N3NA 2E5EA 4JO3L 1DBJL 5KJRL 1YNKH 4EOWH 2DM3A 2NCMA 1HQ4A 3HZMA 4OCYL 4KDVA 4NQCD 4LLDB 3MRHA 4MS8D 4PJDB 4MJ4A 4PR5A 3FFCA 4P59H 3TO4A 3E1F1 4QHNA 1YZZA 5TE4L 4XWGL 1UACL 2NY5L 2HJLA 2X4OB 3QQ9D 1JGEA 2X05A 3QRFM 1DBKL 3B9EA 1RPQA 2ERJB 3MGOB 4XHQA 1A6TA 4K3DH 1N6QL 4XVJL 4AMKH 1KB9J 2Y1VA 3U7YL 5SX5H 1BF8A 5AAWA 1FNSL 5T1MA 4AY0A 5H94B 1A7NL 2RJMA 1EGJH 3QUYB 3DUUA 4PJCB 3TH2T 3P9LB 3VFRB 3MRCB 4JVUA 3GB7A 4TTGA 1JNNH 3OAUL 1A5FH 3C08H 1CQYA 4IBLT 4XCFH 1K6QL 2EC8A 4XCYB 1OQXA 2OBGA 1BMGA 1WCQA 1KFAH 1ZSDB 1FNAA 4KRPD 1KG0B 2YD4A 2YN3A 3B9DA 1H3VA 4FABL 2PTUA 4HZAA 4POYA 4WWKA 4XAWL 2DYPD 4Z7QF 3EYUH 3T0EC 3GI8H 2IPTH 2NLJB 1QYGL 1VA9A 2FEEI 2HT2D 4HXAH 3QXWA 4OB5H 2ADJB 2GK0A 5F1NA 3BP7B 3HB3D 1QTYT 5F7EL 4HUNB 3DO7B 5CFHA 2NTFA 4KUZL 4NQSA 2G5BA 4AG4H 1FL3B 3TVMA 5CEZD 4LGSB 3MNWA 1KB5A 2JB5H 3LS4L 3F65A 3MRKB 4YWGH 4LCUB 1OP5K 3SDAC 1JV5B 2AJUH 4PJAE 4YJZL 3EGSB 5D2LA 3HCVB 2SEBA 4PY7B 5B8CB 1YJDL 3CX5J 3I75A 1G6RL 5IQ7L 4JKMA 2MPAL 2PETA 1NFDB 3KPNB 3KXFE 1RIVL 2P5WD 3BUYB 3RVTD 2Z93B 3CU7A 1HQ4B 3T08A 4XH2B 1KPUA 1ZHBB 2ARJB 1WFTA 4YBLB 3MRHB 4NP4L 4ZG1A 1RZ7H 1K9TA 1AP2A 4PR5B 2ZUXA 1DUZA 2B8OT 3QHFH 1A3LL 4LSQH 2O5YH 3MV9A 5FV2A 2ZCHH 3OG6B 1Z2KA 3ZYZA 2O5ZH 5E2TL 3SQBA 3UTZA 4NO2A 5BOPA 1Y6MR 4YPGB 4AENB 3D9AH 4ESKA 5H2BB 4WHYG 4PJFF 5GRUL 2GTWA 4BQ9A 4F15B 2Y06H 1IGFL 3FRUA 4X7SL 1YPZF 3QIBA 4LARH 1L7TH 5GGRB 3DUUB 3RI5F 5DQJA 4U6VH 4U6XB 1EZVX 1I8IA 1CFTA 4ZXBD 3QXVA 4UDUA 4P49A 1H15B 3RNKB 5EBWB 2DS4A 4Y5XB 1ITBB 3RJDA 2PXYD 1RHHA 3SDXF 5CUSL 1XIWD 3S35H 3VXSA 1TLKA 1LO0H 2GUOA 4L29B 5JW5A 2P7TA 3OXRB 4HIIB 4NT6B 1H5BC 5FO8A 2XTJD 3HLAB 1NGPH 3P30H 1MJJB 1CI5A 1J8HB 5IHZB 3G04A 2NQCA 2WLYA 4P3CL 5CJOH 3R1GL 2MQ3A 2CDEA 2LTQC 4LLQA 1LO3H 1F58L 3WUWG 4WI6A 1YMMA 3G5VB 4NQSB 2G5BB 1HEZA 5I1IL 2CJUL 3MNWB 1KB5B 3GSVA 5L2KE 4NKDA 3BPOB 4Y16B 5T5NG 2NXZC 3H42L 3QNXA 5D2LB 3G5ZB 3ZLQC 3HNTL 3V6BR 1BF2A 3SGDI 1IAIM 1D5MB 3CDCA 5D7LD 3S3PA 43C9B 4PTTB 1I1RA 3CFJB 5D1ZB 4X9FA 1HH9A 2VQ1A 2HWZH 1UB6A 2K7QA 2I27N 3UTTD 2FIRT 4E0RA 1MH5A 4I3GA 4TUOB 2EO9A 4AZ8A 2VXUH 1R0AH 3AREC 4BH7A 3QXTA 4XCNA 1DUZB 2W59A 2UWEA 4C56D 3FRPA 5IVXE 3E3QC 3CXHK 5ALCH 5FKPA 4ODXA 2AVGA 4NO2B 5CJQL 3CSPA 1BVLB 4NDMB 1MHHB 1ACYL 4QOKB 4UNUA 5IHLB 4M6AA 1CFQA 4MB3A 4WEBL 3UJIH 5IM7B 2GTWB 3VXUB 4XWOC 5E7FA 2Q86A 5I18H 1U42A 2FBJL 5HI4D 5AG9A 5EO9A 4IOFD 2ITCA 4UT9H 5E94A 1G6RA 2ICEB