1T4ZA

Solution structure of the n-terminal domain of synechococcus elongatus sasa (25-structures ensemble)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
105
structure length
105
Chain Sequence
GSSLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLVEYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQWLVQQEGIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adaptive-response sensory-kinase sasA
publication title Structure of the N-terminal domain of the circadian clock-associated histidine kinase SasA.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transferase
total genus 19
structure length 105
sequence length 105
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t4zA01
1O6JA 3A3TA 5DJLA 4X43A 1G0TA 3FZ4A 2AB6A 2YN1A 3FY7A 3ZLPA 1QK8A 3QDNA 5CO3A 2L4CA 1XWAA 4LMWA 4L0UA 4KSOA 1TK5B 1ERWA 4MJAA 4PURA 3D5JA 2H70A 4D73B 4MP4A 4WBRD 2H30A 4GSTA 2C0GA 2GLRA 1GTBA 4JR6A 5JCGA 3BBYA 3WT2A 4MABA 2G0FA 5CNWA 4I97A 2VLUA 5EY6A 1GLQA 2O85A 4N30A 2OE0A 4IHUA 2E0QA 1GSSA 5CRGA 3LYPA 3MDKA 5LCZA 1OC9A 2B1LA 2XBQA 4PQIA 2L6CA 5HFGA 3O76A 1X0RA 3FZAA 5IMAA 4J2FA 4BWSA 1NHOA 5A5KA 2V6OA 4JRRA 1O85A 2LQOA 3KGKA 2QKEA 5L71A 4K2DA 5GSTA 1IYIA 4HU7A 3FYGA 1PSQA 7GSSA 1T1VA 2YZUA 5IMDA 1RQMA 1GSEA 4IBPA 5JWOB 5ID2B 2HZEB 4OO5A 1WMJA 2L4QA 4D73A 3E0UA 4DSSA 1K0NA 2H0HA 2QC7A 2WULA 2FWFA 4IP1A 3WGXA 1M99A 2WRTA 3UJ1A 5F06A 2PWJA 4WXTA 3TRQA 3HYPA 1X9WB 3DEXA 3VURA 1PL1A 1Z5YE 2ZCTA 5H5SA 4AJ6A 1WP0A 1X9MB 4DSQA 3P90A 4XS1A 3M3MA 1YDKA 3KIJA 3IDVA 1U88A 4IGJA 2ZUPA 3UVHA 3EE2A 3V1WA 2EIQA 2JACA 2AHEA 3CSIA 4KA0A 4ZB6A 3KH9A 3GNJA 3C73A 5ECRB 3BOAA 1AUCA 3MNGA 4IS0A 3KM6A 2GDRA 1FHEA 2NTOA 3L9SA 5CAXA 2WJUA 3WGEA 4KDXA 2H6ZA 3WYWA 1A23A 5B8AA 4BA7A 2VAFA 4MDCA 1T7PB 5ID2A 2CX3A 2NBSA 6GSVA 5DJMA 1U3IA 1SYRA 1THOA 2H19A 3KZQA 1ON4A 3I6AA 12GSA 4OCEA 2WS2A 3QD9A 2GT6A 2B3SA 1HNBA 2ES7A 4GWRA 4CW9A 1GUHA 3HJMA 4WKWA 5IO2A 2WB9A 4BVXA 5G2ZA 3WGDA 4N11A 2YWOA 3A2WA 3TJBA 2ON7A 14GSA 3GKKA 2OE3A 4K1FA 4NHWA 4AF2A 2F3MA 1PA3A 3ISOA 4TVEA 2HYXA 3F63A 3U6VA 4JEDA 3Q19A 4EVMA 2V1MA 3VWUA 2KUCA 4HZ2A 3TKRA 1SJZA 4X1UA 4BPYA 2LNTA 4OO4A 5J9BA 4MF5A 3DIEA 4K9ZA 4KSMA 4QL7A 3FZ5A 1C72A 2CAQA 2XHFA 2GSQA 3RPNA 5G5FA 2HRFA 3Q6OA 1O8XA 3DWVA 3L9UA 6GSXA 4GXZA 2PPTA 2KP2A 2YWNA 4POLA 2KP1A 3TJJA 2VL3A 1E6BA 3RPPA 2WGRA 5A4UA 5D93A 1ML6A 1AAZA 3RBTA 2CVKA 2MMNA 3KCMA 4IQ1A 3C7MA 5F0GA 3MSZA 1YY7A 1SD8A 4EKZA 1MD4A 4PGTA 4HZ4A 2VM1A 4G19A 2ZNMA 4MMMA 4HJMA 2IFQB 3FR9A 5J41A 2HFDA 6GSSA 2YV7A 1XIYA 1M9AA 3GH9A 4KCEA 4XTSA 4KW6A 2FWGA 5D8IA 4XRAA 3UMAA 2LEGA 2D2ZA 3APSA 1TRVA 5ELGA 2R5GA 2M80A 3EINA 5ENUA 2X8HA 5HFIA 1XW9A 3M9JA 2XPEA 1HNAA 5E4WA 3ED3A 1TKDB 1MDIA 4PQ1A 4J57E 5E59A 4NMUA 5F8BA 2X64A 4FIWA 3IAS2 1S3CA 2H0IA 3W8SA 5HR2A 3D4MA 1M9BA 3EVIA 2VCXA 2TRCP 4MF7A 1ERTA 3KXOA 4LLRA 4CHSA 1W4VA 2IMIA 2PN8A 3H93A 5ECKB 3VK9A 3ZIJA 1JHBA 5ECQB 2VLVA 1QMVA 4JBBA 4RQRA 2F9SA 2VL2C 1XW5A 1XCCA 1MDKA 2M46A 4K7OA 6GSWA 3TCOA 2R6KA 2IFQA 3EMXA 4ZB8A 4YQMA 2DJJA 5G30A 20GSA 1GTIA 3D22A 2H1AA 1XVQA 2PERA 4YQUA 3IA1A 2B1KA 1PRXA 1W89A 1ZOFA 4K0NA 3ZMLA 3GTUA 3J7Yk 5JCWA 4ZL9A 1MDJA 3Q18A 4J56E 2R37A 3CBUA 4I2UA 2WCIA 2N5BA 2E2GA 3LG6A 1O8WA 1UVZA 2VCZA 3HHVA 4KGIA 4E8HA 2HLSA 1GSFA 1T4ZA 3KTLA 2VD1A 3G7JA 5KN2A 3GL5A 3VWVA 4O92A 5H5QA 4Z7XA 1USBA 5B8BA 2GZZA 1SJ6A 2FUG2 2L5OA 19GSA 3UBKA 3ZREA 4G9HA 1YKCA 2ALBA 4K7IA 1QGVA 3HKRA 1JZWA 2LRCA 4IN0A 1WOUA 4EO3A 4POKA 2LKUA 3IK9A 2LRNA 3KP9A 4K7NA 1OE7A 3QAGA 3EWLA 1OC9B 5J9CA 3EU4A 2GSTA 1MEKA 3LEFA 2FY6A 3GKNA 3EYTA 1Z9HA 2MMAA 1U3AA 5J4UA 2C80A 4MJEA 6GSTA 1V57A 4ZIJA 1F37A 5HR1A 1SKRB 2GS3A 4PQHA 4MLYA 3EURA 2H71A 2C0EA 2XC2A 1GULA 1XWKA 1TXXA 4NWYA 2FCHA 3TB2A 5D96A 5AIVA 1U87A 3L78A 1G6WA 5DBQA 3GSSA 1GP1A 3A2XA 1B48A 16GSA 3KMOA 1M2BA 5F05A 4JU5A 5G1KA 4DSSB 3F4RA 2PVQA 2H0GA 4EC0A 3M9KA 1PQNA 1EGOA 2IPAA 3VI5A 2DBCA 1WE0A 1GTAA 3PH9A 5D9WA 4EUYA 4TN8A 1H4OA 5ECIB 2XPDA 3P7XA 2OBKA 3GV1A 1A2JA 4KCAA 1B8XA 1PN9A 1VF3A 1R5AA 3GX8A 2HT9A 3GIXA 2IMEA 10GSA 5ECOB 4MCUA 4KE3A 2VLTA 3VI7A 4G10A 4NV5A 1XXUA 2C3NA 3F6DA 4YAPA 1EV9A 5J5NA 1B9YC 1LU4A 1ZYEA 4PNFA 4WR5A 4MJCA 4IW9A 5IPHA 4POMA 3H79A 1XWCA 1Z7RA 2X99A 4RUVA 1WIKA 3W6GA 1YF0A 2BJXA 5ECSA 3VWXA 4I6XA 4TR3A 2H1DA 3NZNA 1K0OA 3UEMA 2JADA 3PINA 3FKFA 1TP9A 2C4JA 3UARA 4P3YB 2X8GA 3WT1A 3ZTLA 3H1NA 3QAVA 2DJ0A 3GA4A 1XWBA 3OR5A 2HSHA 5EPFA 3GKMA 4MJBA 4TXVA 1OVNA 4I5QA 4ZBDA 1KTEA 5COHA 3IK7A 1GTUA 4GTUA 1T3BA 4GF0A 1A2LA 2G2QA 1JFUA 5ECPB 5EVOA 3DVWA 5G1LA 2I1UA 18GSA 3TJKA 3N5OA 4K6XA 4LL4B 3QFBC 5GSSA 5KN0A 3CTFA 2I9HA 3D6IA 1OC8A 5JCUA 2RM6A 1SL2B 1NW2A 2GSRA 2I3YA 1TI1A 3M0FA 2R2JA 3D4TA 1SYXA 2LUSA 2L59A 2EIRA 3GURA 3HJPA 3IHQA 3BCIA 3H8QA 1TK0B 4YH2A 2JL4A 3IV4A 4MZBA 2LJKA 2VIMA 3CRUA 5FWGA 3ERFA 2H1GA 2AYTA 2DIYA 1YEPA 2H1BA 1I5GA 4WR4A 3DMLA 3TDGA 3QAWA 4ML6A 4K8MA 3D0ZA 5DQYA 4V2MA 2VL2A 3FEUA 5IQYA 2I81A 3DGQA 5IO0A 1AW9A 4I8BA 2B6MA 1Z7PA 1VRSD 6GSUA 4PUAA 2B7JA 4NHZA 1WJKA 1HNCA 3L0HA 1O7UA 3US3A 1GSYA 5ECNB 3HDCA 3I9V2 4ULXA 3GL3A 3FW2A 2IWTA 1K0MA 1ZGNA 3KEBA 1EEJA 4BVYA 3APQA 1B4QA 1BYEA 5IPGA 4TKYA 4HUAA 3HZ8A 2MZCA 2F8FA 3FR3A 3DRNA 3HXSA 3EMPA 3EC3A 2K9FA 2IN3A 3I69A 4XHMA 2GQMA 3IXRA 2ON5A 2YWMA 3UBLA 3M1GA 1DE2A 2A4VA 3VPTA 3HJOA 1ERUA 2E7PA 3IC4A 1PD21 2KLXA 5GAND 2IMDA 2L6DA 2BMXA 2RUFA 3TJGA 4LMVA 1AXDA 4F0BA 3QOUA 4NAXA 4V1Ap 4LL1B 1Y6EA 1DSBA 1WPIA 3GSTA 2QSIA 1KNGA 3C1SA 1EOHA 3IRAA 3N9JA 2C1YA 1XOBA 2NPBA 4EDYA 3LJRA 4EE0A 5A4VA 5CP1A 2MBTA 4ACSA 4BWQA 3F3RA 1EV4A 1XOAA 2O87A 4ID0A 4MH2A 5ECMB 2OE1A 1ZMAA 3F9UA 1QXHA 3SBCA 3P2AA 5IOWA 4K0GA 4CDOA 4TR0A 2C8UA 2HI7A 3LFLA 5G31A 3ZIVA 1K3YA 1AQWA 1BX9A 4KDUA 2DJ3A 4NV2A 5KEJA 2GT5A 2YZHA 5HFKA 1E2YA 5ELAA 4IJ3A 3DYRA 3GTUB 1TDIA 1XW6A 1T00A 3I43A 1U6TA 4TR1B 2NVLA 4PUFC 3IOSA 2LS5A 1PKZA 2YWIA 4MK3A 2YOIA 5FHIA 1Z6NA 2EC4A 4EF0A 1PGTA 1G7OA 1FOVA 1X9SB 3E3EA 4L8EA 2DMLA 4IJIA 1EZKA 1F2EA 1FVJA 3TRPA 1Z6MA 2YPMA 2B5XA 4OCFA 1V2AA 1GLPA 4O32A 2HXKA 1FG4A 3HZ4A 4MPGA 1AQXA 1GNEA 1V98A 2CA8A 4TOPA 1FO5A 1DBYA 4ZXGA 1X5CA 5D73A 5AN1A 3KJYA 4O5RA 3J7Yb 5DCHA 1GWCA 3GX0A 4IVFA 4F82A 4EL1A 2OKAA 3E9JB 1JLWA 4I2TA 1F3BA 4BL7A 2DJ1A 5IOXA 5LD0A 1YQ1A 2B5YA 2VCQA 5HR0A 5KN1A 1GRXA 4IELA 2PUKC 4TXOA 5DDLA 5EL8A 1PMTA 3ZFBA 2DSAA 3HVSA 4GQFA 3TKQA 3VWWA 2H01A 1XZOA 13GSA 1VF2A 2IJYA 2FLSA 1G6YA 2CT6A 3W8JA 3A5WA 3IAM2 2VO4A 2DMMA 1SKWB 2LRTA 3GYKA 5CYYA 1ILOA 4TR1A 4MZCA 2OJLA 1AIUA 5KN3A 3ZVJA 5DAKA 1EEMA 1ABAA 2A2SA 1TRUA 4F0CA 2RLIA 4HEA2 1K3OA 3IR4A 2CZ2A 1I9DA 3F4TA 4RQXA 1A0FA 2IMFA 17GSA 5HQPA 1WWJA 3QR6A 1H75A 2IMKA 2RM5A 1O81A 1R26A 3TOUA 1DE1A 1SENA 2QGVA 2M72A 3TJFA 2N5AA 2V41A 2P5QA 5AISA 3A2VA 1ACVA 4WETA 2Z9SA 4GQCA 3NOFA 1PX7A 1NSWA 1VGLA 1GSDA 2JZTA 1EGRA 4DEJA 4TR4A 5J3RA 4HU9A 1ZL9A 2JSZA 3GH6A 5B6MA 2FA8A 2P5RA 1PL2A 2F8AA 3CXGA 1FB6A 2LV3A 4IP6A 1S3AA 2O7KA 3LSZA 5IMVA 1UA5A 5G5EA 1SU9A 2AV4A 2VCVA 2VL9A 3ERWA 4O7HA 1CQGA 3LQ7A 2GQKA 1F9MA 4XS4A 1TJDA 2K6VA 3R2QA 2FA4A 3Q74A 4G2EA 3GN3A 1OAZA 1SJIA 2H72A 5DALB 4ZBBA 2C3TA 5AIXA 3GUSA 2VCTA 4OMVA 1A24A 3TKSC 1BQ7A 3DD3A 4ILFA 1DUGA 4RI7A 3PR8A 3P8WA 3JCML 2J23A 1SL0B 1HD2A 1TK8B 3F6FA 3GFKA 3HVXA 2PMTA 1UN2A 2YJ7A 2PBJA 4YAVA 2MMZA 2PVOC 1ZCPA 5DQSA 3F0IA 4GSSA 2RIIA 4E8EA 4XIHA 4KDYA 1V9WA 1K0CA 4LA1A 3TGZA 1XBSA 1A0RP 2DJKA 1MTCA 4MF6A 4X0XA 3BJ5A 2N5FA 4DSRA 4H86A 2CZ3A 1TI3A 4ZBAA 3ZVJD 2JZSA 4ECJA 2O8VB 4F03A 5DVBA 4MPFA 5JWQB 3WD6A 8GSSA 1R7HA 3GRXA 3UOMA 3CMIA 1KBNA 1Q4JA 4ZL8A 1F6MC 4JE1A 2H75A 6GSYA 2REMA 1BEDA 4V2LA 1M2AA 4ECBA 1YF1A 3CSHA 2RUEA 2VUPA 2GSSA 4KNDA 1JZDA 4FYUA 1TRSA 4FYCA 3C8EA 2H76A 4WF5A 2YJHA 5DALA 1G7EA 3ERGA 2OADA 1SD9A 1QFNA 2YP6A 5D9VA 4JR4A 1A8YA 3H4KA 1M2DA 1NHYA 4KX4A 1XVWA 2DJ2A 5FT3A 1BAYA 1YEXA 2GVPA 1T4YA 4GLTA 3VPQA 4N0ZA 1TOFA 2WZ9A 2F51A 4NPBA 3VFIA 4ML1A 1GSQA 1R4WA 4EXJA 5INYA 3F8UA 3RAZA 3M8NA 1SK1A 1N8JA 3EU3A 1GUMA 2GTUA 3ME7A 1B9XC 4POBA 4OFNA 2FGXA 3PGTA 4KB3A 3TKPA 2MYGA 3K8NA 3IPZA 4ISDA 4JZQA 2JU5A 4FYBA 4OWYA 4AJ8A 2FWEA 2NDOA 4N10A 3TUEA 3MWHA 1X5DA 4HQSA 1YZXA 2LTKA 4XS6A 3LORA 3DKSA 3BD2A 2IL3A 4N0VA 4QQ7A 4ZL7A 3F4SA 4DVCA 2OA7A 1JLVA 1J08A 2A2RA 1LBKA 3ZYWA 3IE3A 2AUVA 3AY8A 2H74A 3KP8A 1ZZYA 2LSTA 1SK2A 2JSYA 2C0DA 4Q5RA 2BTOT 1Y25A 4PNGA 4NXIA 4KAEA 1GNWA 3HA9A 3U5RE 3FHKA 5IMCA 2HZEA 3BCKA 4Q5QA 2FHEA 2DIZA 2L57A 2K18A 5IMFA 5H5RA 3FZ9A 2FD3A 2LJRA 3FRCA 4HS1A 3LYKA 1FB0A 2GZPA 4MH3A 4XRDA 4TRXA 4ZB9A 5GAPD 2DLXA 2GGTA 4XCSA 4FH8A 4OFMA 2CV4A 4GSNA 1A2MA 3G7IA 4L5LA 1YKAA 1OYJA 2AJQB 3LXTA 3QFAC 4ECCA 2J9HA 4MA9A 1J0FA 3S9FA 1RW1A 4TW5A 2PU9C 2B7KA 3RHCA 1K3LA 1TTZA 2HNLA 1THXA 2YANA 1GSUA 4V2NA 4HQZA 3KTBA 4V1Ag 2IIYA 1TW9A 2WFCA 2FWHA 5B6NA 3O6TA 1T8EB 3DXBA 2P31A 2HZFA 1N2AA 1IYHA 3TRXA 5CRWA 3ZITA 3QCPA 1EWXA 5C04A 4EDZA 1BG5A 4L5OA 2LNSA 2R4VA 1GUKA 2H6YA 3FK8A 1ZYQB 2H6XA 3O3TA 1XPVA 2VD0A 1B4PA 3L9VA 2LQQA 4KUNA 3C1RA 3HD5A 1TRWA 1WRYA 1X5EA 4PX1A 2X8CA 2VM2A 1SL1B 3QPMA 3LGCA 4TXOB 3GMFA 3CTGA 3TKSA 2VOCA 1QQ2A 5A4WA 3LXZA 2FNOA 4KH7A 3SWLA 5JWRB 1V58A 4FO5A 3APOA 1K0DA 1VF1A 3QMXA 3ZZXA 3G7YA 1HQOA 5CRHA 5ECLB 4MZWA 1R5PA 1K0AA 1UC7A 2AAWA 2PGTA 5GZZB 5DAKB 1AQVA 4F2IA 22GSA 1V40A 9GSSA 2DC5A 3VLNA 4ECIA 2CAIA 3HVVA 2V2GA 5LNKe 1PX6A 1SK0A 4OD7A 4PXOA 1HYUA 5C00A 1YJ6A 2YNXA 1EP7A 1QUWA 1JZRA 3C71A 2P0GA 2JZRA 1FAAA 2YV9A 3F3QA 3IBHA 4HI7A 1GL8A 1KEBA 1Z3EA 5CREA 5D9TA 3TKSE 1TU8A 2HRNA 3G9BA 3UIWA 3DVXA 4HOJA 3UAPA 1O73A 2OACA 3RHBA 3ZRDA 4WF4A 1OKTA 5IM9A 3KD0A 1VF4A 1JZOA 2H66A 1OC3A 2H73A 4RI6A 1XFLA 1M0UA 2E2MA 2WDUA 3UVTA 2HSYA 4XS4B 3ME8A 2H8LA 1LJRA 1OKDA 4IKHA 2TRXA 4ZILA 2CQ9A 3CSJA 4Q5NA 4OFTA 1RK4A 1FVKA 3ZL5A 3CRTA 5AGYA 2R3XA 4F9ZA 3KMNA 3ZMKA 2HE3A 2B5EA 2C3QA 2V32A 2CVDA 4GCIA 2VCWA 1M7TA 2TIRA 3RDWA 1F3AA 3UL3A 11GSA 1EP8A 3FR6A 2XBIA 1TU7A 2MBSA 1S3DA 5CRDA 1J9BA 5B7CA 2C0FA 5HR3A 5DCGA 4IQAA 3GHAA 1FW1A 1MD3A 2EIOA 2KHPA 1ST9A 1BJXA 4Q5FA 4WEYA 3ZFLA 3MAKA 5D9XA 4L0WA 3D21A 3HY2A 2K8VA 4HDEA 3HCZA 1SKSB 4YQVA 1AC1A 1PKWA 1EOGA 3KH7A 2CVBA 2CX4A 3NIVA 4AGSA 2L5LA 4WBJA 4HJ2A 2YCDA 1NM3A 1XWGA 2GQLA 5ABRA 1OE8A 1CQHA 5IMZA 1Q98A 2GZYA 2K8SA 4AJ7A 2KOKA 3TOTA 2MMOA 3CYNA 4GRFA 3L4NA 1URMA 3LWAA 5IIZA 2OBIA 2V6KA 3GKXA 2O89A 1A8LA 2LJAA 4QL9A 1K0BA 1GH2A 2I4AA 5ECHB 5F07A 1ERVA
chains in the Genus database with same CATH superfamily
1O6JA 3A3TA 5DJLA 4X43A 1G0TA 3FZ4A 2AB6A 2YN1A 3FY7A 3ZLPA 1QK8A 3QDNA 5CO3A 2L4CA 4K2XA 1XWAA 4LMWA 4L0UA 4KSOA 1TK5B 1ERWA 4MJAA 4PURA 3D5JA 2H70A 4D73B 1ZYNA 4MP4A 4WBRD 2H30A 4GSTA 2C0GA 2GLRA 1GTBA 4JR6A 5JCGA 4BIKA 3BBYA 3WT2A 4MABA 2G0FA 5CNWA 4I97A 2VLUA 5EY6A 1GLQA 2O85A 4N30A 2OE0A 4IHUA 2E0QA 1GSSA 5CRGA 3LYPA 3MDKA 5LCZA 1OC9A 2B1LA 2XBQA 4PQIA 2L6CA 5HFGA 3O76A 1X0RA 3FZAA 5IMAA 4J2FA 4BWSA 1NHOA 5A5KA 2V6OA 4JRRA 1O85A 2LQOA 4A5PA 3KGKA 2QKEA 5L71A 4KF9A 4K2DA 5GSTA 1IYIA 4HU7A 3FYGA 1PSQA 7GSSA 1T1VA 2YZUA 5IMDA 1RQMA 1GSEA 4IBPA 5JWOB 5ID2B 2HZEB 4OO5A 1WMJA 2L4QA 4D73A 3E0UA 4DSSA 4K5SA 1K0NA 2H0HA 2QC7A 2WULA 2FWFA 4IP1A 3WGXA 1M99A 2WRTA 3UJ1A 5F06A 2PWJA 4WXTA 3TRQA 3HYPA 1X9WB 3DEXA 3VURA 1PL1A 1Z5YE 2ZCTA 5H5SA 4AJ6A 1WP0A 1X9MB 4DSQA 3P90A 4XS1A 3M3MA 1YDKA 3KIJA 3IDVA 1U88A 4IGJA 3FMWA 2ZUPA 3UVHA 3EE2A 3V1WA 2DKIA 2EIQA 2JACA 2AHEA 3CSIA 4KA0A 4ZB6A 3KH9A 3GNJA 3C73A 5ECRB 3BOAA 1AUCA 3MNGA 4IS0A 3KM6A 2GDRA 1FHEA 2NTOA 3L9SA 5CAXA 2WJUA 3WGEA 4KDXA 2H6ZA 3WYWA 1A23A 4Z2RA 5B8AA 4BA7A 2VAFA 4MDCA 1T7PB 5ID2A 2CX3A 2NBSA 6GSVA 5DJMA 1U3IA 1SYRA 1THOA 2H19A 3KZQA 1ON4A 3I6AA 12GSA 4OCEA 2WS2A 3QD9A 2GT6A 2B3SA 1HNBA 2ES7A 4GWRA 4CW9A 1GUHA 4CY8A 3HJMA 4WKWA 5IO2A 2WB9A 4BVXA 5G2ZA 3WGDA 4N11A 2YWOA 3A2WA 3TJBA 4ICYA 2ON7A 14GSA 3GKKA 2OE3A 4K1FA 4NHWA 4AF2A 2F3MA 1PA3A 3ISOA 4TVEA 2HYXA 3F63A 3U6VA 4JEDA 3Q19A 4EVMA 2V1MA 3VWUA 2KUCA 4HZ2A 3TKRA 1SJZA 4X1UA 4BPYA 2LNTA 4OO4A 5J9BA 4MF5A 3DIEA 4K9ZA 4KSMA 4QL7A 4HSCX 3FZ5A 1C72A 2CAQA 2XHFA 2GSQA 3RPNA 5G5FA 2HRFA 3Q6OA 1O8XA 3DWVA 3L9UA 6GSXA 4GXZA 2R0PA 2PPTA 2KP2A 2YWNA 4POLA 2KP1A 3TJJA 2VL3A 1E6BA 3RPPA 2WGRA 5A4UA 5D93A 1ML6A 1AAZA 3RBTA 2CVKA 2MMNA 3KCMA 4IQ1A 3C7MA 5F0GA 3MSZA 1YY7A 1SD8A 4EKZA 1MD4A 4PGTA 4HZ4A 2VM1A 4G19A 2ZNMA 4MMMA 4HJMA 2IFQB 3FR9A 5J41A 2HFDA 6GSSA 2YV7A 1XIYA 1M9AA 3GH9A 4KCEA 4XTSA 4X4JA 4KW6A 2FWGA 5D8IA 4XRAA 3UMAA 2LEGA 2D2ZA 3APSA 1TRVA 5ELGA 2R5GA 2M80A 3EINA 5ENUA 2R0GA 2X8HA 5HFIA 1XW9A 3M9JA 2XPEA 1HNAA 5E4WA 3ED3A 1TKDB 1MDIA 4G0KA 4PQ1A 4J57E 5E59A 4NMUA 5F8BA 2X64A 4FIWA 3IAS2 1S3CA 2H0IA 3W8SA 5HR2A 3D4MA 1M9BA 3EVIA 2VCXA 2TRCP 4MF7A 1ERTA 3KXOA 4LLRA 4CHSA 1W4VA 2IMIA 2PN8A 3H93A 5ECKB 3VK9A 3ZIJA 1JHBA 5ECQB 2VLVA 1QMVA 4JBBA 4RQRA 2F9SA 2VL2C 1XW5A 1XCCA 1MDKA 2M46A 4K7OA 6GSWA 3TCOA 2R6KA 2IFQA 3EMXA 4ZB8A 4YQMA 2DJJA 5G30A 20GSA 1GTIA 3D22A 2H1AA 1XVQA 2PERA 4YQUA 3IA1A 2B1KA 1PRXA 1W89A 1ZOFA 4K0NA 3ZMLA 3GTUA 3J7Yk 5JCWA 4ZL9A 1MDJA 3Q18A 4J56E 2R37A 3CBUA 4I2UA 5KOXA 2WCIA 2N5BA 2E2GA 3LG6A 1O8WA 1UVZA 2VCZA 3HHVA 4KGIA 4E8HA 2HLSA 1GSFA 3CQFA 1T4ZA 3KTLA 2VD1A 3G7JA 5KN2A 4EIPA 3GL5A 3VWVA 4O92A 5H5QA 4Z7XA 1USBA 5B8BA 2GZZA 1SJ6A 2FUG2 2L5OA 19GSA 2X49A 3UBKA 3ZREA 4G9HA 1YKCA 2ALBA 4K7IA 1QGVA 3HKRA 1JZWA 2LRCA 4IN0A 1WOUA 4EO3A 4POKA 2LKUA 3IK9A 2LRNA 3KP9A 4K7NA 1OE7A 3QAGA 5BRTA 4O5UA 3EWLA 1OC9B 5J9CA 3EU4A 2GSTA 1MEKA 3LEFA 2FY6A 3GKNA 3EYTA 1Z9HA 2MMAA 1U3AA 4CY6A 3A5IA 5J4UA 2C80A 4MJEA 4Z2TA 6GSTA 1V57A 4ZIJA 1F37A 5HR1A 1SKRB 2GS3A 4PQHA 4MLYA 3EURA 2H71A 2C0EA 2XC2A 1GULA 1XWKA 1TXXA 4NWYA 2FCHA 3TB2A 5D96A 5AIVA 1U87A 3L78A 1G6WA 5DBQA 2HRKA 3GSSA 1GP1A 3A2XA 4EIQA 1B48A 3EPTA 16GSA 3KMOA 1M2BA 5F05A 4JU5A 5G1KA 4DSSB 3F4RA 2PVQA 2H0GA 4EC0A 3M9KA 1PQNA 1EGOA 2IPAA 3VI5A 2DBCA 1WE0A 1GTAA 3PH9A 5D9WA 4EUYA 4TN8A 1H4OA 5ECIB 2XPDA 3P7XA 2OBKA 3GV1A 1A2JA 4KCAA 1B8XA 1PN9A 1VF3A 1R5AA 3GX8A 2HT9A 3GIXA 2IMEA 10GSA 5ECOB 3HVNA 4KE3A 4MCUA 2VLTA 3VI7A 4G10A 4NV5A 1XXUA 2C3NA 3F6DA 4YAPA 1EV9A 5J5NA 1B9YC 1LU4A 1ZYEA 4PNFA 4WR5A 4MJCA 4IW9A 5IPHA 4POMA 3H79A 1XWCA 1Z7RA 2X99A 4RUVA 1WIKA 3W6GA 5KOWA 1YF0A 2BJXA 5ECSA 3VWXA 4I6XA 4TR3A 2H1DA 3NZNA 1K0OA 3UEMA 2JADA 3PINA 3FKFA 1TP9A 2C4JA 3UARA 4P3YB 2X8GA 3WT1A 3ZTLA 3H1NA 3QAVA 2DJ0A 3GA4A 1XWBA 3OR5A 2HSHA 4O5QA 5EPFA 3GKMA 4MJBA 4TXVA 1OVNA 4I5QA 4YKFA 4ZBDA 1KTEA 5COHA 3IK7A 1GTUA 4GTUA 4G0LA 1T3BA 4GF0A 3IHGA 4BVXB 1A2LA 2G2QA 1JFUA 5ECPB 5EVOA 3DVWA 5G1LA 2I1UA 18GSA 3TJKA 3N5OA 4K6XA 4LL4B 3QFBC 5GSSA 2QA2A 5KN0A 4BVYB 3CTFA 2I9HA 3D6IA 1OC8A 5JCUA 2RM6A 1SL2B 1NW2A 2GSRA 2I3YA 1TI1A 3M0FA 2R2JA 3D4TA 1SYXA 2LUSA 2L59A 2EIRA 3GURA 3HJPA 3IHQA 3BCIA 3H8QA 1TK0B 4YH2A 2JL4A 3IV4A 4MZBA 2LJKA 2VIMA 3CRUA 5FWGA 2R0CA 1S3RA 3ERFA 2H1GA 2AYTA 2DIYA 1YEPA 2H1BA 1I5GA 4WR4A 3DMLA 3TDGA 3QAWA 4ML6A 4K8MA 3D0ZA 5DQYA 4V2MA 2VL2A 3FEUA 5IQYA 2I81A 3DGQA 5IO0A 1AW9A 4I8BA 2B6MA 2A2PA 1Z7PA 1VRSD 6GSUA 4PUAA 5BMUA 2B7JA 4NHZA 1WJKA 1HNCA 3L0HA 1O7UA 3US3A 1GSYA 5ECNB 3HDCA 3I9V2 4ULXA 3GL3A 3FW2A 2IWTA 1K0MA 1ZGNA 3KEBA 1EEJA 4BVYA 3APQA 1B4QA 1BYEA 5IPGA 4TKYA 4HUAA 3HZ8A 2MZCA 2F8FA 3FR3A 3DRNA 3HXSA 3EMPA 3EC3A 2K9FA 2IN3A 3I69A 4XHMA 2GQMA 3IXRA 2ON5A 2YWMA 4FQUA 3UBLA 3M1GA 1DE2A 2A4VA 3VPTA 3HJOA 1ERUA 2E7PA 3IC4A 1PD21 2KLXA 5GAND 2IMDA 2L6DA 2BMXA 2RUFA 3MYDA 3TJGA 4LMVA 1AXDA 4F0BA 3QOUA 4NAXA 4V1Ap 4LL1B 1Y6EA 1DSBA 1WPIA 3GSTA 2QSIA 1KNGA 3MIXA 3C1SA 1EOHA 3IRAA 2HSMA 3N9JA 2C1YA 1XOBA 2NPBA 4EDYA 3LJRA 4EE0A 5A4VA 5CP1A 2MBTA 4ACSA 4BWQA 3F3RA 1EV4A 1XOAA 4G0IA 2O87A 4ID0A 4MH2A 5ECMB 2OE1A 1ZMAA 3F9UA 1QXHA 4BL7B 3SBCA 3P2AA 5F07A 5IOWA 4K0GA 4CDOA 4TR0A 2C8UA 2HI7A 3LFLA 4USSA 4MNNA 5G31A 3ZIVA 1K3YA 1AQWA 1BX9A 4KDUA 2DJ3A 4NV2A 5KEJA 2GT5A 2YZHA 5HFKA 1E2YA 5ELAA 4IJ3A 3DYRA 3GTUB 1TDIA 1XW6A 1T00A 3I43A 1U6TA 4TR1B 2NVLA 4PUFC 3IOSA 2LS5A 1PKZA 2YWIA 4MK3A 2YOIA 5FHIA 1Z6NA 2EC4A 4EF0A 1PGTA 1G7OA 1FOVA 1X9SB 3E3EA 4L8EA 2DMLA 4IJIA 1EZKA 1F2EA 1FVJA 3TRPA 1Z6MA 2YPMA 2B5XA 4OCFA 1V2AA 1GLPA 4O32A 2HXKA 1FG4A 3HZ4A 4MPGA 1AQXA 1GNEA 1V98A 2CA8A 4TOPA 1FO5A 1DBYA 4ZXGA 1X5CA 5D73A 5AN1A 3KJYA 4O5RA 3J7Yb 5DCHA 1GWCA 3GX0A 4IVFA 4F82A 4EL1A 2OKAA 3E9JB 1JLWA 4I2TA 1F3BA 4BL7A 2DJ1A 5IOXA 5LD0A 4Z2UA 1FOHA 1YQ1A 2B5YA 2VCQA 5HR0A 5KN1A 1GRXA 4IELA 2PUKC 4TXOA 5DDLA 5EL8A 1PMTA 3ZFBA 2DSAA 3HVSA 4GQFA 3TKQA 3VWWA 2H01A 1XZOA 13GSA 1VF2A 2IJYA 2FLSA 1G6YA 2CT6A 3W8JA 3A5WA 3IAM2 2VO4A 2DMMA 1SKWB 2LRTA 3GYKA 5CYYA 1ILOA 4TR1A 4MZCA 1PFOA 2X4AA 2OJLA 1AIUA 5KN3A 3ZVJA 5DAKA 1EEMA 1ABAA 2A2SA 1TRUA 4F0CA 2RLIA 4HEA2 1K3OA 3IR4A 2CZ2A 1I9DA 3F4TA 4RQXA 1A0FA 2IMFA 17GSA 5HQPA 1WWJA 3QR6A 1H75A 2IMKA 2RM5A 1O81A 1R26A 3TOUA 1DE1A 1SENA 2QGVA 3TJFA 2N5AA 2V41A 2P5QA 5AISA 3A2VA 1ACVA 4WETA 2Z9SA 4GQCA 3NOFA 1PX7A 1NSWA 1VGLA 1GSDA 2JZTA 1EGRA 4DEJA 4TR4A 5J3RA 4HU9A 1ZL9A 1M3IA 2JSZA 3GH6A 5B6MA 2FA8A 2P5RA 1PL2A 2F8AA 3CXGA 1FB6A 2LV3A 4IP6A 1S3AA 2O7KA 3LSZA 5IMVA 1UA5A 5G5EA 1SU9A 2AV4A 2VCVA 2HRAA 2VL9A 3ERWA 4O7HA 1CQGA 3LQ7A 2GQKA 1F9MA 4XS4A 1TJDA 2K6VA 3R2QA 2FA4A 3Q74A 4G2EA 3GN3A 1OAZA 1SJIA 2H72A 5DALB 4ZBBA 2C3TA 5AIXA 3GUSA 2VCTA 4OMVA 1A24A 3TKSC 1BQ7A 3DD3A 4ILFA 1DUGA 4RI7A 3PR8A 3P8WA 3JCML 2J23A 1SL0B 1HD2A 1TK8B 3F6FA 3GFKA 3HVXA 2PMTA 1UN2A 2YJ7A 2PBJA 4YAVA 2MMZA 2PVOC 1ZCPA 5DQSA 3F0IA 4GSSA 2RIIA 4E8EA 4XIHA 4KDYA 1V9WA 1K0CA 4LA1A 3TGZA 1XBSA 1A0RP 2DJKA 1MTCA 4MF6A 4X0XA 3BJ5A 2N5FA 4DSRA 4H86A 2CZ3A 1TI3A 4ZBAA 3ZVJD 2JZSA 4ECJA 2O8VB 4F03A 5DVBA 4MPFA 5JWQB 3WD6A 8GSSA 1R7HA 3GRXA 3UOMA 3CMIA 1KBNA 1Q4JA 4ZL8A 1F6MC 4JE1A 2H75A 6GSYA 2REMA 1BEDA 4V2LA 1M2AA 4ECBA 1YF1A 3CSHA 2RUEA 2VUPA 2GSSA 4KNDA 1JZDA 4FYUA 1TRSA 4FYCA 3C8EA 2H76A 4WF5A 2YJHA 5DALA 1G7EA 3ERGA 2OADA 1SD9A 1QFNA 2YP6A 5D9VA 4JR4A 1A8YA 3H4KA 1M2DA 1NHYA 4KX4A 1XVWA 2DJ2A 5FT3A 1BAYA 1YEXA 2GVPA 1T4YA 4GLTA 3VPQA 4N0ZA 1TOFA 2WZ9A 2F51A 4NPBA 3VFIA 4ML1A 1GSQA 1R4WA 4EXJA 5INYA 3F8UA 3RAZA 3M8NA 1SK1A 1N8JA 3EU3A 1GUMA 2GTUA 3ME7A 1B9XC 4POBA 4OFNA 2FGXA 3PGTA 4KB3A 3TKPA 2MYGA 3K8NA 3IPZA 4ISDA 4JZQA 2JU5A 4FYBA 4OWYA 4AJ8A 2FWEA 2NDOA 4N10A 3TUEA 3MWHA 1X5DA 4HQSA 1YZXA 2LTKA 3IC8A 4XS6A 3LORA 3DKSA 3BD2A 2IL3A 4N0VA 4QQ7A 4ZL7A 3F4SA 4DVCA 2OA7A 1JLVA 1J08A 2A2RA 1LBKA 3ZYWA 3IE3A 2AUVA 3AY8A 2H74A 3KP8A 1ZZYA 2LSTA 2QA1A 1SK2A 2JSYA 2C0DA 4Q5RA 2BTOT 1Y25A 4PNGA 4NXIA 4KAEA 1GNWA 3HA9A 3U5RE 3FHKA 5IMCA 2HZEA 3BCKA 4Q5QA 2FHEA 2DIZA 2L57A 2K18A 5IMFA 5H5RA 3FZ9A 2FD3A 2LJRA 3FRCA 4HS1A 3LYKA 1FB0A 2GZPA 4MH3A 4XRDA 4TRXA 4ZB9A 5GAPD 2DLXA 2GGTA 4XCSA 4FH8A 4OFMA 2CV4A 4GSNA 1A2MA 3G7IA 4L5LA 1YKAA 1OYJA 2AJQB 3LXTA 3QFAC 4ECCA 2J9HA 4MA9A 1J0FA 3S9FA 1RW1A 1ZYPA 4TW5A 2PU9C 2B7KA 3RHCA 1K3LA 1TTZA 2HNLA 1THXA 2YANA 1GSUA 4V2NA 4HQZA 3KTBA 4V1Ag 2IIYA 1TW9A 2WFCA 2FWHA 5B6NA 3O6TA 1T8EB 3DXBA 2P31A 2HZFA 1N2AA 1IYHA 3TRXA 4YKGA 5CRWA 3ZITA 3LW9A 3QCPA 1EWXA 5C04A 4EDZA 1BG5A 4L5OA 2LNSA 2R4VA 1GUKA 2H6YA 3FK8A 1ZYQB 2H6XA 3O3TA 1PN0A 1XPVA 2VD0A 1B4PA 3L9VA 2LQQA 4KUNA 3C1RA 3HD5A 1TRWA 1WRYA 1X5EA 4PX1A 2X8CA 2VM2A 1SL1B 3QPMA 3LGCA 4TXOB 3GMFA 3CTGA 3TKSA 2VOCA 1QQ2A 5A4WA 3LXZA 2FNOA 4KH7A 3SWLA 5JWRB 1V58A 4FO5A 3APOA 1K0DA 1VF1A 3QMXA 3ZZXA 3G7YA 1HQOA 5CRHA 5ECLB 4MZWA 1R5PA 1K0AA 4K5RA 3PPUA 1UC7A 2AAWA 2PGTA 5GZZB 5DAKB 1AQVA 4PTSA 4F2IA 22GSA 1V40A 9GSSA 2DC5A 3VLNA 4ECIA 2CAIA 3HVVA 2V2GA 5LNKe 1XG8A 1PX6A 1SK0A 4OD7A 4PXOA 1HYUA 5C00A 1YJ6A 2YNXA 1EP7A 1QUWA 1JZRA 3C71A 2P0GA 2JZRA 1FAAA 2YV9A 3F3QA 3IBHA 4HI7A 1GL8A 1KEBA 1Z3EA 5CREA 5D9TA 3TKSE 1TU8A 2HRNA 3G9BA 3UIWA 3DVXA 4HOJA 3UAPA 1O73A 2OACA 3RHBA 3ZRDA 4WF4A 1OKTA 5IM9A 3KD0A 1VF4A 1JZOA 2H66A 1OC3A 2H73A 4RI6A 1XFLA 1M0UA 2E2MA 2UZ8A 2WDUA 3UVTA 2HSYA 4XS4B 3R3EA 3ME8A 2H8LA 1LJRA 1OKDA 4IKHA 2TRXA 4ZILA 2CQ9A 3CSJA 1M3JA 4Q5NA 4OFTA 1RK4A 1FVKA 3ZL5A 3CRTA 5AGYA 2R3XA 4F9ZA 3KMNA 3ZMKA 2HE3A 2B5EA 2C3QA 2V32A 2CVDA 2DKHA 4GCIA 2VCWA 1M7TA 2TIRA 3RDWA 1F3AA 3UL3A 11GSA 1EP8A 3FR6A 2XBIA 1TU7A 2MBSA 1S3DA 5CRDA 1J9BA 5B7CA 2C0FA 5HR3A 5DCGA 4IQAA 3GHAA 1FW1A 1MD3A 2EIOA 2KHPA 1ST9A 1BJXA 4Q5FA 4WEYA 3ZFLA 3MAKA 5D9XA 4L0WA 3D21A 3HY2A 2K8VA 4HDEA 3HCZA 1SKSB 4YQVA 1AC1A 1PKWA 1EOGA 3KH7A 2CVBA 2CX4A 3NIVA 4AGSA 2L5LA 4WBJA 4HJ2A 2YCDA 1NM3A 1XWGA 2GQLA 5ABRA 1OE8A 1CQHA 5IMZA 1Q98A 2GZYA 2A4HA 2K8SA 4AJ7A 2KOKA 3TOTA 2MMOA 3CYNA 4GRFA 3L4NA 1URMA 3LWAA 5IIZA 2OBIA 2V6KA 3GKXA 2O89A 1A8LA 2LJAA 4QL9A 1K0BA 1GH2A 2I4AA 5ECHB 2M72A 1ERVA
chains in the Genus database with same CATH topology
1O6JA 3A3TA 5DJLA 4X43A 1G0TA 3FZ4A 2AB6A 2YN1A 3FY7A 3ZLPA 1QK8A 3QDNA 5CO3A 2L4CA 4K2XA 1XWAA 4LMWA 4L0UA 4KSOA 1TK5B 1ERWA 4MJAA 4PURA 3D5JA 2H70A 4D73B 1ZYNA 4MP4A 4WBRD 2H30A 4GSTA 2C0GA 2GLRA 1GTBA 4JR6A 5JCGA 3BBYA 3WT2A 4MABA 2G0FA 5CNWA 4I97A 2VLUA 5EY6A 1GLQA 2O85A 4N30A 2OE0A 4IHUA 2E0QA 1GSSA 5CRGA 3LYPA 3MDKA 5LCZA 1OC9A 2B1LA 2XBQA 4PQIA 2L6CA 5HFGA 3O76A 1X0RA 3FZAA 5IMAA 4J2FA 4BWSA 1NHOA 5A5KA 2V6OA 4JRRA 1O85A 2LQOA 4A5PA 3KGKA 2QKEA 5L71A 4KF9A 4K2DA 5GSTA 1IYIA 4HU7A 3FYGA 1PSQA 7GSSA 1T1VA 2YZUA 5IMDA 1RQMA 1GSEA 4IBPA 5JWOB 5ID2B 2HZEB 4OO5A 1WMJA 2L4QA 4D73A 3E0UA 4DSSA 4K5SA 1K0NA 2H0HA 2QC7A 2WULA 2FWFA 4IP1A 3WGXA 1M99A 2WRTA 3UJ1A 5F06A 2PWJA 4WXTA 3TRQA 3HYPA 1X9WB 3DEXA 3VURA 1PL1A 1Z5YE 2ZCTA 5H5SA 4AJ6A 1WP0A 1X9MB 4DSQA 3P90A 4XS1A 3M3MA 1YDKA 3KIJA 3IDVA 1U88A 4IGJA 3FMWA 2ZUPA 3UVHA 3EE2A 3V1WA 2DKIA 2EIQA 2JACA 2AHEA 3CSIA 4KA0A 4ZB6A 3KH9A 3GNJA 3C73A 5ECRB 3BOAA 1AUCA 3MNGA 4IS0A 3KM6A 2GDRA 1FHEA 2NTOA 3L9SA 5CAXA 2WJUA 3WGEA 4KDXA 2H6ZA 3WYWA 1A23A 4Z2RA 5B8AA 4BA7A 2VAFA 4MDCA 1T7PB 5ID2A 2CX3A 2NBSA 6GSVA 5DJMA 1U3IA 1SYRA 1THOA 2H19A 3KZQA 1ON4A 3I6AA 12GSA 4OCEA 2WS2A 3QD9A 2GT6A 2B3SA 1HNBA 2ES7A 4GWRA 4CW9A 1GUHA 4CY8A 3HJMA 4WKWA 5IO2A 2WB9A 4BVXA 5G2ZA 3WGDA 4N11A 2YWOA 3A2WA 3TJBA 4ICYA 2ON7A 14GSA 3GKKA 2OE3A 4K1FA 4NHWA 4AF2A 2F3MA 1PA3A 3ISOA 4TVEA 2HYXA 3F63A 3U6VA 4JEDA 3Q19A 4EVMA 2V1MA 3VWUA 2KUCA 4HZ2A 3TKRA 1SJZA 4X1UA 4BPYA 2LNTA 4OO4A 5J9BA 4MF5A 3DIEA 4K9ZA 4KSMA 4QL7A 3FZ5A 1C72A 2CAQA 2XHFA 2GSQA 3RPNA 5G5FA 2HRFA 3Q6OA 1O8XA 3DWVA 3L9UA 6GSXA 4GXZA 2R0PA 2PPTA 2KP2A 2YWNA 4POLA 2KP1A 3TJJA 2VL3A 1E6BA 3RPPA 2WGRA 5A4UA 5D93A 1ML6A 1AAZA 3RBTA 2CVKA 2MMNA 3KCMA 4IQ1A 3C7MA 5F0GA 3MSZA 1YY7A 1SD8A 4EKZA 1MD4A 4PGTA 4HZ4A 2VM1A 4G19A 2ZNMA 4MMMA 4HJMA 2IFQB 3FR9A 5J41A 2HFDA 6GSSA 2YV7A 1XIYA 1M9AA 3GH9A 4KCEA 4XTSA 4X4JA 4KW6A 2FWGA 5D8IA 4XRAA 3UMAA 2LEGA 2D2ZA 3APSA 1TRVA 5ELGA 2R5GA 2M80A 3EINA 5ENUA 2R0GA 2X8HA 5HFIA 1XW9A 3M9JA 2XPEA 1HNAA 5E4WA 3ED3A 1TKDB 1MDIA 4G0KA 4PQ1A 4J57E 5E59A 4NMUA 5F8BA 2X64A 4FIWA 3IAS2 1S3CA 2H0IA 3W8SA 5HR2A 3D4MA 1M9BA 3EVIA 2VCXA 2TRCP 4MF7A 1ERTA 3KXOA 4LLRA 4CHSA 1W4VA 2IMIA 2PN8A 3H93A 5ECKB 3VK9A 3ZIJA 1JHBA 5ECQB 2VLVA 1QMVA 4JBBA 4RQRA 2F9SA 2VL2C 1XW5A 1XCCA 1MDKA 2M46A 4K7OA 6GSWA 3TCOA 2R6KA 2IFQA 3EMXA 4ZB8A 4YQMA 2DJJA 5G30A 20GSA 1GTIA 3D22A 2H1AA 1XVQA 2PERA 4YQUA 3IA1A 2B1KA 1PRXA 1W89A 1ZOFA 4K0NA 3ZMLA 3GTUA 3J7Yk 5JCWA 4ZL9A 1MDJA 3Q18A 4J56E 2R37A 3CBUA 4I2UA 5KOXA 2WCIA 2N5BA 2E2GA 3LG6A 1O8WA 1UVZA 2VCZA 3HHVA 4KGIA 4E8HA 2HLSA 1GSFA 1T4ZA 3KTLA 2VD1A 3G7JA 5KN2A 4EIPA 3GL5A 3VWVA 4O92A 5H5QA 4Z7XA 1USBA 5B8BA 2GZZA 1SJ6A 2FUG2 2L5OA 19GSA 2X49A 3UBKA 3ZREA 4G9HA 1YKCA 2ALBA 4K7IA 1QGVA 3HKRA 1JZWA 2LRCA 4IN0A 1WOUA 4EO3A 4POKA 2LKUA 3IK9A 2LRNA 3KP9A 4K7NA 1OE7A 3QAGA 5BRTA 4O5UA 3EWLA 1OC9B 5J9CA 3EU4A 2GSTA 1MEKA 3LEFA 2FY6A 3GKNA 3EYTA 1Z9HA 2MMAA 1U3AA 4CY6A 3A5IA 5J4UA 2C80A 4MJEA 4Z2TA 6GSTA 1V57A 4ZIJA 1F37A 5HR1A 1SKRB 2GS3A 4PQHA 4MLYA 3EURA 2H71A 2C0EA 2XC2A 1GULA 1XWKA 1TXXA 4NWYA 2FCHA 3TB2A 5D96A 5AIVA 1U87A 3L78A 1G6WA 5DBQA 2HRKA 3GSSA 1GP1A 3A2XA 4EIQA 1B48A 3EPTA 16GSA 3KMOA 1M2BA 5F05A 4JU5A 5G1KA 4DSSB 3F4RA 2PVQA 2H0GA 4EC0A 3M9KA 1PQNA 1EGOA 2IPAA 3VI5A 2DBCA 1WE0A 1GTAA 3PH9A 5D9WA 4EUYA 4TN8A 1H4OA 5ECIB 2XPDA 3P7XA 2OBKA 3GV1A 1A2JA 4KCAA 1B8XA 1PN9A 1VF3A 1R5AA 3GX8A 2HT9A 3GIXA 2IMEA 10GSA 5ECOB 4MCUA 4KE3A 2VLTA 3VI7A 4G10A 4NV5A 1XXUA 2C3NA 3F6DA 4YAPA 1EV9A 5J5NA 1B9YC 1LU4A 1ZYEA 4PNFA 4WR5A 4MJCA 4IW9A 5IPHA 4POMA 3H79A 1XWCA 1Z7RA 2X99A 4RUVA 1WIKA 3W6GA 5KOWA 1YF0A 2BJXA 5ECSA 3VWXA 4I6XA 4TR3A 2H1DA 3NZNA 1K0OA 3UEMA 2JADA 3PINA 3FKFA 1TP9A 2C4JA 3UARA 4P3YB 2X8GA 3WT1A 3ZTLA 3H1NA 3QAVA 2DJ0A 3GA4A 1XWBA 3OR5A 2HSHA 4O5QA 5EPFA 3GKMA 4MJBA 4TXVA 1OVNA 4I5QA 4YKFA 4ZBDA 1KTEA 5COHA 3IK7A 1GTUA 4GTUA 4G0LA 1T3BA 4GF0A 3IHGA 4BVXB 1A2LA 2G2QA 1JFUA 5ECPB 5EVOA 3DVWA 5G1LA 2I1UA 18GSA 3TJKA 3N5OA 4K6XA 4LL4B 3QFBC 5GSSA 2QA2A 5KN0A 4BVYB 3CTFA 2I9HA 3D6IA 1OC8A 5JCUA 2RM6A 1SL2B 1NW2A 2GSRA 2I3YA 1TI1A 3M0FA 2R2JA 3D4TA 1SYXA 2LUSA 2L59A 2EIRA 3GURA 3HJPA 3IHQA 3BCIA 3H8QA 1TK0B 4YH2A 2JL4A 3IV4A 4MZBA 2LJKA 2VIMA 3CRUA 5FWGA 2R0CA 3ERFA 2H1GA 2AYTA 2DIYA 1YEPA 2H1BA 1I5GA 4WR4A 3DMLA 3TDGA 3QAWA 4ML6A 4K8MA 3D0ZA 5DQYA 4V2MA 2VL2A 3FEUA 5IQYA 2I81A 3DGQA 5IO0A 1AW9A 4I8BA 2B6MA 2A2PA 1Z7PA 1VRSD 6GSUA 4PUAA 5BMUA 2B7JA 4NHZA 1WJKA 1HNCA 3L0HA 1O7UA 3US3A 1GSYA 5ECNB 3HDCA 3I9V2 4ULXA 3GL3A 3FW2A 2IWTA 1K0MA 1ZGNA 3KEBA 1EEJA 4BVYA 3APQA 1B4QA 1BYEA 5IPGA 4TKYA 4HUAA 3HZ8A 2MZCA 2F8FA 3FR3A 3DRNA 3HXSA 3EMPA 3EC3A 2K9FA 2IN3A 3I69A 4XHMA 2GQMA 3IXRA 2ON5A 2YWMA 4FQUA 3UBLA 3M1GA 1DE2A 2A4VA 3VPTA 3HJOA 1ERUA 2E7PA 3IC4A 1PD21 2KLXA 5GAND 2IMDA 2L6DA 2BMXA 2RUFA 3MYDA 3TJGA 4LMVA 1AXDA 4F0BA 3QOUA 4NAXA 4V1Ap 4LL1B 1Y6EA 1DSBA 1WPIA 3GSTA 2QSIA 1KNGA 3MIXA 3C1SA 1EOHA 3IRAA 2HSMA 3N9JA 2C1YA 1XOBA 2NPBA 4EDYA 3LJRA 4EE0A 5A4VA 5CP1A 2MBTA 4ACSA 4BWQA 3F3RA 1EV4A 1XOAA 4G0IA 2O87A 4ID0A 4MH2A 5ECMB 2OE1A 1ZMAA 3F9UA 1QXHA 4BL7B 3SBCA 3P2AA 5F07A 5IOWA 4K0GA 4CDOA 4TR0A 2C8UA 2HI7A 3LFLA 4USSA 4MNNA 5G31A 3ZIVA 1K3YA 1AQWA 1BX9A 4KDUA 2DJ3A 4NV2A 5KEJA 2GT5A 2YZHA 5HFKA 1E2YA 5ELAA 4IJ3A 3DYRA 3GTUB 1TDIA 1XW6A 1T00A 3I43A 1U6TA 4TR1B 2NVLA 4PUFC 3IOSA 2LS5A 1PKZA 2YWIA 4MK3A 2YOIA 5FHIA 1Z6NA 2EC4A 4EF0A 1PGTA 1G7OA 1FOVA 1X9SB 3E3EA 4L8EA 2DMLA 4IJIA 1EZKA 1F2EA 1FVJA 3TRPA 1Z6MA 2YPMA 2B5XA 4OCFA 1V2AA 1GLPA 4O32A 2HXKA 1FG4A 3HZ4A 4MPGA 1AQXA 1GNEA 1V98A 2CA8A 4TOPA 1FO5A 1DBYA 4ZXGA 1X5CA 5D73A 5AN1A 3KJYA 4O5RA 3J7Yb 5DCHA 1GWCA 3GX0A 4IVFA 4F82A 4EL1A 2OKAA 3E9JB 1JLWA 4I2TA 1F3BA 4BL7A 2DJ1A 5IOXA 5LD0A 4Z2UA 1FOHA 1YQ1A 2B5YA 2VCQA 5HR0A 5KN1A 1GRXA 4IELA 2PUKC 4TXOA 5DDLA 5EL8A 1PMTA 3ZFBA 2DSAA 3HVSA 4GQFA 3TKQA 3VWWA 2H01A 1XZOA 13GSA 1VF2A 2IJYA 2FLSA 1G6YA 2CT6A 3W8JA 3A5WA 3IAM2 2VO4A 2DMMA 1SKWB 2LRTA 3GYKA 5CYYA 1ILOA 4TR1A 4MZCA 2X4AA 2OJLA 1AIUA 5KN3A 3ZVJA 5DAKA 1EEMA 1ABAA 2A2SA 1TRUA 4F0CA 2RLIA 4HEA2 1K3OA 3IR4A 2CZ2A 1I9DA 3F4TA 4RQXA 1A0FA 2IMFA 17GSA 5HQPA 1WWJA 3QR6A 1H75A 2IMKA 2RM5A 1O81A 1R26A 3TOUA 1DE1A 1SENA 2QGVA 3TJFA 2N5AA 2V41A 2P5QA 5AISA 3A2VA 1ACVA 4WETA 2Z9SA 4GQCA 3NOFA 1PX7A 1NSWA 1VGLA 1GSDA 2JZTA 1EGRA 4DEJA 4TR4A 5J3RA 4HU9A 1ZL9A 2JSZA 3GH6A 5B6MA 2FA8A 2P5RA 1PL2A 2F8AA 3CXGA 1FB6A 2LV3A 4IP6A 1S3AA 2O7KA 3LSZA 5IMVA 1UA5A 5G5EA 1SU9A 2AV4A 2VCVA 2HRAA 2VL9A 3ERWA 4O7HA 1CQGA 3LQ7A 2GQKA 1F9MA 4XS4A 1TJDA 2K6VA 3R2QA 2FA4A 3Q74A 4G2EA 3GN3A 1OAZA 1SJIA 2H72A 5DALB 4ZBBA 2C3TA 5AIXA 3GUSA 2VCTA 4OMVA 1A24A 3TKSC 1BQ7A 3DD3A 4ILFA 1DUGA 4RI7A 3PR8A 3P8WA 3JCML 2J23A 1SL0B 1HD2A 1TK8B 3F6FA 3GFKA 3HVXA 2PMTA 1UN2A 2YJ7A 2PBJA 4YAVA 2MMZA 2PVOC 1ZCPA 5DQSA 3F0IA 4GSSA 2RIIA 4E8EA 4XIHA 4KDYA 1V9WA 1K0CA 4LA1A 3TGZA 1XBSA 1A0RP 2DJKA 1MTCA 4MF6A 4X0XA 3BJ5A 2N5FA 4DSRA 4H86A 2CZ3A 1TI3A 4ZBAA 3ZVJD 2JZSA 4ECJA 2O8VB 4F03A 5DVBA 4MPFA 5JWQB 3WD6A 8GSSA 1R7HA 3GRXA 3UOMA 3CMIA 1KBNA 1Q4JA 4ZL8A 1F6MC 4JE1A 2H75A 6GSYA 2REMA 1BEDA 4V2LA 1M2AA 4ECBA 1YF1A 3CSHA 2RUEA 2VUPA 2GSSA 4KNDA 1JZDA 4FYUA 1TRSA 4FYCA 3C8EA 2H76A 4WF5A 2YJHA 5DALA 1G7EA 3ERGA 2OADA 1SD9A 1QFNA 2YP6A 5D9VA 4JR4A 1A8YA 3H4KA 1M2DA 1NHYA 4KX4A 1XVWA 2DJ2A 5FT3A 1BAYA 1YEXA 2GVPA 1T4YA 4GLTA 3VPQA 4N0ZA 1TOFA 2WZ9A 2F51A 4NPBA 3VFIA 4ML1A 1GSQA 1R4WA 4EXJA 5INYA 3F8UA 3RAZA 3M8NA 1SK1A 1N8JA 3EU3A 1GUMA 2GTUA 3ME7A 1B9XC 4POBA 4OFNA 2FGXA 3PGTA 4KB3A 3TKPA 2MYGA 3K8NA 3IPZA 4ISDA 4JZQA 2JU5A 4FYBA 4OWYA 4AJ8A 2FWEA 2NDOA 4N10A 3TUEA 3MWHA 1X5DA 4HQSA 1YZXA 2LTKA 3IC8A 4XS6A 3LORA 3DKSA 3BD2A 2IL3A 4N0VA 4QQ7A 4ZL7A 3F4SA 4DVCA 2OA7A 1JLVA 1J08A 2A2RA 1LBKA 3ZYWA 3IE3A 2AUVA 3AY8A 2H74A 3KP8A 1ZZYA 2LSTA 2QA1A 1SK2A 2JSYA 2C0DA 4Q5RA 2BTOT 1Y25A 4PNGA 4NXIA 4KAEA 1GNWA 3HA9A 3U5RE 3FHKA 5IMCA 2HZEA 3BCKA 4Q5QA 2FHEA 2DIZA 2L57A 2K18A 5IMFA 5H5RA 3FZ9A 2FD3A 2LJRA 3FRCA 4HS1A 3LYKA 1FB0A 2GZPA 4MH3A 4XRDA 4TRXA 4ZB9A 5GAPD 2DLXA 2GGTA 4XCSA 4FH8A 4OFMA 2CV4A 4GSNA 1A2MA 3G7IA 4L5LA 1YKAA 1OYJA 2AJQB 3LXTA 3QFAC 4ECCA 2J9HA 4MA9A 1J0FA 3S9FA 1RW1A 1ZYPA 4TW5A 2PU9C 2B7KA 3RHCA 1K3LA 1TTZA 2HNLA 1THXA 2YANA 1GSUA 4V2NA 4HQZA 3KTBA 4V1Ag 2IIYA 1TW9A 2WFCA 2FWHA 5B6NA 3O6TA 1T8EB 3DXBA 2P31A 2HZFA 1N2AA 1IYHA 3TRXA 4YKGA 5CRWA 3ZITA 3LW9A 3QCPA 1EWXA 5C04A 4EDZA 1BG5A 4L5OA 2LNSA 2R4VA 1GUKA 2H6YA 3FK8A 1ZYQB 2H6XA 3O3TA 1PN0A 1XPVA 2VD0A 1B4PA 3L9VA 2LQQA 4KUNA 3C1RA 3HD5A 1TRWA 1WRYA 1X5EA 4PX1A 2X8CA 2VM2A 1SL1B 3QPMA 3LGCA 4TXOB 3GMFA 3CTGA 3TKSA 2VOCA 1QQ2A 5A4WA 3LXZA 2FNOA 4KH7A 3SWLA 5JWRB 1V58A 4FO5A 3APOA 1K0DA 1VF1A 3QMXA 3ZZXA 3G7YA 1HQOA 5CRHA 5ECLB 4MZWA 1R5PA 1K0AA 4K5RA 3PPUA 1UC7A 2AAWA 2PGTA 5GZZB 5DAKB 1AQVA 4PTSA 4F2IA 22GSA 1V40A 9GSSA 2DC5A 3VLNA 4ECIA 2CAIA 3HVVA 2V2GA 5LNKe 1PX6A 1SK0A 4OD7A 4PXOA 1HYUA 5C00A 1YJ6A 2YNXA 1EP7A 1QUWA 1JZRA 3C71A 2P0GA 2JZRA 1FAAA 2YV9A 3F3QA 3IBHA 4HI7A 1GL8A 1KEBA 1Z3EA 5CREA 5D9TA 3TKSE 1TU8A 2HRNA 3G9BA 3UIWA 3DVXA 4HOJA 3UAPA 1O73A 2OACA 3RHBA 3ZRDA 4WF4A 1OKTA 5IM9A 3KD0A 1VF4A 1JZOA 2H66A 1OC3A 2H73A 4RI6A 1XFLA 1M0UA 2E2MA 2UZ8A 2WDUA 3UVTA 2HSYA 4XS4B 3R3EA 3ME8A 2H8LA 1LJRA 1OKDA 4IKHA 2TRXA 4ZILA 2CQ9A 3CSJA 4Q5NA 4OFTA 1RK4A 1FVKA 3ZL5A 3CRTA 5AGYA 2R3XA 4F9ZA 3KMNA 3ZMKA 2HE3A 2B5EA 2C3QA 2V32A 2CVDA 2DKHA 4GCIA 2VCWA 1M7TA 2TIRA 3RDWA 1F3AA 3UL3A 11GSA 1EP8A 3FR6A 2XBIA 1TU7A 2MBSA 1S3DA 5CRDA 1J9BA 5B7CA 2C0FA 5HR3A 5DCGA 4IQAA 3GHAA 1FW1A 1MD3A 2EIOA 2KHPA 1ST9A 1BJXA 4Q5FA 4WEYA 3ZFLA 3MAKA 5D9XA 4L0WA 3D21A 3HY2A 2K8VA 4HDEA 3HCZA 1SKSB 4YQVA 1AC1A 1PKWA 1EOGA 3KH7A 2CVBA 2CX4A 3NIVA 4AGSA 2L5LA 4WBJA 4HJ2A 2YCDA 1NM3A 1XWGA 2GQLA 5ABRA 1OE8A 1CQHA 5IMZA 1Q98A 2GZYA 2A4HA 2K8SA 4AJ7A 2KOKA 3TOTA 2MMOA 3CYNA 4GRFA 3L4NA 1URMA 3LWAA 5IIZA 2OBIA 2V6KA 3GKXA 2O89A 1A8LA 2LJAA 4QL9A 1K0BA 1GH2A 2I4AA 5ECHB 2M72A 1ERVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6J A;  3A3T A;  5DJL A;  4X43 A;  1G0T A;  3FZ4 A;  2AB6 A;  2YN1 A;  3FY7 A;  3ZLP A;  1QK8 A;  3QDN A;  5CO3 A;  2L4C A;  1XWA A;  4LMW A;  4L0U A;  4KSO A;  1TK5 B;  1ERW A;  4MJA A;  4PUR A;  3D5J A;  2H70 A;  4D73 B;  4MP4 A;  4WBR D;  2H30 A;  4GST A;  2C0G A;  2GLR A;  1GTB A;  4JR6 A;  5JCG A;  3BBY A;  3WT2 A;  4MAB A;  2G0F A;  5CNW A;  4I97 A;  2VLU A;  5EY6 A;  1GLQ A;  2O85 A;  4N30 A;  2OE0 A;  4IHU A;  2E0Q A;  1GSS A;  5CRG A;  3LYP A;  3MDK A;  5LCZ A;  1OC9 A;  2B1L A;  2XBQ A;  4PQI A;  2L6C A;  5HFG A;  3O76 A;  1X0R A;  3FZA A;  5IMA A;  4J2F A;  4BWS A;  1NHO A;  5A5K A;  2V6O A;  4JRR A;  1O85 A;  2LQO A;  3KGK A;  2QKE A;  5L71 A;  4K2D A;  5GST A;  1IYI A;  4HU7 A;  3FYG A;  1PSQ A;  7GSS A;  1T1V A;  2YZU A;  5IMD A;  1RQM A;  1GSE A;  4IBP A;  5JWO B;  5ID2 B;  2HZE B;  4OO5 A;  1WMJ A;  2L4Q A;  4D73 A;  3E0U A;  4DSS A;  1K0N A;  2H0H A;  2QC7 A;  2WUL A;  2FWF A;  4IP1 A;  3WGX A;  1M99 A;  2WRT A;  3UJ1 A;  5F06 A;  2PWJ A;  4WXT A;  3TRQ A;  3HYP A;  1X9W B;  3DEX A;  3VUR A;  1PL1 A;  1Z5Y E;  2ZCT A;  5H5S A;  4AJ6 A;  1WP0 A;  1X9M B;  4DSQ A;  3P90 A;  4XS1 A;  3M3M A;  1YDK A;  3KIJ A;  3IDV A;  1U88 A;  4IGJ A;  2ZUP A;  3UVH A;  3EE2 A;  3V1W A;  2EIQ A;  2JAC A;  2AHE A;  3CSI A;  4KA0 A;  4ZB6 A;  3KH9 A;  3GNJ A;  3C73 A;  5ECR B;  3BOA A;  1AUC A;  3MNG A;  4IS0 A;  3KM6 A;  2GDR A;  1FHE A;  2NTO A;  3L9S A;  5CAX A;  2WJU A;  3WGE A;  4KDX A;  2H6Z A;  3WYW A;  1A23 A;  5B8A A;  4BA7 A;  2VAF A;  4MDC A;  1T7P B;  5ID2 A;  2CX3 A;  2NBS A;  6GSV A;  5DJM A;  1U3I A;  1SYR A;  1THO A;  2H19 A;  3KZQ A;  1ON4 A;  3I6A A;  12GS A;  4OCE A;  2WS2 A;  3QD9 A;  2GT6 A;  2B3S A;  1HNB A;  2ES7 A;  4GWR A;  4CW9 A;  1GUH A;  3HJM A;  4WKW A;  5IO2 A;  2WB9 A;  4BVX A;  5G2Z A;  3WGD A;  4N11 A;  2YWO A;  3A2W A;  3TJB A;  2ON7 A;  14GS A;  3GKK A;  2OE3 A;  4K1F A;  4NHW A;  4AF2 A;  2F3M A;  1PA3 A;  3ISO A;  4TVE A;  2HYX A;  3F63 A;  3U6V A;  4JED A;  3Q19 A;  4EVM A;  2V1M A;  3VWU A;  2KUC A;  4HZ2 A;  3TKR A;  1SJZ A;  4X1U A;  4BPY A;  2LNT A;  4OO4 A;  5J9B A;  4MF5 A;  3DIE A;  4K9Z A;  4KSM A;  4QL7 A;  3FZ5 A;  1C72 A;  2CAQ A;  2XHF A;  2GSQ A;  3RPN A;  5G5F A;  2HRF A;  3Q6O A;  1O8X A;  3DWV A;  3L9U A;  6GSX A;  4GXZ A;  2PPT A;  2KP2 A;  2YWN A;  4POL A;  2KP1 A;  3TJJ A;  2VL3 A;  1E6B A;  3RPP A;  2WGR A;  5A4U A;  5D93 A;  1ML6 A;  1AAZ A;  3RBT A;  2CVK A;  2MMN A;  3KCM A;  4IQ1 A;  3C7M A;  5F0G A;  3MSZ A;  1YY7 A;  1SD8 A;  4EKZ A;  1MD4 A;  4PGT A;  4HZ4 A;  2VM1 A;  4G19 A;  2ZNM A;  4MMM A;  4HJM A;  2IFQ B;  3FR9 A;  5J41 A;  2HFD A;  6GSS A;  2YV7 A;  1XIY A;  1M9A A;  3GH9 A;  4KCE A;  4XTS A;  4KW6 A;  2FWG A;  5D8I A;  4XRA A;  3UMA A;  2LEG A;  2D2Z A;  3APS A;  1TRV A;  5ELG A;  2R5G A;  2M80 A;  3EIN A;  5ENU A;  2X8H A;  5HFI A;  1XW9 A;  3M9J A;  2XPE A;  1HNA A;  5E4W A;  3ED3 A;  1TKD B;  1MDI A;  4PQ1 A;  4J57 E;  5E59 A;  4NMU A;  5F8B A;  2X64 A;  4FIW A;  3IAS 2;  1S3C A;  2H0I A;  3W8S A;  5HR2 A;  3D4M A;  1M9B A;  3EVI A;  2VCX A;  2TRC P;  4MF7 A;  1ERT A;  3KXO A;  4LLR A;  4CHS A;  1W4V A;  2IMI A;  2PN8 A;  3H93 A;  5ECK B;  3VK9 A;  3ZIJ A;  1JHB A;  5ECQ B;  2VLV A;  1QMV A;  4JBB A;  4RQR A;  2F9S A;  2VL2 C;  1XW5 A;  1XCC A;  1MDK A;  2M46 A;  4K7O A;  6GSW A;  3TCO A;  2R6K A;  2IFQ A;  3EMX A;  4ZB8 A;  4YQM A;  2DJJ A;  5G30 A;  20GS A;  1GTI A;  3D22 A;  2H1A A;  1XVQ A;  2PER A;  4YQU A;  3IA1 A;  2B1K A;  1PRX A;  1W89 A;  1ZOF A;  4K0N A;  3ZML A;  3GTU A;  3J7Y k;  5JCW A;  4ZL9 A;  1MDJ A;  3Q18 A;  4J56 E;  2R37 A;  3CBU A;  4I2U A;  2WCI A;  2N5B A;  2E2G A;  3LG6 A;  1O8W A;  1UVZ A;  2VCZ A;  3HHV A;  4KGI A;  4E8H A;  2HLS A;  1GSF A;  1T4Z A;  3KTL A;  2VD1 A;  3G7J A;  5KN2 A;  3GL5 A;  3VWV A;  4O92 A;  5H5Q A;  4Z7X A;  1USB A;  5B8B A;  2GZZ A;  1SJ6 A;  2FUG 2;  2L5O A;  19GS A;  3UBK A;  3ZRE A;  4G9H A;  1YKC A;  2ALB A;  4K7I A;  1QGV A;  3HKR A;  1JZW A;  2LRC A;  4IN0 A;  1WOU A;  4EO3 A;  4POK A;  2LKU A;  3IK9 A;  2LRN A;  3KP9 A;  4K7N A;  1OE7 A;  3QAG A;  3EWL A;  1OC9 B;  5J9C A;  3EU4 A;  2GST A;  1MEK A;  3LEF A;  2FY6 A;  3GKN A;  3EYT A;  1Z9H A;  2MMA A;  1U3A A;  5J4U A;  2C80 A;  4MJE A;  6GST A;  1V57 A;  4ZIJ A;  1F37 A;  5HR1 A;  1SKR B;  2GS3 A;  4PQH A;  4MLY A;  3EUR A;  2H71 A;  2C0E A;  2XC2 A;  1GUL A;  1XWK A;  1TXX A;  4NWY A;  2FCH A;  3TB2 A;  5D96 A;  5AIV A;  1U87 A;  3L78 A;  1G6W A;  5DBQ A;  3GSS A;  1GP1 A;  3A2X A;  1B48 A;  16GS A;  3KMO A;  1M2B A;  5F05 A;  4JU5 A;  5G1K A;  4DSS B;  3F4R A;  2PVQ A;  2H0G A;  4EC0 A;  3M9K A;  1PQN A;  1EGO A;  2IPA A;  3VI5 A;  2DBC A;  1WE0 A;  1GTA A;  3PH9 A;  5D9W A;  4EUY A;  4TN8 A;  1H4O A;  5ECI B;  2XPD A;  3P7X A;  2OBK A;  3GV1 A;  1A2J A;  4KCA A;  1B8X A;  1PN9 A;  1VF3 A;  1R5A A;  3GX8 A;  2HT9 A;  3GIX A;  2IME A;  10GS A;  5ECO B;  4MCU A;  4KE3 A;  2VLT A;  3VI7 A;  4G10 A;  4NV5 A;  1XXU A;  2C3N A;  3F6D A;  4YAP A;  1EV9 A;  5J5N A;  1B9Y C;  1LU4 A;  1ZYE A;  4PNF A;  4WR5 A;  4MJC A;  4IW9 A;  5IPH A;  4POM A;  3H79 A;  1XWC A;  1Z7R A;  2X99 A;  4RUV A;  1WIK A;  3W6G A;  1YF0 A;  2BJX A;  5ECS A;  3VWX A;  4I6X A;  4TR3 A;  2H1D A;  3NZN A;  1K0O A;  3UEM A;  2JAD A;  3PIN A;  3FKF A;  1TP9 A;  2C4J A;  3UAR A;  4P3Y B;  2X8G A;  3WT1 A;  3ZTL A;  3H1N A;  3QAV A;  2DJ0 A;  3GA4 A;  1XWB A;  3OR5 A;  2HSH A;  5EPF A;  3GKM A;  4MJB A;  4TXV A;  1OVN A;  4I5Q A;  4ZBD A;  1KTE A;  5COH A;  3IK7 A;  1GTU A;  4GTU A;  1T3B A;  4GF0 A;  1A2L A;  2G2Q A;  1JFU A;  5ECP B;  5EVO A;  3DVW A;  5G1L A;  2I1U A;  18GS A;  3TJK A;  3N5O A;  4K6X A;  4LL4 B;  3QFB C;  5GSS A;  5KN0 A;  3CTF A;  2I9H A;  3D6I A;  1OC8 A;  5JCU A;  2RM6 A;  1SL2 B;  1NW2 A;  2GSR A;  2I3Y A;  1TI1 A;  3M0F A;  2R2J A;  3D4T A;  1SYX A;  2LUS A;  2L59 A;  2EIR A;  3GUR A;  3HJP A;  3IHQ A;  3BCI A;  3H8Q A;  1TK0 B;  4YH2 A;  2JL4 A;  3IV4 A;  4MZB A;  2LJK A;  2VIM A;  3CRU A;  5FWG A;  3ERF A;  2H1G A;  2AYT A;  2DIY A;  1YEP A;  2H1B A;  1I5G A;  4WR4 A;  3DML A;  3TDG A;  3QAW A;  4ML6 A;  4K8M A;  3D0Z A;  5DQY A;  4V2M A;  2VL2 A;  3FEU A;  5IQY A;  2I81 A;  3DGQ A;  5IO0 A;  1AW9 A;  4I8B A;  2B6M A;  1Z7P A;  1VRS D;  6GSU A;  4PUA A;  2B7J A;  4NHZ A;  1WJK A;  1HNC A;  3L0H A;  1O7U A;  3US3 A;  1GSY A;  5ECN B;  3HDC A;  3I9V 2;  4ULX A;  3GL3 A;  3FW2 A;  2IWT A;  1K0M A;  1ZGN A;  3KEB A;  1EEJ A;  4BVY A;  3APQ A;  1B4Q A;  1BYE A;  5IPG A;  4TKY A;  4HUA A;  3HZ8 A;  2MZC A;  2F8F A;  3FR3 A;  3DRN A;  3HXS A;  3EMP A;  3EC3 A;  2K9F A;  2IN3 A;  3I69 A;  4XHM A;  2GQM A;  3IXR A;  2ON5 A;  2YWM A;  3UBL A;  3M1G A;  1DE2 A;  2A4V A;  3VPT A;  3HJO A;  1ERU A;  2E7P A;  3IC4 A;  1PD2 1;  2KLX A;  5GAN D;  2IMD A;  2L6D A;  2BMX A;  2RUF A;  3TJG A;  4LMV A;  1AXD A;  4F0B A;  3QOU A;  4NAX A;  4V1A p;  4LL1 B;  1Y6E A;  1DSB A;  1WPI A;  3GST A;  2QSI A;  1KNG A;  3C1S A;  1EOH A;  3IRA A;  3N9J A;  2C1Y A;  1XOB A;  2NPB A;  4EDY A;  3LJR A;  4EE0 A;  5A4V A;  5CP1 A;  2MBT A;  4ACS A;  4BWQ A;  3F3R A;  1EV4 A;  1XOA A;  2O87 A;  4ID0 A;  4MH2 A;  5ECM B;  2OE1 A;  1ZMA A;  3F9U A;  1QXH A;  3SBC A;  3P2A A;  5IOW A;  4K0G A;  4CDO A;  4TR0 A;  2C8U A;  2HI7 A;  3LFL A;  5G31 A;  3ZIV A;  1K3Y A;  1AQW A;  1BX9 A;  4KDU A;  2DJ3 A;  4NV2 A;  5KEJ A;  2GT5 A;  2YZH A;  5HFK A;  1E2Y A;  5ELA A;  4IJ3 A;  3DYR A;  3GTU B;  1TDI A;  1XW6 A;  1T00 A;  3I43 A;  1U6T A;  4TR1 B;  2NVL A;  4PUF C;  3IOS A;  2LS5 A;  1PKZ A;  2YWI A;  4MK3 A;  2YOI A;  5FHI A;  1Z6N A;  2EC4 A;  4EF0 A;  1PGT A;  1G7O A;  1FOV A;  1X9S B;  3E3E A;  4L8E A;  2DML A;  4IJI A;  1EZK A;  1F2E A;  1FVJ A;  3TRP A;  1Z6M A;  2YPM A;  2B5X A;  4OCF A;  1V2A A;  1GLP A;  4O32 A;  2HXK A;  1FG4 A;  3HZ4 A;  4MPG A;  1AQX A;  1GNE A;  1V98 A;  2CA8 A;  4TOP A;  1FO5 A;  1DBY A;  4ZXG A;  1X5C A;  5D73 A;  5AN1 A;  3KJY A;  4O5R A;  3J7Y b;  5DCH A;  1GWC A;  3GX0 A;  4IVF A;  4F82 A;  4EL1 A;  2OKA A;  3E9J B;  1JLW A;  4I2T A;  1F3B A;  4BL7 A;  2DJ1 A;  5IOX A;  5LD0 A;  1YQ1 A;  2B5Y A;  2VCQ A;  5HR0 A;  5KN1 A;  1GRX A;  4IEL A;  2PUK C;  4TXO A;  5DDL A;  5EL8 A;  1PMT A;  3ZFB A;  2DSA A;  3HVS A;  4GQF A;  3TKQ A;  3VWW A;  2H01 A;  1XZO A;  13GS A;  1VF2 A;  2IJY A;  2FLS A;  1G6Y A;  2CT6 A;  3W8J A;  3A5W A;  3IAM 2;  2VO4 A;  2DMM A;  1SKW B;  2LRT A;  3GYK A;  5CYY A;  1ILO A;  4TR1 A;  4MZC A;  2OJL A;  1AIU A;  5KN3 A;  3ZVJ A;  5DAK A;  1EEM A;  1ABA A;  2A2S A;  1TRU A;  4F0C A;  2RLI A;  4HEA 2;  1K3O A;  3IR4 A;  2CZ2 A;  1I9D A;  3F4T A;  4RQX A;  1A0F A;  2IMF A;  17GS A;  5HQP A;  1WWJ A;  3QR6 A;  1H75 A;  2IMK A;  2RM5 A;  1O81 A;  1R26 A;  3TOU A;  1DE1 A;  1SEN A;  2QGV A;  2M72 A;  3TJF A;  2N5A A;  2V41 A;  2P5Q A;  5AIS A;  3A2V A;  1ACV A;  4WET A;  2Z9S A;  4GQC A;  3NOF A;  1PX7 A;  1NSW A;  1VGL A;  1GSD A;  2JZT A;  1EGR A;  4DEJ A;  4TR4 A;  5J3R A;  4HU9 A;  1ZL9 A;  2JSZ A;  3GH6 A;  5B6M A;  2FA8 A;  2P5R A;  1PL2 A;  2F8A A;  3CXG A;  1FB6 A;  2LV3 A;  4IP6 A;  1S3A A;  2O7K A;  3LSZ A;  5IMV A;  1UA5 A;  5G5E A;  1SU9 A;  2AV4 A;  2VCV A;  2VL9 A;  3ERW A;  4O7H A;  1CQG A;  3LQ7 A;  2GQK A;  1F9M A;  4XS4 A;  1TJD A;  2K6V A;  3R2Q A;  2FA4 A;  3Q74 A;  4G2E A;  3GN3 A;  1OAZ A;  1SJI A;  2H72 A;  5DAL B;  4ZBB A;  2C3T A;  5AIX A;  3GUS A;  2VCT A;  4OMV A;  1A24 A;  3TKS C;  1BQ7 A;  3DD3 A;  4ILF A;  1DUG A;  4RI7 A;  3PR8 A;  3P8W A;  3JCM L;  2J23 A;  1SL0 B;  1HD2 A;  1TK8 B;  3F6F A;  3GFK A;  3HVX A;  2PMT A;  1UN2 A;  2YJ7 A;  2PBJ A;  4YAV A;  2MMZ A;  2PVO C;  1ZCP A;  5DQS A;  3F0I A;  4GSS A;  2RII A;  4E8E A;  4XIH A;  4KDY A;  1V9W A;  1K0C A;  4LA1 A;  3TGZ A;  1XBS A;  1A0R P;  2DJK A;  1MTC A;  4MF6 A;  4X0X A;  3BJ5 A;  2N5F A;  4DSR A;  4H86 A;  2CZ3 A;  1TI3 A;  4ZBA A;  3ZVJ D;  2JZS A;  4ECJ A;  2O8V B;  4F03 A;  5DVB A;  4MPF A;  5JWQ B;  3WD6 A;  8GSS A;  1R7H A;  3GRX A;  3UOM A;  3CMI A;  1KBN A;  1Q4J A;  4ZL8 A;  1F6M C;  4JE1 A;  2H75 A;  6GSY A;  2REM A;  1BED A;  4V2L A;  1M2A A;  4ECB A;  1YF1 A;  3CSH A;  2RUE A;  2VUP A;  2GSS A;  4KND A;  1JZD A;  4FYU A;  1TRS A;  4FYC A;  3C8E A;  2H76 A;  4WF5 A;  2YJH A;  5DAL A;  1G7E A;  3ERG A;  2OAD A;  1SD9 A;  1QFN A;  2YP6 A;  5D9V A;  4JR4 A;  1A8Y A;  3H4K A;  1M2D A;  1NHY A;  4KX4 A;  1XVW A;  2DJ2 A;  5FT3 A;  1BAY A;  1YEX A;  2GVP A;  1T4Y A;  4GLT A;  3VPQ A;  4N0Z A;  1TOF A;  2WZ9 A;  2F51 A;  4NPB A;  3VFI A;  4ML1 A;  1GSQ A;  1R4W A;  4EXJ A;  5INY A;  3F8U A;  3RAZ A;  3M8N A;  1SK1 A;  1N8J A;  3EU3 A;  1GUM A;  2GTU A;  3ME7 A;  1B9X C;  4POB A;  4OFN A;  2FGX A;  3PGT A;  4KB3 A;  3TKP A;  2MYG A;  3K8N A;  3IPZ A;  4ISD A;  4JZQ A;  2JU5 A;  4FYB A;  4OWY A;  4AJ8 A;  2FWE A;  2NDO A;  4N10 A;  3TUE A;  3MWH A;  1X5D A;  4HQS A;  1YZX A;  2LTK A;  4XS6 A;  3LOR A;  3DKS A;  3BD2 A;  2IL3 A;  4N0V A;  4QQ7 A;  4ZL7 A;  3F4S A;  4DVC A;  2OA7 A;  1JLV A;  1J08 A;  2A2R A;  1LBK A;  3ZYW A;  3IE3 A;  2AUV A;  3AY8 A;  2H74 A;  3KP8 A;  1ZZY A;  2LST A;  1SK2 A;  2JSY A;  2C0D A;  4Q5R A;  2BTO T;  1Y25 A;  4PNG A;  4NXI A;  4KAE A;  1GNW A;  3HA9 A;  3U5R E;  3FHK A;  5IMC A;  2HZE A;  3BCK A;  4Q5Q A;  2FHE A;  2DIZ A;  2L57 A;  2K18 A;  5IMF A;  5H5R A;  3FZ9 A;  2FD3 A;  2LJR A;  3FRC A;  4HS1 A;  3LYK A;  1FB0 A;  2GZP A;  4MH3 A;  4XRD A;  4TRX A;  4ZB9 A;  5GAP D;  2DLX A;  2GGT A;  4XCS A;  4FH8 A;  4OFM A;  2CV4 A;  4GSN A;  1A2M A;  3G7I A;  4L5L A;  1YKA A;  1OYJ A;  2AJQ B;  3LXT A;  3QFA C;  4ECC A;  2J9H A;  4MA9 A;  1J0F A;  3S9F A;  1RW1 A;  4TW5 A;  2PU9 C;  2B7K A;  3RHC A;  1K3L A;  1TTZ A;  2HNL A;  1THX A;  2YAN A;  1GSU A;  4V2N A;  4HQZ A;  3KTB A;  4V1A g;  2IIY A;  1TW9 A;  2WFC A;  2FWH A;  5B6N A;  3O6T A;  1T8E B;  3DXB A;  2P31 A;  2HZF A;  1N2A A;  1IYH A;  3TRX A;  5CRW A;  3ZIT A;  3QCP A;  1EWX A;  5C04 A;  4EDZ A;  1BG5 A;  4L5O A;  2LNS A;  2R4V A;  1GUK A;  2H6Y A;  3FK8 A;  1ZYQ B;  2H6X A;  3O3T A;  1XPV A;  2VD0 A;  1B4P A;  3L9V A;  2LQQ A;  4KUN A;  3C1R A;  3HD5 A;  1TRW A;  1WRY A;  1X5E A;  4PX1 A;  2X8C A;  2VM2 A;  1SL1 B;  3QPM A;  3LGC A;  4TXO B;  3GMF A;  3CTG A;  3TKS A;  2VOC A;  1QQ2 A;  5A4W A;  3LXZ A;  2FNO A;  4KH7 A;  3SWL A;  5JWR B;  1V58 A;  4FO5 A;  3APO A;  1K0D A;  1VF1 A;  3QMX A;  3ZZX A;  3G7Y A;  1HQO A;  5CRH A;  5ECL B;  4MZW A;  1R5P A;  1K0A A;  1UC7 A;  2AAW A;  2PGT A;  5GZZ B;  5DAK B;  1AQV A;  4F2I A;  22GS A;  1V40 A;  9GSS A;  2DC5 A;  3VLN A;  4ECI A;  2CAI A;  3HVV A;  2V2G A;  5LNK e;  1PX6 A;  1SK0 A;  4OD7 A;  4PXO A;  1HYU A;  5C00 A;  1YJ6 A;  2YNX A;  1EP7 A;  1QUW A;  1JZR A;  3C71 A;  2P0G A;  2JZR A;  1FAA A;  2YV9 A;  3F3Q A;  3IBH A;  4HI7 A;  1GL8 A;  1KEB A;  1Z3E A;  5CRE A;  5D9T A;  3TKS E;  1TU8 A;  2HRN A;  3G9B A;  3UIW A;  3DVX A;  4HOJ A;  3UAP A;  1O73 A;  2OAC A;  3RHB A;  3ZRD A;  4WF4 A;  1OKT A;  5IM9 A;  3KD0 A;  1VF4 A;  1JZO A;  2H66 A;  1OC3 A;  2H73 A;  4RI6 A;  1XFL A;  1M0U A;  2E2M A;  2WDU A;  3UVT A;  2HSY A;  4XS4 B;  3ME8 A;  2H8L A;  1LJR A;  1OKD A;  4IKH A;  2TRX A;  4ZIL A;  2CQ9 A;  3CSJ A;  4Q5N A;  4OFT A;  1RK4 A;  1FVK A;  3ZL5 A;  3CRT A;  5AGY A;  2R3X A;  4F9Z A;  3KMN A;  3ZMK A;  2HE3 A;  2B5E A;  2C3Q A;  2V32 A;  2CVD A;  4GCI A;  2VCW A;  1M7T A;  2TIR A;  3RDW A;  1F3A A;  3UL3 A;  11GS A;  1EP8 A;  3FR6 A;  2XBI A;  1TU7 A;  2MBS A;  1S3D A;  5CRD A;  1J9B A;  5B7C A;  2C0F A;  5HR3 A;  5DCG A;  4IQA A;  3GHA A;  1FW1 A;  1MD3 A;  2EIO A;  2KHP A;  1ST9 A;  1BJX A;  4Q5F A;  4WEY A;  3ZFL A;  3MAK A;  5D9X A;  4L0W A;  3D21 A;  3HY2 A;  2K8V A;  4HDE A;  3HCZ A;  1SKS B;  4YQV A;  1AC1 A;  1PKW A;  1EOG A;  3KH7 A;  2CVB A;  2CX4 A;  3NIV A;  4AGS A;  2L5L A;  4WBJ A;  4HJ2 A;  2YCD A;  1NM3 A;  1XWG A;  2GQL A;  5ABR A;  1OE8 A;  1CQH A;  5IMZ A;  1Q98 A;  2GZY A;  2K8S A;  4AJ7 A;  2KOK A;  3TOT A;  2MMO A;  3CYN A;  4GRF A;  3L4N A;  1URM A;  3LWA A;  5IIZ A;  2OBI A;  2V6K A;  3GKX A;  2O89 A;  1A8L A;  2LJA A;  4QL9 A;  1K0B A;  1GH2 A;  2I4A A;  5ECH B;  5F07 A;  1ERV A; 
#chains in the Genus database with same CATH topology
 1O6J A;  3A3T A;  5DJL A;  4X43 A;  1G0T A;  3FZ4 A;  2AB6 A;  2YN1 A;  3FY7 A;  3ZLP A;  1QK8 A;  3QDN A;  5CO3 A;  2L4C A;  4K2X A;  1XWA A;  4LMW A;  4L0U A;  4KSO A;  1TK5 B;  1ERW A;  4MJA A;  4PUR A;  3D5J A;  2H70 A;  4D73 B;  1ZYN A;  4MP4 A;  4WBR D;  2H30 A;  4GST A;  2C0G A;  2GLR A;  1GTB A;  4JR6 A;  5JCG A;  4BIK A;  3BBY A;  3WT2 A;  4MAB A;  2G0F A;  5CNW A;  4I97 A;  2VLU A;  5EY6 A;  1GLQ A;  2O85 A;  4N30 A;  2OE0 A;  4IHU A;  2E0Q A;  1GSS A;  5CRG A;  3LYP A;  3MDK A;  5LCZ A;  1OC9 A;  2B1L A;  2XBQ A;  4PQI A;  2L6C A;  5HFG A;  3O76 A;  1X0R A;  3FZA A;  5IMA A;  4J2F A;  4BWS A;  1NHO A;  5A5K A;  2V6O A;  4JRR A;  1O85 A;  2LQO A;  4A5P A;  3KGK A;  2QKE A;  5L71 A;  4KF9 A;  4K2D A;  5GST A;  1IYI A;  4HU7 A;  3FYG A;  1PSQ A;  7GSS A;  1T1V A;  2YZU A;  5IMD A;  1RQM A;  1GSE A;  4IBP A;  5JWO B;  5ID2 B;  2HZE B;  4OO5 A;  1WMJ A;  2L4Q A;  4D73 A;  3E0U A;  4DSS A;  4K5S A;  1K0N A;  2H0H A;  2QC7 A;  2WUL A;  2FWF A;  4IP1 A;  3WGX A;  1M99 A;  2WRT A;  3UJ1 A;  5F06 A;  2PWJ A;  4WXT A;  3TRQ A;  3HYP A;  1X9W B;  3DEX A;  3VUR A;  1PL1 A;  1Z5Y E;  2ZCT A;  5H5S A;  4AJ6 A;  1WP0 A;  1X9M B;  4DSQ A;  3P90 A;  4XS1 A;  3M3M A;  1YDK A;  3KIJ A;  3IDV A;  1U88 A;  4IGJ A;  3FMW A;  2ZUP A;  3UVH A;  3EE2 A;  3V1W A;  2DKI A;  2EIQ A;  2JAC A;  2AHE A;  3CSI A;  4KA0 A;  4ZB6 A;  3KH9 A;  3GNJ A;  3C73 A;  5ECR B;  3BOA A;  1AUC A;  3MNG A;  4IS0 A;  3KM6 A;  2GDR A;  1FHE A;  2NTO A;  3L9S A;  5CAX A;  2WJU A;  3WGE A;  4KDX A;  2H6Z A;  3WYW A;  1A23 A;  4Z2R A;  5B8A A;  4BA7 A;  2VAF A;  4MDC A;  1T7P B;  5ID2 A;  2CX3 A;  2NBS A;  6GSV A;  5DJM A;  1U3I A;  1SYR A;  1THO A;  2H19 A;  3KZQ A;  1ON4 A;  3I6A A;  12GS A;  4OCE A;  2WS2 A;  3QD9 A;  2GT6 A;  2B3S A;  1HNB A;  2ES7 A;  4GWR A;  4CW9 A;  1GUH A;  4CY8 A;  3HJM A;  4WKW A;  5IO2 A;  2WB9 A;  4BVX A;  5G2Z A;  3WGD A;  4N11 A;  2YWO A;  3A2W A;  3TJB A;  4ICY A;  2ON7 A;  14GS A;  3GKK A;  2OE3 A;  4K1F A;  4NHW A;  4AF2 A;  2F3M A;  1PA3 A;  3ISO A;  4TVE A;  2HYX A;  3F63 A;  3U6V A;  4JED A;  3Q19 A;  4EVM A;  2V1M A;  3VWU A;  2KUC A;  4HZ2 A;  3TKR A;  1SJZ A;  4X1U A;  4BPY A;  2LNT A;  4OO4 A;  5J9B A;  4MF5 A;  3DIE A;  4K9Z A;  4KSM A;  4QL7 A;  4HSC X;  3FZ5 A;  1C72 A;  2CAQ A;  2XHF A;  2GSQ A;  3RPN A;  5G5F A;  2HRF A;  3Q6O A;  1O8X A;  3DWV A;  3L9U A;  6GSX A;  4GXZ A;  2R0P A;  2PPT A;  2KP2 A;  2YWN A;  4POL A;  2KP1 A;  3TJJ A;  2VL3 A;  1E6B A;  3RPP A;  2WGR A;  5A4U A;  5D93 A;  1ML6 A;  1AAZ A;  3RBT A;  2CVK A;  2MMN A;  3KCM A;  4IQ1 A;  3C7M A;  5F0G A;  3MSZ A;  1YY7 A;  1SD8 A;  4EKZ A;  1MD4 A;  4PGT A;  4HZ4 A;  2VM1 A;  4G19 A;  2ZNM A;  4MMM A;  4HJM A;  2IFQ B;  3FR9 A;  5J41 A;  2HFD A;  6GSS A;  2YV7 A;  1XIY A;  1M9A A;  3GH9 A;  4KCE A;  4XTS A;  4X4J A;  4KW6 A;  2FWG A;  5D8I A;  4XRA A;  3UMA A;  2LEG A;  2D2Z A;  3APS A;  1TRV A;  5ELG A;  2R5G A;  2M80 A;  3EIN A;  5ENU A;  2R0G A;  2X8H A;  5HFI A;  1XW9 A;  3M9J A;  2XPE A;  1HNA A;  5E4W A;  3ED3 A;  1TKD B;  1MDI A;  4G0K A;  4PQ1 A;  4J57 E;  5E59 A;  4NMU A;  5F8B A;  2X64 A;  4FIW A;  3IAS 2;  1S3C A;  2H0I A;  3W8S A;  5HR2 A;  3D4M A;  1M9B A;  3EVI A;  2VCX A;  2TRC P;  4MF7 A;  1ERT A;  3KXO A;  4LLR A;  4CHS A;  1W4V A;  2IMI A;  2PN8 A;  3H93 A;  5ECK B;  3VK9 A;  3ZIJ A;  1JHB A;  5ECQ B;  2VLV A;  1QMV A;  4JBB A;  4RQR A;  2F9S A;  2VL2 C;  1XW5 A;  1XCC A;  1MDK A;  2M46 A;  4K7O A;  6GSW A;  3TCO A;  2R6K A;  2IFQ A;  3EMX A;  4ZB8 A;  4YQM A;  2DJJ A;  5G30 A;  20GS A;  1GTI A;  3D22 A;  2H1A A;  1XVQ A;  2PER A;  4YQU A;  3IA1 A;  2B1K A;  1PRX A;  1W89 A;  1ZOF A;  4K0N A;  3ZML A;  3GTU A;  3J7Y k;  5JCW A;  4ZL9 A;  1MDJ A;  3Q18 A;  4J56 E;  2R37 A;  3CBU A;  4I2U A;  5KOX A;  2WCI A;  2N5B A;  2E2G A;  3LG6 A;  1O8W A;  1UVZ A;  2VCZ A;  3HHV A;  4KGI A;  4E8H A;  2HLS A;  1GSF A;  3CQF A;  1T4Z A;  3KTL A;  2VD1 A;  3G7J A;  5KN2 A;  4EIP A;  3GL5 A;  3VWV A;  4O92 A;  5H5Q A;  4Z7X A;  1USB A;  5B8B A;  2GZZ A;  1SJ6 A;  2FUG 2;  2L5O A;  19GS A;  2X49 A;  3UBK A;  3ZRE A;  4G9H A;  1YKC A;  2ALB A;  4K7I A;  1QGV A;  3HKR A;  1JZW A;  2LRC A;  4IN0 A;  1WOU A;  4EO3 A;  4POK A;  2LKU A;  3IK9 A;  2LRN A;  3KP9 A;  4K7N A;  1OE7 A;  3QAG A;  5BRT A;  4O5U A;  3EWL A;  1OC9 B;  5J9C A;  3EU4 A;  2GST A;  1MEK A;  3LEF A;  2FY6 A;  3GKN A;  3EYT A;  1Z9H A;  2MMA A;  1U3A A;  4CY6 A;  3A5I A;  5J4U A;  2C80 A;  4MJE A;  4Z2T A;  6GST A;  1V57 A;  4ZIJ A;  1F37 A;  5HR1 A;  1SKR B;  2GS3 A;  4PQH A;  4MLY A;  3EUR A;  2H71 A;  2C0E A;  2XC2 A;  1GUL A;  1XWK A;  1TXX A;  4NWY A;  2FCH A;  3TB2 A;  5D96 A;  5AIV A;  1U87 A;  3L78 A;  1G6W A;  5DBQ A;  2HRK A;  3GSS A;  1GP1 A;  3A2X A;  4EIQ A;  1B48 A;  3EPT A;  16GS A;  3KMO A;  1M2B A;  5F05 A;  4JU5 A;  5G1K A;  4DSS B;  3F4R A;  2PVQ A;  2H0G A;  4EC0 A;  3M9K A;  1PQN A;  1EGO A;  2IPA A;  3VI5 A;  2DBC A;  1WE0 A;  1GTA A;  3PH9 A;  5D9W A;  4EUY A;  4TN8 A;  1H4O A;  5ECI B;  2XPD A;  3P7X A;  2OBK A;  3GV1 A;  1A2J A;  4KCA A;  1B8X A;  1PN9 A;  1VF3 A;  1R5A A;  3GX8 A;  2HT9 A;  3GIX A;  2IME A;  10GS A;  5ECO B;  3HVN A;  4KE3 A;  4MCU A;  2VLT A;  3VI7 A;  4G10 A;  4NV5 A;  1XXU A;  2C3N A;  3F6D A;  4YAP A;  1EV9 A;  5J5N A;  1B9Y C;  1LU4 A;  1ZYE A;  4PNF A;  4WR5 A;  4MJC A;  4IW9 A;  5IPH A;  4POM A;  3H79 A;  1XWC A;  1Z7R A;  2X99 A;  4RUV A;  1WIK A;  3W6G A;  5KOW A;  1YF0 A;  2BJX A;  5ECS A;  3VWX A;  4I6X A;  4TR3 A;  2H1D A;  3NZN A;  1K0O A;  3UEM A;  2JAD A;  3PIN A;  3FKF A;  1TP9 A;  2C4J A;  3UAR A;  4P3Y B;  2X8G A;  3WT1 A;  3ZTL A;  3H1N A;  3QAV A;  2DJ0 A;  3GA4 A;  1XWB A;  3OR5 A;  2HSH A;  4O5Q A;  5EPF A;  3GKM A;  4MJB A;  4TXV A;  1OVN A;  4I5Q A;  4YKF A;  4ZBD A;  1KTE A;  5COH A;  3IK7 A;  1GTU A;  4GTU A;  4G0L A;  1T3B A;  4GF0 A;  3IHG A;  4BVX B;  1A2L A;  2G2Q A;  1JFU A;  5ECP B;  5EVO A;  3DVW A;  5G1L A;  2I1U A;  18GS A;  3TJK A;  3N5O A;  4K6X A;  4LL4 B;  3QFB C;  5GSS A;  2QA2 A;  5KN0 A;  4BVY B;  3CTF A;  2I9H A;  3D6I A;  1OC8 A;  5JCU A;  2RM6 A;  1SL2 B;  1NW2 A;  2GSR A;  2I3Y A;  1TI1 A;  3M0F A;  2R2J A;  3D4T A;  1SYX A;  2LUS A;  2L59 A;  2EIR A;  3GUR A;  3HJP A;  3IHQ A;  3BCI A;  3H8Q A;  1TK0 B;  4YH2 A;  2JL4 A;  3IV4 A;  4MZB A;  2LJK A;  2VIM A;  3CRU A;  5FWG A;  2R0C A;  1S3R A;  3ERF A;  2H1G A;  2AYT A;  2DIY A;  1YEP A;  2H1B A;  1I5G A;  4WR4 A;  3DML A;  3TDG A;  3QAW A;  4ML6 A;  4K8M A;  3D0Z A;  5DQY A;  4V2M A;  2VL2 A;  3FEU A;  5IQY A;  2I81 A;  3DGQ A;  5IO0 A;  1AW9 A;  4I8B A;  2B6M A;  2A2P A;  1Z7P A;  1VRS D;  6GSU A;  4PUA A;  5BMU A;  2B7J A;  4NHZ A;  1WJK A;  1HNC A;  3L0H A;  1O7U A;  3US3 A;  1GSY A;  5ECN B;  3HDC A;  3I9V 2;  4ULX A;  3GL3 A;  3FW2 A;  2IWT A;  1K0M A;  1ZGN A;  3KEB A;  1EEJ A;  4BVY A;  3APQ A;  1B4Q A;  1BYE A;  5IPG A;  4TKY A;  4HUA A;  3HZ8 A;  2MZC A;  2F8F A;  3FR3 A;  3DRN A;  3HXS A;  3EMP A;  3EC3 A;  2K9F A;  2IN3 A;  3I69 A;  4XHM A;  2GQM A;  3IXR A;  2ON5 A;  2YWM A;  4FQU A;  3UBL A;  3M1G A;  1DE2 A;  2A4V A;  3VPT A;  3HJO A;  1ERU A;  2E7P A;  3IC4 A;  1PD2 1;  2KLX A;  5GAN D;  2IMD A;  2L6D A;  2BMX A;  2RUF A;  3MYD A;  3TJG A;  4LMV A;  1AXD A;  4F0B A;  3QOU A;  4NAX A;  4V1A p;  4LL1 B;  1Y6E A;  1DSB A;  1WPI A;  3GST A;  2QSI A;  1KNG A;  3MIX A;  3C1S A;  1EOH A;  3IRA A;  2HSM A;  3N9J A;  2C1Y A;  1XOB A;  2NPB A;  4EDY A;  3LJR A;  4EE0 A;  5A4V A;  5CP1 A;  2MBT A;  4ACS A;  4BWQ A;  3F3R A;  1EV4 A;  1XOA A;  4G0I A;  2O87 A;  4ID0 A;  4MH2 A;  5ECM B;  2OE1 A;  1ZMA A;  3F9U A;  1QXH A;  4BL7 B;  3SBC A;  3P2A A;  5F07 A;  5IOW A;  4K0G A;  4CDO A;  4TR0 A;  2C8U A;  2HI7 A;  3LFL A;  4USS A;  4MNN A;  5G31 A;  3ZIV A;  1K3Y A;  1AQW A;  1BX9 A;  4KDU A;  2DJ3 A;  4NV2 A;  5KEJ A;  2GT5 A;  2YZH A;  5HFK A;  1E2Y A;  5ELA A;  4IJ3 A;  3DYR A;  3GTU B;  1TDI A;  1XW6 A;  1T00 A;  3I43 A;  1U6T A;  4TR1 B;  2NVL A;  4PUF C;  3IOS A;  2LS5 A;  1PKZ A;  2YWI A;  4MK3 A;  2YOI A;  5FHI A;  1Z6N A;  2EC4 A;  4EF0 A;  1PGT A;  1G7O A;  1FOV A;  1X9S B;  3E3E A;  4L8E A;  2DML A;  4IJI A;  1EZK A;  1F2E A;  1FVJ A;  3TRP A;  1Z6M A;  2YPM A;  2B5X A;  4OCF A;  1V2A A;  1GLP A;  4O32 A;  2HXK A;  1FG4 A;  3HZ4 A;  4MPG A;  1AQX A;  1GNE A;  1V98 A;  2CA8 A;  4TOP A;  1FO5 A;  1DBY A;  4ZXG A;  1X5C A;  5D73 A;  5AN1 A;  3KJY A;  4O5R A;  3J7Y b;  5DCH A;  1GWC A;  3GX0 A;  4IVF A;  4F82 A;  4EL1 A;  2OKA A;  3E9J B;  1JLW A;  4I2T A;  1F3B A;  4BL7 A;  2DJ1 A;  5IOX A;  5LD0 A;  4Z2U A;  1FOH A;  1YQ1 A;  2B5Y A;  2VCQ A;  5HR0 A;  5KN1 A;  1GRX A;  4IEL A;  2PUK C;  4TXO A;  5DDL A;  5EL8 A;  1PMT A;  3ZFB A;  2DSA A;  3HVS A;  4GQF A;  3TKQ A;  3VWW A;  2H01 A;  1XZO A;  13GS A;  1VF2 A;  2IJY A;  2FLS A;  1G6Y A;  2CT6 A;  3W8J A;  3A5W A;  3IAM 2;  2VO4 A;  2DMM A;  1SKW B;  2LRT A;  3GYK A;  5CYY A;  1ILO A;  4TR1 A;  4MZC A;  1PFO A;  2X4A A;  2OJL A;  1AIU A;  5KN3 A;  3ZVJ A;  5DAK A;  1EEM A;  1ABA A;  2A2S A;  1TRU A;  4F0C A;  2RLI A;  4HEA 2;  1K3O A;  3IR4 A;  2CZ2 A;  1I9D A;  3F4T A;  4RQX A;  1A0F A;  2IMF A;  17GS A;  5HQP A;  1WWJ A;  3QR6 A;  1H75 A;  2IMK A;  2RM5 A;  1O81 A;  1R26 A;  3TOU A;  1DE1 A;  1SEN A;  2QGV A;  3TJF A;  2N5A A;  2V41 A;  2P5Q A;  5AIS A;  3A2V A;  1ACV A;  4WET A;  2Z9S A;  4GQC A;  3NOF A;  1PX7 A;  1NSW A;  1VGL A;  1GSD A;  2JZT A;  1EGR A;  4DEJ A;  4TR4 A;  5J3R A;  4HU9 A;  1ZL9 A;  1M3I A;  2JSZ A;  3GH6 A;  5B6M A;  2FA8 A;  2P5R A;  1PL2 A;  2F8A A;  3CXG A;  1FB6 A;  2LV3 A;  4IP6 A;  1S3A A;  2O7K A;  3LSZ A;  5IMV A;  1UA5 A;  5G5E A;  1SU9 A;  2AV4 A;  2VCV A;  2HRA A;  2VL9 A;  3ERW A;  4O7H A;  1CQG A;  3LQ7 A;  2GQK A;  1F9M A;  4XS4 A;  1TJD A;  2K6V A;  3R2Q A;  2FA4 A;  3Q74 A;  4G2E A;  3GN3 A;  1OAZ A;  1SJI A;  2H72 A;  5DAL B;  4ZBB A;  2C3T A;  5AIX A;  3GUS A;  2VCT A;  4OMV A;  1A24 A;  3TKS C;  1BQ7 A;  3DD3 A;  4ILF A;  1DUG A;  4RI7 A;  3PR8 A;  3P8W A;  3JCM L;  2J23 A;  1SL0 B;  1HD2 A;  1TK8 B;  3F6F A;  3GFK A;  3HVX A;  2PMT A;  1UN2 A;  2YJ7 A;  2PBJ A;  4YAV A;  2MMZ A;  2PVO C;  1ZCP A;  5DQS A;  3F0I A;  4GSS A;  2RII A;  4E8E A;  4XIH A;  4KDY A;  1V9W A;  1K0C A;  4LA1 A;  3TGZ A;  1XBS A;  1A0R P;  2DJK A;  1MTC A;  4MF6 A;  4X0X A;  3BJ5 A;  2N5F A;  4DSR A;  4H86 A;  2CZ3 A;  1TI3 A;  4ZBA A;  3ZVJ D;  2JZS A;  4ECJ A;  2O8V B;  4F03 A;  5DVB A;  4MPF A;  5JWQ B;  3WD6 A;  8GSS A;  1R7H A;  3GRX A;  3UOM A;  3CMI A;  1KBN A;  1Q4J A;  4ZL8 A;  1F6M C;  4JE1 A;  2H75 A;  6GSY A;  2REM A;  1BED A;  4V2L A;  1M2A A;  4ECB A;  1YF1 A;  3CSH A;  2RUE A;  2VUP A;  2GSS A;  4KND A;  1JZD A;  4FYU A;  1TRS A;  4FYC A;  3C8E A;  2H76 A;  4WF5 A;  2YJH A;  5DAL A;  1G7E A;  3ERG A;  2OAD A;  1SD9 A;  1QFN A;  2YP6 A;  5D9V A;  4JR4 A;  1A8Y A;  3H4K A;  1M2D A;  1NHY A;  4KX4 A;  1XVW A;  2DJ2 A;  5FT3 A;  1BAY A;  1YEX A;  2GVP A;  1T4Y A;  4GLT A;  3VPQ A;  4N0Z A;  1TOF A;  2WZ9 A;  2F51 A;  4NPB A;  3VFI A;  4ML1 A;  1GSQ A;  1R4W A;  4EXJ A;  5INY A;  3F8U A;  3RAZ A;  3M8N A;  1SK1 A;  1N8J A;  3EU3 A;  1GUM A;  2GTU A;  3ME7 A;  1B9X C;  4POB A;  4OFN A;  2FGX A;  3PGT A;  4KB3 A;  3TKP A;  2MYG A;  3K8N A;  3IPZ A;  4ISD A;  4JZQ A;  2JU5 A;  4FYB A;  4OWY A;  4AJ8 A;  2FWE A;  2NDO A;  4N10 A;  3TUE A;  3MWH A;  1X5D A;  4HQS A;  1YZX A;  2LTK A;  3IC8 A;  4XS6 A;  3LOR A;  3DKS A;  3BD2 A;  2IL3 A;  4N0V A;  4QQ7 A;  4ZL7 A;  3F4S A;  4DVC A;  2OA7 A;  1JLV A;  1J08 A;  2A2R A;  1LBK A;  3ZYW A;  3IE3 A;  2AUV A;  3AY8 A;  2H74 A;  3KP8 A;  1ZZY A;  2LST A;  2QA1 A;  1SK2 A;  2JSY A;  2C0D A;  4Q5R A;  2BTO T;  1Y25 A;  4PNG A;  4NXI A;  4KAE A;  1GNW A;  3HA9 A;  3U5R E;  3FHK A;  5IMC A;  2HZE A;  3BCK A;  4Q5Q A;  2FHE A;  2DIZ A;  2L57 A;  2K18 A;  5IMF A;  5H5R A;  3FZ9 A;  2FD3 A;  2LJR A;  3FRC A;  4HS1 A;  3LYK A;  1FB0 A;  2GZP A;  4MH3 A;  4XRD A;  4TRX A;  4ZB9 A;  5GAP D;  2DLX A;  2GGT A;  4XCS A;  4FH8 A;  4OFM A;  2CV4 A;  4GSN A;  1A2M A;  3G7I A;  4L5L A;  1YKA A;  1OYJ A;  2AJQ B;  3LXT A;  3QFA C;  4ECC A;  2J9H A;  4MA9 A;  1J0F A;  3S9F A;  1RW1 A;  1ZYP A;  4TW5 A;  2PU9 C;  2B7K A;  3RHC A;  1K3L A;  1TTZ A;  2HNL A;  1THX A;  2YAN A;  1GSU A;  4V2N A;  4HQZ A;  3KTB A;  4V1A g;  2IIY A;  1TW9 A;  2WFC A;  2FWH A;  5B6N A;  3O6T A;  1T8E B;  3DXB A;  2P31 A;  2HZF A;  1N2A A;  1IYH A;  3TRX A;  4YKG A;  5CRW A;  3ZIT A;  3LW9 A;  3QCP A;  1EWX A;  5C04 A;  4EDZ A;  1BG5 A;  4L5O A;  2LNS A;  2R4V A;  1GUK A;  2H6Y A;  3FK8 A;  1ZYQ B;  2H6X A;  3O3T A;  1PN0 A;  1XPV A;  2VD0 A;  1B4P A;  3L9V A;  2LQQ A;  4KUN A;  3C1R A;  3HD5 A;  1TRW A;  1WRY A;  1X5E A;  4PX1 A;  2X8C A;  2VM2 A;  1SL1 B;  3QPM A;  3LGC A;  4TXO B;  3GMF A;  3CTG A;  3TKS A;  2VOC A;  1QQ2 A;  5A4W A;  3LXZ A;  2FNO A;  4KH7 A;  3SWL A;  5JWR B;  1V58 A;  4FO5 A;  3APO A;  1K0D A;  1VF1 A;  3QMX A;  3ZZX A;  3G7Y A;  1HQO A;  5CRH A;  5ECL B;  4MZW A;  1R5P A;  1K0A A;  4K5R A;  3PPU A;  1UC7 A;  2AAW A;  2PGT A;  5GZZ B;  5DAK B;  1AQV A;  4PTS A;  4F2I A;  22GS A;  1V40 A;  9GSS A;  2DC5 A;  3VLN A;  4ECI A;  2CAI A;  3HVV A;  2V2G A;  5LNK e;  1XG8 A;  1PX6 A;  1SK0 A;  4OD7 A;  4PXO A;  1HYU A;  5C00 A;  1YJ6 A;  2YNX A;  1EP7 A;  1QUW A;  1JZR A;  3C71 A;  2P0G A;  2JZR A;  1FAA A;  2YV9 A;  3F3Q A;  3IBH A;  4HI7 A;  1GL8 A;  1KEB A;  1Z3E A;  5CRE A;  5D9T A;  3TKS E;  1TU8 A;  2HRN A;  3G9B A;  3UIW A;  3DVX A;  4HOJ A;  3UAP A;  1O73 A;  2OAC A;  3RHB A;  3ZRD A;  4WF4 A;  1OKT A;  5IM9 A;  3KD0 A;  1VF4 A;  1JZO A;  2H66 A;  1OC3 A;  2H73 A;  4RI6 A;  1XFL A;  1M0U A;  2E2M A;  2UZ8 A;  2WDU A;  3UVT A;  2HSY A;  4XS4 B;  3R3E A;  3ME8 A;  2H8L A;  1LJR A;  1OKD A;  4IKH A;  2TRX A;  4ZIL A;  2CQ9 A;  3CSJ A;  1M3J A;  4Q5N A;  4OFT A;  1RK4 A;  1FVK A;  3ZL5 A;  3CRT A;  5AGY A;  2R3X A;  4F9Z A;  3KMN A;  3ZMK A;  2HE3 A;  2B5E A;  2C3Q A;  2V32 A;  2CVD A;  2DKH A;  4GCI A;  2VCW A;  1M7T A;  2TIR A;  3RDW A;  1F3A A;  3UL3 A;  11GS A;  1EP8 A;  3FR6 A;  2XBI A;  1TU7 A;  2MBS A;  1S3D A;  5CRD A;  1J9B A;  5B7C A;  2C0F A;  5HR3 A;  5DCG A;  4IQA A;  3GHA A;  1FW1 A;  1MD3 A;  2EIO A;  2KHP A;  1ST9 A;  1BJX A;  4Q5F A;  4WEY A;  3ZFL A;  3MAK A;  5D9X A;  4L0W A;  3D21 A;  3HY2 A;  2K8V A;  4HDE A;  3HCZ A;  1SKS B;  4YQV A;  1AC1 A;  1PKW A;  1EOG A;  3KH7 A;  2CVB A;  2CX4 A;  3NIV A;  4AGS A;  2L5L A;  4WBJ A;  4HJ2 A;  2YCD A;  1NM3 A;  1XWG A;  2GQL A;  5ABR A;  1OE8 A;  1CQH A;  5IMZ A;  1Q98 A;  2GZY A;  2A4H A;  2K8S A;  4AJ7 A;  2KOK A;  3TOT A;  2MMO A;  3CYN A;  4GRF A;  3L4N A;  1URM A;  3LWA A;  5IIZ A;  2OBI A;  2V6K A;  3GKX A;  2O89 A;  1A8L A;  2LJA A;  4QL9 A;  1K0B A;  1GH2 A;  2I4A A;  5ECH B;  2M72 A;  1ERV A; 
#chains in the Genus database with same CATH homology
 1O6J A;  3A3T A;  5DJL A;  4X43 A;  1G0T A;  3FZ4 A;  2AB6 A;  2YN1 A;  3FY7 A;  3ZLP A;  1QK8 A;  3QDN A;  5CO3 A;  2L4C A;  4K2X A;  1XWA A;  4LMW A;  4L0U A;  4KSO A;  1TK5 B;  1ERW A;  4MJA A;  4PUR A;  3D5J A;  2H70 A;  4D73 B;  1ZYN A;  4MP4 A;  4WBR D;  2H30 A;  4GST A;  2C0G A;  2GLR A;  1GTB A;  4JR6 A;  5JCG A;  3BBY A;  3WT2 A;  4MAB A;  2G0F A;  5CNW A;  4I97 A;  2VLU A;  5EY6 A;  1GLQ A;  2O85 A;  4N30 A;  2OE0 A;  4IHU A;  2E0Q A;  1GSS A;  5CRG A;  3LYP A;  3MDK A;  5LCZ A;  1OC9 A;  2B1L A;  2XBQ A;  4PQI A;  2L6C A;  5HFG A;  3O76 A;  1X0R A;  3FZA A;  5IMA A;  4J2F A;  4BWS A;  1NHO A;  5A5K A;  2V6O A;  4JRR A;  1O85 A;  2LQO A;  4A5P A;  3KGK A;  2QKE A;  5L71 A;  4KF9 A;  4K2D A;  5GST A;  1IYI A;  4HU7 A;  3FYG A;  1PSQ A;  7GSS A;  1T1V A;  2YZU A;  5IMD A;  1RQM A;  1GSE A;  4IBP A;  5JWO B;  5ID2 B;  2HZE B;  4OO5 A;  1WMJ A;  2L4Q A;  4D73 A;  3E0U A;  4DSS A;  4K5S A;  1K0N A;  2H0H A;  2QC7 A;  2WUL A;  2FWF A;  4IP1 A;  3WGX A;  1M99 A;  2WRT A;  3UJ1 A;  5F06 A;  2PWJ A;  4WXT A;  3TRQ A;  3HYP A;  1X9W B;  3DEX A;  3VUR A;  1PL1 A;  1Z5Y E;  2ZCT A;  5H5S A;  4AJ6 A;  1WP0 A;  1X9M B;  4DSQ A;  3P90 A;  4XS1 A;  3M3M A;  1YDK A;  3KIJ A;  3IDV A;  1U88 A;  4IGJ A;  3FMW A;  2ZUP A;  3UVH A;  3EE2 A;  3V1W A;  2DKI A;  2EIQ A;  2JAC A;  2AHE A;  3CSI A;  4KA0 A;  4ZB6 A;  3KH9 A;  3GNJ A;  3C73 A;  5ECR B;  3BOA A;  1AUC A;  3MNG A;  4IS0 A;  3KM6 A;  2GDR A;  1FHE A;  2NTO A;  3L9S A;  5CAX A;  2WJU A;  3WGE A;  4KDX A;  2H6Z A;  3WYW A;  1A23 A;  4Z2R A;  5B8A A;  4BA7 A;  2VAF A;  4MDC A;  1T7P B;  5ID2 A;  2CX3 A;  2NBS A;  6GSV A;  5DJM A;  1U3I A;  1SYR A;  1THO A;  2H19 A;  3KZQ A;  1ON4 A;  3I6A A;  12GS A;  4OCE A;  2WS2 A;  3QD9 A;  2GT6 A;  2B3S A;  1HNB A;  2ES7 A;  4GWR A;  4CW9 A;  1GUH A;  4CY8 A;  3HJM A;  4WKW A;  5IO2 A;  2WB9 A;  4BVX A;  5G2Z A;  3WGD A;  4N11 A;  2YWO A;  3A2W A;  3TJB A;  4ICY A;  2ON7 A;  14GS A;  3GKK A;  2OE3 A;  4K1F A;  4NHW A;  4AF2 A;  2F3M A;  1PA3 A;  3ISO A;  4TVE A;  2HYX A;  3F63 A;  3U6V A;  4JED A;  3Q19 A;  4EVM A;  2V1M A;  3VWU A;  2KUC A;  4HZ2 A;  3TKR A;  1SJZ A;  4X1U A;  4BPY A;  2LNT A;  4OO4 A;  5J9B A;  4MF5 A;  3DIE A;  4K9Z A;  4KSM A;  4QL7 A;  3FZ5 A;  1C72 A;  2CAQ A;  2XHF A;  2GSQ A;  3RPN A;  5G5F A;  2HRF A;  3Q6O A;  1O8X A;  3DWV A;  3L9U A;  6GSX A;  4GXZ A;  2R0P A;  2PPT A;  2KP2 A;  2YWN A;  4POL A;  2KP1 A;  3TJJ A;  2VL3 A;  1E6B A;  3RPP A;  2WGR A;  5A4U A;  5D93 A;  1ML6 A;  1AAZ A;  3RBT A;  2CVK A;  2MMN A;  3KCM A;  4IQ1 A;  3C7M A;  5F0G A;  3MSZ A;  1YY7 A;  1SD8 A;  4EKZ A;  1MD4 A;  4PGT A;  4HZ4 A;  2VM1 A;  4G19 A;  2ZNM A;  4MMM A;  4HJM A;  2IFQ B;  3FR9 A;  5J41 A;  2HFD A;  6GSS A;  2YV7 A;  1XIY A;  1M9A A;  3GH9 A;  4KCE A;  4XTS A;  4X4J A;  4KW6 A;  2FWG A;  5D8I A;  4XRA A;  3UMA A;  2LEG A;  2D2Z A;  3APS A;  1TRV A;  5ELG A;  2R5G A;  2M80 A;  3EIN A;  5ENU A;  2R0G A;  2X8H A;  5HFI A;  1XW9 A;  3M9J A;  2XPE A;  1HNA A;  5E4W A;  3ED3 A;  1TKD B;  1MDI A;  4G0K A;  4PQ1 A;  4J57 E;  5E59 A;  4NMU A;  5F8B A;  2X64 A;  4FIW A;  3IAS 2;  1S3C A;  2H0I A;  3W8S A;  5HR2 A;  3D4M A;  1M9B A;  3EVI A;  2VCX A;  2TRC P;  4MF7 A;  1ERT A;  3KXO A;  4LLR A;  4CHS A;  1W4V A;  2IMI A;  2PN8 A;  3H93 A;  5ECK B;  3VK9 A;  3ZIJ A;  1JHB A;  5ECQ B;  2VLV A;  1QMV A;  4JBB A;  4RQR A;  2F9S A;  2VL2 C;  1XW5 A;  1XCC A;  1MDK A;  2M46 A;  4K7O A;  6GSW A;  3TCO A;  2R6K A;  2IFQ A;  3EMX A;  4ZB8 A;  4YQM A;  2DJJ A;  5G30 A;  20GS A;  1GTI A;  3D22 A;  2H1A A;  1XVQ A;  2PER A;  4YQU A;  3IA1 A;  2B1K A;  1PRX A;  1W89 A;  1ZOF A;  4K0N A;  3ZML A;  3GTU A;  3J7Y k;  5JCW A;  4ZL9 A;  1MDJ A;  3Q18 A;  4J56 E;  2R37 A;  3CBU A;  4I2U A;  5KOX A;  2WCI A;  2N5B A;  2E2G A;  3LG6 A;  1O8W A;  1UVZ A;  2VCZ A;  3HHV A;  4KGI A;  4E8H A;  2HLS A;  1GSF A;  1T4Z A;  3KTL A;  2VD1 A;  3G7J A;  5KN2 A;  4EIP A;  3GL5 A;  3VWV A;  4O92 A;  5H5Q A;  4Z7X A;  1USB A;  5B8B A;  2GZZ A;  1SJ6 A;  2FUG 2;  2L5O A;  19GS A;  2X49 A;  3UBK A;  3ZRE A;  4G9H A;  1YKC A;  2ALB A;  4K7I A;  1QGV A;  3HKR A;  1JZW A;  2LRC A;  4IN0 A;  1WOU A;  4EO3 A;  4POK A;  2LKU A;  3IK9 A;  2LRN A;  3KP9 A;  4K7N A;  1OE7 A;  3QAG A;  5BRT A;  4O5U A;  3EWL A;  1OC9 B;  5J9C A;  3EU4 A;  2GST A;  1MEK A;  3LEF A;  2FY6 A;  3GKN A;  3EYT A;  1Z9H A;  2MMA A;  1U3A A;  4CY6 A;  3A5I A;  5J4U A;  2C80 A;  4MJE A;  4Z2T A;  6GST A;  1V57 A;  4ZIJ A;  1F37 A;  5HR1 A;  1SKR B;  2GS3 A;  4PQH A;  4MLY A;  3EUR A;  2H71 A;  2C0E A;  2XC2 A;  1GUL A;  1XWK A;  1TXX A;  4NWY A;  2FCH A;  3TB2 A;  5D96 A;  5AIV A;  1U87 A;  3L78 A;  1G6W A;  5DBQ A;  2HRK A;  3GSS A;  1GP1 A;  3A2X A;  4EIQ A;  1B48 A;  3EPT A;  16GS A;  3KMO A;  1M2B A;  5F05 A;  4JU5 A;  5G1K A;  4DSS B;  3F4R A;  2PVQ A;  2H0G A;  4EC0 A;  3M9K A;  1PQN A;  1EGO A;  2IPA A;  3VI5 A;  2DBC A;  1WE0 A;  1GTA A;  3PH9 A;  5D9W A;  4EUY A;  4TN8 A;  1H4O A;  5ECI B;  2XPD A;  3P7X A;  2OBK A;  3GV1 A;  1A2J A;  4KCA A;  1B8X A;  1PN9 A;  1VF3 A;  1R5A A;  3GX8 A;  2HT9 A;  3GIX A;  2IME A;  10GS A;  5ECO B;  4MCU A;  4KE3 A;  2VLT A;  3VI7 A;  4G10 A;  4NV5 A;  1XXU A;  2C3N A;  3F6D A;  4YAP A;  1EV9 A;  5J5N A;  1B9Y C;  1LU4 A;  1ZYE A;  4PNF A;  4WR5 A;  4MJC A;  4IW9 A;  5IPH A;  4POM A;  3H79 A;  1XWC A;  1Z7R A;  2X99 A;  4RUV A;  1WIK A;  3W6G A;  5KOW A;  1YF0 A;  2BJX A;  5ECS A;  3VWX A;  4I6X A;  4TR3 A;  2H1D A;  3NZN A;  1K0O A;  3UEM A;  2JAD A;  3PIN A;  3FKF A;  1TP9 A;  2C4J A;  3UAR A;  4P3Y B;  2X8G A;  3WT1 A;  3ZTL A;  3H1N A;  3QAV A;  2DJ0 A;  3GA4 A;  1XWB A;  3OR5 A;  2HSH A;  4O5Q A;  5EPF A;  3GKM A;  4MJB A;  4TXV A;  1OVN A;  4I5Q A;  4YKF A;  4ZBD A;  1KTE A;  5COH A;  3IK7 A;  1GTU A;  4GTU A;  4G0L A;  1T3B A;  4GF0 A;  3IHG A;  4BVX B;  1A2L A;  2G2Q A;  1JFU A;  5ECP B;  5EVO A;  3DVW A;  5G1L A;  2I1U A;  18GS A;  3TJK A;  3N5O A;  4K6X A;  4LL4 B;  3QFB C;  5GSS A;  2QA2 A;  5KN0 A;  4BVY B;  3CTF A;  2I9H A;  3D6I A;  1OC8 A;  5JCU A;  2RM6 A;  1SL2 B;  1NW2 A;  2GSR A;  2I3Y A;  1TI1 A;  3M0F A;  2R2J A;  3D4T A;  1SYX A;  2LUS A;  2L59 A;  2EIR A;  3GUR A;  3HJP A;  3IHQ A;  3BCI A;  3H8Q A;  1TK0 B;  4YH2 A;  2JL4 A;  3IV4 A;  4MZB A;  2LJK A;  2VIM A;  3CRU A;  5FWG A;  2R0C A;  3ERF A;  2H1G A;  2AYT A;  2DIY A;  1YEP A;  2H1B A;  1I5G A;  4WR4 A;  3DML A;  3TDG A;  3QAW A;  4ML6 A;  4K8M A;  3D0Z A;  5DQY A;  4V2M A;  2VL2 A;  3FEU A;  5IQY A;  2I81 A;  3DGQ A;  5IO0 A;  1AW9 A;  4I8B A;  2B6M A;  2A2P A;  1Z7P A;  1VRS D;  6GSU A;  4PUA A;  5BMU A;  2B7J A;  4NHZ A;  1WJK A;  1HNC A;  3L0H A;  1O7U A;  3US3 A;  1GSY A;  5ECN B;  3HDC A;  3I9V 2;  4ULX A;  3GL3 A;  3FW2 A;  2IWT A;  1K0M A;  1ZGN A;  3KEB A;  1EEJ A;  4BVY A;  3APQ A;  1B4Q A;  1BYE A;  5IPG A;  4TKY A;  4HUA A;  3HZ8 A;  2MZC A;  2F8F A;  3FR3 A;  3DRN A;  3HXS A;  3EMP A;  3EC3 A;  2K9F A;  2IN3 A;  3I69 A;  4XHM A;  2GQM A;  3IXR A;  2ON5 A;  2YWM A;  4FQU A;  3UBL A;  3M1G A;  1DE2 A;  2A4V A;  3VPT A;  3HJO A;  1ERU A;  2E7P A;  3IC4 A;  1PD2 1;  2KLX A;  5GAN D;  2IMD A;  2L6D A;  2BMX A;  2RUF A;  3MYD A;  3TJG A;  4LMV A;  1AXD A;  4F0B A;  3QOU A;  4NAX A;  4V1A p;  4LL1 B;  1Y6E A;  1DSB A;  1WPI A;  3GST A;  2QSI A;  1KNG A;  3MIX A;  3C1S A;  1EOH A;  3IRA A;  2HSM A;  3N9J A;  2C1Y A;  1XOB A;  2NPB A;  4EDY A;  3LJR A;  4EE0 A;  5A4V A;  5CP1 A;  2MBT A;  4ACS A;  4BWQ A;  3F3R A;  1EV4 A;  1XOA A;  4G0I A;  2O87 A;  4ID0 A;  4MH2 A;  5ECM B;  2OE1 A;  1ZMA A;  3F9U A;  1QXH A;  4BL7 B;  3SBC A;  3P2A A;  5F07 A;  5IOW A;  4K0G A;  4CDO A;  4TR0 A;  2C8U A;  2HI7 A;  3LFL A;  4USS A;  4MNN A;  5G31 A;  3ZIV A;  1K3Y A;  1AQW A;  1BX9 A;  4KDU A;  2DJ3 A;  4NV2 A;  5KEJ A;  2GT5 A;  2YZH A;  5HFK A;  1E2Y A;  5ELA A;  4IJ3 A;  3DYR A;  3GTU B;  1TDI A;  1XW6 A;  1T00 A;  3I43 A;  1U6T A;  4TR1 B;  2NVL A;  4PUF C;  3IOS A;  2LS5 A;  1PKZ A;  2YWI A;  4MK3 A;  2YOI A;  5FHI A;  1Z6N A;  2EC4 A;  4EF0 A;  1PGT A;  1G7O A;  1FOV A;  1X9S B;  3E3E A;  4L8E A;  2DML A;  4IJI A;  1EZK A;  1F2E A;  1FVJ A;  3TRP A;  1Z6M A;  2YPM A;  2B5X A;  4OCF A;  1V2A A;  1GLP A;  4O32 A;  2HXK A;  1FG4 A;  3HZ4 A;  4MPG A;  1AQX A;  1GNE A;  1V98 A;  2CA8 A;  4TOP A;  1FO5 A;  1DBY A;  4ZXG A;  1X5C A;  5D73 A;  5AN1 A;  3KJY A;  4O5R A;  3J7Y b;  5DCH A;  1GWC A;  3GX0 A;  4IVF A;  4F82 A;  4EL1 A;  2OKA A;  3E9J B;  1JLW A;  4I2T A;  1F3B A;  4BL7 A;  2DJ1 A;  5IOX A;  5LD0 A;  4Z2U A;  1FOH A;  1YQ1 A;  2B5Y A;  2VCQ A;  5HR0 A;  5KN1 A;  1GRX A;  4IEL A;  2PUK C;  4TXO A;  5DDL A;  5EL8 A;  1PMT A;  3ZFB A;  2DSA A;  3HVS A;  4GQF A;  3TKQ A;  3VWW A;  2H01 A;  1XZO A;  13GS A;  1VF2 A;  2IJY A;  2FLS A;  1G6Y A;  2CT6 A;  3W8J A;  3A5W A;  3IAM 2;  2VO4 A;  2DMM A;  1SKW B;  2LRT A;  3GYK A;  5CYY A;  1ILO A;  4TR1 A;  4MZC A;  2X4A A;  2OJL A;  1AIU A;  5KN3 A;  3ZVJ A;  5DAK A;  1EEM A;  1ABA A;  2A2S A;  1TRU A;  4F0C A;  2RLI A;  4HEA 2;  1K3O A;  3IR4 A;  2CZ2 A;  1I9D A;  3F4T A;  4RQX A;  1A0F A;  2IMF A;  17GS A;  5HQP A;  1WWJ A;  3QR6 A;  1H75 A;  2IMK A;  2RM5 A;  1O81 A;  1R26 A;  3TOU A;  1DE1 A;  1SEN A;  2QGV A;  3TJF A;  2N5A A;  2V41 A;  2P5Q A;  5AIS A;  3A2V A;  1ACV A;  4WET A;  2Z9S A;  4GQC A;  3NOF A;  1PX7 A;  1NSW A;  1VGL A;  1GSD A;  2JZT A;  1EGR A;  4DEJ A;  4TR4 A;  5J3R A;  4HU9 A;  1ZL9 A;  2JSZ A;  3GH6 A;  5B6M A;  2FA8 A;  2P5R A;  1PL2 A;  2F8A A;  3CXG A;  1FB6 A;  2LV3 A;  4IP6 A;  1S3A A;  2O7K A;  3LSZ A;  5IMV A;  1UA5 A;  5G5E A;  1SU9 A;  2AV4 A;  2VCV A;  2HRA A;  2VL9 A;  3ERW A;  4O7H A;  1CQG A;  3LQ7 A;  2GQK A;  1F9M A;  4XS4 A;  1TJD A;  2K6V A;  3R2Q A;  2FA4 A;  3Q74 A;  4G2E A;  3GN3 A;  1OAZ A;  1SJI A;  2H72 A;  5DAL B;  4ZBB A;  2C3T A;  5AIX A;  3GUS A;  2VCT A;  4OMV A;  1A24 A;  3TKS C;  1BQ7 A;  3DD3 A;  4ILF A;  1DUG A;  4RI7 A;  3PR8 A;  3P8W A;  3JCM L;  2J23 A;  1SL0 B;  1HD2 A;  1TK8 B;  3F6F A;  3GFK A;  3HVX A;  2PMT A;  1UN2 A;  2YJ7 A;  2PBJ A;  4YAV A;  2MMZ A;  2PVO C;  1ZCP A;  5DQS A;  3F0I A;  4GSS A;  2RII A;  4E8E A;  4XIH A;  4KDY A;  1V9W A;  1K0C A;  4LA1 A;  3TGZ A;  1XBS A;  1A0R P;  2DJK A;  1MTC A;  4MF6 A;  4X0X A;  3BJ5 A;  2N5F A;  4DSR A;  4H86 A;  2CZ3 A;  1TI3 A;  4ZBA A;  3ZVJ D;  2JZS A;  4ECJ A;  2O8V B;  4F03 A;  5DVB A;  4MPF A;  5JWQ B;  3WD6 A;  8GSS A;  1R7H A;  3GRX A;  3UOM A;  3CMI A;  1KBN A;  1Q4J A;  4ZL8 A;  1F6M C;  4JE1 A;  2H75 A;  6GSY A;  2REM A;  1BED A;  4V2L A;  1M2A A;  4ECB A;  1YF1 A;  3CSH A;  2RUE A;  2VUP A;  2GSS A;  4KND A;  1JZD A;  4FYU A;  1TRS A;  4FYC A;  3C8E A;  2H76 A;  4WF5 A;  2YJH A;  5DAL A;  1G7E A;  3ERG A;  2OAD A;  1SD9 A;  1QFN A;  2YP6 A;  5D9V A;  4JR4 A;  1A8Y A;  3H4K A;  1M2D A;  1NHY A;  4KX4 A;  1XVW A;  2DJ2 A;  5FT3 A;  1BAY A;  1YEX A;  2GVP A;  1T4Y A;  4GLT A;  3VPQ A;  4N0Z A;  1TOF A;  2WZ9 A;  2F51 A;  4NPB A;  3VFI A;  4ML1 A;  1GSQ A;  1R4W A;  4EXJ A;  5INY A;  3F8U A;  3RAZ A;  3M8N A;  1SK1 A;  1N8J A;  3EU3 A;  1GUM A;  2GTU A;  3ME7 A;  1B9X C;  4POB A;  4OFN A;  2FGX A;  3PGT A;  4KB3 A;  3TKP A;  2MYG A;  3K8N A;  3IPZ A;  4ISD A;  4JZQ A;  2JU5 A;  4FYB A;  4OWY A;  4AJ8 A;  2FWE A;  2NDO A;  4N10 A;  3TUE A;  3MWH A;  1X5D A;  4HQS A;  1YZX A;  2LTK A;  3IC8 A;  4XS6 A;  3LOR A;  3DKS A;  3BD2 A;  2IL3 A;  4N0V A;  4QQ7 A;  4ZL7 A;  3F4S A;  4DVC A;  2OA7 A;  1JLV A;  1J08 A;  2A2R A;  1LBK A;  3ZYW A;  3IE3 A;  2AUV A;  3AY8 A;  2H74 A;  3KP8 A;  1ZZY A;  2LST A;  2QA1 A;  1SK2 A;  2JSY A;  2C0D A;  4Q5R A;  2BTO T;  1Y25 A;  4PNG A;  4NXI A;  4KAE A;  1GNW A;  3HA9 A;  3U5R E;  3FHK A;  5IMC A;  2HZE A;  3BCK A;  4Q5Q A;  2FHE A;  2DIZ A;  2L57 A;  2K18 A;  5IMF A;  5H5R A;  3FZ9 A;  2FD3 A;  2LJR A;  3FRC A;  4HS1 A;  3LYK A;  1FB0 A;  2GZP A;  4MH3 A;  4XRD A;  4TRX A;  4ZB9 A;  5GAP D;  2DLX A;  2GGT A;  4XCS A;  4FH8 A;  4OFM A;  2CV4 A;  4GSN A;  1A2M A;  3G7I A;  4L5L A;  1YKA A;  1OYJ A;  2AJQ B;  3LXT A;  3QFA C;  4ECC A;  2J9H A;  4MA9 A;  1J0F A;  3S9F A;  1RW1 A;  1ZYP A;  4TW5 A;  2PU9 C;  2B7K A;  3RHC A;  1K3L A;  1TTZ A;  2HNL A;  1THX A;  2YAN A;  1GSU A;  4V2N A;  4HQZ A;  3KTB A;  4V1A g;  2IIY A;  1TW9 A;  2WFC A;  2FWH A;  5B6N A;  3O6T A;  1T8E B;  3DXB A;  2P31 A;  2HZF A;  1N2A A;  1IYH A;  3TRX A;  4YKG A;  5CRW A;  3ZIT A;  3LW9 A;  3QCP A;  1EWX A;  5C04 A;  4EDZ A;  1BG5 A;  4L5O A;  2LNS A;  2R4V A;  1GUK A;  2H6Y A;  3FK8 A;  1ZYQ B;  2H6X A;  3O3T A;  1PN0 A;  1XPV A;  2VD0 A;  1B4P A;  3L9V A;  2LQQ A;  4KUN A;  3C1R A;  3HD5 A;  1TRW A;  1WRY A;  1X5E A;  4PX1 A;  2X8C A;  2VM2 A;  1SL1 B;  3QPM A;  3LGC A;  4TXO B;  3GMF A;  3CTG A;  3TKS A;  2VOC A;  1QQ2 A;  5A4W A;  3LXZ A;  2FNO A;  4KH7 A;  3SWL A;  5JWR B;  1V58 A;  4FO5 A;  3APO A;  1K0D A;  1VF1 A;  3QMX A;  3ZZX A;  3G7Y A;  1HQO A;  5CRH A;  5ECL B;  4MZW A;  1R5P A;  1K0A A;  4K5R A;  3PPU A;  1UC7 A;  2AAW A;  2PGT A;  5GZZ B;  5DAK B;  1AQV A;  4PTS A;  4F2I A;  22GS A;  1V40 A;  9GSS A;  2DC5 A;  3VLN A;  4ECI A;  2CAI A;  3HVV A;  2V2G A;  5LNK e;  1PX6 A;  1SK0 A;  4OD7 A;  4PXO A;  1HYU A;  5C00 A;  1YJ6 A;  2YNX A;  1EP7 A;  1QUW A;  1JZR A;  3C71 A;  2P0G A;  2JZR A;  1FAA A;  2YV9 A;  3F3Q A;  3IBH A;  4HI7 A;  1GL8 A;  1KEB A;  1Z3E A;  5CRE A;  5D9T A;  3TKS E;  1TU8 A;  2HRN A;  3G9B A;  3UIW A;  3DVX A;  4HOJ A;  3UAP A;  1O73 A;  2OAC A;  3RHB A;  3ZRD A;  4WF4 A;  1OKT A;  5IM9 A;  3KD0 A;  1VF4 A;  1JZO A;  2H66 A;  1OC3 A;  2H73 A;  4RI6 A;  1XFL A;  1M0U A;  2E2M A;  2UZ8 A;  2WDU A;  3UVT A;  2HSY A;  4XS4 B;  3R3E A;  3ME8 A;  2H8L A;  1LJR A;  1OKD A;  4IKH A;  2TRX A;  4ZIL A;  2CQ9 A;  3CSJ A;  4Q5N A;  4OFT A;  1RK4 A;  1FVK A;  3ZL5 A;  3CRT A;  5AGY A;  2R3X A;  4F9Z A;  3KMN A;  3ZMK A;  2HE3 A;  2B5E A;  2C3Q A;  2V32 A;  2CVD A;  2DKH A;  4GCI A;  2VCW A;  1M7T A;  2TIR A;  3RDW A;  1F3A A;  3UL3 A;  11GS A;  1EP8 A;  3FR6 A;  2XBI A;  1TU7 A;  2MBS A;  1S3D A;  5CRD A;  1J9B A;  5B7C A;  2C0F A;  5HR3 A;  5DCG A;  4IQA A;  3GHA A;  1FW1 A;  1MD3 A;  2EIO A;  2KHP A;  1ST9 A;  1BJX A;  4Q5F A;  4WEY A;  3ZFL A;  3MAK A;  5D9X A;  4L0W A;  3D21 A;  3HY2 A;  2K8V A;  4HDE A;  3HCZ A;  1SKS B;  4YQV A;  1AC1 A;  1PKW A;  1EOG A;  3KH7 A;  2CVB A;  2CX4 A;  3NIV A;  4AGS A;  2L5L A;  4WBJ A;  4HJ2 A;  2YCD A;  1NM3 A;  1XWG A;  2GQL A;  5ABR A;  1OE8 A;  1CQH A;  5IMZ A;  1Q98 A;  2GZY A;  2A4H A;  2K8S A;  4AJ7 A;  2KOK A;  3TOT A;  2MMO A;  3CYN A;  4GRF A;  3L4N A;  1URM A;  3LWA A;  5IIZ A;  2OBI A;  2V6K A;  3GKX A;  2O89 A;  1A8L A;  2LJA A;  4QL9 A;  1K0B A;  1GH2 A;  2I4A A;  5ECH B;  2M72 A;  1ERV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...