1T4KB

Crystal structure of unliganded aldolase antibody 93f3 fab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
217
structure length
217
Chain Sequence
b'EVMLVESGPGLVAPSQSLSITCTVSGFSLSDYGVSWIRQPPGKGLEWLGVIWGDGSTYYASALKFRLTISKDSSKSQVFLNMHSLQTDDSAMYYCAKHTYGGPGDSWGQGTSVTVSSASTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG1, KAPPA LIGHT CHAIN
publication title The Origin of Enantioselectivity in Aldolase Antibodies: Crystal Structure, Site-directed Mutagenesis, and Computational Analysis
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t4kB01
1GIGL 4W4OC 4G5ZH 5FCUL 4OZHE 2BP3A 2R2EA 4LASL 1S7VA 5T1MA 1CLYH 4N8CH 3V6OA 4PJAB 2XG5A 1LP9E 4LCYB 1JWSA 3L5XH 5D72L 1NMCB 1Z3GL 2DIBA 3VFNA 2P5EB 3L3OA 3VGBA 5E2TH 2QR0B 3FFCE 4PD4J 2MHAA 3OGCA 2ESVE 4LNRB 3TT1H 2DQGL 2QADD 2ICEA 5T3ZE 4Y2DA 4I2XE 4LGSB 1NCBH 3BD4A 1ZMYA 4JZOB 4WW1A 4H0GA 1CE1H 1JUFA 4F7MA 4IMLA 4NRXB 1OGAE 2DLEA 4LRNL 5DRWA 3KPMB 3IVKA 3T0WA 5JIHA 3M8OL 3JWDH 4KKAD 1P4BL 3CLFH 1CE6B 4PJIF 5DFTA 5ADOL 4LHUG 5I75C 5D96B 3LEVL 2BMKA 2JF1A 2VXUL 4OFVA 3BP6A 5JW3H 3BKYH 4XP9L 1QPPA 4AEIH 3RA7H 2LTQB 3S36L 5TE6H 1FSKC 1XF3B 2DQTL 4FQ2H 1N5AB 3O11B 3KLHD 1PSKH 5IEKA 1MAMH 2WAHA 1YMMA 2Z35A 4L1DA 2DQIL 1CFQA 4NP4L 3MLUH 4JVUA 1IGFL 5SWSB 1YEKH 4JZNB 3BUYB 1CGSL 1ND0A 2YA1A 4EBQL 3CVHA 3HR5B 5TF1L 3KLSA 3HE7C 3O4LD 2IH3A 3VXNB 1I7UA 4JFPB 4APQB 3WN5A 4PJHB 1UB5A 2GJ6A 4JY4B 4NBZB 4OV5B 3IFLH 4ZDHA 4X9GA 3GSXB 1ZLSL 1ONQB 1KLUB 5D1XA 5HGBB 3MNVB 2OQJA 4X4XA 4JQXA 4PJGF 2B39A 4Z76B 2P1YA 1I9EA 1C5CL 2FIKB 3UYPA 1U8NA 5DEGB 2VDNH 4QRSB 2Y5TA 4L9LB 4K9EC 2C26A 3MLWL 2BSTB 3QB7C 5M95B 2XWJB 4YC2C 4AT6A 1CLOL 5DJCB 3RQ3A 1EV2E 2EIBA 3ISWA 4JDZA 2VMFA 5BJTA 4G7YL 1IAMA 4NDMA 5L2KB 2DWEB 2EYRB 4RSVA 5IFHH 4L3EB 2W91A 5I15H 3NH7H 2EIEA 5ID1A 1J0YA 5D7LD 2BFVH 2EKSB 4HH9A 3IU4H 3PQYB 5LAXB 1ZGLA 1ZTXH 4EI5D 1J1OL 1K3IA 1KPUB 2DMCA 5CIPH 2LU7A 4ZSOE 2YHGA 3WDIA 1LEIA 4XC3H 5GIRB 4PRHD 1ZXQA 1FP5A 4WVRA 5K9QI 1JNLH 2Q86A 5MENA 2YEZB 3FQTA 5IK3B 2CK2A 2BDNH 3LY6A 1D6EA 1GSMA 2VLLA 2MFNA 1VADB 3RDTA 2WP3O 3WFCH 1NAML 4ZO8A 1F5WA 2OR9H 3MROB 1INQA 4NGHH 4I9WE 1VFAA 1HINH 5E6ID 5GQBA 2VIRB 4LCIL 4UQ3B 4JRYD 2IAMB 2EEAA 3DMMC 2W1NA 4PGBA 3MGAA 3OB0K 4XCYB 5IEHB 1RK0A 1E27B 2R0LL 1H15B 5D5MF 2V5SA 2A6JA 2E6PA 4I18B 4G43A 1YNLL 5DUBA 4X5XA 3QDGB 4NQSB 4NQCD 3GMPB 3X3GH 1XF2B 5EDXA 2YUVA 5AWNH 3UTTB 4ORZC 2WUBL 4FXGB 4D0BA 1S7TA 2VQTA 3KPNB 5I76A 2ITCA 3MV8B 1H8SA 5EU4B 1A1OB 1EMTH 3ZYOA 3V5KB 1M6OA 4X98A 2EO9A 5ESVA 2YD9A 3HC4H 5DQJB 3CDFA 5E99L 3SCMD 3HZVA 3G5XA 2ZKHH 2AXHA 1JHKL 1PJ9A 1WZMA 5BZWA 3BIBX 4X0KB 1R3LA 5JO5B 1M71B 3QPQC 3F12A 1NMAH 1G7LB 2C1OB 3LVEA 4EOWL 1HE7A 4D9RE 4BFGA 2OK0L 3Q48A 5BQ7A 3KPQA 3KYKH 4Z95H 4KDWA 2XZCH 1AJ7L 5DMKB 3BHBA 4PJ5E 3C6LA 5HYJB 5C0BE 3E2HC 3QRFM 3FTGA 1CZ8L 1MAKA 4WUKL 3AB0C 3LEYH 1RD6A 2AXJA 3O81A 3LPFA 2ZCLL 3CSGA 5KSUA 4RFNB 2WMPA 3U46A 1B4RA 2R4SH 4NFBA 5CLWA 3I6GA 4OLWH 4YAQA 1QBML 2NY7L 3C2AL 2PXYA 3NIGF 3AS2A 1VEOA 1IVLA 3RAJL 1DQJA 4YGAB 1K6QH 3VFPB 3DV6B 3TP4A 1SJEB 1TLKA 5HHMB 5EZOH 3ARDA 5F89A 1U8OA 1HK6A 4CMHB 3BZDA 4U6XA 4E41B 2CIKA 2G9HB 4YHYB 4UTBH 2RB8A 4LFHG 4P2OC 4KROC 5AUMB 4OLXH 2HRPL 5ISZE 4ZOCA 1T4KA 3T4YA 4G80B 1HHJB 1CICC 2AEIT 3D39D 3BEWA 3BVNB 1AQKL 1U92B 4AIOA 1QR1B 4L4VE 4ZFZB 3ZDXE 3WYRA 4YEFA 4M7ZB 1NBVH 2AQ2A 4JPWH 1T1YB 1UQSA 1BOGA 1XGPA 2VE6B 4WI5A 3WXWH 3WFEL 5C9JB 4N68A 5J3HC 3HAEB 3L1OH 1Q9LB 4HAGA 3NFNB 3C5SA 4J1UA 2X9XA 1BF2A 3VFOA 3IRPX 1LDPH 1U8HA 4GKOA 3WIIL 4S1RL 2EIDA 2C7UA 4LPVA 1RFDH 4OB5L 1F3JB 4IMKC 3G5ZB 2X4RB 4JM2A 5ICXB 3ARGD 5BRZD 3QDMA 2FO1A 4R8WH 2A0LC 4G6FD 2QHLA 2V7HB 1J1XH 3P40A 1KTDA 3TCLA 1EBAA 4FQHB 3EYUH 1IEHA 5I9QC 2ZJSL 5EOTA 2X4NB 1JPGB 5DMJB 1CGUA 1F97A 4P3WA 1BEYH 1NUGA 3LHPL 4TSCL 4FQLL 5EO9B 5DMGD 1K8IB 5ESQB 1QNZH 4MAUL 4QXGH 1I9IL 5C0CB 1EFXD 3OJDB 4M02A 3IDJA 5HGHB 1KELL 2VLKE 2XRAL 2AJZA 4PGCB 1U8IB 3B83A 4H1LG 3W2DL 5A43C 4R96A 4C56D 2XZQH 4K71C 1L9MA 3B9KC 3IAQA 3VG0H 3ARRA 3C6SB 4P5MA 1QUNA 4ODUB 1JNHA 5MERA 1I7RB 1YJDC 2QQKL 3ULUC 3BIKA 1MCKA 4OCYL 4UT6H 4XMLL 3EFFA 3GUTA 1A9BA 4RGNE 4XVTL 4JG1H 2DMBA 3U0TA 1E28A 1JGVH 3GMMA 3LD8C 4NO0D 3HE6D 4YDJB 3GGWA 3HNVH 1UVQB 2HP4A 1QACA 4OZGE 3TIEA 5IVXA 1OTTC 4JFEA 3LKPB 3VD3A 2IBZY 3I6LE 3VXUA 1KEGL 1V8HA 3ZTJH 4K7PL 2BRRH 5AAWA 4I4WA 4KK9C 4R7DB 1JHTA 2KPNA 4EVNB 4ZXBB 3SGEI 3M1BA 5GHWH 3STBA 3K0WA 4KH2A 3I75B 3P4NB 2MNUA 4G3YL 5FHAL 4YK4C 4G9DB 1A14H 4M4PA 1NBYA 4RRPG 4ZNEA 5DJAB 5SWZD 4Y8AA 3T0BA 3FJTA 1D6VH 2HTLC 4Z7NE 1T66D 5GZNC 3S7GA 1OP3H 5M7QA 3TBWB 1PG7L 4OLUH 3UAJD 3O41B 5IW6B 2FEDC 1J7VR 1CU4L 4WTXA 1J8HE 4I3SL 1KJMB 3PDOA 3QWOA 5I1IL 1MLBA 3MFFB 1N0LA 4L8SC 1FN4A 2YSSA 4HZAA 3BEVA 3EOBA 1JPSH 1Q9KA 3OKYA 4ODWB 4AENA 5A2KH 1UB6B 2BSRB 2J88H 4U0QB 2IANE 1CFSA 4K55A 3MBEB 4PJEA 5ILTH 5C0JA 5E94A 3KPLB 4HFUL 3SOBL 4C57C 3BD3A 5KJRL 4JGJA 3HUJA 4OLZL 3VD4A 4NJ9H 5DUML 3AREA 2F74A 1XR9B 2D2OA 1ZK9A 3OSKA 4UIKH 1I1FB 3MV7D 1PY9A 5ID0B 5T3XH 5CJQL 4MLIA 5GGUA 2R2HA 4NHCL 1FNHA 5IB2A 3D6GA 3A0OA 4IRSD 1CXLA 1U3HC 2QV2A 4HWZB 5CEZL 4LAJH 3SJVB 3Q6GH 4WUUD 4MHHI 4ONGH 4PJ8A 2R2BB 5LGHH 2JJTC 5E1AB 2VITB 3OPZL 1YECH 4N0CD 2ZUQC 1NUDA 2VXSH 2IBGA 4YBQC 1PAMA 2R69L 4G8IB 5I18H 2CO7B 2APXA 2MWCA 1RIVL 4JO1H 5KSBB 3WHE1 2IADB 5F7LB 1EAJA 4OAWB 4O58L 5E9DD 1R3JB 1LP9F 3T08A 1D5ZA 3SKJL 1EUUA 4ZO7A 2EYSB 1FPTL 1SJXA 4FXKA 4M3KB 1XF4B 1Q0YH 2BNQA 5CBEB 43CAB 3N1QC 1ITCA 1HWGB 2PTUA 5T5FL 3SKNA 2QADB 4X7TA 5I73C 2XTLA 1TJGL 2I5YH 4ZUVA 5F7WC 3NOIA 4LSQH 4NIKB 3L3DB 4ZAKA 1CK0H 5B39A 1QFHA 2VN7A 3H9SE 1FJ1B 3L3GB 1OM3L 1FGVL 5FOBA 4QCIA 3VI3F 4MNHA 2GT9B 5DHVA 5IT2H 1JZ4A 4UQ2B 4LEOB 4NOFA 4XVSH 3HI6H 3F6IA 4DVRH 4JRYA 5EOQH 4K7FA 4P4KC 1OP9A 4OCNC 3WLWD 1R5IA 3RJQB 5DQ9A 43C9B 1DP0A 5HYSA 3U36A 2PCPA 1KTRL 3J8F7 4PBVC 1YJDL 3BPNC 4NQCA 1LEKA 5I1JL 3TF7C 3U9UA 4M6OH 1V3JA 1CG9A 5DDHA 1AGDA 3W11D 1X5YA 3S4SB 2EXWD 4HUMB 3JVGA 3OXSA 1JPFB 3HAEG 3FOMA 4TULH 5FYKD 4GBXD 3CPLA 4OD3H 4IDJH 3D18B 4GO6B 4QRUB 3LN4B 2EDDA 1KFAL 3S35X 3K4AA 3W0WE 1X5AA 4U49A 4XPFH 1KN4L 3DX9A 2GTZA 1O0VA 3D3VA 5FKPB 4YJZL 4DOHE 4GG6E 2LAAA 1AO7E 1QLEH 4I0PC 3KPRD 2CLRB 3EYFA 1AIFA 5JW4N 4R90L 3K81A 5AD0B 4KKBC 1DUZB 5DT1L 1CCZA 2NY5L 2OTWB 2E8ZA 4HG4J 5HVWA 4U0RB 4YDVA 4CNIB 3R1GL 4P9HH 3E1F1 3FB5A 3P73A 4HJ0D 5DRXA 4HBCH 5C0EB 1A9EB 1FG2A 2OX5A 5D1QD 2ARJA 1CXIA 3MBXH 3W82A 3FO9B 2VH5H 3OHXB 5D6DA 3TJHD 3ARTA 1ZT4B 4NWUH 5MP6H 1JF1B 1QSVA 3QI9D 1N64L 3MV9A 1FNEA 1GZPB 3OAYH 1PGRB 1CLZL 4OF6A 4LLQB 2WINA 4XNYH 4KU1A 2C3XA 4M7JL 5DHXB 3CXDL 5BXFB 5D7LB 4PS4H 4YGVA 2VZSA 5DZNA 4EI5B 3VCLB 4Q6IB 5EBLA 1RIHH 1JGLH 4I77L 4PRHB 5C07A 4X4MA 2R4RH 3HB3D 4MWFA 5C0RH 3ULUE 2ZUWA 1MPAH 1A7BA 1G6RB 3RRQA 4MJIA 5EORH 1JV5B 4OCRH 5I8EA 4NQDA 4BYHA 4GAJH 4MQXC 2PW1B 3RVWD 4KJYB 4GFTB 1JWUA 4ODBD 3O3EB 2JIXB 1CT8A 3C5JA 1BWWA 3BE1L 3G6DH 1MFEL 4AEHL 1DBJH 4LLDA 4PRBA 3D39A 1T5XA 5IOPB 1MFCL 4UOW1 5JZ7C 3L7EB 1SYSA 4WV1C 4BFIB 3DX6B 2CJUL 3B6SB 1AFVH 2VYRE 2X4OB 1PLGH 1U95A 1K9TA 4OFKA 4U1HB 1H9VA 4X6BA 2C3VB 1GC1L 2CRYA 3IFNL 5CIPB 5IKCB 5AZEL 3CU1A 5E4IA 1KOAA 4OFPA 3QG6A 5FK9A 2FD6L 4LARL 5CKGA 1W8OA 1RMFL 1JTTA 1W0WB 1JFQL 3FHQA 3VWJD 1KT2B 3WV0A 5D93C 1RZGB 4XTRC 3SCMB 3MCKA 3ARBD 1AP2A 4KI5D 4O2EB 5SV4A 2QQNH 5JDJA 2WLYA 4JQVA 2Y7QA 1F00I 1F3DJ 1BJ1H 5F9WB 1EPFA 3WKML 3DGCR 3M45A 3ARGA 3QUML 1RUML 5EH1A 3A6CL 1KTLB 4NO3B 2VLMD 2ADGB 1EAPB 3KYMB 4N1EA 1FORL 2N56A 1TQBB 4J6RL 5D7KE 1LE9A 1AI1L 2Y9RT 3U7AA 5CSBA 2AJUH 2HFFB 1VA9A 3QJFA 4BZ1L 5GRUH 5ICZB 1HQRB 2WBJA 2EDKA 1RZ8B 3MJ9L 5FGRA 5F1IA 4ONFH 3FO2A 4LASH 4NQEA 3KR3L 1CFTA 4JO3L 2PO6C 3GEWB 4A2MA 3U0WH 4N9OB 3BN9D 3ZTNH 5ANMB 2VL4A 4M3JA 3KJ6L 1Z3GH 5AAMA 2HFEB 1OB1A 2Z93A 3F7YA 1KSRA 3NCMA 4O9HH 3ZKSD 3GMOB 3RWFA 4OSUL 4A6YA 1U8MB 1B0GB 4GW1B 2DQGH 1FHGA 5CINH 4M93B 3UC0H 1H3VA 1G7PB 1BVKB 3F7RA 3G04A 3VI4E 3SDCB 4RX4D 3LKRA 2DQDL 2FGWL 4NO0A 3BGAA 3HE6A 3M8OH 4RAVA 4JPKL 5EU6D 1P4BH 4KQ3L 3EDFA 1DQDL 3MLYL 3IJSB 3W9DB 4PJDA 3V8CA 4GAFB 1VKXB 4ZFFA 3LEVH 1P2CB 1GZQB 2EDTA 5E5UB 2H45A 1WISA 2VXUH 4PRNA 4XP9H 3V95A 3QUYD 2COQA 1S7UB 5D7JC 2HT3D 2D03L 5EN2B 4NJAL 1NFDA 2CKBA 2XQBL 3EOAA 3UXFA 1T0MA 3MOAL 1WJ3A 1D5BB 2AV1A 1CQKA 3OAYK 2R1WA 2DQIH 3ZDXF 3GKWH 4XNUH 1ED3B 1YUHB 1AD9A 4WW2B 1IGFH 2VAAB 3G6JB 1CGSH 5HVHC 4PR5B 1KC5L 3ARYA 5JORA 5E8NB 4ZD3L 4O2CB 4WO4D 4M5YL 1DBML 5HPMB 4NO5A 5B8CB 5IB5A 5HI4C 4Y4FA 5EZLB 2H6PA 3LCYA 5I1EL 2D0GA 3GSQA 2Z4QA 1RHHB 5BRZB 3VFRB 3SDDD 4ORGB 5C08B 3MJ8A 1IJ9A 4G6FB 1C5CH 1U36A 3Q0HA 1DUYA 4LL9A 4JDTL 3S36X 4KDTA 3MV7A 4NQXA 3MLWH 3VFUB 2BOCB 2UZIH 3V2AR 1IM9B 4IRSA 4GRWE 4X4ZA 3VGAB 1IC4L 3BZFA 4AM0A 5E6YA 3QDHA 3FOLA 1JI2A 1N7ML 4ISVA 1FVDA 4PRDA 1EFXB 3L5JA 4LLWA 5L2JA 3MREA 5DFVD 4YX2L 3L3KA 4JGUA 1VFBA 5J6HA 4QHLA 3IF1A 4LLYA 1K85A 1UWEL 4HCRL 4PJCA 4C56B 1KIPB 1JZ3A 1QHOA 3SDAC 1FC1A 2APVA 2FX9H 4ZUWA 3RGVC 3FQUB 2PYED 3SE8L 2R8SL 3LKSA 2B7DT 5J1AA 1TETL 3C5ZD 4G6ML 4K3GA 1EJOL 4Y4KD 3BZEA 3MRPB 2EDJA 4N0RA 3HCVA 2I07B 3TA3C 4FQIL 5FYLH 2EO1A 2XTJB 3ES6B 4M8QA 3H42L 1Q72L 4RWYL 3RIFK 3BJLA 4GRLD 2GKIA 1LDSA 5E0QA 2VKXA 1LO0H 4OZGF 1GXEA 4LMQI 1YNLH 2C4FT 5D1ZA 1AHWB 4YHLH 2XXCB 3QXAA 1Y0LB 1IQWL 2Q7YB 1CDIA 3H7BA 3REVB 5KS9E 5KSAA 2WANA 4Q0XH 3SO3C 5IB1A 4ZG1A 4K23H 5SWZB 3O6FA 1FFNB 4RMRA 1CFNB 3WJLC 4Z0BL 1MI5B 2V5RA 2EC9U 1MCWM 4GBXA 2M2DA 3GSOB 5EBWA 4Z7NF 2P45B 3KWWA 3MRMB 4H8WC 4IOFC 2D7OA 2H1PL 3N1MC 4O00A 4O51A 1JK8B 1BFOA 4PLOB 5HHOA 3S34L 3PL6A 4ZUUA 4EOWH 3QCTH 1KENH 3IDIB 1EHXA 5HHVH 4F8QA 2OK0H 2IPKA 1VFUA 2DJ4A 3KPRA 1BMGA 1I85C 5LCVH 4NKMA 3DSFH 1AJ7H 3MLZH 5EBMA 1WQVT 1FDLL 4R6UA 4XZUB 2G5BB 1IQDA 2V7NB 4WUKH 4ELMB 5F1SA 3VFSB 4KQ4L 4Z7VE 5IBTL 3SKOA 1WC7B 3NTCH 1R3IL 3ZDZE 4YHMH 1OAYH 1PQZA 2J8UB 5ADPL 2XN9E 1SHMA 4XVJL 1Z9SA 5F88A 5IMKB 2P44B 1FNSH 4WTZA 3IDNA 2DI7A 3BMWA 4WFFE 3QA3B 5AEAA 4BFBD 4WNQA 1R6VA 2P5WB 3D25B 2I9LA 3X17A 1VACB 1PFCA 2JJVA 3MZTA 4HDIA 5E9DB 4PLKC 32C2B 3L9RB 2XQYG 1GGYA 3WS6C 3IFOB 4PRID 1ZHBA 1Z0NA 4MXQC 3TVMC 1KGCE 1I7ZB 1G7HA 1IGJB 1Q0XH 2HRPH 2FR4B 2VDLL 5GGVH 1WFOA 5B38A 3U82B 1OF2A 1ZT7A 1P7HL 3FN0H 3VXSA 4JGMA 3CIQA 4PJBA 35C8H 4ZTOH 1AQKH 3B8SA 1U3ZA 2Z31C 1A6AA 2YZ1A 1I3UA 2AI0L 4WHYH 2DQCL 2X6MA 4UNUA 4TTGA 4ODTH 5BV7H 3DXAD 5T5NF 3HG1A 4NPYB 3RTQB 4P4RB 4IIQB 3TWCH 1UH3A 4RAUB 2BERA 1JZ2A 1CGYA 3FZUC 1KPVB 5JHDE 1BQLH 4K07A 4KUCF 4P5KB 5DD0L 3MXWL 2WLZA 2GK2A 2FGZA 2QHRH 5E24E 1HOCA 1LNUB 4OZHA 3MGOB 5D7SL 3Q6FA 2XFXA 4S1RH 1MHHA 1NJ9B 3GSWA 5D2LE 4HWEL 1SJHA 5I16A 2NY2D 3MRLA 2DQUL 2P4AB 3BYYA 1T1ZA 2WWMC 3H9YA 5TDNA 4LIQH 4LCWB 1YY9C 2FBJL 1WZ1L 2Y36H 4X4YB 3S5LB 3FFCA 1YDPA 3O6KL 4K94C 1NBZA 4Y4HA 3IKCB 2H32A 2FJGA 4DWHA 4F7PB 2C5DC 1JRHH 3RWJB 4YWGL 2VR4A 4JHWH 1GHFL 4GG6F 1EBPA 1GYAA 3QIWD 4ENEC 3NA4A 4MAUH 4JFHE 4PREA 1N0XL 5J6GA 3GHBH 3SY0A 1OD7A 2OXHA 3RZCB 1OY3B 3QDJB 5C2UB 4OZIE 1KELH 3W39A 4HJGB 3DUSB 4GAYA 4HX1A 2UVFA 1AGBB 5H8DA 2MCPL 5EU7C 4OF3A 3GSRB 1MQKH 5DURD 1IE5A 1YPZA 4PTUB 1A7QH 3NVQA 5D1QB 1IFHH 4UINL 4JFFE 4FQXC 4JKPL 1ZA6B 3DMMD 5BS0B 1XCQB 4H25B 12E8H 4Y5YA 4U1MA 3N1GC 1Z9OA 2ID5A 3QI9B 2QQKH 1XIWB 4HFWB 4JY5L 4WI9A 3TESA 3FO0L 4PJXE 4ODXB 1BFVL 2A83A 4G6AD 4F9PC 2DLHA 4XVTH 3K8LA 4WEBL 3QWQB 1YY8A 4XX1G 2LABA 1IGCH 3KNBA 1S5IH 4P2QE 3O3BA 1RK1B 1AR2A 4RX4A 1RUPH 3MFGB 3LKQB 3MUHL 1V3KA 2EXYD 4RA3A 4Z7WE 3QAZC 5E2WH 2R0WH 4K7PH 3UZVB 4DW2L 1OTSD 5FECA 3ULUF 5CEYA 2YZ8A 3WFHA 3RWEB 1WAAE 1KEMH 4HUXA 4CKVX 2ZOLB 4S1QH 3NA9H 5FHAH 4X8JB 3QUKA 4IRZH 2RQ8A 4LLUA 3FONB 2N7AA 4BKLB 1HEZB 5DSCB 4QOKE 3QEHA 5LWYL 3VD9A 1J5OH 1PG7H 1ZLWH 1EHNA 1VENA 3DSNA 3KPSE 5EOCL 4MMXC 3ZHKA 2AXFB 4M00A 5EU3A 3T2QA 3HPLA 4HAFA 4G7VH 3K8MA 3IU3B 2E8YA 4G9FB 4S11A 3WLBB 2VXQH 3ILPB 4BQ8A 3X12B 5DQDH 4AMKH 4HHAB 5DVKA 4WO4A 2P8MB 2LQRA 5LGJB 4MSWB 1MWAH 4MAYD 4OIAA 4DZ8B 3ARBB 4OLZH 3V6ZA 4M5ZL 4K7PX 3ZTJG 5I30L 4ZSOA 1Y6MR 4WWKC 3D0LB 5IHLB 1UXSB 2EECA 3WO3B 3QUZC 2IPTL 3B9DA 1NGYA 3UROR 4LAQL 2AK4B 2B2XL 2FWOB 5FA3A 1H5BB 3MCLL 4YBHA 4X7SH 1LK2B 1YEDB 1R5WA 2DLIA 3OAUH 1E4WH 1PG7X 2R2EB 3OPZH 4BA8A 3C08H 5F7DB 4M7LT 4KROD 3SE9L 5ACZA 5I0DA 1RUAL 2R69H 5HHNA 1YEHL 3MRDB 4CDHA 5I8OL 1OPGH 2X4UA 3EOYG 4LVNB 3L3OB 2VQ1B 4MJ6A 3QQ9D 5ALCH 2X44D 4O58H 4XPTL 1KIRB 1M7DA 1RUKL 3OX8A 1HH9B 2GCYB 4G6JL 1GGCH 4K94L 1XR8B 3LIZL 2F19L 5FO7A 1MRDH 4OCWH 3QHFL 5T5FH 1XGUB 2IC2A 2PYEA 1UJ3A 1TJGH 4TQEL 5DJ2B 4P48A 1DEEB 1TTGA 3GO1H 1FGVH 1FFOA 5I0ZA 1J10A 2VLJD 5CEZD 1UJTA 1XGYL 1U8JA 2B5IB 1KB9K 5E6ZA 4HKJA 3QT2A 5EU6B 7FABH 3F65A 2FNBA 3VI4F 3SDXE 2X70B 5AYQA 1T2QH 1VFOA 3SGDI 3FT3A 3VGGA 3EYSL 1DBAH 2MSPA 4NCC1 1IILE 3QUYB 3B4NA 4IRJA 1T6WA 4GW4A 3C8DA 4P3DB 5GRVL 4XC1L 5GGTH 1ZWIA 5KSVB 4OZFA 5D9SB 3L3HA 5C0BA 5IEKB 4DEPB 4HS6A 2ED9A 1MFBH 1NGQH 3ZKND 1YMMB 4U31A 3TO4B 1ZT1A 4N0YH 5JDSB 2ITDA 3MZGB 4UILL 5CGYD 3S96A 4F15C 1FYTB 3TYFB 1KJVB 4N8PA 3TBTB 1FVCA 5ECJE 4XAKD 1ND0B 3ULVC 1RJZA 1E4XL 1EO8L 1NAMA 4FMKA 3T0AA 1KN4H 5EC2B 4W4OA 1B90A 2AJVL 4LPUA 3QIBC 4G6KL 2NNAB 4POUB 1VSCA 3V4VH 1MNUL 3QXVA 3GJEA 4GG8B 3D0VA 2YRPA 2IPUK 3MRIA 3SGKC 4JFYB 1WGOA 1CGTA 1RJLB 4XCNA 3SDDB 1UENA 3SKMB 2A2QT 3MR9A 2X4PA 1G7MA 1OAKL 5F93C 4CMMB 2ZUVA 5IB3A 3FHAA 2DQHL 3L7FB 5IHZA 3C8HA 1X5ZA 4QRRD 1S3KH 4K8RC 5HGAA 3NCEB 4DK6A 2P24B 3MUZ1 3KDMB 4PJ7B 3STLB 3P0YH 1NMCC 4GRWF 1L6ZA 3KLDA 1IGTB 1FIGH 1CLZH 2ZOKA 2E7BA 1QSZA 2UYLA 2DAVA 4RCAA 4L4VA 3PWJA 1U0QA 4XI5C 1I3VA 3VXMD 1MHEB 1UKSA 3D85A 1LEIB 1WEJL 2R56L 4KRPB 3VXTB 1O7SA 1DQLH 1OAZH 4Q2ZA 4OLVH 4P46B 1D6EB 4LPCA 4J3WA 5C70A 3C5ZB 4Y4KB 4Q9BA 5DUPL 2NY1D 2JCCB 1MCFA 1I8IB 3V4UL 1TDQA 4KAQH 4K2UH 3HRZA 1FZKB 4XX1E 3FQNB 4AZ8A 1AGFB 2DICA 2HYMA 5D96C 4PGBB 1KJ2L 4AEHH 2IFGA 4HIXH 3GHEL 3V5DA 3BXNA 3DO3A 3HE7A 1S7QB 4GRLB 4ONHB 3UJJL 2IG2L 2LTQC 1ZLUH 2HTKD 3RPIA 3VJ6B 1T03H 2EIZA 3KVQA 5HHPB 4NKOB 3MYJA 2CJUH 3EO9H 1XGQB 4XRCB 2GI7A 3MLRL 3QEUA 1OT2A 3AXLB 5BO1H 2OLDA 1GC1H 1C16B 4OF5A 2ZSWA 5ESVB 5AZEH 5E8DL 1A0QH 2A73A 2IFFH 4EUPA 4WI8A 2FX7H 4I3RH 5T1DL 1N3NB 4F8TA 1RMFH 3CGTA 5TDPB 1S78C 5KS9F 4RQQA 2NMSA 5JTWA 4A6YH 4MD5A 3SHSA 1NFIB 3ZHDA 3CFCH 3HMXL 4APQC 5F21B 5JQ6L 1MAJA 4HWBA 3QUMH 1NCWH 4YBQD 2XNAA 3BH8A 3QQ3A 3JWOH 4J6RH 2D7NA 4OUUA 3KPQB 5DJ8A 4UMGA 3IAPA 4HUNB 2X05A 1FO0H 3BHBB 2NTFA 1DE4A 5T1KD 5E5RB 1T83C 4BZ1H 4W70A 4L9LC 4AY0A 2QQQA 3FTGB 5E08H 1J8KA 5GS1B 1BREA 4BH7B 3U2SA 5CSZA 4HKZB 1F6FB 1OAXL 1WV7T 1HKFA 2LU3A 2V6HA 1B0WA 1DSFH 3ULVL 2XY2A 4ELKB 2CKBH 4QF1A 1TIUA 4Z7VF 1QSFE 5L0QB 3ARWA 4XNMB 1Q94A 1J87A 3ZDZF 3MACL 1RZIB 3O45A 4QXWA 2A74A 2X5PA 1DQJB 3DUUA 3T0XA 3DMMA 4U3HA 4KMTL 4OZ4B 1RU9H 4NO2A 2FJFB 1QO3A 4DAGH 3NABH 1T7XA 3GB7A 4FG6C 1EIBA 1U8OB 5B3JE 4EDWL 4H0HB 2CLVA 3V4PL 4QT5B 4M6AA 4U6XB 3PHQA 2R9HC 5TDOB 1SYVB 2EE3A 4BUHA 3I3DA 2DQDH 4IBLT 1J8HA 1KNOB 1GVIA 4KQ3H 1N2RA 4OCSL 3MLYH 5C09B 3VH8A 2V5MA 3ZL4L 3T4YB 5GGRB 3H3KA 5F97E 5FGBC 4QRTB 2IAMC 4YDIH 1JGDA 4D0CA 1HSBA 1MF2L 5L8JB 5FYJL 1FZOA 4JEGB 3BEWB 1BZ7A 2C9AA 3UBXB 3MOAH 4MNGE 4BK4A 4XCEA 3MPCA 4K3EH 2XYCA 4N0FB 3O2VL 4L3CA 1BOGB 1CF8H 2XZZA 3DXAB 1L7TH 2E5EA 1J0ZA 4GKSA 2H8PA 4K3HA 5E8PA 3IXTA 3QUXD 5FO8A 4HUUA 4EI6A 4F37K 4LVHB 3C5SB 1BHGA 1MCRA 4IJ3B 2VTFA 4Y1AD 1TPXB 2O5ZH 4M5YH 1DBMH 1QSEE 2BVQB 2FL5A 5IG7B 3FT2A 4KK6D 2PW2B 4S0SD 4HGWB 1I8LC 3ECBA 3C8KA 5I1EH 4JM2B 4YDLB 4JKMA 2NY2B 3QDMB 4ZPVA 1BJMA 4KHXL 5D2LF 2F54D 3TJEL 3B3IB 5EOTB 1MJ7H 4V1DA 3VRJB 2ZCHL 3RNQA 1VCAA 4PJ9D 1KB5L 7CGTA 4MA3B 3NBNA 3RP1A 4IOSD 5BV7B 3FRPG 2BY3A 3RVXD 1IC4H 3ORJA 2VDMH 1Z5LB 1GCFA 5IM7A 3O3DA 5IBUB 3IS0X 4POYA 5LJYH 4L29B 2Y6SD 4RFNC 1MVUA 4GXUN 1J05B 2VRAA 1B2WL 1NGWB 4P2OA 5IVZA 2IALB 1QFWM 3EHBD 5IF0B 4U7KA 5C0AD 4F33A 4OZIF 1UWEH 3AGVA 2CXKA 2YPLD 2HJFA 2YA0A 2M8XA 5I1LB 5DURB 1S8DB 4L8CB 2CDGA 2NPLX 3OF6D 5DO2C 2F9BT 1C12A 1CICA 1O7VA 2GIYA 2R8SH 5DK3A 4GQ9H 4W6YB 2YC1A 1DR9A 4P0DA 5HY9A 5JZ7D 4CMHC 3HNSL 5FXCH 4GUPA 1A9BB 4KJWC 5DHYB 2H2PD 3U0TB 4MD4B 4OJFL 4B41A 4PJXF 1J88A 5E8EB 3QH3A 1ZVSA 4FQIH 1RZ7H 3QFJD 4PGDB 1XGTB 2ZCKL 1UKQA 3OXRA 1DCLA 3VXUB 3QHZH 3W0WA 1WBZA 4AIZA 3KGRA 3G6AA 3QNZA 1IL1A 4XNQB 1JHTB 2NYYC 5EU5A 4GG6A 5TH2A 3MXVL 2EDQA 4X7FC 2XI9A 4Z7WF 5FB8A 4NOBA 4CVZA 2OSLB 4M7ZC 4IMKA 4MYWB 1IQWH 1QEWB 4IDLA 4OQ1A 1CDHA 5IQ9B 2D4FA 2H3NB 1WWAX 1L0QA 1P7QD 4MNQD 2J6EA 1WAAF 4U1LA 3HTLX 5E2UL 3PDOB 1PKQE 4P57B 1FNGA 3RX8A 3CK0L 1P7KA 2Q87A 1T21A 2AK1H 2YSSB 4HUVB 1NC2B 2ICCA 5GJTL 3RVUC 1AQDA 3EOBB 4AENB 2PO6D 2VLRE 5FGCE 3RNKB 4N90E 3MRHA 4LSVL 3MRNB 3L5WA 1NCNA 2VABB 2XPGA 4NHUB 2WWKT 3EDJA 4JDVB 1GGIH 1M05B 4CJ1A 1A22B 3HUJB 1A6VL 1OCWL 2F74B 1BX2B 5INCA 2P49B 2R1XA 4PJHE 1NEZA 5C0FA 3I9GL 4YXKH 1J18A 3VFVB 4ZYKB 4NN6B 5IBTH 1UFUA 1ZE3C 2A6KB 3DNKA 2Z92A 2YD6A 1R3IH 4DKEL 3FL7A 1XGRA 5EWIL 1EGJL 4HIIA 3IDGA 3MMEB 3VRIB 5J06A 1KCVL 5C0GB 2BHUA 1D9KD 4ZTPL 3KJ4B 4P2RB 1T0NA 2GFBB 3BKJL 1RJYB 3ZYZA 4NNXA 4HK0B 5D7JD 4L3EE 4Z5RB 1KG0A 2CIIB 2HVKA 4MDJA 2YRLA 3CC5A 5GS0L 1MWAB 3QCUH 1IC5L 1Q9WB 4U2YA 4AH2A 4C83A 1IZKA 5K9KB 3MRCB 3R0NA 5A2JH 4TNWF 4L4TB 3M17A 2AXGA 2ATKB 5HVFB 2I24N 1FE8L 3RWCA 2VLJB 4MNHB 1JGEB 4U1KB 1CL7H 4L8SA 4JLRB 3F62A 1HXMB 4ZXBC 1P84K 2DQCH 2MKWA 5CD3A 3TO2A 5C0DA 5HI4D 4FQQA 5ETUB 4KGLA 1ROWA 1ZHLB 5EPMA 5HYSB 4EXKA 1DL7L 4RA0C 1UM5L 2H9GA 2DYPB 3HI1B 1YEJH 2PCPB 3SDXF 5E1HB 1L7IH 1LEKB 1MJUH 3D2UD 3T77A 1G7JB 4HT1H 5LKNA 1BAFL 4HIJB 4Q58C 5DD0H 2EDRA 5GS2D 3QDGE 3FOMB 3NIDE 1OWWA 3ME0A 4JVWA 3O2DL 1JF6A 4G8EB 2P7TB 1INDL 3E6FA 3V9FA 2IH1A 1CR9L 1U3HA 4FTVB 1MRCL 1YYML 2WIIB 2DQUH 1UCBL 4GLRH 3T65A 5HYQA 4MCZA 4PYGA 2J3SA 1WZ1H 1R24A 3ZE0E 4WI3A 2ESVD 4FQJH 5GGSY 1X6LA 2JJTA 4QHNB 1I1YA 1IT9L 2EDXA 1FVEA 5GZOC 4U3CA 2B1AL 5ALBH 5DR5L 2EKJA 4TVPL 3QJHB 4UU9B 2FB4H 4NM8H 1LE5B 2V2TB 5IHUH 5F72S 1LO2L 3SDAD 2NW2B 5DK0A 2VR9A 2WSKA 3GRWA 2UWEA 2GJ6E 4HC1H 4WHYG 4PJIB 1JIBA 1IBGL 4U4BA 4RMTA 2YUXA 3FB5B 4MVBD 5IBUG 4MB3A 1VDGA 5IMOB 1OWRM 3VE0B 3QPXH 4PG2C 2W9DH 1MUJB 5F3HA 2ARJB 3HS0B 4WCYL 5EUKB 1IGMH 3BKCL 1BIIB 1CXKA 3O9WD 1A4KA 4XBEL 3MV9B 4LNVA 4UV4L 2H26A 4OGXH 2WINB 3FO0H 1BFVH 1AD0B 1T1WB 4JFDE 4P4KA 3LMJL 3VXMB 5F8RC 2J8OA 1N5YL 4DVBA 3FQWA 2XV6B 5C07B 2QADC 4MWFB 5HHME 2C3HA 3CFDB 3F6LA 4NQDB 5DK2B 4E41E 2Q8BL 1BQHB 5CKAA 5DJ6A 4M1DH 3U4BH 3MJ9A 4DW2H 4XB8A 3KLAB 5J9PB 1F02I 2NY1B 3OJ2C 4KKAC 4EKXA 3ARUA 1E6JL 2X1QA 3PP3H 4IOFD 4PJGB 1LK3L 4LLDB 4LVEA 3S37L 2HLAA 1T5XB 4MCYA 1UM4H 4RDQG 3VXPA 5LG1A 3CFEA 5DRNB 4DN3H 3PWPB 5HDOA 3PE9A 4I0PA 4WU5A 4ZOBA 1YNTB 3UPAA 3U4EA 4GKZA 1MCOH 1NDGB 2CUMA 1RZFL 2OJEA 3Q1SH 3KLHC 1FFPB 3RUGA 1HHHA 1UA6H 4PRPD 3TM6A 3GK8L 3BH9B 5DD5L 3ET9F 1MLCA 4N0UA 3QO0A 2DM3A 5J1TC 3BWAB 4XHJD 4Y1AA 2HT4D 3MCKB 4X9HA 2I9TB 5CZXC 3DETC 3OJMB 4NZDA 1FYHB 3GSUB 4YHPB 1GPOL 3T1FB 4N9GB 3E0GA 4M5ZH 1IKNC 1S9VA 3LZFH 4PJFA 5DRZB 3WUWB 3L6FA 5DMIL 3INUH 2AEPL 3O4OB 3NACL 2X4TA 3LKNA 1NC4A 3WL9B 1NAKL 1T22B 2B2XH 4OQTL 5DEFA 2BY2A 4JFXB 2BVOB 2UV3A 5T1KB 3CDCA 4O5LL 1MOEA 1NKOA 4F7CB 1MCNA 2DJUA 3ROOA 1QFUL 3FO2B 5EFIB 5D5MB 2DD8L 3BJ91 1D7FA 2B0SH 2APWA 4Z0XB 1BM3H 2HVJA 5SWQB 1YEHH 3E3QE 4FMFA 2VZUA 5I8OH 5C0CE 3DVNB 4Y2OA 1JNNH 2FECL 1ZA3B 3H9HB 3EO1B 4XPTH 4LSUH 5C0AA 3BPCB 2NY0B 1RUKH 3IKKA 4XP1H 3B43A 3X14B 5KVFL 4WWID 4U33A 5KN5A 3UZQA 3NGBB 5C0IB 5KS9A 4EI5C 3QO1B 4WI2A 3QUMB 1WBXA 2B1HH 1ADQL 4Q6IC 1CTNA 4WV1A 5EOCJ 1F3RB 3QULB 2ICES 3LKRB 5I2IA 3LQAL 4HD9A 1SY6L 2IMNA 4H5SA 5B3JF 1IMHC 1FO0B 3K8KA 5DFWH 4KHTL 3OG6B 1XFPA 4GAGH 1MCLA 3BKML 1DDHB 2ADIA 3BO8A 3DURA 1QRNE 1SVZA 3BP5A 3ZZ1A 3KG5A 4PRNB 4RMWA 3EYSH 4PGEA 5E6IC 4D9RD 1ACYL 3CMOL 5TE4H 5HYSG 3HMWL 1DVFB 1X5LA 2HJKA 3EGSA 2CKBB 3U7WL 3H3PL 3UYRH 4PJ5D 3EOAB 4HCRA 5I1AA 3IDUA 4PBWD 2VISB 3G5YA 4NN7B 3T4AB 4MNQA 4UILH 4Z7UA 4ODSL 4RGMB 4WY7L 3VWKB 2X7LA 1XAUA 1AD9B 3DVGB 3WS3B 4ENED 4HIHB 3K4DA 4U1JB 3LKOB 4AL8H 1E4XH 2BVYA 1EO8H 5GGQL 4MA7L 5HD8D 4F57L 4Y5VB 5TGBB 2UY6A 1KIQB 5EO0A 2PUQT 1A7RL 3GSVB 3SCMC 1KCRH 4G8GD 2DQJH 1JNJA 4HKXB 2PO6A 3WXVH 1YNKL 3LRGA 1JWMA 5JMOC 2A6IB 5F9WC 5I8CB 5C0NC 2H6PB 3REWB 3JV0A 1GGBL 2BZDA 1CLYL 4N8CL 3L5XL 1TQBC 1R5VA 4QLRA 3Q3GB 1QLFA 2BNRB 4FQ1H 1A5FH 4P3CL 1HH6B 1OAKH 2NX5D 5DJ0A 2DQHH 4YR6B 5E2TL 2CDFB 3G08B 4PJ9B 3PV6A 3WE6B 1LO4H 1PBYA 3DYMA 1YA5A 3TT1L 2XWTB 4Y16D 4HUKB 4KV5E 3P4MB 5EIIA 1OD9A 1FVDB 2XZAH 1P4LB 4UIMB 4BSVB 1NCBL 2NY3B 4LLWB 2BHZA 4E5XA 5FDWA 4HW6A 1CE1L 3TBVB 3TT3L 3L3KB 4MJ5B 1Q1JH 4LHUD 2X9WA 2ZUUA 4N8VA 3BRGC 1WIOA 1T3FB 2IQ9H 3JWDL 2DI9A 4ZUWB 3CLFL 2YPLB 1U91A 1S7WA 5D7JA 4EUPH 1QOKA 4M93C 5DD1L 5JW4M 4HS3B 2EE2A 4C4KT 4LF3A 5J1AB 3JTTA 5JW3L 1MCBA 2H41A 2LVCA 2VZ1A 3RA7L 5I1HL 3SDCC 2YBRB 5TE6L 1I4FB 3HCVB 5DUPH 3FKUS 3D87B 3WHXB 3P9MB 1K5NB 2NTSP 3B9EA 4HWBH 4FQ2L 1BQHG 1UC6A 4O4YL 4U2ZA 3V4UH 2AV7A 4YHOL 2BOBB 4OI8A 4YUEH 3MOQA 3N06B 4XWGH 1MAML 3QFJB 4NT6A 3V5HA 1ZOXA 3DBXA 4UUJB 1U8LA 2BK8A 5IVXE 2DKMA 4JFEE 5DJXB 4ZUTB 1YEKL 4IOIA 2UUDH 4JHAH 5CJXC 4U1NA 3CFBA 3Q2CA 3IETA 1MFNA 2GITA 3H0TA 2AGJH 1XCTA 3GJFH 4NQUA 4WWKD 4JRXA 1G0DA 3EFDL 4M48H 3D2UA 1U3YA 3VFMA 3IFLL 1XT5A 2FJHA 4X6DF 2VLKD 4WW2C 4OZIA 5I17B 5ESAA 3EJYD 2EDEA 2PF6A 1T20A 2NR6C 3OR7A 1ZGLM 2VB5A 2VDNL 3OQ3B 3HMXH 4MMZC 3DRTB 4B5EA 1C7TA 3IJYB 2EZ0D 4DGYH 5F44A 2Q8AH 5B8CC 5FYKU 5HHOB 4DKAA 4LCCC 3CD4A 2A6DA 5F1KC 3E6HB 2V2XB 3QISA 1I3RB 2YRZA 4CW1A 3ARGC 2NW3B 3X11B 4G8FA 3O4LE 3SDAA 4PJEE 3LN9A 5I15L 3NH7L 4NKDA 3VA6A 5GRVK 3RGVA 3GIZH 2BFVL 3RWHB 4P2QA 3VGAC 4WEMB 1K2DB 2PN5A 3QNYA 4Z7WA 1CD1A 2NCMA 5E5MB 3T3ME 3TA3A 2BDNL 3QHTC 3MACH 5L9DH 1YN7A 1P4IH 3JTSA 4OUOA 2GK0A 1D9KB 1NCTA 4KMTH 4LLVB 3A6BH 3HLAB 3SO5A 3HRPA 2HG5A 1JHLL 5KTEL 4NGHL 1HINL 1EH9A 2RFXB 4EDWH 1PKOA 3D48R 1IEAA 4CN6A 5I1DA 4HDIB 3KPSA 2R0KL 5I66B 5IFJB 3QNXA 4G42A 2YUZA 3X3GL 4PRHE 4YIQA 5AWNL 3S88H 3WJLA 2XTJC 2J12B 3UP1A 4UDTB 1EMTL 4FFVD 1U8PA 3MJ7B 4O2FA 3ULVD 1MF2H 4OT1L 2ZG1A 3HC4L 3BP7A 3CSBA 1IEBB 3QIBD 4CVXA 1S9KC 5JOPD 1IAOB 4LKXA 1AHWC 3HG1B 1W72A 3LV3A 5DTFA 2ZKHL 3MSPA 4P59H 4M1CD 2YD7A 4JRYE 1IGYA 3NFPB 4D3CL 1I85A 5F1OB 4OBRA 5DVLA 1NMAL 5L88L 5DA0B 4PP1D 4J3XA 4WHTB 2GTWB 1A6ZA 3FB6B 1UWXH 3UAJC 4NQCE 2YD8A 3KYKL 4Z95L 4JN2B 3W9EA 2XZCL 4W81A 2DI8A 2Q6WA 4EDXA 4JE4B 5I6XC 3GMLA 3MUGA 4NC1E 3JV5A 1LP9B 4PV9B 3O3AB 3UJIL 4YEEA 5IV2A 3AM8C 3CZFA 3MRKB 3FFCB 5FYJD 5FM4A 1LO5A 2ESVB 3TJEH 1FIEA 1H3PH 3ALWA 1NBZB 2P5ED 3KAAA 3OKLB 4F3FA 1CTOA 4L8BB 4OLWL 1KB5H 3ZE0F 3D3VE 4I2XB 4XI5D 3BDXA 2D7QA 1FL6B 1S9WA 2UUDK 5E95B 3DYOA 1OGAB 2I60H 5KVGH 2C1PA 1MY5A 5EZOL 3JBG7 1XH3A 1U42A 3WS6A 1B2WH 3TVMA 4LFHD 1VFMA 4UTBL 4KUCD 1JZ8A 5KW9H 4N0CC 4XVUD 5EZIH 4NUJB 5ANME 4OLXL 3MRFA 5JA9A 1A1NB 3O9WB 4J3VA 4LDEB 2Z31A 1KYOK 2A83B 4E0RB 3V0WL 1DANT 3HZYA 1N8ZA 3PIQA 5EUOA 2PETA 5I74B 2V2WA 1YY8B 2GJZB 5D7IE 4YHNB 2A38A 5EO1A 2B4CL 4OJFH 1D5IL 3DROB 3KNBB 3IXAB 3MO1A 1NBVL 4JPWL 3I85A 5CZVL 1HILA 4MZ3A 4O02H 1YMHA 1WLHA 1K4CB 1WBYA 3EW3B 1B0RA 1VESA 3CCHA 3ILQD 4NC0B 4XPBL 3WXWL 4X5WA 4X4ME 1AO7D 2KBGA 5SWSD 2BVPB 4U1IB 3A67H 4MS8D 3MXVH 3L1OL 1ZVHA 3IFPA 5K9OB 3STZB 4W4NA 5FKAA 4NQTA 3T8XA 1A1MA 2CPCA 2VWEC 4APQD 5I71B 1MCHA 1EK3A 1EEZA 3ULUH 4PP2B 1TXKA 4LLUB 1LDPL 3RTQC 4RIRA 3WLWC 1O5DT 2R23B 4RBPK 1RFDL 4JANA 5HJ3A 2Z9TA 5KG9A 2WBWB 2HJLB 4L8DA 2IWGA 1ZLVH 3D39E 1JP5A 5E2UH 3DTXB 4R8WL 1RQ5A 2DM7A 1EERB 1J1XL 4BH8B 5SX4I 3CK0H 3LSOA 3W11C 2EXWC 2Q76A 4LSSL 2YWZA 1V7MH 2Q20A 4HWUA 5GJTH 3R06B 4LSTL 3MRJA 3QQ4A 1SEBB 4PRPB 1BQUA 3VD7A 2OTUB 2VZOA 4R3SB 2E7LC 4G8GA 4QXGL 2DRUA 5L2KD 1HSAA 1C1EH 3F5WB 2YWYA 1NL0H 1OCWH 2FATH 4NNYA 1QKZH 2NZ9D 4LPWA 4ZSOB 1K4DB 1MRFH 2ADJA 4FQXA 1KTKE 1RIUL 5HYFA 3OKDB 4BQ6A 2GY7B 2JB6A 3VG0L 4FG6D 3O2WH 4WDIA 3T04D 1LO3L 3ETBF 5FA3B 1NDMA 4NSKB 2RAMA 2NX5A 4LPXA 1MY7A 2XWBB 4F9PA 3RZCC 3O6LH 3IRZA 4JFOB 3K1KC 1C08A 1U2CA 1WCBA 1IGIH 4HJ0C 2LU4A 1K8DA 4P99A 3ARSA 4JG1L 5ACZB 4R0LB 1JGVL 3F7VA 4WTZG 5D1QC 3HNVL 4ZTPH 1RY7B 3BKJH 2IAMD 4GKNA 4LHUA 3OX8B 3UJTH 1MJJB 3QI9C 1TTFA 5TQ0L 1BGXH 3LEXB 5GS0H 4S1SH 5JPNB 2BRRL 2W0PA 4R7NB 3EDKA 3BZ4A 5F9DC 3UTTD 1MVFA 3BQUB 15C8L 3I2CH 1A14L 2HKHH 4YHKH 4NQVB 2NLJB 2XY1A 1PYWA 2W92A 3S3PA 1ZVYA 5F3BB 3OV6A 3C60B 2BSSB 2H2SD 4P9HC 4WFHD 1CDGA 2PYFA 3BGMA 4RISH 2NY4B 2EYTB 4C55A 4EIGB 2Z8SA 1ES0B 2DN7A 5AYUL 1DL7H 3K4ZA 4PJDE 1KPRA 4OFYD 5D7KD 3PWVB 1NANH 3THML 3O8XD 5TE7L 1JPSL 4DFHA 1J12A 1WFTA 1BAFH 4PJ5B 4DCQA 2K7PA 1KCSH 5HDBE 5GS0D 4WWKA 3SDYH 4M61B 4YHIA 1I1AB 1NFDE 1ZT1B 1XF5B 3LDBB 3QXDA 4MA8H 1BZ9B 1INDH 1UZ6E 3ULSA 1CYGA 5HYJD 2Z8RA 2ZPKH 4PY7B 3QUZA 4NJ9L 3UTQA 4LSRH 1I3GL 5SWZE 5T3XL 4F2MA 3KS0H 1LD9A 1QSFA 3EUUA 3MRRA 3LN5A 3VWJC 1IT9H 2FEEL 4KVCH 3G9VA 4F7TB 2B1AH 3PJSA 3ARBC 3Q6GL 4KI5C 1KLGB 3P4OA 4ONGL 5LGHL 3WIFA 2VZVA 4PG9A 3PGCA 1YECL 3P9LB 1F11A 1JBJA 1E4KC 2L0DA 5I18L 3GSNA 2DL2A 4JO1L 1W0VA 4XNZB 2QKIB 1H5BC 5IW3A 4PB0L 4KJWD 3TBSA 1HQ4B 5ISZB 4I5BA 4ELME 4WCYH 3MV7E 1Q0YL 5D2NC 25C8H 3B8YA 3BKCH 4Y16B 4J3UA 2YS4A 4KK5C 2I5YL 3LB6D 3BN9C 1SBSH 1UWGH 2CRZA 4WU7B 1NSNH 5I75B 4KV5F 4WUUE 4L4VB 4JJ5A 5JW5A 4MNGA 4I0CC 1BBDH 3FT4A 5CCKH 3LMJH 3D85B 4GRWH 4H26A 1R3HB 2CKNA 2BSED 4TVPD 4JPIB 4XVSL 3HI6L 2P48B 5MHSD 4MQSB 4DVRL 4NNPH 4PJCE 3U7YH 4HUWB 1NCCH 3VXRD 5INDB 2F53A 1YN6B 3V0VA 1ZKAA 2B5IC 4MX7B 4M6OL 1U58B 3RL2B 3ROLB 1J0JA 1LK3H 4TULL 1T04A 1FL3A 4OD3L 1TMCB 3BXNB 5JOEA 5IMLA 4DTGH 3QUYC 3AAZB 3QIBA 4QTHB 1MHPH 3QXWA 1BBJA 1N59B 3AUVA 3QEUB 4OD1L 3SE4C 4XPFL 5C2BH 5IVXF 1KXQE 1HZHH 4DEPC 3MRBA 1RVFH 2K3TA 1QLEL 3TO4C 1S9XA 3SGKA 2A73B 4EUPB 2J8HA 1WTLA 2YKLH 5DD5H 2IF7A 3FCTA 1H0DB 4FQCH 4RQQB 4KTEH 3LS4H 2QQLH 2VLKB 2X4SA 3CDGB 5FYKE 4FA8A 1KF9B 1B9ZA 1F13A 2Z8VC 5HBBA 4C4KO 4HBCL 4PJAA 2HRLA 5DMIH 1FL5B 2AEPH 4EN3B 4X6FB 3MBXL 3OAZH 2OJZL 5D70H 3GI8H 2P5EA 2E9WA 2VH5L 5J12B 1NAKH 4LOUD 1T5WB 3S37X 2QR0A 3KYOB 4EEEA 5GXBB 4NWUL 5MP6L 4WI7A 4RGNB 3SDDC 3DX7B 4LNRA 1TQCB 3KPRE 1JVKA 2O5XH 1MHCA 1QFUH 4QXTB 1A4JB 3U9PH 3TPUB 4OZGB 3VG9C 3GJFB 4PS4L 1IC1A 2DD8H 3VMNA 1IKFH 4PJEF 4JZOA 1F8TH 1AKJA 5L6YH 1RIHL 4NRXA 1JGLL 5JNYB 4YNYA 3QBTB 2R4RL 3DGGB 5C0RL 2NXZD 5IUSA 1CE6A 4OCRL 4GAJL 2A74B 4U1GB 4ZXBD 3V7AE 1W0YT 1VGEL 3T3MF 4PY8I 1VERA 4QYOA 1NH6A 5ENWB 5FF6B 3PHQB 4PY8J 2GSIA 4FFZH 2XA3A 3G6DL 4P46C 1MCEA 1XF3A 1N5AA 1PKQA 3O11A 3C5ZC 4Y4KC 4KHTH 4TSBL 2MOVA 4HPOH 1AFVL 3BKMH 5TQ2H 1PLGL 4IS6A 1DEDA 4X99B 3B5TA 1AY1H 2IANB 4JZNA 4D0CB 3CMOH 1HSBB 3HMWH 5E2JA 3HR5A 2E7MA 4GRLC 3H3PH 1Z6JT 3BPOB 3MBED 5E4EB 3RWDB 3X13A 5SX5K 4RZCB 4JFPA 3VXNA 3VXSE 4APQA 4BJLA 2YD4A 4PJHA 4ETYA 4OZFG 1JZ6A 4JY4A 2JLLA 2QQNL 4OV5A 3V52H 4ODSH 2FHBA 3GSXA 5F7KC 1ONQA 1KLUA 2Z91B 5HGBA 3MNVA 2CMRH 1C5BH 1X5XA 4Z76A 3KXFD 2FIKA 3MYZA 5GGQH 1T83A 4QRSA 3PNWB 4L9LA 3MODL 2BSTA 5E7FA 3SJVD 2XWJA 3RIAF 5DJCA 1YNKH 3QEQD 2AJUL 1EO7A 5GRUL 4R4ND 4AJ0A 5IJKC 3BMVA 4UV7H 2VDOH 1NLBH 1A02N 1LEGB 4ONFL 1GGBH 2W59A 4Z78B 1DN0A 3NN8B 5FUCE 5L2KA 4HXAH 2DWEA 2EYRA 4JHBA 3U0WL 4L3EA 2L7UA 1AGCB 3ZTNL 3RX7A 5JW4R 1GOFA 4P3CH 2EKSA 3RNQB 3PQYA 2EH7L 3ZT6A 1KPUA 4O9HL 2O93L 4OFDA 5ICYA 2VDPL 5EBGA 5GIRA 5JXAH 4P5TB 3H9SB 5IM7B 2VLME 5CINL 2YEZA 3ZKQD 2PR4H 3UC0L 1QD0A 3CXHK 5H94A 1VADA 1HYSD 3TT3H 2SEBB 4UZGA 2NXYD 4NZRL 1AE6H 4Z6AT 3JV6B 3MROA 1LILA 4X83A 5D2NE 2VIRA 5FGBA 4UQ3A 2CDGB 1BP3B 2IAMA 1Y18B 4L5FH 5DD1H 1MQ8A 4XCYA 4MDIB 2FH6A 4GRMB 5IEHA 1E27A 1YPZE 1H15A 5HY9B 1EUTA 4XMKH 4FRWA 2V5YA 4GUPB 4QGTA 5I1HH 4WFED 3QDGA 4NQSA 2QLVB 2XA8L 4RRPA 1XF2A 3OAZK 1OOAA 1ODAA 4O4YH 3QH3B 3KPNA 1KB5B 1V05A 3HZMB 4D8PB 3MV8A 5EU4A 1A1OA 4YHOH 3V5KA 3U6RB 1F6AB 1OQXA 5T33H 2ERJB 5D7IF 3KPPA 1WBZB 4WEUD 3GKWL 3BFOA 4XNUL 5DQJA 1JL8A 4DOHB 4GG6B 1AO7B 5TH2B 4C54A 2CUHA 5CZXD 4XXDB 2G2RB 3DETD 4X9FA 4CVZB 4ZFOB 3BW9A 3SEPA 4DGVH 1I8LA 2EDOA 4OFYA 4X8XA 4RMUA 4X0KA 2E7HA 3EFDH 3EYOB 1M71A 4M7LH 4NM4L 5JO5A 1G7LA 2C1OA 1ZHKA 4JPVH 4LDLB 1CN4A 5I9QB 1LGVA 4EUPG 4ODVL 5CJ8A 5DMKA 4HH8A 4LVHC 3IDYB 4F58H 5MEPB 4IJ3C 2QSCH 1TPXC 3L5IA 1RUQH 4NZUH 5J13B 4OF7A 2UZIL 2VC2H 4QRPD 2DB8A 4YDLC 1FRGH 2NY2C 1WWBX 4CJ0A 2YPKB 4LEXL 4AQOA 3P11H 5ITBL 4XPHH 3ZSTA 4H1LB 4JFDA 3B9KB 2R1XB 4TN9A 4KZDH 5C0FB 2AS5M 4Z18A 2PTTB 1U6AH 3VFPA 3DV6A 3GZKA 4M8VA 1MFAL 3NCYP 2XG4A 2FX9L 1J11A 3QIWC 5HHQB 2DM4A 4E41A 4H8WH 3O2DA 2G9HA 2R0ZH 4KUZH 3IDGB 5IR1B 2DJSA 1FCCA 1P1ZA 1MSPA 3WIHA 3ARPA 2JIXD 3PWNB 1GAFH 3FB8B 3FN9A 1G7QB 3GIVB 4PJ7E 1JHLH 4QOKD 4G80A 5KTEH 4FZEH 1W8NA 5FYLL 3WJJC 2IGFH 1HHJA 5CHNA 2X09A 4UB0L 2WQRA 2ZNWA 3BVNA 2YN3A 1U92A 2RGSA 1QR1A 4ZFZA 1D5MB 4YK4B 1LO0L 3QYCA 2AJ3B 4TPRL 3AS0A 2R0KH 5DWUH 1JPTH 5C6WH 5IFAH 4G6AC 1T1YA 4HIEA 1I1RA 3M17B 3SGJC 2HH0H 4XNXH 4YHLL 2VE6A 3VH8G 4XXCC 5C9JA 3T0ED 2PYEE 5MI0B 4LMQE 3HAEA 4Q0XL 1Q9LA 1B4JH 4OT1H 2A9NH 3HC3H 3NFNA 3P0GB 4K23L 4JREB 4L8SB 2EXYC 5CMAB 4GXVL 4XCFH 1OTSC 4FQQB 2ZWLT 4J3SA 2WW8A 1F3JA 5C0ND 2H9GB 2X4RA 4QTIH 1YQ2A 1KJ3L 2M26A 4D3CH 4JM4L 2V7HA 3O8XB 4YQXL 4FQHA 4Q7DA 4PJDF 4TNVF 3QCTL 5L88H 1FZJB 1KENL 5HHVL 1CIUA 2X4NA 1JPGA 4ODHH 4CL7A 3N85H 5LCVL 5BVPL 5EO9A 3QSKB 3DSFL 1K8IA 3MLZL 3PHOB 1CD8A 5ESQA 4KMLB 1U3HB 1MCPH 4TRPH 5HDBF 1ORQB 1NFDF 1PX4A 5C0CA 3UJIH 3IGAB 1UZ6F 3OJDA 1C5DB 1R0AL 1BLNB 3NTCL 2Y06L 1U8IA 1OAYL 4L1HA 4OKDA 3U1SH 5F9JB 4YHML 4MAYC 1CBVL 1QFWH 3PF2A 3C6SA 4ALAL 2BJMH 1FNSL 4CAGA 3BAEH 4NBXB 5EB9A 1X5HA 4ODUA 4NN6C 1I7RA 1TCRB 2VDQL 3RBSA 4KVNH 4E42B 1YEEH 1I8KB 4ZO9A 4NZJA 4DKFL 3QZWB 3OZ9H 3SDCD 4NUGH 2D9QB 4YDJA 5T5NG 4Z7OF 5C3TA 4M9OA 1QRNA 1UVQA 3K46A 4ZS7L 3LKPA 3VFTB 5LGKA 1Q0XL 1QBLH 3WFZA 1NGZB 3KJ4C 1BIHA 4S1DD 3V79C 5GGVL 4R7DA 1C8PA 2XKSA 4EVNA 3V0WH 4ZXBA 3FN0L 1S7XB 4LCUB 3QQ9C 35C8L 3P4NA 4MQTB 4ZTOL 2B4CH 1D5IH 1CS6A 4G9DA 5FEBA 1S7SB 3BWUC 2YXMA 5F1NB 1U93B 5DJAA 5CZVH 4ODTL 1WSST 5BV7L 2HAZA 4OQTA 1F4YL 3ZT5A 3U0PB 1F42A 4XPBH 3TWCL 3O41A 5DD6B 5IW6A 4PJCF 3VXRB 3X3FH 1KJMA 5FDYA 1T89C 4GXUM 3MFFA 2NR6D 1BQLL 4PRIE 5KANI 2QHRL 4D0DB 2MQ0A 2K9UA 4ODWA 2C3WA 2WUCH 1IAKB 3AU1B 2BSRA 1QFOA 4QHKI 2B8OT 2YXFA 1QQDB 4QHKJ 4WU5B 2C4FU 3KPLA 4LIQL 4KKCC 5C08D 2Y36L 2FHCA 3BIAX 2BY0A 3OG4B 4GRWB 4LSSH 1ADQA 3ZKNC 3DXAE 4LSTH 1IM9D 1JRHL 5CGYC 2D9CA 4HWZA 4NYLB 4JHWL 1SY6A 4NRZB 1WK0A 4KI1A 4EXPX 3GHBL 4PG2A 2R2BA 1DQQB 5E1AA 2VITA 1ZS8B 3AFLA 1YEFH 2RCSL 4JFQB 1RIUH 4G8IA 1MQKL 1NEZG 1A6TB 4U3XA 5KSBA 2IADA 1A7QL 3CU7A 3LS5H 2GAZA 1IFHL 4JO2L 4OAWA 1JZ5A 1LO3H 1UM6L 5CZKA 4RFEA 12E8L 4N5EC 1NGXB 1XF4A 3RL1A 1ETZB 5CBEA 3ROOB 1A7NH 4Y19D 2O61A 5IW1B 1NCAH 2CSPA 5A3ID 4EZMA 2DLTA 1QLRB 3L3DA 4Y5XC 3LPGA 6FABL 2XQYK 1FJ1A 3L3GA 1IGCL 3OJVC 2XTJD 1S5IL 2W9EH 4ZQKB 1F4XH 5F7HA 4YBLB 1RUPL 1D5XB 2F15A 2GT9A 5TQ0H 2NXZB 3GDBA 3HZKB 5E2WL 2W65A 4LEOA 2R0WL 3AROA 1UACH 3B5GA 1A3LL 3SQOH 5KS9B 43C9A 1N6QH 1WBXB 5GRZA 5I19H 1KEML 4RFOL 4S1QL 3NA9L 15C8H 1CIDA 2X4QB 2K1MA 2NY5C 3S3JA 3FQRB 4FS0A 4IRZL 1X7QB 2X1WL 1DZBA 1WF5A 3S4SA 1MI5D 1L4IA 4OGZA 2HT2C 1J5OL 3CFKB 2ZG3A 4AG4L 4R4FH 3DURB 2NY1C 3D18A 3BD5A 4QRUA 2JJWA 5CFHA 3LN4A 4J2XA 3FN3A 5D71L 5AYUH 1YC8A 4G7VL 5D93B 5KOVC 5JPMB 3HC0B 3THMH 1QA9B 5TE7H 2VXQL 4HEPG 3ZT7A 5JOFB 1LQSR 5DQDL 5EULV 1IKNA 2HTKC 3LRSB 3O4LA 4AMKL 1P69B 2CLRA 1MIEH 1MWAL 2VXTL 5AD0A 1DUZA 5FUZH 2X7LB 4Z7VB 2E7CA 2OTWA 5IBLC 2V9TA 4LP5A 2OM5A 3ZMRA 1I3GH 4PJBF 3AY4C 4CNIA 3RHWK 2XN9B 3DO7B 2Z0BA 4Q9QL 3ZDYF 3KXFB 1MIMH 5JR1L 5KZCB 4HS8H 4WTWA 2ATPB 1I1CA 1JWMB 1NGPH 3PWUB 4X7SL 4H88L 3DVIA 3OAUL 3QEQB 1E4WL 3FO9A 1BD2D 3OHXA 3C08L 3L3JB 1NQBA 1ZT4A 1JF1A 4AEFA 3QIUB 3O4OC 1GZPA 1YYLL 2P5WD 1DFBL 4LLQA 5DZLA 5B21A 3RI5F 2DWDA 4QO1A 4OZHF 4QY8B 1OPGL 5JQHC 4X9BA 4S2SB 5DJ0B 4PB0H 5BXFA 5D7LA 5ALCL 1ZAGA 3DV4B 3PV6B 3CX2A 4EI5A 3VCLA 2DF3A 3TIDB 3QZWG 3BI9X 4Q6IA 1GGCL 2PKDA 4V1DE 5JXEC 4PRHA 1MRDL 3OR6B 1GC1C 4OCWL 5EIIB 2FZ3B 1G6RA 5C71A 4PB9L 3JUYA 1JV5A 5T3XD 3BPLB 2PW1A 3GO1L 3LQZB 2IQAA 2NY0C 2NXYB 2BCKB 3BT2H 3AMKA 5E6IA 7FABL 2HN7B 5IP4A 3NGBC 1FCGA 5IOPA 1T2QL 2CUIA 4U6VH 3RTQD 1DBAL 3WFDH 5JHDB 4BFIA 3DX6A 3B6SA 2X4OA 5KAQF 4YH6A 1YPZF 5GGTL 2VUYA 4U1HA 5T1LB 2C3VA 1PW3A 1OSZA 2C3GA 1HI6B 5IKCA 5CIPA 5D2LB 1MJ8H 1MFBL 1NGQL 5FO9B 4N0YL 2IEPA 4U6HB 2W60B 1YC7A 4JY6B 1U8LB 3EYVB 1ZEAL 1KT2A 3BSZH 1RZGA 2VLJE 3NCFB 3SCMA 1C7SA 4LCWD 5CEZE 4IOIB 1DVFC 4OD1H 2CR3A 2VSDA 4UT7H 4BSJA 1RURH 4CADB 1KTLA 4NO3A 1UZ8B 1JCKA 4QHMB 2ADGA 3VFWB 3V4VL 3VFMB 1EAPA 5H35B 1TNNA 1HKLH 4KPHH 3VWKC 3TZVD 3FFDB 4OZIB 3RFZC 4LSPH 5F96H 3QUXC 2HFFA 3MRGB 4YO0B 3GMNB 3RZCD 3QDJD 5ICZA 4Y5VC 1SEQH 3QP3A 2XKNB 2A77L 4JFFB 4KK6C 5DJYA 5ANMA 1S3KL 1OP3K 2A1WH 1JMZA 1U8QB 4HV8B 4QRPB 2OJZH 4CW1B 5HXMA 3IYLW 4PJXB 4HKBB 5BS0D 3ARFB 3P0YL 2FHFA 5MEOB 4FZ8H 5F7NC 4RGOH 1XIWD 1CDBA 5IMMB 2DBJA 2LE9A 5D7IA 4GW1A 1B0GA 1FIGL 2D31A 4X6EB 3MLVL 1XF1A 1OP5H 4HF5H 4PJ9C 1JTPA 4ZUSB 5HGDA 1G7PA 4YXHH 5IHBA 2EEBA 2YOCA 1BVKA 3QNYB 3MA9H 3RVXC 1EJ6A 3SDCA 1DQLL 1GOGA 1OAZL 2NY3C 4OLVL 2Y6SC 1EEYB 1HHGB 3W9DA 3T2NH 1PEWA 1N6VA 3S98A 5EZJB 1VKXA 2BC4B 4QRRE 2NY6D 1VGEH 1GZQA 3EHBC 3UTSD 4KAQL 2X41A 3K74B 4K2UL 1S7UA 2ZP0T 4QOKB 5DF0A 1A64A 5EN2A 1MCIA 1A6UL 3JV4B 4UAOB 4HIXL 5CJXA 3KPSB 2P8LB 4HZLB 4PJ7F 3WSQH 1HIML 1HXYB 1D5BA 3I02B 3TH4T 1T03L 5IGXL 4TSBH 2G75B 3EO9L 2H2PC 1RPQA 5BO1L 1ED3A 2F8OA 2CK0L 2OXGA 5CILH 4WW2A 1PEZA 2VAAA 4G9FD 3R8QA 5CUSH 3T0EB 4PR5A 1F45A 1A0QL 2IFFL 4X6CE 2FX7L 4I3RL 2W38A 5E2VH 4JR9H 3BP7B 5E8NA 1WZKA 4O2CA 4D2NA 2WP3T 3LRHA 2EDLA 1UEYA 5HPMA 2VDKH 1ORSB 5B8CA 4A6YL 2W0FB 4LCCA 5JA8B 4JAMB 5EZLA 2Y23A 3MRQB 3CFCL 4XH2B 4Q97A 2AABL 1RHHA 1NCWL 5BRZA 2OZ4A 3VFRA 4ORGA 5C08A 4R9HA 5IJVB 5BVJB 4GS7C 1MH5A 3MNWB 3JWOL 1HDMB 3MODH 2AK4D 3VFUA 3LH2H 4J4PD 3VDAA 3RVVD 1FZMB 1FO0L 1IM9A 3FO1B 3GMLB 5E08L 5DGQA 2Q3ZA 2DLFH 2EDYA 5GGSB 1EFXA 4KK5D 1MFDH 1SMAA 3EDEA 1JI1A 1DSFL 3AC0A 1RULL 2CKBL 4OKVB 4XWOD 4ZMAT 2EH7H 4C56A 1KIPA 4KK8D 5E70A 2VDPH 5GRXG 3NZHL 2XXMB 1H8OA 3C2SA 4Y2DD 1DTUA 3FQUA 3MA7B 2OL3A 4R4BA 2LFGA 2FYYB 5CP7B 5CWSA 1RU9L 1U8KB 2E27L 4GW5B 4RNRB 4DAGL 2UWEE 3NABL 3RU8H 3FQXA 3MRPA 3CVHH 3TVMB 3IJHB 3RKDC 4NZRH 2I07A 3SDXB 4ZPTB 4Z77B 1PZ5B 3OMZA 4X7EC 5D5ME 4N8VG 4BQCA 3N9GL 4QHUB 5CJ5A 1D9KC 4I1NB 3I6KA 2DTMH 3VU2A 1TFHA 4MQ7B 1EHAA 3TCXA 5DVOA 4YDIL 3CZJA 2ADFH 3K3QA 1T1XA 4F7EB 1AHWA 2XA8H 3PGDB 1HWHB 3RBGA 3DX8B 1Y0LA 2CGRH 1REIA 2Q7YA 3MO1B 3REVA 1YMMD 2JE8A 3TO4D 2MKLC 4K3EL 2WK2A 5GJSH 5SWZA 1FYTD 2HWZH 1CFNA 1CF8L 1L7TL 4JKKA 1S5HB 5A2FA 3FB7B 3DPBA 4JB9H 3TYGH 4J12A 3MRMA 3EZJB 4LVOB 4TYUA 1A1MB 2ICWB 2O5ZL 3V6FB 1JK8A 3OKEB 4NWTH 4CGTA 4NM4H 4QRQB 4QNPE 3AM8A 3DECA 3IDIA 1IAIH 3C09B 4JANB 5D1XD 1RZJL 1OLZA 1NCUA 2OMNA 2QBWA 4ODVH 4OM1L 4YFEA 3S9DB 4XZUA 3LSOB 3WIHH 2G5BA 2Q76B 4KJQD 3OKOA 1KCUL 1W2KT 2V7NA 1MJ7L 3EJZC 1I7TB 4ELMA 3VFSA 3MRJB 1WC7A 1Q8MA 4RAHA 5ABDE 3TBYB 3RUGE 2E3VA 2VDML 1HSAB 4LEXH 4WUUA 1VGKB 4N0UE 2VXVH 5IMKA 5ITBH 2DIJA 4GMSL 4Y1AE 1TENA 4KKLD 2P46B 2FH8A 3QA3A 1OSPH 1MFAH 2JJSA 2P5WA 3I3EA 4PJFE 5IWLC 4WDIB 1VACA 4KRPD 4PGZA 1J1PH 5DI8B 5MEND 4P46D 5E9DA 4UDUB 2F54E 32C2A 3L9RA 4GQ9L 4J23A 4XMPH 3IFOA 4MVBC 1NKRA 3C9NB 4OIBA 1I7ZA 1K8DB 4Y19B 1IGJA 1QR4A 4B50A 1UH2A 2FR4A 3QAZB 3NZ8B 5H2BB 3K7UA 3UTPE 4TOYH 1RZ7L 1CD9B 4GKNB 2KDGA 4UB0H 3O9WC 1I75A 4H20H 3QHZL 4TVSa 5DJDB 3MUJA 5KOMC 3B5HA 1TVBB 5ERWB 4TPRH 5I74C 5C0AE 4NPYA 3RTQA 4P4RA 4RAUA 1L0YA 3GMRB 3HR6A 1B6UA 4P5KA 1QHPA 4GXVH 4OCXL 2O26U 1LNUA 5EG6C 2GUOB 1E6OH 3MGOA 4M62H 5EC1B 5FA4B 5ITFB 1G0YR 5I71C 2AK1L 3ZKXC 3RWIB 1KJ3H 4LCWA 3OKMB 5J57B 2E7LA 3U4AA 5FYLD 4JM4H 4X4YA 3S5LA 4YQXH 4NRYA 4DCQB 4J4PA 3IKCA 1GGIL 1EZVX 5FCSH 1N4XH 4F7PA 4JKLA 3N50A 5BVPH 3QUZB 3RWJA 5DGRA 4P23B 1XEDA 3QCVL 5C6PB 1NPUA 4YXKL 5KVDL 4MNQE 4F2MB 4Z7UE 3RZCA 1R0AH 1OTUD 3QDJA 4OM0H 1QSFB 1JGUL 2CDEB 4HJGA 2Y06H 1AGBA 2J4WH 4XHJC 4Y7MA 2HT4C 3PJSB 5JMRA 3TN0B 1CBVH 2D7TH 3WIFB 4PTUA 2HKFH 5D1QA 3PGCB 4ALAH 2OP4L 3KHOA 1F58H 1ZA6A 1BD2B 4MD0B 1CFBA 4H25A 3K2UL 3ARDD 3QI9A 3UO1H 1XIWA 2VDQH 5CEXA 2XOTA 1W0VB 2DKSA 4J8RB 4ODXA 4I48B 1RZKH 4DKFH 3JSSA 4TUJB 4KXZI 1V7NL 2JK5B 3QCUL 2JKXA 1RK1A 4KJPD 5C09D 1B88A 4ZS7H 5J4MA 4R0LC 3LKQA 3CDYA 4R2GD 1BPVA 5HI3D 1UG9A 3UCRA 5IIEB 1S9YB 1DBBH 2WIMA 4Q74A 3EOTH 5BZDB 1WICA 3RWEA 2DQFB 4X80H 4R26H 1CL7L 1ZSDB 2ZOLA 3AVEA 4D9QD 4NZTH 1CXHA 3ESUF 5IROC 4X8JA 5T3ZL 2AJSH 1DLHB 3FONA 4BKLA 4CU8A 1AGEB 1F4YH 4HQQH 3BQUC 4WJ5B 3NCJH 1HCVA 1QYGH 1SMOA 1YEJL 4XBPB 1V3LA 3L5HA 1L7IL 1MJUL 5CD5C 1QSEB 1TJHL 4HT1L 2AXFA 2FIRT 3C60C 2FO4B 4G9FA 2BVUA 3BP4B 3WLBA 2NY4C 1QBAA 3GMQB 3UBXI 3EO0B 1TTUA 3X12A 3VXOB 2ZSVB 5B4MD 4HHAA 4JM2D 1BF8A 2P8MA 3QDMD 3VWJA 1QRKA 3JXAA 4MSWA 4FABH 2QSQA 4DZ8A 3ARBA 4FQJL 3D0LA 1I1AC 3MLTB 3O3UN 1UXSA 3IDMA 3LDBC 4S10A 3PWLB 5ALBL 4XBGB 1E4KA 2FB4L 1UXWB 3P3YA 1FBIL 4NM8L 5IHUL 3JUZA 5KVEL 3SPVB 3TZVB 4JRXE 3EZ8A 2FWOA 5E56A 1H5BA 5FV2A 4HC1L 3EAKA 1LK2A 2HA1A 3OB0H 2GQHA 5HD8C 4PLJD 3VW3L 2RCSH 2VR5A 1EXUB 1KBGL 5F7DA 5D2NA 1G0XA 3MGTB 3QPXL 2W9DL 5JUEH 3MRDA 3TNNB 1WFNA 4M9PA 4M4RA 4JO2H 1IGML 4OTXH 2VQ1A 9CGTA 4LBEB 3IT8D 1UM6H 3TNMB 3UPCA 1KIRA 4PV8B 1EO5A 4FN0A 1HH9A 4JZJB 2GCYA 1XR8A 4LPYA 4XNZC 2GSGB 4OGXL 3CH1B 5D4QA 5EA0L 1MHCB 5FYJU 5FFLA 5KVMC 2X9YA 3D9AH 1XGUA 1RSFA 3VI3E 1IARB 3B2VL 3JWNC 4LHJB 5DJ2A 5D6CB 5FIEA 1DEEA 6FABH 1AKJB 4ZNCD 3HPJA 1T7WA 3IDXH 2F5BH 3U30B 4YNYB 4JFED 4Y16C 3CLEH 4CRPA 4N1CA 2QSVA 3VXUD 1BVLA 5EU6A 3R0MA 1P6AB 2X70A 4Z7QE 4X6DB 1A3LH 4M1DL 3U4BL 3ALPA 2NY6B 4KGJA 4QYOB 3H2WA 5F7EL 3UTSB 1DQMH 2GSIB 1F4AA 3QUYA 4RFOH 3P0VL 5LQBH 5IESL 2EDBA 3QEGH 4YPGB 4P3DA 1YEIH 1QVOB 1UM4L 1JRHI 2VQUA 3SE4A 5KSVA 1PKQB 5D9SA 3DRQB 5K9JL 4DN3L 4AG4H 3TO4A 5JDSA 8FABA 1KB9J 4IS6B 1FYTA 3TYFA 4ETQB 3P30H 1KJVA 4FNLH 2VLRB 3TBTA 1MCOL 5FGCB 4GMTL 1NC2D 2R1YB 4ERSH 5D71H 3Q1SL 1NLDL 3UPRB 4BSWB 1UA6L 2D7PA 5CBAB 5EC2A 5FUOH 3X13B 1BECA 1X4YA 1M7IB 5DYOB 3FRUB 3TH3T 1NCDL 2NNAA 4BM7A 1WFUA 1BVZA 4X6CF 3ARED 2VXTH 2FBOJ 2JELH 4GG8A 4ESKA 1G6RH 2DOCA 2VSCA 3MNZB 3LZFL 3VFGH 3DWTA 4JFYA 5L7XH 1H3WM 3INUL 1RJLA 4PD4K 4ZO6A 3SDDA 4Q9QH 3EDDA 3SKMA 3BUTA 4CMMA 1FNFA 5JR1H 3L7FA 3FRPA 3QFDB 5DHVH 4PJ8D 3EJYC 1A2YB 4XAWH 4H88H 2Y1VA 4XP6L 1GRWA 2P24A 3GBLA 3KDMA 4PJ7A 5T1MB 1S7VB 1DN0B 4PRPE 2EZ0C 3STLA 4EN3C 2B0SL 1JWSB 1IC7L 1BM3L 1G9NL 1IGTA 1YYLH 2AQ1A 4P2RD 4F37F 1DFBH 5ELIA 5J12C 3F58L 3VFNB 1JNNL 3GI9L 5A16A 4RGNC 1MHEA 4LP4A 2RIKA 4LSUL 1TQCC 2MHAB 3OGCB 4XP1L 5I1GL 5ICYB 4OI9A 2BNQD 1RAMA 1F2XK 3VXTA 3CFJA 2HMIC 4ACPA 6CGTA 3LOWA 2ICEB 4M6MH 4L4TD 4P46A 4Y2DB 4ZAKD 4PB9H 5H94B 4WW1B 2B1HL 4CU7A 3C5ZA 4Y4KA 1JUFB 4F7MB 4IMLB 2X40A 2JCCA 5DRWB 3IAGC 3VRLE 3IVKB 1I8IA 5F8QC 2UWEF 1FZKA 3FQNA 1OGTA 3TFKD 1AGFA 4U1GC 1MCJA 5DJZA 1R3KA 4GAGL 2BMKB 4MA1B 4YFLI 3BP6B 1S7QA 4GRLA 4ONHA 3VJ6A 2DYPD 5HHPA 4NKOA 4IHOA 1XGQA 4XRCA 5TE4L 4KKCD 2P43B 3AXLA 3UYRL 1TZGH 1HNFA 1C16A 1TVHA 5EUOE 4Q6YA 3KPPB 1PX3A 2Z35B 1N3NA 5C6TH 4EJ1C 1CFQB 1BZQK 4FTVD 5TDPA 1ZEAH 5BW7C 3NPSB 2CLZA 1F4WH 4FFVC 5AG8A 1NFIA 1TJIL 3CVHB 4AL8L 3D3VD 3BPOC 5E4EC 3BW9B 2W0LA 4XPGH 2OR7A 3Q5TA 4Z8FH 4LGRB 5IJKA 2IH3B 3TV3H 1I7UB 1KCRL 4U7SA 2FX8H 3WN5B 2DQJL 1UB5B 5KBNC 2GJ6B 3WXVL 1ZHKB 4XP5H 4ZDHB 2R29L 2YN5A 3G5VA 4M1CC 5D1XB 2BX5A 2OQJB 4UOJA 4QNPF 4X4XB 4N5ED 4KWUA 2VN4A 1U8NB 5GS1A 4FQ1L 2Y5TB 3BOVA 4PP1C 1A5FL 5CJBA 3H3BC 4BH7A 2A77H 4HKZA 3RY4A 4AT6B 2MPAH 4ZODA 4JDZB 1LO4L 1ZLWK 3WO4B 4ELKA 5BJTB 3MOBH 4PIRF 4P2YA 4NDMB 2XZAL 3MV9D 4XNMA 4JFDB 4OGAD 3HFMH 1RZIA 3RUGF 5ID1B 4G8GE 3MLVH 5EU7E 4HH9B 4OZ4A 4YE4L 1Q1JL 1ZGLB 2FJFA 2IQ9L 5J8OA 4P5TC 4QT5A 3QG7L 5C07D 3KYAA 5TDOA 1XMWA 3BESR 1SYVA 2Q86B 5MENB 4POZC 4MJID 3FQTB 4K9EL 1JF5A 1FAKT 1KNOA 4NQDD 4PJFF 2VLLB 3RDTB 3SE3C 2HT2D 1P1ZB 4PRIA 5C09A 2NX5E 3GBMH 1J9CT 5GGRA 3NIFE 4HWBL 1INQB 2OZ4H 1VFAB 3CNKA 4QRTA 4HPYL 1G7IA 5CHNB 4XVUC 4YUEL 4XWGL 4DKDC 1A6UH 2ZZUT 1PY4A 1RK0B 1U9KA 3UBXA 1HIMH 3PWPD 1RI8A 2A6JB 3RIAK 4G43B 5IGXH 4N0FA 4HIEB 5DUBB 2J5LB 4X5XB 1LWRA 4JHAL 3ZKMD 3DXAA 1NUFA 4D0BB 2CK0H 1S7TB 2AGJL 5I76B 5IBLD 2ITCB 3F7QA 2ERJC 1M6OB 4M48L 4X98B 1P5VA 3OKNA 2J1KA 3DARA 3ILQC 3B9VA 3AMLA 2BVQA 5IG7A 2PW2A 4MS8C 3HZVB 4HGWA 3G5XB 2OL3H 3W5MA 4PUBH 5DS8A 2AABH 5BZWB 3GNMH 3SGEH 4DGYL 2Q8AL 5IQ7L 5FGSA 1R3LB 1MEXH 3F12B 3B3IA 5CJOH 3VRJA 5BQ7B 3SBWC 3PXHA 3IDYC 5BOPA 4MA3A 2WBJD 3C6LB 2QL1A 4AIXA 1GGTA 1Z5LA 4NQED 5JXED 3QIWA 2RHEA 5J13C 3GIZL 2Y72A 4HMCA 4L29A 4NN5B 5KSUB 3U46B 2QEJA 1J05A 3V6BR 3MLSH 1NGWA 3BGFB 5I1CH 1RULH 3P4LA 2AJYH 2IALA 4Z7UF 3I6GB 5IF0A 2NY0D 4HK3J 1CLCA 4YAQB 2VDRH 2PXYB 5I1LA 2NZ9C 3NZHH 1S8DA 4L8CA 5L9DL 3WJJA 1P4IL 4LGPB 3A6BL 1FLRH 1JTOA 3ZE1E 2E27H 1B3JA 4JVPA 3ARDB 4MB5A 5F89B 4BK5A 1X44A 4AK1A 5DHYA 2F5AH 3DIFA 3HNTH 2CIKB 4MD4A 1HNGA 3SGJA 1QRNB 5E8EA 4WFGD 5TFSL 5K33A 1F90H 1NBQA 4XXCA 4PGDA 1XGTA 3N9GH 1NUNB 1A7PH 2APBA 3DYPA 4R2GB 1T4KB 3S88L 4YXLL 4XNQA 3KYNA 5LBSH 1OW0A 1DVFD 2OSLA 2OS7A 2WZPD 1QPXA 2D7MA 3NPZB 1QEWA 4I18C 2EE9A 2EDWA 5IQ9A 2H3NA 4M6NH 5HVGB 1UQSB 3VWKD 1UKTA