1T4KB

Crystal structure of unliganded aldolase antibody 93f3 fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
217
Chain Sequence
EVMLVESGPGLVAPSQSLSITCTVSGFSLSDYGVSWIRQPPGKGLEWLGVIWGDGSTYYASALKFRLTISKDSSKSQVFLNMHSLQTDDSAMYYCAKHTYGGPGDSWGQGTSVTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG1, KAPPA LIGHT CHAIN
publication title The Origin of Enantioselectivity in Aldolase Antibodies: Crystal Structure, Site-directed Mutagenesis, and Computational Analysis
pubmed doi rcsb
total genus 36
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kB01
2CLZB 3Q6FB 4EQ2A 4JKWA 4DZ8B 5K9OB 1YMMA 1T1WB 2VXSL 5MEQB 3DVIA 1ZVSA 2VQ1B 3ZKQD 1FZJB 1YQVH 2Y5EA 3BN9C 1NBVL 3PE9A 5L6YH 4HUUB 1AXTH 5FO9B 1NL0H 4L4TE 1I3GL 4LGSB 3DBXB 4GMTH 5KVDL 1HNGA 2EE6A 2AJSH 4OT1L 1MWAH 2WIMA 3SDCA 3KYKH 2NNAB 2DWEA 2W9DH 3BKJL 2WUCH 2DS4A 2VLLA 4K8RD 4HXBL 4PG2A 5BVPH 5F3BA 3QZWB 4PJBB 2IQ9H 3MGOA 2WSKA 1AQDA 3HMWH 3FQUB 1PGRB 1JNLL 5HGDA 3EO1A 5C07E 2P5WB 5JW5B 4JFDD 5DJ2A 1NCNA 4JHAL 4IIQC 4CMMB 1N64L 4PYGA 4GLRI 1X6LA 1DQQB 4PJ8C 1D6EA 4CADB 4JE4B 4EBQH 2DQCH 2VE6B 4NO5B 5TDNA 3LB6D 2YZ8A 4KQ4L 4JM2D 5E2TH 3O3DA 4WV1B 1I8MB 4D9QD 4DOHE 1OGTA 3DUUB 4P3CH 1VERA 4ZXBA 4P2OA 3SE4C 2CR6A 1MFAL 3NFSH 4ZO6A 5GJTL 3DSNA 5EUOE 1I85C 2NQCA 3WIIL 4QRSA 1NCWH 1IQDB 5DD1H 1T03H 4NKMB 2FB4L 4X9BA 1DLHA 4MJ2A 3BDYL 4NQDE 3MV7A 2ZG3A 5FKAA 2GUOB 1OGAD 4MJ6A 3HG1E 4M7LH 4HWEL 1KJ2H 5HHXL 1AGCA 5BXFA 1AGEA 3VG0L 3QDME 3FOMB 3HCVB 4ENEC 1MIML 4LVOC 1DCLA 3O3EA 5C6TL 4GXVL 3DVFA 1KJVB 3UP1A 3SE8H 1QRNA 1UGNA 2ZUSA 1JGUH 3RI5K 2HWZL 1PG7W 4JLRA 1YN7B 1KJMB 4X9HA 1BVZA 3JTTB 2H2PD 4RISH 3PDOA 4AEHH 4POYA 2YUVA 1JUFA 5KVFH 5E1HB 1XF4B 3WIFA 1N5YL 2LVEA 1N7ML 3PNWA 2AXFB 3L5WB 3LRSA 4OM1H 4Y5VA 4U1GB 4YGVB 5IKCA 1VACA 3IXTB 1U36A 3GM8A 3F12B 4ONHB 1MFBL 3VFWB 3DIFA 5DR5H 5KVGH 3MLVH 1IM9B 2E27L 4KDTA 4Z78B 3MZTA 4KAQL 1JIBA 4CN4A 1BGXL 4JAMB 1IGTA 3W11D 4PJ7B 1PKOA 1GHFL 2Q7NA 1CGSH 1TQBB 4U1GC 4KWUA 1S9VB 2WIIA 3HFML 4KMQA 5D1ZC 2QQKL 1J05B 1C7SA 1GC1L 2PYFA 1IKNA 2H1PL 3X3FH 3DURB 1BMGA 3QEQA 1WVZA 3SDAA 5DLMH 1I3GH 1OB1B 5KVDH 1FZMA 2ENYA 4JJ5A 3IF1B 3K3QA 4OT1H 3BAEH 3I6LD 4WO4D 3DV6A 4AENB 3V4PH 4OF8A 5ESVB 3TYFB 3BKJH 4V2BA 1G7LB 4D9LL 5T33L 1AIFB 4XC1H 3U4BL 4XHJC 2DJUA 3LMJL 2FIRT 1QKZL 2QADB 4IM8A 4MX7B 4IS6B 4Y4KD 1FZOB 4Y4HB 1DQDL 3CD4A 2FH8A 4LHUA 3VXNA 2C9AA 3QJFA 3CUPA 4PJXF 4TULL 5IIEB 5IR1A 3AAZB 1U3ZA 2NY6D 1INQA 8CGTA 1NBZB 4JHAH 1KG0A 2OTPA 5DJZA 4Y4HC 1E4KC 4X6CF 1M71A 5IHLB 4QTHB 1C5DA 2HG5B 4KUZL 1T0PB 1NAMB 3G04A 5M95B 3VXPA 3IDNB 4CN6A 4OI8A 4KQ4H 1EUUA 3PHQA 4R6UA 2DBJA 4HBQA 2VDNH 2VKXA 43C9B 1JHTB 2QJDA 3HN3A 1KT2A 1MFAH 3WNPA 5T5NF 5GJTH 4D9RE 3VRJA 4DTGH 3BN3B 3IFLH 2APWA 4ELME 3FRUA 1EAPA 1YY8A 4RGOH 3BDYH 3ZYOA 4WW2F 5EBLB 2BNRA 1NUDA 3CGTA 5BS0A 1IILE 3DV4B 5EZOL 5HHXH 3VGFA 3MLWH 3PP4L 2Q76B 2B1HH 5FUZL 1NFIA 1MIMH 2GYSA 1OQOA 2DBLH 2DD8L 3MRCA 2V5RA 4Z18A 3ZYZA 2X4UB 2J88H 4WI8A 5TPWL 5D8JL 5J3HD 2FHCA 3QBTB 4LPCA 1FFNA 4WFFE 5E2JA 1UA6H 4UIKH 4EI5C 1P1ZB 1KFAH 3LN5A 3B5GA 5KSAB 4HH8A 3ROOB 3LKNB 1J8KA 1T5XA 1CGYA 3OJ2C 4JRWA 4OD3H 5I1HL 5C09B 3WD5H 1FNEA 1MLCB 2KPNA 2V7HA 2OZ4A 1UENA 2P46B 3CFDB 4M6OH 3VDCA 1N7MH 4WUUA 2YKLL 1BFVL 1BPVA 3QI9B 2B39A 4R7NB 4NDMB 1MFBH 2YUWA 3HZYB 2W59A 2VDQL 4QHLB 1ZT4B 1TTFA 2JJTA 4N5EC 5F9DC 3EKCA 3MBEB 2ESVE 1BGXH 3UPAA 5B8CC 5I17A 3VRIA 3H9SB 1GHFH 4KVCL 2R2EB 2IAMB 1CDYA 2VC2H 2F8OA 3HFMH 1UWXH 2CXGA 2QQKH 1GC1H 3GSWB 5EZIH 5F3HB 2H1PH 4YZFE 2YUZA 1MI5B 1C5CL 3VXQB 5C9KA 3TVMC 2P8LB 2NXZD 3Q5OA 5I1CH 5E00B 2EKJA 1K4DA 2BSSA 2EH7L 3T0ED 1FRGH 2PO6B 5F9WC 5A3IC 1J86A 5L9DL 3U4BH 2FCBA 3HE7D 4WHYG 3LMJH 4TULH 2HH0L 5EPMB 4LSTL 3HC4L 4LCWB 1TIUA 4NHUB 3HZKA 3GB7A 5ICZA 2ITCA 4ONOA 2IFFL 1GGTA 4G7YL 1CN4A 2C1PA 4MJ5A 5F7EL 4NUJA 4YDJA 1OAUH 4M5YL 4BQBA 1HCVA 3PWNA 4IMLA 3FONB 3EJYD 5F7NC 3MCLH 5D72L 5KZCD 2Y36L 4XWOC 2C3VB 1NAML 3LKQB 3G5VB 4ODXA 3O2VL 4X5LA 5CEXA 3D3VA 1A6AB 5L8JB 3PABA 4IHOB 1PSKL 4J3TA 3T8XB 2NX5A 2I25N 2NY3B 3DMMD 2DQHL 3O6ML 3MREA 4LSRL 3TZVA 1ZHKA 4G3YL 1GIGH 5J9PA 4GRWE 5EZOH 3N1QC 3KPRA 4V2CB 2D0GA 1HILA 2JIXA 5LXGL 3RTQA 3U46B 3V0VB 2EYRB 3LS4L 3QQ9D 3W0WB 3O2DL 3TV3H 5M7QA 3U7AA 4HDIB 5D8JH 1AC6A 3RIAF 5IGXL 1QBLH 1QSEA 1H3PL 2CDFA 2AEIT 4P4RA 5H2BB 1J8HE 3S35H 3TA3A 3WEXA 4MHHI 5DEFA 3QUXA 3OPZL 4X4XB 1CDBA 2OTWA 1N8ZA 1DVFD 1MCKA 2CIIA 5I8OL 4WGWB 3P4NB 1SEBA 4UMGA 4PLNC 2YKLH 1BFVH 3ZSSA 1FGNL 4C83B 1IZJA 1K3ZA 1MCJA 4IRJA 3FT2A 3VFNB 5CILH 5DMYA 1TZHA 5DMKA 1UJ3A 5HI5D 3NCMA 2GTWA 2FJFB 1AGBA 3LKOB 4ZAKB 1MHHA 15C8L 3QFJE 4ZUVB 4XCNA 5HDLA 4MDJB 4TSCL 2XQBL 4L3EE 3MLTA 3ARED 4KVCH 3CLEH 5DWUL 2RIKA 3VMNA 1U8JA 1S7WA 3OXSB 1VKXB 4PRHE 3HNVL 4JRXE 3ZE0E 4I3SH 1C5CH 3O8XD 2EE9A 1C8PA 4NC1E 4JFFE 5EU3B 1V7NH 2EH7H 4Z5RB 3DXAB 3QFDB 4NKOA 2Z8VC 1S9XA 2LAAA 2ICWI 5DQ9B 4LVNC 3WIHA 2P1YA 2IANA 2FSEB 1YUHA 3QUYC 1NFKA 3BISA 5INCA 4YGAB 3CFJA 2VITA 3FFCE 4ZDHA 4UAOB 2R0ZL 1A7NL 4OZGA 1Q8MA 3KNBA 1I3UA 2PYED 3MLXH 1CLYH 2BXZA 2ZUYA 1E4XH 2IFFH 5IBUG 2GFBB 1TPXB 4G7YH 2HT3C 3DX8B 4UAOC 5F7EH 1HSAA 5IW1B 2ZPKH 5D1QD 3MJ7A 3ECBA 1BEYL 4G6FD 4X4MA 5EN2A 1DFBL 4LDLB 3AM8C 4Y16C 4CVXA 4YBHA 5DA0B 3U82B 3GI9L 3QIBA 3MNWA 4X7EC 5D72H 2Y36H 1JV5A 1NDGB 2BVPB 4JFZL 1RSFA 1NAMH 1YN6A 3VWKA 4JN2A 1T22B 4ZFZB 1H5BC 3O2VH 2VYRE 5D7JC 4NBYB 1U58B 4JY5H 2LU3A 4C4KO 1MRCL 3MODH 1YEGL 5BW7C 1F42A 4PJFF 3TNNB 1Z5LA 2Q8AH 4LSRH 1VFBB 3GSQA 4G3YH 1B4JL 1OTUD 1D5BB 4KKCD 4WTZG 4L29A 1CFTB 1Q1JL 5LXGH 1P4IH 3RPKA 1ZWIB 3LS4H 5IB1A 5F9JA 1RK0B 3H9HA 4JR9H 1ITCA 1R3JA 5E9DB 3ZHLA 2OSLB 2VLJE 4H26A 2ZCLH 5SWZD 3WDHA 1H3PH 2VWEC 4NJAL 2J5LC 4WFED 3ZDZE 4M61B 3BW9B 3IJSB 5C2BL 3QDHA 3STBA 3HC0A 3GSXA 3L5XL 3GJFK 3LQAH 4X6CB 5I8OH 4AL8H 4UIMA 4MD4B 5FYLD 4EKXA 5IBLC 1HI6A 3OGCB 3OKEA 2F8XC 5E6IA 4PRPE 5T5FH 1MCSA 4OBRA 2ERJB 2Z8WC 2Z31C 1FVCB 1U93B 4P9HL 3MXWH 3BVNB 1MHEB 15C8H 2EYSA 1LE9B 2JCCA 3QYCA 4TSCH 3ZE2F 43CAB 3P0YL 2X44D 1FNFA 5LVEA 3TO4D 4K2UL 1QLEL 3HNVH 4NKIH 5D2LA 2R56L 3RZCB 5KG9A 2W07A 2JK5B 4WW2B 1NCCL 3CFKA 4QEGA 2UZIH 4TQEL 4BK4A 3D85D 1Y6KR 3UPCA 2E5EA 3S4SA 5GSVB 2CDEA 5ELIA 4F15C 4PUBH 1J0KA 1FYTD 4JQVC 3RZCC 2LV4A 4PGJA 2FEEI 1ZGLA 3RWHA 5EU5A 3S36X 1BOGB 1OAQH 3W39B 2Q6WA 4X5XB 3EFDH 3V95A 1A9EB 3QNXB 2X10A 4X6FA 2X4QB 3HI1A 4GG8B 1V7ML 4NN7B 1IC4L 2AK4E 3QG7L 5DGRA 2V2TA 2Q1EA 1G7PB 1I7ZA 3PXJA 3T0WA 4UTBL 1BIHA 2Q8BH 1QSFB 2HLFD 5E8NB 2WANA 5LGKA 4ZFGL 1D5XA 3LQZB 2PXYC 2G75A 3K80A 3KS0H 2YBRA 3REVB 1DFBH 1BJ1J 4LLDB 5DD6A 3CDCA 3M17B 1WBYA 3P30H 4LCIH 1BFOB 1HHHA 4JFHD 3M1BB 4HSQA 4JFZH 4LPYA 5EUOA 1S5IL 4G5ZH 4LGPB 1AKJB 3FL7A 3NTCL 5GS1A 3QP3A 3O4OB 3GBNH 4K7FB 4F7EA 1GZPA 5JMRA 5ANMB 5I8EB 1B4JH 1RFDL 5DJ8A 4PJIE 1AQKL 1PFCA 5GRXG 3QDMA 1NGQL 5C0DB 1F4HA 3V0AC 5F88B 3FT4A 5DZNA 4G6JL 3HUJF 3N50A 3SQOL 4F8TA 5EZLA 5I16A 5DEGA 1C16B 4TVPL 2PUQT 5D7LB 4IOIB 4P46B 3B8YA 1KIRB 4K9EC 2AKRB 4RGND 3QO1A 5FDYA 5T3XE 5F9OH 4K07A 4MQTB 4DGYL 5DK0B 1FNGB 2Q3ZA 4MAYC 1ZGLM 3QEHB 4EXKA 3MGTA 2R1WB 4ZUWB 4UOJA 4OSUL 2MCPL 2X4NB 2ID5A 1JRHH 1U9KA 1Z2KA 4QNPF 5IBTH 5JHDE 5JO5B 1I7TB 4P46C 1OTTC 4KC3B 2QR0A 5HBBA 1IEAA 4KTEH 4XCYA 3UAJC 4ESKA 4BSWB 1DTUA 2A73B 1KGCD 3UTSB 1CZ8H 5FB8B 3CFCL 4XZUA 4RNRB 5IM7A 2IBBA 3BZ4A 2DYPB 4HZLA 2FZ3B 3VA2C 5AAMA 4NQSA 1P4BL 3JV4A 4DCQA 3P0GB 4LSDA 1HQ4B 2Z93B 2VDOH 5GRYA 1IAKA 4XI5C 1EGJH 3QA3B 3VW3L 1QLEH 3QUZA 4P99A 1ES0B 3V9FA 1UKQA 2EE3A 4KJYA 2OL3B 2R56H 4Q7DA 3DUSB 1RZKC 3V6BR 5FYJD 1L7TL 4NQCA 4R4BA 4CKVX 3KYNB 3IJHB 5DK3A 1RUPH 1C08A 2Z4QA 1F6AA 4GAGL 4P4KA 1A2YA 4S1DD 3C5ZB 3P11L 4NO3A 4L3CB 3C8KA 4ODVH 3D5OF 3UROR 4CAGA 1FFPB 1I1YA 4HIHB 4FQQB 3MR9B 1FZKB 2QSVA 3CNKA 5CGTA 5GGTA 2A38A 2FHBA 5IK3B 3G5YB 1IAIM 1IC4H 1WAAE 3C5ZC 3RL1B 4F7MA 1PBYA 1NCTA 4HW6A 2P5WD 3BXNB 2ORBL 4ZFGH 4HJJH 4U2ZA 4X0KB 1UVQB 2B0SL 1QFHA 5DF0A 4U1MB 1GZQA 5KW9H 2OR9L 1U8NA 1SYVB 3Q3GB 5E1AB 1YMMB 4F57L 5A2LH 1QLFB 5FO8B 3BMWA 1UM5H 5CS7A 1IFHL 2HMIC 4HT1H 1S5IH 4I8DA 4KHTH 4N8PA 4OFVA 4G8IA 2EKSA 4NRZB 3UTTB 1GJIA 3NTCH 2FBOJ 1A64A 2YEZA 4KMTL 3TIEB 4S2SA 1NC2B 5J12C 1XGQB 2DWEB 3D0VA 4XCEA 1MUJB 4H88L 1RFDH 4JY6A 4YWGL 5IB4A 1AQKH 5F3BB 2ADGB 3VWJC 1MRFL 2DQJL 4HUWA 4NSKB 1AQDB 3N1PC 4X4YA 3TFKC 3MRBB 4WI4A 4LSUL 5HGDB 4YHPB 3G9AB 4DN3H 4G6JH 3BZFB 5ICXB 3RWEA 4EDXA 4N9GA 3SQOH 4AQ1B 1DQJB 4RRPG 1RZJL 4KU1A 1OCWH 2DQUL 3BP5B 1S7XB 3FOLA 3HC3H 5FA3A 3E2HC 1RUAL 4I18A 2B5IB 3LIZL 4DGYH 4ODUA 4LARL 4KVNH 3IXAA 1EERB 2HN7B 2F54D 1O0VA 5TDNB 2AV1B 5A2IH 5BRZE 1UFUA 4YK4C 4PRIB 2Y7QB 1JI2A 3D9AL 3O3DB 2QHRH 5C6PB 5DJAB 2B5IC 2DQTH 2DJ4A 3ILQC 4ZXBB 1NEZA 3RGHA 3N1FC 5JR1L 4U1NA 2A77L 2VZTA 3IDXL 5B3JE 2UV3A 1WZMA 5IV2B 3VXMB 4UILL 1T4KA 4ZUTB 5IMOA 1HSBA 2YRLA 3W2DL 1ZSDB 4R7DA 1IM9D 5CUSL 3VW3H 4JPWL 1PZ5A 1UH2A 1NCBL 3OKDB 3DI3B 4OZ4A 4Q9QH 4R2GB 3GMQA 4PD4K 5FHBH 4PJFB 3TESA 1HHKB 1UADC 3E6FB 2G2RB 2HA1A 2IF7A 1GXEA 4FZ8H 4OCXH 3TBVA 2ARJA 1RIUL 2H2SC 3O3EB 1UWXK 2O5XL 5HHOA 1U8MA 1SM3H 4M3KB 2V6HA 2C3XA 3OF6D 3GSNL 1P7KB 1A1OA 5ACZA 2GJ6B 4X7CC 4HIEB 5E24E 2AABL 5DUPL 4HS6A 4HH9B 2BVQB 3B9VA 4JKKA 3BUTA 4KI1A 3BPNC 2V5MA 2QADD 4Y4HD 1R3LB 3MCKB 4Y5VB 2X89D 3K1KC 3LDBC 4OCNC 1KJ3H 5CWSA 3BRGC 1NKOA 5I71B 1HZHL 3B4NA 4M7KH 4OD1H 2ORBH 3V52L 4QCIA 1FC2D 3ZLQC 1EX0A 4V1DA 1AHWA 3T4YA 1QZ1A 2CRIA 4YNYB 3LSOA 3T2QA 2OR9H 4KV5E 5F7HA 3RUGF 2BHZA 1HHGA 3U7YH 1D6VL 2PF6A 4F57H 1A7OL 1ORQB 32C2A 3DHJA 4EUPG 1D9KA 2VQTA 4YIQA 3DRTB 5E5RB 1IFHH 3J7HA 4Z7VE 1UWEH 1QPPA 1JTOA 1CFNA 3B9AA 3QEQB 4N0YL 3SDAB 5IFJA 4JJ5B 3UYRH 4KMTH 1DQLL 3GKZA 4BYHA 2P43B 5EZJB 1F2QA 3P0VH 4NO0A 1OP5H 4H88H 4XNXL 4Q9RH 1WFUA 2VDML 1A3LL 1OSPL 1EV2E 2DQJH 4OAWB 4WFGD 3V8OA 4GKSA 4HX1A 2BZDA 3G5ZB 1IT9L 1FJ1A 2FEDD 2BVOA 4JO2H 5TDOA 3CIQA 4OIAA 1DBBL 3VXNB 3QJFB 2GITB 3CUPB 1LD9A 4JFPA 4MLSA 1WITA 3KGRA 2XRAL 1XGRA 1VPOL 1A14L 2DQUH 5E8EB 5HYQA 5I30L 2W91A 4MS8D 3MOBL 4JFQB 3N9GL 1FQ9C 1JPFA 1U3HB 1C5DB 2DQEL 4LARH 5IVXA 3N0PB 4PJGE 1U8LA 3AU1B 3FO1B 3G04B 3SDDB 1I1FA 5KSAD 3D9AH 2ADIB 3VE0A 3F8UB 3BD3A 3WFBH 1U3HC 1CWVA 5C09D 1H15B 2Y1VA 3ZYIA 2NW2A 3V0WH 5JR1H 3BP7A 3VRJB 4MHHG 5SX4I 2FBJL 2OJZH 1EFXB 4FHBD 5D2LF 4H0HB 3TT3L 1L7IH 3QI9D 5FECA 1KPUA 1EPFA 1Y18A 3JVGC 3MJ9H 2V2XA 5E5MB 5HJ3B 4PRHA 5CUSH 3MNVB 3CSYA 3HAEB 3TVMD 3IKKA 1FVDB 2HTKD 3ARGA 3CDGB 2EC9U 3H9SD 1C5BL 1CGTA 2IAMD 1NFIB 4P2QA 1X5ZA 1NMCC 3V5KA 5J0BA 5A3ID 4CVUA 4H8WH 2EZ0C 4KGLA 3I6KA 5D7SH 2D9QB 3MRQA 1MI5D 1UB5B 4E41A 1EEYA 1ZGLP 2OL3H 1A9BA 1XCTB 3FB7B 1DUYA 1RMFH 4P2RB 3BKML 2DDQL 3FTGA 3QHTC 4JQXC 4QRRE 1BZQK 3HUJB 3KWWA 4O2CA 4OM0H 3ZDXE 3VI3F 2PO6D 4NNPL 4GXUN 2AABH 5DUPH 1FNEB 4G8EB 4YFDB 4DGVH 1P7QB 1CDCA 1T1XA 3AUVA 1MCPL 4D3CL 3BWAB 1TETL 3PHOB 5E2VL 1S9WA 1HZHH 1O7VA 4TYUA 4LCWD 3KJ6H 2ZOLA 4YHML 1NSNL 2AI0H 5EO1B 1OLZA 1PEZA 2FD6H 1OF2A 5EUOF 3WUWG 4W6WB 3VFSA 4PTUA 2OMBA 3CFBA 3ISWA 4XNUL 1D6VH 3H3KA 3E8UL 4TRPH 4XWOD 3ALPA 2MQCA 3U30B 1A02N 2GY5A 2UWEB 4N0UE 3T65B 4Z7NE 1K85A 1SBSH 3WNLA 3DGGB 1YDPA 1I7RA 4N0YH 4OCWL 2XKNA 4OZFB 1MSPA 1KCLA 4XXCC 3S88L 1K4DB 4FTVA 3OZ9L 1DQLH 4MNGE 5C2UB 4X8JB 3X14A 1Q0YL 4XNXH 3GSUA 2X1PA 2VDMH 1A3LH 1RU9H 1JCKA 3MRJA 2EDXA 2LABA 1IT9H 2NY3D 2VZOA 1CI5A 3CAFA 1DBBH 3VFUA 5C0IA 2WP3O 1FNSL 5F72S 4RWYL 1WK0A 3QJHA 5FYJU 4O51B 1VPOH 1A14H 3ZL4L 3HZKB 1X4XA 4LQFL 3RVVD 1DN0B 3N9GH 1CFQA 2FECL 3W0WD 2X5PA 2B4CC 3GBMH 4KHXH 2DQEH 3DX6B 2WWMC 3TH2T 4KQ3H 3QDJA 3L3KA 1EK3A 3PP3H 5C3TA 2C5DC 2P44B 4OCSH 2ZUUA 3H6JA 5CIPB 5DC4B 4IMLB 3MFFA 5FK9B 3U9PH 2ZG2A 3VGBA 1OTSD 4PJ5B 1PX3A 3BKYL 1PAMA 3TWCL 5FKPA 4HKJB 3CZFA 2QKIA 1A1MA 2GAZB 4FP8L 3H9ZA 3TT3H 3IAGC 2VIRB 3WN5C 2A6IB 1NLBL 1B0GB 2BMKB 4P5KB 1CDGA 1JWUB 4HUKB 2HJFB 3MREB 4ZAKD 1T7VA 1OPGL 1T2XA 1CXFA 1F4WL 1KEGL 4RQQB 1K9TA 1YECL 4O5LH 5MEPA 3MV9E 3OB0H 2MMXA 2VABA 4NJ9H 4PGBA 1FN4B 4JFDA 4JCMA 5FOBB 2GT9A 4WUKH 5K9JL 4NN5C 2CDFB 2DDQH 2NY0C 3BKMH 1E28B 3DXAD 3UTZA 2RQ8A 2X7LB 2ITDA 4I4WA 5GGSA 4O58L 3CMGA 4F58L 1X5AA 2ATPB 4JM2A 4U6HB 3BPCA 4HUVB 4QHMA 5TF1H 3ET9F 2HT3D 4D3CH 1TETH 3OV6A 5E2VH 1F5WA 3B5TA 4TNWK 1UJ3B 2OZ4L 4YHMH 1NSNH 1S78D 4XCNB 3G5XA 5ALBL 3D18A 4YLQT 5DJXA 4XNUH 1CXIA 2V9QA 4MB3A 2MCG1 1BVLA 1OGAA 5B4MC 3OR7A 2HTLC 3RL2A 3U48A 4GH7B 1ZT1B 5I0ZA 4OCWH 2XPGA 3VXUE 3S88H 2JTDA 4HIJA 3RVUC 3IU3A 4FN0A 3QISA 3SBWC 6FABH 4AIZA 1FO0A 5F70A 5CMAB 3P4MA 4DKEL 3WL9A 2X42A 1QR1A 4U7SA 5F1IB 4BFIB 1KLGA 2NY2B 2E9IA 4GG6A 4GJTB 4L4VB 4WHTA 3ZL4H 1AY1L 4LQFH 2VXQH 5SX5H 3ROLA 1T7WA 2DM3A 1RI8A 4QRTB 5EU7E 2VUYA 5ESQA 4M9OA 5E9DD 5EOQL 4NWUL 1U91B 4U0QB 5CP3A 1PVHA 1ORSA 4N5UA 4ODWA 5EN2B 2CQVA 4CVXB 3SJVE 3TH3T 1AXSA 4C4KT 2COQA 3BZDA 3KR3L 3PL6C 1T80A 2WINA 3RUGB 1YN6B 4QRPE 3VWKB 4MWFB 4C56E 2P8PA 3MUHL 3S36L 2ZUQC 4YZFF 4JDZA 3KPSB 3HR6A 2R8SL 1NLBH 4WO4A 3OKOA 3UMTA 1K5NB 2R2HB 4FQLH 2NTSP 5EOCH 4U6XB 3RNKA 1MJ8L 4OI9A 3DO3A 1F4WH 2AEPL 1XF2B 1I1AC 4Y4KA 4PP2B 3HI6L 5MERB 3MSPA 1YMHA 1YECH 5F9JB 4XXDA 3KYOA 1ZS8A 3AY4C 3ZKXB 2W0KA 3RZCD 1MH5B 5J11B 1FL5A 5D5MB 3F7YB 3SKJL 3GMPA 1X5HA 4ISVA 1HN1A 1ZE3C 3Q6GH 5K9JH 5DD5L 1WTLA 1RK1A 3FRPG 4PJEE 2Z9TA 1AC0A 2PTUA 5E08L 5SWSB 2JJWA 4CDGC 4HG4K 4NQUA 3HTLX 2NY4B 4I48A 3L5JA 4NC0B 1N26A 3F58H 5DHVA 5DQDL 2YK1H 4XP9L 2JB5L 5JA8B 1P9MC 3OKEB 1R5IA 1DEEA 3FFDA 4M7ZC 5JIIA 2IJ0C 3QCTH 1A7PL 3BGAA 3L3GA 3LN9A 2AXGA 2NY4C 4Z7UE 2APXA 5DA4A 2AJ3A 3BQUC 3EOAA 1QSFD 4EOWH 3V6FA 5AAWA 3T77B 3R8BB 1N5AA 3TCLA 4QRUB 4NKDB 3VCLB 1UQSB 3S98A 1KV3A 1A21A 4HGWA 4P59L 2NXYB 4KI5E 1NBYA 4GRWF 3OX8B 1CTNA 2Q3AA 1X3DA 4U3CA 4XPGH 3C08L 5HGGS 4B7LA 4LPXA 2C4FT 1AKJD 4MSWA 1IM3B 1HINL 3NCCB 4NNXA 1I7UA 4DKEH 5INDB 3MRFB 4AH2A 1FGVH 5C07B 2XFXA 4J4PD 3WJJA 3LD8B 3KAAA 4R96A 3BUYB 3OAYK 2R29L 5L7XL 2IFGA 1HIML 3HA0A 1ZMYA 4BSVB 3WIHL 4H1LB 5ID0B 3ULVE 1H3UA 3I6GB 1I7ZB 5GRZA 5CEZE 5DC9B 3QSKB 1KIQB 1D5XB 5EOQH 3A6OA 5D7LD 2HKFL 3OAZK 4P46D 1OTTD 4C59B 4HMEA 1G9NH 4YDKL 3IU4H 4XNMB 5CZXC 4DOHB 3MLZL 2ZSWA 3O11A 4K3JH 1VADB 3HS0A 1CGXA 3ULUL 3MPCA 3NCJL 2BVUA 4I3RL 4JPKL 5EUOB 1AD9B 3SKMA 3ELAT 4FG6D 2CJUH 3QQ3A 4WU5B 5IP4A 2VH5L 5JLZA 3IVKB 1KPRA 1OW0C 4F7EB 1GZPB 4PRBA 3T0EA 4XI5D 5TE4H 3BRFA 4KK8C 4NQEE 3CC5A 3UTSD 4Y4FC 1MJ8H 3HG1B 3FCTA 1JPSL 4LSSH 2DYPD 1LWRA 2AEPH 4DVBB 3HE7A 2LE9A 3QDMB 4G80B 2XT1B 3ZTNL 4FXGA 3H7LA 5HGHB 5DUMH 3T3PE 4UB0L 4LPVA 3QXDA 3QIWB 5JW4Q 5DEGB 3SKJH 4L8SA 4PLJC 4P9HC 1T0MB 1MF2H 2AJVL 4MB4A 1BWWA 1MFDL 3B2UC 3CVHA 5MEOB 5FUOL 2W0FA 1UWGH 3QIWC 3MGTB 2GSGA 2AEQH 3PIQA 3FAWA 3T2PA 2YXMA 5I2IA 3IGAB 4I77L 3C5ZD 1EZVX 5JW4R 1LK2A 4PBWD 5DQDH 1AGFB 4WU7A 1KTLA 4LPTA 4XP9H 2JB5H 2D7NA 2CLVB 1V5JA 2EXYD 3D1MC 4PGEA 2IPKB 4RX4A 3UTQA 4CVWA 5ITFA 4LASL 3RKDC 5K9QI 5EU6E 1J5OL 2ZCHH 1A7PH 3SKOA 2QEJA 5KTEL 4KKLC 1OQXA 4U1SB 5CAYB 1ZTXH 3JV4B 4DCQB 2VLRE 4MNHA 3OMZA 3DMMA 3JWDL 4TN9A 5F71A 2HMID 3FT3B 7CGTA 3QUZB 3CLFL 3K46A 4CJ0A 4KJYB 2I27N 5GGRB 3FQRA 4XBEH 4P59H 2FJHA 1CE6B 1BZ7A 2DM7A 1YY9C 1YMMD 3EYUL 3ARZA 5I1AA 3VJ6A 3RHWF 4Y5XC 2RAMA 5I74C 3C08H 1GOHA 1J0YA 3DX7B 1HH6A 4MQXD 5H37G 4KXZH 2R4RL 4X99A 5CKGA 5GIRA 1E27B 1QUNA 2VMFA 4P4KB 3UTTD 3BKCH 3TFKD 4LCYA 3SCMC 4XNZC 1NC2D 4RRPA 2E7MA 5C0EB 1I1YB 1WFNA 3EYVA 3FB5A 2OK0H 4ETQB 5IWLA 1DVFA 3QH3B 3ZDZF 4P0DA 3BD5A 5L7XH 4JREC 4ZQKA 1HIMH 2UZYB 1ZK9A 3WIHH 1H8SA 3S37X 4F7MB 3OKNB 1CGUA 2FWOA 2IG2L 4YBLB 1XF5B 3RWJB 5FGBA 5CZVL 1GZQB 4YDKH 1A4JA 2EDLA 1FNLA 1L6XA 2UVFA 3AREA 1IBGH 3MLZH 5FGCE 3RVTC 5J56B 2VN7A 3HRPA 4PG9A 2NY7H 4I2XE 3KG5A 4UQ3A 3CZJA 4I3RH 5C0JA 4Z77B 2D7TH 4K3EL 3VH8A 3O8XA 4G6AD 4PJ9B 2WAHA 3OJMB 4G8GE 1CXHA 3L5IA 1TQCB 4PRID 2EKSB 5EOTA 1YYML 2C4XA 4ZFOA 5I1GL 1GL4B 4ELMB 5E4EB 3QAZB 3MV8E 1G7JB 2WQ8A 4BQCA 4ZXBD 1JGVH 5J13B 4R8WL 4QOKE 3CFEB 4JDVA 3D0VB 2ZUVA 3F7VB 4KTYA 4GUPB 1TQCC 5IQ7L 4HUWB 1MEXL 3SHSA 3VXMD 2RCSH 4RFNC 3ZTNH 3UC0L 3PQYE 4UB0H 5DT1H 1OSZA 3L6FB 4LP4A 5HHPA 3H0TA 3RWEB 2FDBP 2PYEA 2E8ZA 3LS5L 5D2NA 5DC0A 4R2GD 5HGBA 3PV7A 5JORB 4H0IA 3FOLB 3GIVA 4WCYH 5FA3B 1OP9A 1F58H 5DJYB 4JO3H 1YPZA 2AJVH 4TUOA 4JM2F 5AYUL 1E4JA 3DI2B 4C58B 3OAUH 5DHYB 2NW3B 4ODUB 3RAJL 5FUOH 1CG9B 4YBQC 4J1UB 1IAIL 2XKUA 5D1QA 5ICYA 3WV0A 1KN4H 1GGIH 1FSKB 4LRNL 2R23B 4YHIA 5K33A 3IJYB 4BZ2H 1MNUH 2GJ6D 4PRNA 2Y25A 3O3BA 5FCSH 1WICA 3GMRA 3R8QA 1LEIA 3VI4E 4OUOA 2H32B 3BPLB 3UZEA 1V8HA 4LASH 5JXED 1HWGB 1J5OH 2ESVB 4LEXH 1D5MA 5F6HI 5DRNA 4OZHE 3P9LA 3S97C 3ZMRA 1NCAL 3B6SA 3DECA 5KSBA 1FCGA 5HVWA 4WGVB 1NJ9B 3KLAA 4F7PA 3SPVB 2X70A 4R7DB 1JMXA 4JHBA 4HS8L 5HDQL 5DUBA 3CLFH 3S96B 4PRDA 2GHWB 3RIAK 1YEEL 3TF7C 5I73B 4PJIF 4A6YB 3EYUH 2AK1L 1Q9KB 1GOGA 1Z9SA 5HI3C 1S7QB 5I1LA 4OLVH 2M26A 3K4ZA 5I76B 1K8DA 3HRZA 4Z76A 3QEQD 5HHOB 2XIDA 5SWZA 2B20A 1U8MB 4IJ3B 2JJUA 5J1AB 3MLPA 4CU7A 3MOQA 2DOCA 3TT1H 1U8OB 1YJDL 3CSPA 4LEOA 4HKZB 4YJZL 4N0RA 1QP1A 4JG1L 4TUKH 1MCFA 4U31A 1L0YA 3HPLA 3OGOE 1IZKA 3BIKB 4RMSA 4DKDC 4L8CA 4EI6A 5ENWB 2IG2H 3BO8A 4HPOH 5AZ2L 1OD7A 1I9RL 4X83A 3WS6C 3KLHC 5GGTL 1TMCB 3T4YB 1RZGA 4R3SB 5KSVB 1PZUB 5CZVH 3VFTB 3S5LA 2X41A 4H1LH 2YPKB 1HHGB 1U3HD 2P24A 1PKQE 3MOAH 3TO4A 3L3DB 4YIQB 3C87A 3O41A 3SDDD 5ISZE 4OV6F 5HHVL 4DAGL 4PS4L 3S6CA 1K8IA 1YYMH 1LP9A 1ZHBB 5EBWB 2OM5A 1BVKB 5K93A 1RZJC 5AG9A 5T3ZE 4U0RB 3D85A 3MLRH 1LVEA 3NZHL 3PJSA 1W0VB 4R8WH 1FYTA 4GRWB 4E42A 4U49A 2AW2A 2O5YL 5TGBB 1EFXD 4D0CB 2F58L 3U7WL 1MEXH 4YHNB 5IOPA 1IGCL 3UC0H 3BGMA 3GMNB 3P77B 2EIZB 4DUWA 1IE5A 4PTTB 4CDHA 4QYOB 1JPTL 3LS5H 4WI7A 1PLGL 1QFWM 3NPSB 5HYQB 1BQHG 3OG6B 1QA9B 3ZKMD 5AYUH 1N6QL 1J8HB 4NRYA 4JZOA 1CIUA 1WAAF 1DBKL 3EDDA 4ZSOE 3OB0K 1IAIH 5IMKA 4YAQB 4X5WB 3LEXA 1SEQL 3S3SA 4P2RD 3MLYH 1A7QL 1P5VA 1I1FB 4LRNH 2VZ3A 4KKBD 3VE0B 1RAMA 3ZZ1A 2AXJA 2NW2B 3RJDA 3O4LE 1P7QD 3LH2L 3WDJA 3BP7B 3QFJB 4HWZB 5JW4N 3VXTB 1BBDL 1NCAH 4L3EB 1OVZA 2A6DB 4LMQI 1NGZA 2D31A 2BVTA 3CH1B 1TCRB 1DLFL 2V2XB 2VR9A 4NBZB 4NGHH 5A2JH 1RD6A 4PRHB 4JRXB 5BCAA 4Z7QE 4DVRH 1I9EA 1WZKA 3QXAA 1CL7L 1JN6A 3JWOL 1YEKH 3GDBA 3HNSL 3C09B 3ARGB 4JFFB 5FYKL 3STLA 1JF1B 4P2QB 1PYWA 2AK1H 3O9WB 3I6KB 2VXUL 2W0LA 3RVWC 4CU6A 2EEAA 4E41B 4HUMB 2VWEE 5HY9B 1DUYB 3OWEA 2XWBA 4NC1C 3UBXA 3WHE1 1DQTA 1NGYB 3ARBB 3SGEH 5C0BE 3FFCB 3IDYB 3MRKB 5E99L 4ZO8A 3D48R 2JELL 2XZAH 2D7PA 2X6MA 4MA3A 1T1XB 3L3JB 3GMLB 1KCUL 3EUUA 1DANU 5HPMA 3HZVB 3MROA 1MFNA 4FFYL 3ARBC 1QBBA 4Y8AA 1U95A 2WWMD 3ILPB 4NOBA 4WY7L 4X98B 1U8HA 3GMOB 5AZ2H 1K4CA 2J3SA 3KPOA 5LGJB 4HZAA 4RIRA 5GGTH 1EH9A 4J23A 4OFIA 5E8OA 3EOYG 5CD3B 5E70A 5SX5K 5B3JF 1RJZB 4OGXL 5D4QA 4W6XB 4PRAB 2GTZA 4YXHL 4KGJA 3OR6A 4GW4B 4FXLA 4UUJB 1L0XA 2EYTA 4NZDA 1H8OA 4LHJB 4XBPB 3Q6FA 5HHVH 1YDPB 4PS4H 4S1RL 5F6HJ 1I7RB 3H2WA 4DZ8A 1F4XH 1T1WA 5MEQA 1J1PL 1NCDH 4PV9A 3PWPD 5JPNB 4JG0L 4PJ5D 4JKPL 1DBAL 2VQ1A 2PTTB 2DQDL 1FZJA 2RJMA 4FQJL 4HUUA 5FO9A 4LU5L 4M1GL 5HYSG 1Z9MA 2O5YH 3DBXA 3NCBB 3I02B 3U7WH 3MRJB 2NNAA 3L7FB 4W4NA 1H3WM 3PGCA 4MQSB 5C6WH 5CJ5A 3BGFB 2SEBB 3G6JE 5FEBA 3PDDA 3BYYA 4B53A 3AXLA 2YN3A 1UCBH 1JPTH 4KKNA 3QZWA 4IIQA 2VLJB 1PLGH 3EYSL 4F2MB 2GEEA 5K59E 2EDDA 4PJ8A 4NN6B 2P5WA 1N6QH 5E4IA 4LVHC 1ACYL 1DBMH 2UUDH 4G9FE 2EE2A 1SEQH 5C0RH 4CMMA 1A7QH 4D2NA 1EMTH 1Q0XL 1IQWL 2Q86B 1UM4L 5GGSY 1DQQA 3SKNA 4NN6C 4CADA 4KV5F 1MCLA 2MQ3A 4XAWH 2VE6A 1I85A 4NO5A 4H25B 3UYPA 3P73A 2IQAA 1MAKA 3LH2H 5GZNC 4LRIC 3ZT6A 3CZFB 4RFEA 1QOKA 1A1MB 4WV1A 5AEAA 1I8MA 3N1MC 5IW3A 3DUUA 2HFGL 4L8BB 5CINH 4QRQB 3RDTB 5DEZA 5I1JL 5B4MD 2UZXB 1CBVL 2H32H 4KRPB 4IRZL 1CL7H 3JWOH 4NBXB 1IQDA 3DYPA 3Q1SH 4NKMA 2K1MA 3RVUD 3O6LH 4HPYH 3THML 4A2MA 4Z95H 3RDTC 4ZNEE 3UDWC 2VXUH 4PGBB 4KRPC 4MZ2A 4OB5L 3UTPE 3MRMB 5DVKA 3FOMA 3HCVA 4ODSH 4NQXB 1CD9B 4M03A 2L7JA 4W81A 1XF3B 5E99H 1KJVA 2AQ3A 2F54A 1WV7T 5IBUB 5KOMC 2VB5A 3WHE0 4PJGF 1YN7A 2AK4B 3BT2L 12E8L 3OJVC 1EEUA 1KCUH 4KDTC 4LBEB 4CN1A 3JTTA 4X6DE 2O61A 4FFYH 3BJLA 3PWVB 2NY2D 2DI8A 1EHXA 1IC7L 2CK2A 2YPLD 1EHAA 2WMPA 4L4VD 3C5SB 3BPOB 3MZGB 2AXFA 4YGVA 5HPOA 3VD4A 4WWKB 3IXTA 1P7HL 3MRDB 3F12A 1Z9OA 4ONHA 4OGXH 4NZUL 1IM9A 1IC5H 4YXHH 4Z78A 2A6KB 1R3KA 3HNTH 4JAMA 2PR4H 3RL2B 4PJ7A 1CS6A 4S1RH 2I5YH 3NGBB 1J1PH 1M7DB 4WWKC 1S9VA 4P9MH 4HAFA 4M43L 2ZWLT 1EJ6A 4JG0H 1A3RL 1J05A 1SJEB 3B9KB 2EIEA 4JKPH 4YFEA 1DBAH 3IU3B 3I50L 1CF8H 4FQ2H 2DQDH 3X12B 4FQJH 2EDJA 3U9UB 3VWKD 4PJIB 1FO0B 1KTRL 1Q9LB 1OB1A 1E6JH 1E4WL 4M48H 4TSAL 1J88A 3P4MB 3LZFH 3OF6A 3KPSD 3NGBC 1RQ5A 4J3UA 4AENA 5E0QA 3TYFA 1G7LA 4PGDB 3ESVF 3ZDXF 1AIFA 4GRWH 2MPAH 1PG7L 3EYSH 4OGAC 4JFEE 2VDRL 4Y4HA 4IS6A 5CJXA 1S8DB 4X7TB 1QRKA 2G60H 4PJAE 5BV7L 3D39E 4K94L 5IIEA 4IMKA 4IOFC 1GGCH 5ESQB 3AAZA 1JGLH 3QQ4B 1WWWX 3SDYH 2XZCL 5JHDB 1NBZA 2BXYA 1G0DA 4C57C 4PB9L 5SWQB 3DHMA 4OFYD 4ODWB 4UDUA 4HFWB 4ZPVB 4AMKL 1Q0XH 1IQWH 1MCIA 1UM4H 2N56A 5E94B 4QTHA 2G5BA 5SWSD 5KSBF 3W9DB 3IDNA 3SDXE 2NY4D 2IWGA 1EO5A 2P8PB 3BQUD 3I9GL 1CD1B 1NANH 3TCXA 2Z91B 1QFPA 4BZ1L 4LLYB 1X5YA 1LMKA 5AWNL 1V3MA 1CBVH 3KYAA 5LAXA 2N7BA 5JUEL 1JWSB 4LKCA 1QLRB 4WHCA 4Y2DB 3VFOB 2MJWA 3HI5H 5EBLA 3THMH 3CX5K 1YMHB 3O0RL 3AC0A 3X11A 4K8RL 1MHPL 4CU8A 3TO2B 2NXYD 1YYLH 1NGPH 3M45A 3GRWH 2WUBL 4ZTOL 4JPVH 5H35B 4MB5A 2X4UA 2G9HB 2RBLA 2DAVA 4WHYH 2VDLL 1P1ZA 4JB9L 4I48B 5CJQH 2OR8A 5GXBB 2GK0B 1CD8A 2VXTL 1T66C 4RZCA 3ROOA 5JNYB 3LKNA 2NLJA 5TQ0L 3KXFE 5C07D 5C09A 3WMSA 3C6LB 4Z8FL 1CFVL 1IC7H 4UT7H 1MCOL 5B8CA 1YEJL 1GAFL 3CFDA 3O6FC 4L5FH 1JWMB 3QI9A 3VRLF 3R0MA 2B8OT 4YR6B 2A0LC 3LAFA 1SJHA 4NDMA 2P5EE 3V6FB 4QHLA 1NPUA 1ZT4A 3TVMA 4HFUH 4OJFH 1HYRC 1HXYB 4HGWB 4P3DB 5DK2B 2R2EA 1H8NA 2IAMA 5EU4A 5C0FB 4N8VG 2QQQA 2QSCL 4KK8D 1A3RH 3GSWA 5F3HA 4QTIL 3VXQA 1MI5A 2R0LH 3TJEH 2P8LA 1F3RB 1WZ1L 2J4WH 4MSWB 5E00A 1E4WH 4IEFB 4TSAH 2VR4A 1WFOA 4DKAA 4XP1L 4NQDD 4IRSB 1R6VA 2BOBB 3EYOB 5FV1L 2XFXB 1MCEA 3HG1D 3PWUA 1MAML 1BF2A 2HRPH 3EJZC 1T7XA 3HHRB 3QDMD 1FO0L 2VDRH 5IFHH 1CD0A 4N90E 1J1XL 3B9DA 1FBIH 3AMKA 5BV7H 4IRSC 4K94H 1S5HB 4FFVC 3QIWD 1XH3A 5EPMA 1J0IA 2YXFA 4YXKL 4OLXL 4FS0A 4LCWA 4JHZA 4NHUA 3RIFF 4HQQH 4Z7WA 5FUCC 4AMKH 2RGSA 4OF7A 4F37F 2IALB 2OQJB 1RUML 2MFNA 4LNRB 2P4AB 4L1HA 5F6IC 3HS0B 1ZHNB 3FO0L 2EDHA 4S0SD 2NXZB 3QQ3B 3TZVC 3I9GH 1KPRB 1A6TB 1KULA 3T0EB 5AWNH 4I9WE 2F53E 4Z0XB 3LKQA 3RTQC 3G5VA 3F5WB 4O4YL 1BAFL 5TF0A 4M1CC 2WV3A 5DJDB 1OP3K 4IHOA 3VFGL 3HE7B 4IDJL 1C1EL 4FXGB 3WHXB 1J0JA 1U8KA 5TDPB 1X4ZA 3O0RH 3QXDB 1ZA6A 1Z0NA 3QUZD 4AEFA 4GW1B 1FDLH 4K8RH 3WSQL 1JZ8A 4AZ8A 4JO1L 3L7EA 3TA3C 4G42B 4U1LB 1QBAA 2EYRA 1AI1L 5EUKA 3VD3A 5ILTL 3W0WA 4ZTOH 2HT2C 2B2XL 1CFSB 4ALAL 2W0FB 4HDIA 3C5JA 3OKLB 2VDLH 4GSDL 4XT1C 4IRJC 4P4KD 4RBPK 4HG4J 2WBJB 2VXTH 5H2BA 4JO4L 2EDYA 5BQ7B 4P23B 5DMGC 3QXWA 4X4XA 4Z8FH 5D7KE 5HHME 4N8CL 5GPRA 1MCOH 1GAFH 3SKOB 3P4NA 2GKIA 4Y1AE 3K8KA 1OAXL 9CGTA 4MJIE 4C83A 2WBJC 3RVTD 2AEWA 3VFNA 5B38B 1URLA 3GSVB 3NVQA 1EGJA 4TVSa 2FJFA 2YSSA 3LKOA 4ZAKA 5I1IL 3C8DA 3I3EA 4G9DA 2BX5A 5K9KB 2W38A 3DETD 4ZUVA 4MDJA 1XMWA 5FXCH 5J6GB 2YMXL 1H9VA 3F6LA 3OXSA 1VKXA 4W4OC 4UV4L 4LLAA 5DFWH 3MFGB 3TM6A 4QTIH 4XMKH 4D9RD 2XA8L 4MQ7B 2AQ2A 1MHCB 4ZO7A 4PJ9D 4QHUB 3MQIA 4U1HB 5EU3A 4Z5RA 3QFDA 3N06B 5SV3A 3AS3A 5KBNC 4ONFL 4PJEF 4AQOA 4DW2L 5IHUH 5DQ9A 2BSRB 3PDGA 2FSEA 3ULUC 1FO0H 5KOVC 2HJKB 4X80L 4GKZA 5IW6B 1VGKA 3C2AH 4YXKH 3U79A 1IKFL 4PJGB 4OIIL 3SE3C 5JW3H 3KPTA 4WFFD 4Y19E 3STZB 2GFBA 1A4JB 1YEFL 4N0CD 4GBXB 5T3XH 3DX8A 2APVA 1JVKA 3RX8A 5CLWA 5IW1A 3D25B 1OAYH 4LLQB 4BSJA 3MUGB 1JZ3A 4HLZG 1CVSC 5CP3H 5DI8B 3T04D 1A6WL 3T1FA 4PJCE 3VA6A 5BW7A 3QXUA 4PJBE 1VSCA 4GBXC 4OTXL 4U1KB 1TVBA 1NDGA 3FKUS 5CCKL 4KKAC 1T22A 4ZFZA 2ESVD 2VZSA 4XH2B 2LU7A 5IJVB 4YXLH 2JLLA 4DFIA 1U58A 5MENE 1MRDL 5IJKA 1C1EH 5HI3D 3F7RA 1KCRL 4LAQL 5HTSA 3TNNA 2XZQL 1G6RA 1OSZB 3CJJA 1VFBA 4QKXB 2OP4L 3Q5YA 4TOYH 1D5BA 3FHQA 1KB5B 4RDQG 1CFTA 2ICES 3GEWB 1BQLL 3L3HB 1ZWIA 5B39G 3A6BL 4QRRB 2FATL 1CICB 3AGVA 3ULVF 5E9DA 2B2XH 4ALAH 3ARFB 2OSLA 3QIUB 3JWDC 5D7IA 5E6IC 2GCYB 3GFUA 5HHOD 1MQKL 4BKLB 3S3JA 3C8HA 4RMVA 1QPXA 1CK0H 3U36B 2APFA 3REWB 5FA4B 4YHIB 1LQSR 4XMLL 4A2LA 4M61A 3VXSE 3BW9A 3GMRB 4QXGL 3IJSA 4X7DC 1RZIB 3CVHL 3GJEB 4AEIH 3KLHD 5KVEH 2X4PA 1DSFL 3SGKC 4MD4A 1D5MB 5KS9E 4R97B 1OAXH 4HIXH 4EUPB 3OGCA 1FE8H 5DRZB 5KSBB 1X5IA 3KLDA 4L8DB 1FVCA 3KLAB 5IB3B 1U93A 5I1IH 3TYGH 4N0UB 4OD2A 5D93C 5KJRH 1EVUA 3BVNA 1JE6A 1MHEA 2EEBA 4MXWH 43CAA 1INDL 2YMXH 1N0XH 4GLRH 3VDBA 4ONGL 3BEWA 4MNGB 3OL2A 3LKPA 1A6VL 4UV4H 3RWGB 5I1LB 5GHWH 4JQVA 1OARL 3NMEA 3RZCA 2XA8H 1IC1A 4X8XA 3T3PF 2I9LB 5B21A 1GCFA 2JK5A 4D0DB 4WW2A 4CMHB 4MVBC 1FORL 2FLBT 5GSVA 4ONFH 2WLZA 2CLRB 4L3AA 1V05A 4YC2C 1I9IL 2GSIA 4FQXB 1J7VR 3IFNL 1HDMB 4CMHC 1BOGA 3W39A 1BHGA 3HPLB 4X5XA 1A9EA 5A40E 3NH7L 3QNXA 3U4AA 3CVIL 5I8KH 2X4QA 3BO8B 1T7ZA 4GG8A 4HULB 1CXEA 4F7TB 1G7PA 3K4DA 1YEFH 4DN4L 3HE6B 2VLKE 1HYSC 4XVUD 1J8HD 3EYQC 1QSFA 2P8MB 3TH4T 3QB7C 5E8NA 4PB0L 3RP1A 3PV6B 3LQZA 1Z9LA 1SHMA 2VSCA 1SJXA 3REVA 5EORH 4LLDA 1X5FA 3VXRA 1XCQA 3P9WB 1PW3A 1BFOA 5D71H 4OTXH 1HXMB 3PJSB 1AR2A 2EC9T 1KBGL 3QDGE 5L6YL 2VUOA 5C0AE 1AKJA 4U4BA 4E42B 3CU7A 3SN6N 3QFJD 2I24N 1XF1A 4L3ED 1J10A 2AJSL 4K7FA 4ZFOL 3U2SB 2IADB 5C0CE 3KYKL 3T0XA 1UH4A 4FRWA 1KCRH 2W9DL 3MV9B 2XZQH 4J4PA 5ANMA 5I8EA 1KELL 3ARRA 3RVWD 4PRHD 4JRXD 4ZNEA 3S8WA 2OP4H 1JNHB 1RUKH 5BJTB 3NBNA 1IGYB 5BVPL 2DICA 4WWID 3ARGD 4JFFD 2X09A 3HMWL 5C0DA 3A6BH 1UXWA 5ERWA 2D03H 4MAYA 2FATH 4P2QD 4QWWC 5F88A 3O81A 3O9WD 4NRXB 2VDPL 4YX2H 4NRYB 3FJTA 5FHAH 1C16A 4Z7OF 4E41D 5D7LA 4IOIA 1B6DA 2MKLC 4P46A 1MQKH 3OJDB 4H5SB 1KIRA 1HNFA 3ARYA 1TTUA 2OTUB 3ARBD 3FFCD 3KJ4C 2K3TA 1IL1B 3LEYH 4XMLH 5DK0A 1FNGA 5I75B 3U0WH 4D0BB 4QXGH 3QEHA 4EBQL 2DQCL 2R1WA 4Q74A 4X9GA 4ZUWA 3CVHH 3WDIA 2FECI 3WUWB 3VFRA 1DSFH 1II4E 1I7TA 1KXTB 1XIWB 4HIIB 4HGMA 3MJ9A 1F3DJ 4WNQB 1ITBB 4JZJC 1F02I 2V5TA 4BSWA 5I75C 2A73A 1J87A 5FB8A 3NFSL 4M93B 4RNRA 5IVOA 1ZA3A 2DYPA 2A83B 1JN6B 1YJDC 5DD1L 2HT4C 4LSVH 3VXUB 1HQ4A 3STLB 3CPLB 1AP2B 2BNQE 3P4LA 2D4DA 1T0NA 2B7DT 4HBCH 3QA3A 4C55A 1A6VH 2OL3A 1N2RB 4M93C 5I8CB 3I75B 5FO7B 2J2ZA 5IHBA 2R9HC 3IT8D 1F11B 3BI9X 1S7RA 2H41A 3KYNA 2PCPB 3IJHA 4GFTB 1QFWL 1JGUL 2DLFH 3C5ZA 1OD9A 3IFNH 1L6ZA 4L3CA 4FNLH 5FM4A 1FFPA 5HPMB 4HIHA 2OI9B 5ETUB 4FQQA 3MR9A 3MROB 4K55A 4XVTL 4Z7WF 1FZKA 4RISL 3NH7H 3W9EA 3CVIH 4L1DA 5I15L 5IK3A 3G5YA 5KVFL 2VLJD 3KPOB 3WO3B 1NAKH 2HP4A 3RL1A 5FYLL 3DYMA 3SJVB 4DN4H 4NM4L 3TBTB 1ZT7B 2VZUA 5EU7C 5KVGL 3MLVL 4PB0H 5GZND 1RULL 3A6CH 2OXGA 4X0KA 1UVQA 2C26A 4FOMA 4QRPB 4U1MA 4C56B 1SYVA 5C8JB 3DVNB 2YD4A 1L4IA 3Q3GA 5E1AA 3C9NA 1CGSL 5CGYC 5DQJB 4PV9B 4PRPD 1SY6A 5HYJE 1QLFA 5FO8A 5JIPA 1ADQA 1KBGH 2V5YA 2VTFA 4FFZL 1PDKA 1OAZL 3X3FL 4R26L 4NRZA 3UTTA 5DLML 5AYQA 1FV1B 3BAEL 3TIEA 1NC2A 1XGQA 3RDTD 5KVMC 3GHEH 3V4PL 2JJSA 3PGCB 1X5KA 3G6DL 3I84A 1KELH 1IGIL 5EG6C 1MUJA 2IC2A 4KRPD 1S9YB 1YQ2A 4HK0B 3AXLB 2ADGA 4XC1L 4IIQB 1F2XK 4NSKA 1F3JB 1NGXA 3MRBA 1CDHA 1UH3A 2BNUB 1B3JA 4PJ8B 4PJEB 1KPVB 4YHPA 4OFDA 2D0HA 3BZFA 2VDPH 5GRVL 5ICXA 3TPKA 3X3GH 3WJLC 5JHLL 1DQJA 4P5TC 3BP5A 3L1OL 1S7XA 5HXMA 5AUMB 2PN5A 4RMQA 2Z35A 3RY6C 3V6OA 3SKNB 2YUXA 1Q9WB 2HN7A 4PPTA 4AIXA 2VL5A 4RMUA 3P73B 2AV1A 2IQAB 4RFEB 1JYNA 4PRIA 2Y7QA 2AK4D 4Z7UB 5HVGB 2VDNL 1LNUB 1UM6H 1J9CT 4KROC 5DJAA 2CPCA 1ZEAL 5ABDE 1KNOB 4ZPTA 3TN0C 3MMEB 5LCVH 4DTGL 3FB8B 4HKBA 5LQBL 3IFLL 3D0LB 5IV2A 2IGFH 4WWKD 3VXMA 4EUPH 5F1NB 4LVOB 4ZUTA 4RGOL 3I2CH 1H3VA 2ADJB 3CFIC 1ZSDA 3FQXA 2K7QA 4J2XA 3S34H 2YHGA 3B9EA 3OKDA 4HXAL 2W60A 5F7WC 1MJUL 1QQDB 3MLWL 1J11A 3NABL 4PJFA 1HHKA 2B1HL 3E6FA 2G2RA 4KI5C 1NQBA 4HHAB 3B9KD 2DBLL 3JV6A 1CCZA 3NIFE 2H9GA 2J88L 1QFWH 1R5WB 2F54B 4UU9A 4OGAD 1UA6L 4UIKL 3VGGA 1KFAL 1ZLUH 1P7KA 4GKNB 2GJ6A 2O61B 4HIEA 3EHBC 4J3XA 4OD3L 3ARWA 3QG6B 2X4TB 4XVTH 5E7FA 3WD5L 4OZIE 3RY5A 4HH9A 5JXEA 4XC3L 5I15H 2BVQA 1OAKL 1T1ZB 1MCCA 1R3LA 4M6OL 3MCKA 3ULSA 2DQGL 5T3XD 5FYLH 3ULVC 1NGWB 4NM4H 1Q94B 5D1ZB 3BIAX 5HI4C 3AS0A 5B3NA 3ARDC 2KQNA 3DXAE 4RAHA 1RULH 3RPIA 5DVMA 2PW1A 5JHDD 1R3KB 4XPAL 1QHPA 4YNYA 4ORGB 5MI0C 3NACL 3OXRB 4Z7QF 3BH9B 4YQXH 4BM7A 3TBWA 1ORQA 4QHKI 5F1OB 2VC2L 3DRTA 5EZIL 3VFVB 4FFZH 1OAZH 4R26H 3FO2A 1BJ1H 5I1CL 5FYJL 4K23H 5LBSH 1Z3GH 3VMOA 1FRGL 3G6DH 2E6PA 4OLZL 5EZJA 1IGIH 1KIPA 4M6ML 4OAWA 4KXZI 4QO1A 5D9SB 4R0LB 5D7IF 3G5ZA 5TH2B 4Y2DD 3RU8H 1U8PB 1HQRA 4GOSA 4LLWB 4NPYB 2GITA 5DXWA 5E5UB 1NFDE 3BE1H 5JHLH 1PD6A 3UXFA 4WW1B 3MNZB 5E8EA 4EQ3A 3L1OH 3ORJA 5T1DH 1EEZA 4JFQA 1T66D 4UDUB 4R0LC 1U3HA 4QGYA 3WNKA 2G5BB 2R2BB 1OAUL 3AU1A 3FO1A 3HPJA 3IS1X 4MCZB 5EU6B 1X7QB 4EIGB 3SDDA 1X5JA 5F7FA 2DRUA 1JGEB 2Y6SC 4HWBA 4TVPE 2ADIA 2VLRB 2H45A 4S1QH 3MCLL 1AD0B 1H15A 1ZEAH 3RWFB 3C6LD 3MV11 1JP5A 4N8VA 5LAXB 2CUHA 5LQBH 4HJ0C 1EFXA 3JBG7 4LKCB 3GBLA 3MUY1 2KZ1B 5E5MA 1P69B 4I0PC 3NZ8B 5HJ3A 3X11B 2C1OA 4PJXE 4BFEA 3MNVA 1GIGL 3HAEA 1FVDA 4EI5B 4HXAH 2ARJQ 1B90A 1I8IB 2IPTH 4G7VH 1MJUH 4J3OC 4OQ1A 3CDGA 3NABH 1I3RB 4JQXA 2XG4A 3D6GA 4X6CE 1AGDA 1WLHA 2O5ZL 4JVPA 3NN8B 3TV3L 1QFUH 1UB5A 3LRGA 1BD2E 1XCTA 3FB7A 5DD3L 1WTGT 4P2RA 1QBLL 3DX9B 3L9RA 1JK8B 4Q6IB 5FFLA 2L4OA 2H6PA 2NY5C 3HUJA 4RZCB 3ABZA 1KN2L 2NLJB 4IRSD 3S35L 2KBGA 1FH5H 1A1NB 4G8EA 5EC2B 1P7QA 5F93C 1AR1C 2DTML 4XC3H 4Y19A 1C12B 5B8CB 1OAKH 3IETB 3DRQB 5GZOC 2DQGH 4BQ9A 4Q6IC 3BWAA 1OY3B 3PHOA 4XPHL 2WWKO 1F97A 5CILL 5FGCB 1G0YR 4JRYA 5JPMB 1SJHB 1R0AL 3QRGL 4I2XB 1DP0A 5L2KA 1EEQA 3TVMB 4XPAH 2EXWD 4HAGA 3J8F7 5EO1A 5BRZD 4G8GB 4XXCA 3WE6A 3NACH 4BH8B 4Y2OA 3CLEL 5EU4B 3MV8B 5F9WB 3SE9H 2FGZA 2EH8H 4E0RB 2UWEA 4QOKB 3T65A 4M1CD 4I3SL 4JFOB 4XVSH 3DGGA 4G43B 1I8KA 2CK0H 5EBMB 4OZFA 1YEDB 1V7NL 4NUGL 5FYJH 3VG9C 2QQNH 1NUNB 3PQYB 2IBZY 1RIVH 4OLZH 4X8JA 4NT6B 3PWUB 1FLRL 4M6MH 4DEPC 4UT6H 1J18A 2AS5M 3QHFH 1S7SA 1OWWA 4NCDA 2J12B 4I13B 5C08E 3KPPB 1XH3B 1JNNL 2C7UA 3MLXL 1LDSA 4O51A 1H0DB 1WT5A 1CLYL 1DN0A 1E4XL 4Z7WB 4PJDE 4O2EB 5DMGD 1QYGH 3DX6A 4M9PA 2VXVL 5BVJB 2LFGA 2ZPKL 2CSPA 4HMDA 5IG7B 3GSRB 5CIPA 2WBJD 5FK9A 2J6EA 1W2KT 3PWPA 1IJ9A 3EZ8A 3AB0B 3BDXA 4PJ5A 2VISB 4P23D 3RKPA 4RX4D 3B83A 2A9NL 1XAUA 1CGVA 1MCQA 4HKJA 2XN9A 2D4FA 2BC4A 2UYLB 2GAZA 1MFCH 4GAJH 5LWYL 1AH1A 4JY5L 1H3TA 2VIRA 4RA0C 2A6IA 3MODL 1B0GA 2BMKA 2DQFB 4P5KA 3AB0C 1JWUA 2HJFA 5IHZB 1U8KB 2Q8AL 1RPQA 5JDSB 3GO1L 3CX5J 1ZA6B 4PJHE 4DGIL 2Y23A 4XX1G 1MFEH 1FAIH 3L7EB 2HYMA 3MRIB 1RJLA 1P4IL 3O2WH 3MLSH 4RQQA 3LB6C 5L2JB 2J8UE 2O5ZH 1JHKH 3QO0B 5EUKB 1AO7A 4JR9L 1FN4A 1G9MC 4HEME 3C5JB 4MNQE 4PJAF 5FOBA 2ZCLL 3UTSE 5DD3H 5KANI 4P2CG 3LKSB 1E28A 3B2VH 2AAVA 1KN2H 2X7LA 5DRXB 1A6ZB 5BZWA 1SYSA 1NLDH 1EXUA 2ATPA 2DTMH 1K3IA 3LQAL 4U6HA 1XGPB 1M6OB 4AL8L 4F8QA 4HUVA 1IAII 1BIIB 1I3VA 3ARPA 4TPRH 3SDXF 4Y5YC 2N1KA 3BHBB 3ULVH 5T5FL 1IEBA 4XPHH 1T3FA 1QD0A 1PKQB 1YNKH 5TFSH 1R0AH 3DNKA 3QRGH 3VDAA 3MV01 2YSSB 4NYLA 3MXWL 3Q2CA 5ISZB 5GGVY 4G9DB 5DFTA 1WWCA 1DR9A 4GBXD 5GSRB 4ZTPL 4PR5B 3ZHKA 1EHLH 4MAUH 4NKIL 3QDGA 3R06B 4LVNB 5F7DB 2E7LC 1ZT1A 1EIBA 3QUYB 4BJLA 2H2PC 3OB8A 4F3FB 2UZIL 4NUGH 1BFSA 4MXVF 3D87B 3LHPL 2E7HA 5B39A 4PUBL 2AV7B 1HWHB 1FLRH 1FFOB 5CMAA 4J6RH 4W68A 1VEMA 2FIKB 3T0VA 4EVNB 3BYTA 2R1XA 5F1IA 1OAQL 4G6KL 4BFIA 1ED3B 3T3ME 1ZXQA 3EFDL 4GKZB 3W11C 1YMME 3JV0A 1VGKB 3SGEI 4ZSOB 1JNNH 2YPLA 3GMMB 5CP7B 4TSBH 5E56A 4L4VA 2NYYC 4Y16B 2OBGA 2EDOA 4QRRD 5L0QB 1CICD 5JA9A 2Q8BL 2ED7A 4QRTA 1IGJA 4U1JB 2VXVH 3ARFD 3QIUD 4HEPG 3O4LB 1U91A 1H5BB 5MP6H 5F7LB 1RURH 1HOCB 4KK5C 5D7JB 4RAUB 2EDNA 2OJEB 3JTSB 5H8DA 3T1FB 5IT2L 3P30L 4LCIL 5L0QC 1JZ7A 3O45B 1JFQL 1TVBB 5I1DB 2A9NH 4LSPH 5KSUA 5IROA 3RUGA 4G5ZL 4UV7L 4MWFA 1UG9A 4PP1C 5LWYH 3GBNL 3KPSA 3T0DA 4LHUG 3ZE1E 2X1XR 1K5NA 2R2HA 4N1EA 1MVFA 2DB8A 4XX1E 1RHHB 1G6RB 2X4OB 4U6XA 3ZHDA 3GO1H 3DVGA 1CU4H 3MRHB 4DGIH 4RAVA 4LNVA 1XF2A 3BH8B 4KJPD 4GQ9H 3M07A 4PP2A 5SV4A 2J5LB 5MERA 4MVBD 3PGFH 5C0BB 5C70A 3ARUA 2ATKB 3SKUD 1MH5A 5D5MA 3F7YA 5D7IB 3BZEA 1X5LA 3SY0B 4OFYA 5EO9B 3B8SA 4OKVA 1P9MA 4M4PA 3P4OB 5F9OL 2NY5H 5KN5B 2CH8A 4NIKB 3RA7L 5SWSA 3R1GH 2Z31B 3HLAB 4HUXB 2EIBA 4LLVA 1JRHL 5IBTL 2DLTA 3NCFB 3MV7E 2X4PB 3EO9L 4FQXD 3T1WA 3BQUA 4KTEL 1HYSD 3EYQD 4U6TA 3T0BA 1IMHC 4TNVK 5I6XC 2IH3B 5IEHB 1CZ8L 4OD2B 1U41A 2XA3A 4IBLT 4YHKH 3MRGB 4S11A 1FVEA 1QRNE 3HE6D 5J3HC 4ZTPH 3MRRA 3EW3B 2VDOL 3T77A 3BEWB 1EGJL 3LKPB 1LO0H 4NKQB 4F15B 4KPHH 7FABL 4P5MB 1I75A 2APTA 4NKDA 4QRUA 3VCLA 1UQSA 1ZLVK 1GGBH 2HRLA 4L4TA 3P3YA 1CL7I 3OX8A 3WFHB 1XR8B 3TP4A 4K7PY 2CDGB 4URTB 3LHPH 3G6JB 1BQHB 1RUPL 1KOAA 1EUTA 4ZOEA 2HFFA 2JB6A 4FQPA 1U92B 2GSIB 1IM3A 1BLNB 5INDA 4U6VL 3MRFA 4ODVL 4FA8A 3VFPB 4G6KH 5C07A 1G7HB 3MV9D 2NZIA 3BUYA 1LEGA 4G9FB 2PXYB 4M8QB 2V17L 2XXCB 1TFHA 4BSVA 3KLSA 4H1LA 5ID0A 1CQKA 3I6GA 4M6AA 3QEQE 2W9EH 2BSED 2XACC 1ZANL 2I9TB 5IB5B 1KIQA 4HJJL 5D1XB 3I3BA 3RNQB 1T83C 5KW9L 2DL9A 3TIDB 5FM5M 1OW0A 1T6WA 4XNMA 3VXRB 3T0AA 1XCQB 5IT2H 1NMBH 5GGVL 1VADA 4Y4FA 1JFQH 1UM5L 2XWTB 3TNMA 4HT1L 1AD9A 4KHTL 4MD5B 5D1XC 4UV7H 1XIWD 3UX9B 1HCFX 3UZQA 4WU5A 5CBAB 3IVKA 2DLHA 4AG4H 5A1AA 1VENA 3VFMB 3NOIA 3NCEB 4NQDA 4WI2A 1JGDB 3GHBH 1TZIB 1FLTX 3HG1A 4EN3B 4ZS6D 1R24A 3VXOA 3BEVB 3MGAA 4NHCL 4ZUSA 4DVBA 4NO2A 4KK6C 3RWIB 4G80A 3VXUD 1JHLL 1P2CB 2R9HD 4XPFH 2J8HA 5ERWB 1UXWB 5HGHA 5H37H 4MAYB 1YZZA 3TJHD 4DN3L 3QIWA 1DBJH 1UC6A 4AYFA 1G6RL 5CSGA 1EO7A 4EN3C 1DANT 2ICWJ 1OCWL 3HC3L 4R90L 1T0MA 3PGDA 1MVUA 3RA7H 25C8L 4KVNL 5MEOA 1P4LA 1MJJB 1BX2A 4JHWH 4XAKE 2PW2A 3VFRB 2FO1A 1LGVA 2BNRE 4CJ1A 3EO9H 3GJFB 3IGAA 3RZWA 3ALWA 3VGEA 5BS0E 1WEJH 1AGFA 2QHRL 1ZLUK 2NZ9C 2CLVA 3R0NA 2DQTL 2IPKA 4YUEL 4PJCF 4JFXB 1NH6A 1FIGL 1ZA3B 3QQ9C 2QL1A 4U1SA 2UWEF 5CGYD 1U0QA 4G8FB 5I19L 2BY2A 3QUMB 3SJVD 1AE6L 4KY1L 3D2UB 3JV5A 3PG2A 1T0NB 4NCC2 1NANI 5HYSB 3FT3A 3BN9D 4OV5B 7FABH 4FQIL 2GQHA 4QRPD 5GGRA 5I9QC 5FF6B 4C56D 4Q9QL 1CE6A 5FHBL 1QO3B 3L95B 1UKTA 2BRRL 1AJ7L 1EBPA 5IWLC 4FZ8L 4OCXL 3S7GA 1S7TB 2DIAA 2GIYA 4WUUE 1S7RB 3DX7A 4FFWC 2FRGP 4QNPE 1E27A 2AGJH 2IPUK 4TTDC 1JI1A 1SM3L 5MHSE 4JFEB 5HI5C 4U6VH 1CFBA 4HCRA 1WBXB 5C0EA 3FQTB 4PJAB 3D39B 2WW8A 1MAJA 4MGXA 4ETQA 1NFDA 3W9EB 3AREC 3QH3A 4LL9A 4XGZB 2V17H 3U4EB 3OKMA 3MRPA 5F9AC 1DE4B 3MUZ1 1KJ3L 2HKHH 2DI7A 3OKNA 4OCYH 4PJ8D 5KS9F 1BBJB 1MCHA 3S37H 4KFZC 4OD1L 4M7KL 1ZANH 4OLYL 4KUCF 5GRVK 4XWGH 3SDXB 1XF5A 3RWJA 2BDNH 5J8OA 3U7YL 3C9NB 5J12B 3A0OA 4Q0XL 5GGVH 4NZJA 4QGTA 4U7MA 3TN0D 2XQYK 4Z77A 1U8IB 1WJ3A 5B38G 1UWEL 4OCMC 1KYOK 4PJ9A 3VWJB 5HVHB 3L3OB 4ELMA 1JYXA 3UYRL 1G7JA 3ZYJA 5D2NC 5J4MA 4ZOBA 1QG3A 5IB2B 3CFEA 2W0PA 3H42H 3P0VL 5J1SC 3F7VA 4Q9RL 5EIIB 4GUPA 3RIFK 4NHCH 4GQPH 5HVHC 3E2HB 1U2HA 1JHLH 3TEUA 2ENSA 4GAYA 4ENED 2JE8A 1NGXB 4JO2L 5JOPE 3L6FA 3IKCB 3K2UH 4ZD3L 3I3DA 1G6RH 4CBPA 1ULVA 3VGHA 1FL6B 4YK4B 1YNTA 5JORA 4R90H 5FUCE 5EFIB 1KJ2B 5DJYA 5F7MC 2Z35B 4M6NL 3KXFB 3D3VE 5DHYA 3QCUH 3EBAA 2NW3A 1FFQA 25C8H 3RWDB 2ZP0T 5GS0C 1CG9A 3LRHA 4J1UA 2NX5E 3V6ZA 2VL5B 5CEYB 2R23A 3ULVD 3IJYA 3T2OA 1OTUC 3KPRE 3GM0A 3WFBL 5HI4D 5CEZD 2H32A 1MJ7H 2P5EB 4YUEH 3QWQB 4ZPTB 4WI3A 3V0WL 3WFDH 4ETYA 1FIGH 2ESVA 2DL2A 4HKBB 2AVGA 5FDWB 2OJZL 4F9PA 1L7IL 5I19H 5D1ZD 1AE6H 1WC7B 3MJ9L 1NJ9A 4KY1H 3G9VA 1QSEE 5HHQB 2R69L 3FQXB 4HS3B 4U6YB 4XCFL 1K6QL 3SPVA 4RDQF 3S96A 1F8TL 4FQIH 1T89A 2H3NB 2M8XA 2W60B 2A74B 4X7SH 4A6YA 2CMRH 3KPQB 3CSBA 2BRRH 1AJ7H 3AMLA 2AJZA 3LN4B 1Q9KA 3OBAA 1EO8H 4H8WL 1S7QA 3JV6B 4NQED 5D7SL 5I76A 2H9GB 4JGUA 1UKSA 2OL3L 4UU9B 4XHJD 3BPNB 5BOZG 5J1AA 1RMFL 3LDBB 4OM0L 1U8OA 2Z92A 4XTRC 5C9JB 1FL3B 3C6SB 3WS6A 1NEUA 4HKZA 4DGVL 4KH2A 2ADFL 3ULSB 5DYOB 3BIKA 4QY8A 1INEH 1TJHH 5ENWA 4OLYH 3E3QE 1LEKB 5KAQG 2GJZA 2QSQA 2X9XA 3KJ6L 4YDLC 3RBGA 3RPIB 2PW1B 4R3SA 5KSVA 2AI0L 4JY4A 1HHJB 3VGDA 2FD6L 3VFTA 4KDVA 2YPKA 3TBWB 4Q0XH 4TRPL 2IANE 1IGFH 2DI9A 3L3DA 3S4SG 5IMMA 2W65B 1J1OL 2F53B 1H3GA 3INUL 1BP3B 5EU6D 2L7UA 1SBSL 4OI7A 3FO2B 1MQ8A 1G6VK 3DTXB 4OZGE 1ZHBA 5EBWA 1BVKA 3MLUH 4ZOAA 4NP4H 1WIUA 2VLRD 4UBDC 1N3NA 2FL5B 5AD0B 1SY6L 1W0VA 2E7BA 1ADQL 4K7PH 2WM0A 1KIPB 5TGBA 3ULUE 4D0CA 2HLFC 4LSQL 4APQB 4O2FB 2ZJSL 1RU9L 4YEEA 4YHNA 1HE7A 4UINH 5D5MF 5L8LB 1R3HB 2D7QA 4X4ME 4ZS7L 4X4ZA 1HQRB 1LO2L 3GMNA 3P77A 2EIZA 2ICEA 4UTAH 4PTTA 4ZD3H 4KJWC 4QYOA 4IOSD 4EI5D 4O9HH 3RRQA 5IFAH 4OIBA 1B2WH 3NIGE 4K9EH 1EEZB 3BP4B 4APQC 1QA9A 4M6NH 1CXKA 1J8HA 3GBML 3K8MA 4KHXL 1W72B 3RQ3A 1AR1D 1KF9B 5HHMB 3HPJB 4KQ3L 4X5WA 4YAQA 2E3VA 5CBEA 2LAGB 2ZSVB 5GZOD 4TNWF 5GISL 4Y1AB 4F7CB 4OCSL 4ZOCA 4MJIB 3U9PL 1LO4L 1EBAA 2FX8H 4XRCB 5KANG 2MQ0A 1XR9A 4N5ED 1U6AH 2CKNA 4UOW1 2LTQB 4N8VB 3CXHK 4ODTH 3QFJA 5FCUL 4HWZA 3FHAA 3GJFH 3VXTA 2Y4SA 4L3EA 5DURB 2A6DA 3GNMH 1NMCB 1HEZA 2HFEA 3CH1A 1TCRA 4M5ZH 2R69H 1KCKA 2C1OB 4JRXA 1K6QH 1T04B 4XCFH 1ZLWH 1RV6X 1F8TH 5DJ6A 4I0KA 2LTQC 4G8GD 4JFFA 1RZKH 3W82A 2EO9A 1JF1A 3GRWA 1TNMA 3MV8D 3QUMH 1AGDB 5HVFB 3IFPB 3O9WA 4O5LL 2EDBA 4NJ9L 4QOKD 3HMXA 5ADOH 3BJ91 1UB6A 4BFGA 3BSZL 4WUKL 5HY9A 2WZPD 4LAJH 1RJYB 3L9RB 4PV8A 5DHXB 1T6VN 1NGYA 3ARBA 3FFCA 2H6PB 1LE5B 3KPNA 3EO0B 3PQYD 3MRKA 4W70A 5TQ2H 2JCCE 2DM4A 2WWKT 3VU2A 2G5RA 3QPXH 2BY3A 1GC1C 3LPGA 4GMSH 4Y19B 1KXVC 1MELA 5GGQL 2ADFH 3L3JA 5TF1L 3GMLA 1T5WA 5D2LE 4OLUL 3HZVA 1D7FA 4MDIA 3U0PB 3ILPA 4X98A 4JRYB 3GMOA 4LPWA 2DIJA 2LQRA 2E6QA 5L2KB 5LGJA 2KQMA 5CGMA 3WE6B 2OR7A 4W6YB 4NNYB 4PJCB 5CD3A 3SGJC 1RJZA 2A1WL 2ICCA 4PRAA 4S1DC 1JF6A 1DUZB 4GW4A 1J1OH 4UUJA 3INUH 3CX2A 1VFAB 4XBPA 1RHFA 4LGRB 2D2OA 5HD8C 1I8KB 3AS2A 4JGJA 4WFHE 5MENB 5JPNA 1IRAY 2X4SA 3P9MA 3VI3E 1JZ4A 2YZ1A 1SY6H 2PTTA 4XNYL 2ZKHH 6FABL 4MA1B 1UZ6E 3A67H 5DVOA 1ADQH 4BQ8A 3NIFF 1Y0LB 3I02A 4LSQH 2IH1B 2ZJSH 1S7SB 2BJMH 2VJXA 3L7FA 4EXPX 3ARQA 4LCCB 4ZS7H 4B0MM 2SEBA 3WXWH 1LO2H 1F90H 1F6LL 3U6RB 2R4SH 3EYFB 1KENH 4MA1C 2VLJA 2C7UB 3RJQB 1G7QB 4JVUA 4F2MA 4OZIF 3IRZA 1YEHH 2VXQL 4I3GA 3H3BC 5GGUA 3MO1A 3O3AA 4LCCC 3VXSB 5JXAH 1FPTH 5GS0H 4WV1C 5JOFB 4LRIA 1YEIH 3KPLA 3GSOB 1A4KB 1B0RB 5GISH 5KS9B 2Q86A 3WN5B 1LO4H 3PWPB 4PRPA 1VGEH 3BP6B 4ZFFB 5H94B 2XY2A 2XOTA 1W72L 4H25A 1CR9H 2KKQA 2DKMA 4PBXA 5T1KA 1J0ZA 1X6NA 1YNLL 2XN9B 5FCUH 3PWJB 5F1KC 3PWLB 2BC4B 4L8BA 3K0WA 4QRQA 5FYKU 4HWBL 1JPGB 1AFVH 4Q9BA 3RDTA 3LPFA 2YA1A 1U3YA 4FQLL 3UDWA 1MREL 4UOW0 1M05B 1SVZA 5EOCL 3UO1L 5ISZD 4XP5L 4NN5B 3T08A 1QBMH 3V79C 1RUQH 2KUTA 2NY0B 1RJLB 5T3ZD 1AO7B 3C60B 5GJSL 3MRMA 3QUYD 1JJUA 3BSZH 3Q6GL 4MA8H 1NFDF 4NQXA 2V7NB 1F45A 4K71B 1XF3A 1NEZG 5BZWB 3KDMB 2VXSH 1SYSB 1FHGA 1EFQA 1EXUB 3C60C 4HJGB 2NYYD 5GGQH 2AK4A 4S1SL 3F58L 1NBVH 1ZV5A 2EC8A 2KDGA 2YK1L 1TVHB 4LBEA 1XFPA 4OLUH 3RGVB 2F5BL 5I66B 2VLKB 3PWVA 1IEBB 4N68A 4K71C 3OKYA 1T3FB 4DJMA 3H7BB 4NQCE 1TQBC 2ZOKB 3DARA 3QCTL 4KK5D 4NYLB 1QR4A 3C5SA 4Y16D 4ZYKB 4HXBH 4WWKA 3MRDA 3RGVC 4EOWL 2A1WH 4ELMF 2H26A 4KJQC 1JNLH 1GH7A 2A6KA 3O4LD 1LO5A 2XTJE 3QDGB 5C0AB 5D7JD 4PP1D 3D69B 1T2QL 2O26U 4JM4L 1QVOB 1M7DA 4F9LC 4WTZA 1BFTA 5C0CB 4WI5A 1SJEA 3B9KA 4XPGL 1N64H 3GK8L 2QADC 4XNYH 3X12A 2DLGA 5CJXC 1MPAL 3U9UA 5B39B 4XMPL 4PJIA 3UPRB 3TC9A 2YPVL 1JZ6A 3WUZA 1Q9LA 4X6BB 4IMKC 1DDHB 5FM8A 1CLCA 1FGVL 2R1XB 3UJJL 3EJJX 1HHIB 3ES6B 4PGDA 2YD8A 2YPLB 3NFPB 2K7PA 5J1TC 1S8DA 4X7TA 5CJBA 4L9LB 3WIIH 5C0BD 3ZKSD 2B4CL 3V8CA 1KLFA 2FB4H 5IEKB 1IGJB 3QQ4A 3PL6B 5JHDA 5SWQA 2ZUQB 5IBLD 4HFWA 4ZPVA 1G9NL 4M7JL 4HWEH 3IU4L 4EJ1C 4PLOB 5E94A 4YFLF 4L9LC 4K3JL 3VG0H 2Z31D 3IDJA 2RFXB 1W72H 2NR6C 4Y89A 3W9DA 1J0HA 1X5GA 4RSVA 4XNQB 5KSUB 2FEDC 4RCAA 1YNLH 4DK3A 3LKRA 1I1AB 2CJUL 5C6TH 2ZUWA 3JWNC 4GXVH 1CD1A 1KXQE 1A7BA 2Z91A 4I0CC 4HWBH 2BNQB 4MMZC 5DSCB 2J6EL 4LLYA 2HWZH 5T1MA 5TE4L 4WTXA 4MS8C 1MREH 3GGWA 5FGSA 3V5HB 4JDTL 3UO1H 3DVGB 4LSSL 4XP5H 4RAVB 1JWSA 3B3IA 1QLRA 1U8QA 2J8OA 4Y2DA 3VFOA 3LQAC 2YS4A 5JQ6L 1YC8A 3V7AG 5DUML 1N5YH 3QCVL 4WIQA 5KSAC 4RA3A 5GJSH 3HAEH 3TO2A 2X4RB 3BZEB 3JZ7A 5E7BA 2E27H 5CLTA 4OKVB 1MF2L 4KAQH 3IDMB 5T1LB 3FQWB 5C1MB 2F19L 5FYKE 3Q5TA 1QEWA 5EDXA 3ZDYE 5H35A 4M7ZB 3EDEA 3K74B 2G9HA 1UWGL 4PJDF 4J7RA 4LK4A 1T21A 2H8PB 3QI9C 4OCRL 3O6FA 2AEQL 4LLVB 3MJ8B 2GK0A 1HKLL 4S1SH 2I60L 1WAAA 5JNYA 3UTOA 5IQ9B 3BQUB 4MZ3A 1PY4A 2X1QA 3MBEC 2F5BH 2HTKC 3C6LA 1I4FB 4G9FD 2PXYD 2IAMC 2ZCHL 1JWMA 1KACB 2VLME 3L3IA 3MC0A 4D9LH 1KLUA 1PG7X 1ZTXL 1FVEB 5T33H 5HHOE 4YR6A 5HYJB 3MRRB 4CW1A 1QKZH 1JZ5A 1DQDH 2WBWB 2CKBA 5D1XD 2HJLB 2EDQA 3EOBB 4XBEL 2PO6C 1HXYA 1T2QH 4GKOA 4L4TB 4P3DA 1G7IB 4JM4H 5DK2A 2QSTA 4PJHF 5EC1B 3VXRD 4AT6B 5EIVA 5C0FA 1CT8B 2XNAB 4LVEA 1WBZB 3GK8H 2J8UF 3PUCA 1MPAH 1U2CA 3L5HA 4XMPH 1SMAA 4KK6D 2HFFB 2JB6B 2YPVH 4KUZH 3BKCL 5EB9A 2LVCA 4LFHG 4F33B 5CJOL 4V1DE 4OZFH 2ZNWA 1PEWA 3UJJH 4IRSA 2BOBA 1LILA 2YC1A 3EYOA 3Q48A 4JQIL 3JUZA 4EN3D 2DTSA 2OK0L 3DO7B 1LEGB 3BD4A 1B4RA 3UTPD 1QFWI 3IYLW 3QNYB 3U1SL 4MAYD 3WKML 2B4CH 1S5HA 2NY1B 4LCUB 3LV3B 3ARTA 5BRZA 3IFOB 2NZ9D 5A16B 4M7JH 3UAJD 2XICA 1VHPA 1IBGL 2IALA 3PP4H 2OQJA 4LNRA 2NY7L 5FUZH 4Y4FB 2NY1C 2QHLA 1ZHNA 2D7TL 3TNMB 4CVZB 2DD8H 2NY3C 1ZHLB 5TPWH 5CIPH 3ZE0F 5IMLB 4JANB 1A6TA 2J6EH 1XT5A 2ED8A 5E2WL 4NQDB 3EGSB 1JGVL 3RVVC 4Z0XA