1T5FA

Arginase i-aoh complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
314
structure length
314
Chain Sequence
b'KPIEIIGAPFSKGCPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLAVIWVDAHTDINTPLTTSSGNLAGQPVAFLLKELKGKFPDVPGFSWVTPAISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSAFGTKREGNHKPETDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Design of amino acid aldehydes as transition-state analogue inhibitors of arginase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 113
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1t5fA00
2EF5A 1P8QA 3PZLA 4RHIA 1CEVA 3KV2A 4Q3VA 4G3HA 4RLAA 3SKKA 4Q41A 4MYLA 1T4RA 4IE3A 4Q3PA 1P8SA 3RLAA 1RLAA 1HQFA 2EF4A 1P8RA 3E6KA 4HXQA 2PLLA 3LP7A 3TF3A 3CEVA 4ITYA 1TBLA 3E8QA 4DZ4A 1T5GA 1T4SA 4Q42A 1ZPGA 3F80A 4IU1A 1WVBA 4GSMA 1HQGA 3SL1A 4IXVA 4IE2A 1PQ3A 1T5FA 1TBHA 1P8PA 5RLAA 2RLAA 4IU0A 4FCKA 3NIQA 5HJAA 1T4PA 4I06A 2EIVA 4Q3RC 2CEVA 1TBJA 2ZAVA 1XFKA 4Q3TA 5CEVA 3NIOA 3LP4A 3NIPA 2A0MA 3TH7A 4Q40A 1D3VA 3MJLA 4GSVA 4MXRA 4MYNA 1T4TA 4RHMA 1WVAA 1HQXA 4FCIA 4RHQA 3SL0A 4Q3RA 4HWWA 1P8MA 5HJ9A 1WOGA 2PHOA 1WOIA 4HZEA 3GMZA 1P8OA 4GSZA 3THEA 1TA1A 4RHKA 1GQ6A 3DJ8A 4RHLA 4GWDA 2PHAA 4IE1A 1HQHA 3MFWA 4Q3SA 3E8ZA 3THHA 4Q3UA 3M1RA 4MYKA 3THJA 3LHLA 3E6VA 4IXUA 3GN0A 3MFVA 4Q3QA 3SJTA 4IU4A 1R1OA 3MMRA 4GWCA 1GQ7A 4CEVA 1P8NA 4IU5A 1ZPEA 3E9BA 4MYFA 2AEBA 1WOHA 4RHJA 1HQ5A
chains in the Genus database with same CATH superfamily
2EF5A 4ZUMA 1P8QA 3PZLA 4RHIA 1CEVA 3KV2A 4Q3VA 4G3HA 4RLAA 3SKKA 3C0ZA 2GH6A 4BZ6A 4Q41A 5LI3A 4MYLA 1T4RA 4IE3A 4Q3PA 5FCWA 1P8SA 3EZTA 5THUA 3ZNSA 2VCGA 3RLAA 4BZ9A 1HQFA 1RLAA 2EF4A 1P8RA 5G0GA 5EEIA 3E6KA 5EF8A 4HXQA 3SFHA 2PLLA 3MZ7A 5EFJD 3LP7A 3TF3A 5D1CA 5G13A 3CEVA 2V5XA 4ITYA 1TBLA 5G0IA 5THTA 3E8QA 4DZ4A 1T67A 3ZNRA 1T5GA 4CQFA 2VQQA 1T4SA 4Q42A 5EFGA 5G0YA 4QA1A 1ZPGA 3F80A 4QA5A 4IU1A 1WVBA 4GSMA 3MZ4A 1HQGA 5FUEA 3SL1A 4BZ8A 5G12A 4IXVA 5EFNA 4IE2A 5G3WA 4ZUOA 1PQ3A 1T5FA 4CBYA 4BKXB 1TBHA 4QA0A 1P8PA 3MAXA 4QA3A 2RLAA 4IU0A 5RLAA 1ZZ3A 4FCKA 3NIQA 3Q9BA 1C3SA 5HJAA 1T4PA 3Q9EA 2EIVA 4I06A 4Q3RC 2CEVA 1TBJA 2ZAVA 1XFKA 4Q3TA 5CEVA 3NIOA 3MZ3A 3LP4A 1ZZ0A 3NIPA 2A0MA 3TH7A 1T64A 4Q40A 4RN1A 1D3VA 3MJLA 4GSVA 4MXRA 4LY1A 4MYNA 5EFHA 1T4TA 4RHMA 1WVAA 5G17A 1HQXA 4FCIA 5JI5A 3C0YA 4RHQA 5EF7A 5DC8A 5G1CA 3SL0A 5G11A 4Q3RA 4HWWA 1P8MA 5HJ9A 3F07A 3Q9CA 5G0XA 5D1DA 5THVA 3SFFA 3F06A 5EFBD 1WOGA 3EWFA 2PHOA 1WOIA 5DC6A 4HZEA 1C3PA 4ZUQA 3GMZA 2VQWG 1P8OA 1T69A 3Q9FA 4GSZA 3C10A 4ZUNA 5G1AA 3THEA 5A2SA 1TA1A 5EFKB 2VQOA 3F0RA 4RHKA 5IWGA 4QA4A 1GQ6A 1W22A 3DJ8A 4RHLA 5IX0A 4LXZA 4RN2A 4GWDA 2PHAA 2VQJA 4IE1A 4RN0A 1HQHA 3MFWA 4Q3SA 4BZ5A 3E8ZA 3THHA 4Q3UA 3M1RA 4MYKA 3THJA 5EEKA 5G10A 3RQDA 3LHLA 3E6VA 4IXUA 3EW8A 2V5WA 3GN0A 5EEFA 5DC5A 5G0JA 3MFVA 4A69A 4Q3QA 5EEMA 3SJTA 4BZ7A 4IU4A 1R1OA 2VQMA 5D1BA 1ZZ1A 5EENA 1VKGA 3MMRA 5G0HA 4GWCA 4QA6A 1GQ7A 3EZPA 4CEVA 5BWZA 5ICNB 1C3RA 4ZURA 5THSA 4QA7A 1P8NA 3MZ6A 3MENA 4IU5A 4QA2A 1ZPEA 4CBTA 3E9BA 4MYFA 2AEBA 1WOHA 4RHJA 5G1BA 1HQ5A 4ZUPA 5DC7A 2VQVA
chains in the Genus database with same CATH topology
2EF5A 1P8QA 3PZLA 4RHIA 1CEVA 3KV2A 4Q3VA 4G3HA 4RLAA 3SKKA 4Q41A 4MYLA 1T4RA 4IE3A 4Q3PA 1P8SA 3RLAA 1RLAA 1HQFA 2EF4A 1P8RA 3E6KA 4HXQA 2PLLA 3LP7A 3TF3A 3CEVA 4ITYA 1TBLA 3E8QA 4DZ4A 1T5GA 1T4SA 4Q42A 1ZPGA 3F80A 4IU1A 1WVBA 4GSMA 1HQGA 3SL1A 4IXVA 4IE2A 1PQ3A 1T5FA 1TBHA 1P8PA 5RLAA 2RLAA 4IU0A 4FCKA 3NIQA 5HJAA 1T4PA 4I06A 2EIVA 4Q3RC 2CEVA 1TBJA 2ZAVA 1XFKA 4Q3TA 5CEVA 3NIOA 3LP4A 3NIPA 2A0MA 3TH7A 4Q40A 1D3VA 3MJLA 4GSVA 4MXRA 4MYNA 1T4TA 4RHMA 1WVAA 1HQXA 4FCIA 4RHQA 3SL0A 4Q3RA 4HWWA 1P8MA 5HJ9A 1WOGA 2PHOA 1WOIA 4HZEA 3GMZA 1P8OA 4GSZA 3THEA 1TA1A 4RHKA 1GQ6A 3DJ8A 4RHLA 4GWDA 2PHAA 4IE1A 1HQHA 3MFWA 4Q3SA 3E8ZA 3THHA 4Q3UA 3M1RA 4MYKA 3THJA 3LHLA 3E6VA 4IXUA 3GN0A 3MFVA 4Q3QA 3SJTA 4IU4A 1R1OA 3MMRA 4GWCA 1GQ7A 4CEVA 1P8NA 4IU5A 1ZPEA 3E9BA 4MYFA 2AEBA 1WOHA 4RHJA 1HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EF5 A;  1P8Q A;  3PZL A;  4RHI A;  1CEV A;  3KV2 A;  4Q3V A;  4G3H A;  4RLA A;  3SKK A;  4Q41 A;  4MYL A;  1T4R A;  4IE3 A;  4Q3P A;  1P8S A;  3RLA A;  1RLA A;  1HQF A;  2EF4 A;  1P8R A;  3E6K A;  4HXQ A;  2PLL A;  3LP7 A;  3TF3 A;  3CEV A;  4ITY A;  1TBL A;  3E8Q A;  4DZ4 A;  1T5G A;  1T4S A;  4Q42 A;  1ZPG A;  3F80 A;  4IU1 A;  1WVB A;  4GSM A;  1HQG A;  3SL1 A;  4IXV A;  4IE2 A;  1PQ3 A;  1T5F A;  1TBH A;  1P8P A;  5RLA A;  2RLA A;  4IU0 A;  4FCK A;  3NIQ A;  5HJA A;  1T4P A;  4I06 A;  2EIV A;  4Q3R C;  2CEV A;  1TBJ A;  2ZAV A;  1XFK A;  4Q3T A;  5CEV A;  3NIO A;  3LP4 A;  3NIP A;  2A0M A;  3TH7 A;  4Q40 A;  1D3V A;  3MJL A;  4GSV A;  4MXR A;  4MYN A;  1T4T A;  4RHM A;  1WVA A;  1HQX A;  4FCI A;  4RHQ A;  3SL0 A;  4Q3R A;  4HWW A;  1P8M A;  5HJ9 A;  1WOG A;  2PHO A;  1WOI A;  4HZE A;  3GMZ A;  1P8O A;  4GSZ A;  3THE A;  1TA1 A;  4RHK A;  1GQ6 A;  3DJ8 A;  4RHL A;  4GWD A;  2PHA A;  4IE1 A;  1HQH A;  3MFW A;  4Q3S A;  3E8Z A;  3THH A;  4Q3U A;  3M1R A;  4MYK A;  3THJ A;  3LHL A;  3E6V A;  4IXU A;  3GN0 A;  3MFV A;  4Q3Q A;  3SJT A;  4IU4 A;  1R1O A;  3MMR A;  4GWC A;  1GQ7 A;  4CEV A;  1P8N A;  4IU5 A;  1ZPE A;  3E9B A;  4MYF A;  2AEB A;  1WOH A;  4RHJ A;  1HQ5 A; 
#chains in the Genus database with same CATH topology
 2EF5 A;  4ZUM A;  1P8Q A;  3PZL A;  4RHI A;  1CEV A;  3KV2 A;  4Q3V A;  4G3H A;  4RLA A;  3SKK A;  3C0Z A;  2GH6 A;  4BZ6 A;  4Q41 A;  5LI3 A;  4MYL A;  1T4R A;  4IE3 A;  4Q3P A;  5FCW A;  1P8S A;  3EZT A;  5THU A;  3ZNS A;  2VCG A;  3RLA A;  4BZ9 A;  1HQF A;  1RLA A;  2EF4 A;  1P8R A;  5G0G A;  5EEI A;  3E6K A;  5EF8 A;  4HXQ A;  3SFH A;  2PLL A;  3MZ7 A;  5EFJ D;  3LP7 A;  3TF3 A;  5D1C A;  5G13 A;  3CEV A;  2V5X A;  4ITY A;  1TBL A;  5G0I A;  5THT A;  3E8Q A;  4DZ4 A;  1T67 A;  3ZNR A;  1T5G A;  4CQF A;  2VQQ A;  1T4S A;  4Q42 A;  5EFG A;  5G0Y A;  4QA1 A;  1ZPG A;  3F80 A;  4QA5 A;  4IU1 A;  1WVB A;  4GSM A;  3MZ4 A;  1HQG A;  5FUE A;  3SL1 A;  4BZ8 A;  5G12 A;  4IXV A;  5EFN A;  4IE2 A;  5G3W A;  4ZUO A;  1PQ3 A;  1T5F A;  4CBY A;  4BKX B;  1TBH A;  4QA0 A;  1P8P A;  3MAX A;  4QA3 A;  2RLA A;  4IU0 A;  5RLA A;  1ZZ3 A;  4FCK A;  3NIQ A;  3Q9B A;  1C3S A;  5HJA A;  1T4P A;  3Q9E A;  2EIV A;  4I06 A;  4Q3R C;  2CEV A;  1TBJ A;  2ZAV A;  1XFK A;  4Q3T A;  5CEV A;  3NIO A;  3MZ3 A;  3LP4 A;  1ZZ0 A;  3NIP A;  2A0M A;  3TH7 A;  1T64 A;  4Q40 A;  4RN1 A;  1D3V A;  3MJL A;  4GSV A;  4MXR A;  4LY1 A;  4MYN A;  5EFH A;  1T4T A;  4RHM A;  1WVA A;  5G17 A;  1HQX A;  4FCI A;  5JI5 A;  3C0Y A;  4RHQ A;  5EF7 A;  5DC8 A;  5G1C A;  3SL0 A;  5G11 A;  4Q3R A;  4HWW A;  1P8M A;  5HJ9 A;  3F07 A;  3Q9C A;  5G0X A;  5D1D A;  5THV A;  3SFF A;  3F06 A;  5EFB D;  1WOG A;  3EWF A;  2PHO A;  1WOI A;  5DC6 A;  4HZE A;  1C3P A;  4ZUQ A;  3GMZ A;  2VQW G;  1P8O A;  1T69 A;  3Q9F A;  4GSZ A;  3C10 A;  4ZUN A;  5G1A A;  3THE A;  5A2S A;  1TA1 A;  5EFK B;  2VQO A;  3F0R A;  4RHK A;  5IWG A;  4QA4 A;  1GQ6 A;  1W22 A;  3DJ8 A;  4RHL A;  5IX0 A;  4LXZ A;  4RN2 A;  4GWD A;  2PHA A;  2VQJ A;  4IE1 A;  4RN0 A;  1HQH A;  3MFW A;  4Q3S A;  4BZ5 A;  3E8Z A;  3THH A;  4Q3U A;  3M1R A;  4MYK A;  3THJ A;  5EEK A;  5G10 A;  3RQD A;  3LHL A;  3E6V A;  4IXU A;  3EW8 A;  2V5W A;  3GN0 A;  5EEF A;  5DC5 A;  5G0J A;  3MFV A;  4A69 A;  4Q3Q A;  5EEM A;  3SJT A;  4BZ7 A;  4IU4 A;  1R1O A;  2VQM A;  5D1B A;  1ZZ1 A;  5EEN A;  1VKG A;  3MMR A;  5G0H A;  4GWC A;  4QA6 A;  1GQ7 A;  3EZP A;  4CEV A;  5BWZ A;  5ICN B;  1C3R A;  4ZUR A;  5THS A;  4QA7 A;  1P8N A;  3MZ6 A;  3MEN A;  4IU5 A;  4QA2 A;  1ZPE A;  4CBT A;  3E9B A;  4MYF A;  2AEB A;  1WOH A;  4RHJ A;  5G1B A;  1HQ5 A;  4ZUP A;  5DC7 A;  2VQV A; 
#chains in the Genus database with same CATH homology
 2EF5 A;  1P8Q A;  3PZL A;  4RHI A;  1CEV A;  3KV2 A;  4Q3V A;  4G3H A;  4RLA A;  3SKK A;  4Q41 A;  4MYL A;  1T4R A;  4IE3 A;  4Q3P A;  1P8S A;  3RLA A;  1RLA A;  1HQF A;  2EF4 A;  1P8R A;  3E6K A;  4HXQ A;  2PLL A;  3LP7 A;  3TF3 A;  3CEV A;  4ITY A;  1TBL A;  3E8Q A;  4DZ4 A;  1T5G A;  1T4S A;  4Q42 A;  1ZPG A;  3F80 A;  4IU1 A;  1WVB A;  4GSM A;  1HQG A;  3SL1 A;  4IXV A;  4IE2 A;  1PQ3 A;  1T5F A;  1TBH A;  1P8P A;  5RLA A;  2RLA A;  4IU0 A;  4FCK A;  3NIQ A;  5HJA A;  1T4P A;  4I06 A;  2EIV A;  4Q3R C;  2CEV A;  1TBJ A;  2ZAV A;  1XFK A;  4Q3T A;  5CEV A;  3NIO A;  3LP4 A;  3NIP A;  2A0M A;  3TH7 A;  4Q40 A;  1D3V A;  3MJL A;  4GSV A;  4MXR A;  4MYN A;  1T4T A;  4RHM A;  1WVA A;  1HQX A;  4FCI A;  4RHQ A;  3SL0 A;  4Q3R A;  4HWW A;  1P8M A;  5HJ9 A;  1WOG A;  2PHO A;  1WOI A;  4HZE A;  3GMZ A;  1P8O A;  4GSZ A;  3THE A;  1TA1 A;  4RHK A;  1GQ6 A;  3DJ8 A;  4RHL A;  4GWD A;  2PHA A;  4IE1 A;  1HQH A;  3MFW A;  4Q3S A;  3E8Z A;  3THH A;  4Q3U A;  3M1R A;  4MYK A;  3THJ A;  3LHL A;  3E6V A;  4IXU A;  3GN0 A;  3MFV A;  4Q3Q A;  3SJT A;  4IU4 A;  1R1O A;  3MMR A;  4GWC A;  1GQ7 A;  4CEV A;  1P8N A;  4IU5 A;  1ZPE A;  3E9B A;  4MYF A;  2AEB A;  1WOH A;  4RHJ A;  1HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...