1T5IA

Crystal structure of the c-terminal domain of uap56
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
159
Chain Sequence
b'GLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPEQTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT RNA HELICASE
publication title Crystal structure of UAP56, a "DEXD/H-box" protein involved in pre-mRNA splicing and mRNA export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
total genus 57
structure length 159
sequence length 168
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t5iA00
4DIDA 1W7AA 3TBKA 2XOKD 4FINA 3TUZC 1S3SA 3CH5A 1D5CA 3LAWA 2H16A 1NLYA 3OEEA 1QG4A 3P4YA 3IIKA 3EA0A 821PA 1SVOA 1Z0IA 3PUZA 3B8HA 4P4SA 1OJLA 4AG6A 2F7SA 4BQSA 4I1UA 2JLWA 4B3GA 4BRUA 1RE0A 5GJCA 3TSOA 3D3QA 3VMFA 3I32A 5HZHA 3VKGA 4TQAA 2HXSA 3DZ8A 2IYQA 3K09C 4TLDA 4KO8A 1TF5A 1MH1A 2JLVA 3SBDA 2NOAA 1QBKC 2QTFA 1JEEA 3R9IA 1PV4A 2GILA 3IIMA 4YXWD 3P1JA 1CR0A 4Q01A 2R6CA 4IXNA 1WA5A 4Q18A 1W46A 3THYB 2GCNA 1Z0AA 2IL1A 2G3YA 1QHYA 1E4VA 4TL8A 2YC2C 1P9WA 2QT1A 3WYAA 5AJXA 4BE7B 5IHPA 1JR3D 2IC5A 3BORA 5C46F 3AF2A 5L3QB 3T15A 3QXSA 4JLAA 4QFMA 3T1VA 1YU9A 2PZEA 4HLCA 1KDTA 4RD0A 3GLFE 2V9PA 5FOVA 2REBA 3FHCB 1G7CA 3B1YA 4DLVA 4E09A 5JS8A 4LJ7A 3MAAC 1UM8A 2BM1A 5FBRB 2WSMA 5L3SA 1F2TA 1E69A 3EARA 4L9WA 4PTLA 3KQLA 4ZCMA 3RS5A 2XNSA 3I3SR 2F55A 2ZJ2A 4TYPA 4DLZA 1P4SA 1GNPA 4IVRA 2RGBA 4DT1B 3B13B 3GFPA 4Q4AA 5CLLA 4DBLC 4B47A 3BBPA 3DDCA 1E0AA 2BWJA 3QQ5A 2O0JA 4CEJB 1NVWQ 2YJTD 4NMMA 1KJYA 4QJ4A 4PC3A 1DEKA 3GEHA 2H92A 2ZQ5A 2PH1A 2EFHB 3WHKA 2ZSAA 5EE1A 2GESA 4DLWA 1EXMA 4DKXA 3IEVA 2GXSA 1E79A 1MR3F 3IKJA 5EXPA 3RS2A 4X8OA 4EPYA 4ZCIA 4CEHB 1HA3A 2IHBA 2JIZD 1XFAA 2ZJ5A 1AIPA 4Q7LA 2W2TA 1AA9A 1AKYA 4TMXA 4DLSA 1QHHB 1U98A 1UDWA 2QTVB 3IGFA 1AGPA 4M9SA 1FTSA 4DCVA 5CDFE 3ZZTA 4B74A 4TT3D 4HLQB 3LVQE 1N5JA 3SYKA 2ORIA 2X2FA 2C95A 1E9DA 3AF3A 4XD7D 4V0ME 1KAOA 3QG1A 4OQNA 2QBYA 2QE7A 1J8MF 2REOA 1EGAA 4PZYA 4U00A 1XXHB 3W6PA 5JCPA 3UXMA 4JZKA 5G40A 4B3XA 3THXA 4QKQA 2FA9A 2IXGA 1ZUHA 2O8EB 4G5QA 3OEHD 4XJXA 1KMHB 3AH8A 1E9SA 4YMVA 4OHWA 5TARA 2ZRFA 3CX7A 3OE7D 1G9XA 2H57A 2ODBA 2Y8EA 4Q4HB 5FH9A 3V4RA 5J40A 3E70C 1JXMA 1U8ZA 4IDQA 3RC8A 1P2TA 4WOPA 4ILEA 1BYUA 2IUTA 1XEFA 1W44A 1YR8A 2C5LA 4O0MA 4M4SA 4FMCF 4A8JB 2PLRA 4JT4A 3K8YA 5SZIA 3DM5A 2R6GA 4C9BA 1FZQA 1XCPA 3B1VA 3HJNA 1JB1A 2H18A 2QY9A 1VHLA 2A5GA 4I99A 3OIUA 4Q47A 1UBCA 1I2DA 3KQHA 1HURA 1X8KA 2AWNA 4PC1A 5KNDA 1IHUA 2OILA 2FN4A 2VHTA 2YNMA 3FMPB 1UBEA 4ASUD 2W6JD 4XWKA 1XMIA 5C18A 5EQTA 4H1VA 4O2RA 3WXMA 2RB4A 3D7MA 4HDOB 1DOAA 3B60A 2ASEA 3TE6A 3QKSB 2GBLC 2JLQA 2PL3A 3LLUA 1TUIA 2CE7A 4NBSA 1DAKA 1Q1ZA 4UJ5A 2V6JA 1XXHE 3BFXA 1N5KA 1D2MA 2D3WA 4PZLA 5B2ZA 3GJ0A 2R6FA 4Q1BA 2WWXA 3SJAA 1F6BA 3T06B 4LHYA 2VHJA 3KXLA 4GZMA 2EWWA 1YR6A 3W8RA 1SVLA 5JJKA 1VYVA 3A1UA 1NIJA 4DDVA 5KSZA 3TH5A 2UZ3A 4BFTA 4E5UA 3UMSA 3ICQB 2PCLA 1U0LA 4IW3B 2E9SA 5M04A 1GNQA 2MSEB 3ASZA 2GKSA 4LJYA 5CYPA 3TQCA 1OH5A 1HQCA 4MYHA 5KDDA 2WKRA 4MH0R 2RCNA 3IPYA 4B3DA 1UKVY 4M1KA 3B6EA 1E4YA 2B7CA 3NWJA 1SQ5A 1CTQA 1NSFA 2IYRA 2ZPTX 2XITA 2ZITA 4F4JA 1TMKA 1OH7A 3NDPA 2P67A 4OJQA 3TSZA 5EE5B 2QMUA 1EFRA 2Z4RA 1E2LA 3FHTA 1JECA 5EUQB 2JLXA 3KTAA 1P2SA 2X19A 5DHAA 3ECCA 3VNVA 1OKKA 1G20E 1G5TA 1GNRA 4PSKA 4PAOA 3GPLA 5TB5A 3B1ZA 4JBYA 2ZS7A 4QRHA 4HB0A 4I1VA 3IEUA 4JL6A 2D7DA 1TEXA 1Z6TA 3SNHA 1NY6A 3ZVMA 3GQBA 3J81k 4A92A 1Z6GA 4GL2A 1TPZA 4LOAA 1KSHA 3I5YA 4NCIA 1SHZA 2WV9A 4DWJA 3A8TA 2FDCA 2EW1A 1Z6YA 2BC9A 1N5IA 3PEUA 1S9HA 1VIAA 1ZNYA 2NMVA 4AI6A 4OJKA 1TQ6A 4EQ6A 2W0MA 1Z6XA 3FFAA 4I81A 1WBBA 4ABYA 4QBIA 4C30A 2P2LA 3EW9A 1B0UA 1E2JA 1ZCAA 1RRFA 1MO4A 2IF2A 1K8RA 1QVAA 3SJBA 3LNCA 4MYTA 2Q0HA 2DYKA 1OHHD 2ECKA 3EA5A 2VRWA 5FBVB 1P75A 4MYUA 3CF2A 5FTLA 3PFIA 3QF4A 3NG1A 1Z06A 3EC1A 2QAGC 5AJWA 4DIEA 1JJ7A 5JZVA 3FFBA 1ZU5A 4JL8A 5AJYA 4HSEA 3QOFA 4QM6A 4NCKA 2GDJA 1G6OA 2DFLA 1E6CA 3A36A 2G0NA 3TR5A 4TLBA 4JJKA 1LF0A 1SKQA 3QPWA 3OZXA 1UBGA 3DO6A 1SVMA 2J46A 1G64A 3RS4A 3AP1A 4FMDF 3A58B 1S96A 5J4KA 2VH5R 4UXIA 3CRW1 2A5JA 3CNNA 2H5EA 1OFIA 4AY2A 3HPQA 4IVQA 2C96A 1WF3A 4PXAA 5JWRA 2VP4A 4AYXA 1KYIA 3WBJA 3B5JA 4OQFA 5FOSA 4WVFA 3BK7A 3PR1A 1RJ9A 2P6NA 2ORWA 2QENA 5J5CA 3K0SA 1ODFA 4HDCA 5SZHB 4LHXA 1XEWY 2IS1A 2EFEB 2OUKA 2CHQA 4UNPA 2VP2A 3PEYA 4AKHA 3MRSA 1N6NA 2NGRA 1IY0A 2NO9A 3DVLA 5H70A 4UKDA 1IN7A 2O0HA 3T5DA 4M9QA 5FL7A 1E2IA 1M7HA 3T1OA 4EDHA 4YONB 4TZ6A 4FCTA 4GI7A 1Z22A 2ZJYA 1G16A 1R8SA 3GJ6A 5DE3A 4L15A 3W6OA 1YRAA 1CJMA 2G1JA 2GEVA 5LB2A 2JIZA 1KK3A 1KI4A 4CYMA 2FPMA 3EC2A 4PC2A 1PLLA 4TYNA 3U4QA 1N0UA 1JQLB 3PIRA 1W2GA 4DDUA 1E3MA 1G1MA 2HCBA 4A2PA 1QVRA 2HJGA 5EP1A 3KKQA 1R6BX 4TT3A 2ZE5A 2HT6A 1ONBA 3Q5EA 4D2IA 5FPSA 2W2XA 1E2DA 3I8SA 1I4TD 3I72A 4JLVA 2GVDC 3R7WB 1ZRHA 4KFRA 3VKWA 2XEXA 5FPHA 5FPTA 2P6UA 3UWOA 3VFDA 2Z6VA 2QMOA 3HDTA 3C4JA 3BH7A 3EZ6A 3Q3JB 3VTKA 3KQNA 1HE1C 2UZIR 3PVSA 2D2FA 1JQJC 1G3MA 2KI5A 1KIMA 2Q3MA 3GJ7A 1A2KC 3KFVA 2PT7A 3TUJC 4EJSC 1T6NA 2HV8A 3OE7A 1VCOA 3RHFA 3SJCA 1OXVA 2QI9C 8OHMA 2EYUA 4JLDA 2CLDX 1SZPA 1U8YA 2RGNC 1FNNA 1VIYA 1N6PA 4B35A 3B9QA 3KB2A 4LWZA 2A7QA 1ZVQA 2VHCA 3VU9B 3ZH9B 1SVIA 3IILA 3GEEA 4KVGA 4D26A 3SFZA 2YWHA 3I4LA 4ON9A 1LS6A 3NBXX 3U3KA 4BGDA 2I1QA 4MGYR 4GRAA 1DPFA 2WKPA 1E9RA 5LD2C 1KDPA 4NZYA 3EPHA 2I4IA 2ZJ8A 4ZDIA 2IX3A 1E9BA 1OT3A 2C9CA 2MMCA 4JVLA 4TYYA 2FPLA 2W6JA 3A4NA 4L4UA 5D3MB 2C03A 4MKIA 3QBTA 5FFMA 1JI0A 4IDPA 5HCNA 4G3XA 3IBGA 4XIGS 1OIWA 4ZKEA 3FVQA 5FR1A 3CBQA 2C04A 2F1RA 2A5FA 2RAPA 1UJ2A 1NJFA 1XZQA 5IT5A 3ZDQA 4CZ2A 1IN4A 4JVSB 3L0PA 4IOLA 3O8CA 1XX6A 3HR7A 3FMFA 5L3VA 2QSYA 2R62A 2QG6A 4MGZR 3TKLA 3ZD6A 2O8BA 4O25A 3L2OB 2QU8A 2ZRGA 4OBEA 1D9ZA 1YZTA 3SN6A 2FJUA 3U7FB 3EAQA 3KB1A 5G41A 4BEBA 2GNOA 2AFIE 1Z08A 2ZRJA 2CXXA 4Q1CA 5AJVB 4URVR 3GLIA 4BFZA 1SXJA 4LHVA 3NBZC 1W36C 1MO6A 3QPVA 5CJ2A 1HH4A 4A0HA 1KO8A 1KZGB 2ZAMA 4HUQA 4A82A 5C1BA 1XCMA 4KVAA 4RKFA 5DGXA 1XF9A 1R2QA 1ZM3A 2FG5A 3N2IA 4OKSA 4LI0A 4GPTA 5FUYA 5FTMA 1XJ0A 4RD1A 2XSZD 1HUQA 1DAHA 2WBLC 3C5CA 4RZ3A 1F60A 1W4RA 1Z28A 3NC1C 3B1WA 1P72A 1K5DA 3EIEA 1DARA 1OSNA 3EX7C 1E79D 2D06A 4P31A 3RNLA 1W0JD 1VCIA 1BYIA 3QNUA 1VG0B 4Q4JA 1FOEB 3QENA 3HPRA 5JS7A 2EYQA 2A3RA 1ZM2A 1R5BA 2A30A 4RD4A 3H0KA 4OK6A 5LB4A 4TMWA 1OFTA 2QP4A 2VP0A 3TUIC 3UANA 3GLGE 3BERA 2RHDA 5HTKA 1Z0FA 1H8HD 1UF9A 4JVNA 2OXCA 2KBFA 5KYKA 2GXQA 4RY2A 4KHZA 3V4FA 3ND8A 2ZR0A 2QSZA 2WJIA 2V6IA 3FMIA 1KY2A 5L3SB 2QE7D 2RMKA 3UWKA 3THWA 4QGFA 3HWSA 3P27A 3Q8XB 1IXZA 1J90A 1N0VC 3O8BA 4ZCLA 5EXXA 2XNDA 2YWFA 4NH0A 1R0WA 3QXJA 5CM9C 4URZR 3TIFA 2J7PA 1WB9A 5B58C 3MG9A 3LWNA 3TVDA 3CF0A 4Q1EA 4UQOA 1U2RA 1FMJA 1OHHA 3OHMA 2ZE8A 4D80A 2WWWA 4X8HA 4AYTA 1G8PA 2J0UA 1G8HA 3QVVA 5BW8A 2IYVA 3LXXA 4B6EA 5H68A 2RGCA 2OZEA 3W5JA 1Q1QA 1J8YF 5JMTA 2IYXA 2ZYTX 4CT5A 221PA 2ZREA 3O47A 3B85A 2ANBA 2BKUA 2OE2A 2QGNA 4PC7A 3B82A 1E1RA 4BUJA 4UJ3A 1QF9A 1F2UA 5KNBA 2GJSA 3AP3A 4MUAA 1QRAA 5FR2A 121PA 4F4IA 1C1YA 4YC7A 1OH8A 2WWGA 3CWZA 4II7A 2EFGA 2FSGA 2WMOB 1VECA 421PA 3RABA 1G41A 2JA1A 4FIDA 4A15A 5JJIA 1WE2A 3C7KA 1PVOA 2QBYB 2V3CC 1N5LA 3RS3A 3U44B 5E95A 4AIIA 4E07A 4EIWA 3TAHA 3KQKA 1OV4A 5DNYB 1U9IC 3KQUA 2A5YB 4FXPA 3THXB 2RGAA 1G5PA 1OF1A 2G1KA 4B33A 1E2PA 1ZD1A 1S2MA 2KBEA 3PITA 4BLPA 4DEYA 3DPUA 1VHTA 2RHMA 4TTQA 2NZ8A 1XU4A 3SC3A 3N70A 1RW4A 5L8VA 1LS1A 3IQWA 3SDZA 2P0EA 3NEYA 4JLJA 5H8WA 2PZGA 2ZR7A 3Q7PA 4PR0A 3MWYW 3AVTA 2GZAA 1ETUA 3CF6R 5F3WB 3DZDA 1M8PA 3TW8B 1A82A 2F1IA 2NPIA 1II0A 4BFWA 2WWYA 1XPOA 4NCNA 1E0JA 3BFVA 4AD8A 1US8A 2NIPA 2DHRA 1RRPA 1XB2A 5FOWA 3X1XA 4TYQA 3FE2A 4RZUA 2AN9A 3ND9A 5AR1A 3KX2A 4K8OA 1OE0A 4M1WA 3AKYA 3W6NA 3RSOA 1KKMA 5FUVA 3SHFA 2IYYA 3NC0C 4F93B 4ERNA 5IRCD 1KJZA 4IEEA 3BH0A 5TMPA 5F9FA 5BYJA 4DUGA 5FBWB 5DH9A 1EX6A 4B43A 2WJHA 2ZS8A 3MWLA 2H7VA 4MGKR 2BDTA 5BYKA 2W2VA 1C9KA 5JLJA 4EKDA 1BS1A 2CL7X 1I2MA 1XEWX 1DAMA 2ZE7A 4NYIR 3E5HA 1XMSA 4PAQA 1Q3HA 1W4BA 4PPQA 4Q9LA 3I62A 4TLCA 4W9MC 1ESMA 1GG2A 4BECA 1ZIPA 3BGWA 2GZDA 3CR8A 4XVQA 1DADA 3QSYA 1F48A 1CJKC 1E9FA 1KK2A 4DJTA 1AM4D 1OKKD 2OV2A 2IYWA 4PSAA 1XCGB 2J9RA 3FPAA 5TXGA 4LHZA 2ZI4A 1S0UA 1P3JA 2IYLD 1GRRA 1NLFA 2VLIA 3K0FA 4R2IA 4LDJA 5F9HA 2ZU6A 4MRPA 3GLGA 3VR4A 1CF4A 1Z0JA 4NYJR 4AURA 2KSQA 1VG8A 4Y0AA 2ORVA 3REFA 3PEWA 3D31A 2ZRKA 3PUWA 4XWAA 3HYRA 1GL7A 1N3BA 4CDGA 1Z3IX 2UVQA 3BOSA 2XAUA 2V54A 1E32A 2YHSA 4P3YA 4B3BA 2CVHA 5KDOA 4Q9JA 3A1VA 3EG5A 4Q1DA 2L0XA 1NJGA 1M74A 2DCUA 3JVUA 3JZAA 1W5SA 1XD2B 2BMJA 2EQBA 1LTQA 1YQTA 3L0SA 1M7BA 1CR2A 2R2AA 5AUOB 5EP4A 3ADCA 4NDZA 2RKOA 2QQ0A 1S4QA 3LBIA 2QL6A 2BJWA 3B9PA 3SFVA 1EG7A 3FDIA 4GOXA 3QVUA 2JATA 1Z47A 2IEZA 4OL0A 2GK7A 1A4RA 4JLOA 1XRJA 2OCPA 4ZI3A 1FTNA 4C0LA 4DDTA 4PO9A 1T8UA 4XVRA 2CK3A 2WWIA 1G6HA 1Q1BA 2QPAA 3DOFA 4RFSA 2BOVA 3DKPA 2ZSFA 4Q03A 4OHZA 1H8EA 2G88A 1NLZA 5E3HA 2IUSA 3CPEA 3L82B 3U3RA 3VR2A 3SE0A 1YZLA 2GXAA 1WRBA 4BPBA 3Q5DA 3TW4A 2F1HA 3P32A 2OAQ1 4LJ6A 2HT1A 2Q21A 4BZQA 1G7TA 4HAWA 4B48A 4R98A 4IRUB 4JLBA 2I1VB 4RCYA 4QGGA 1FNMA 1DVRA 5FL7D 1QHGA 2XSZA 4EFMA 3CZQA 5JWOA 1UKYA 4UNSA 1U99A 2ZRPA 4DVGA 4E22A 5BWMA 2PCJA 3CPJB 2WJJA 4A0GA 4HAVA 1AKEA 1W0JA 2BJVA 2XZPA 3KJEA 1QZXA 3SZRA 1CLUA 1CJUC 3AP2A 3HYTA 1ZD9A 1M6NA 1Q12A 3S1AB 2O8FA 1KOFA 4RZ2A 1XBTA 3BAFA 2ODWA 1FPMA 1IXSB 2WSSA 3H4MA 1E98A 4L16A 4C0JA 3ICEA 1KY3A 4H1UA 1ZJ6A 4RFVA 2GJ9A 2PBRA 3ADKA 3VAAA 1H8HA 3A1WA 5KPDA 1N6IA 1G7RA 5EE9A 3KKPA 3DL0A 3AM1A 4NE2A 4B32A 1FL9A 1FX0A 3UK6A 1OXTA 1KK0A 1MV5A 3K1JA 1S3GA 2ZRHA 5ELXA 1OYWA 1AQYA 3QY0A 2AL7A 3ETLA 3EIHA 1F3OA 4CEIA 4QJ5A 1RJ9B 2BBOA 4V0OA 4G1UC 2QM7A 3C14C 4LYAA 3GJ5A 2IYTA 1BIFA 3PUVA 4OK3A 1GAJA 5BN5A 2R6AA 3ZYCA 1P2UA 1U0HC 1CJVC 2DBYA 2JLZA 3KZ1E 2Q3HA 2GA8A 4NHOA 4POAA 2WTUA 2XB2A 5KTYA 4RZXA 2CL0X 2X2EA 3OIWA 2AX4A 5EZ6B 2ANCA 5FI1B 3WNCA 4O2LA 2CL6X 4QL3A 4KODA 1JJVA 2CEAA 4B2PA 1TUEA 1RYFA 1N6KA 4DLYA 2YOFA 3OESA 4M8NE 2BBWA 1E94E 2CHVA 2KJQA 2J0SA 2A78A 1XTJA 3BC1A 2OAP1 1MRSA 5HKKD 3GP8A 3C8UA 3CRMA 2HCJB 3KXIA 1I4LD 3LW7A 2BMFA 1GVNB 2IYUA 3RWMB 1ZNXA 3K09A 2BKEA 3VKHA 1R8QA 4KJZA 4L9SA 2ZRLA 3M1IA 2J0VA 3RLFA 2ZSDA 1JR3E 3AVQA 2ZS9A 4PQRA 4B73A 1NRJB 2XTZA 2W0SA 1IAQA 3SYNA 3FGNA 5DYGA 2OFWA 3CW2A 4WAUA 3R9XA 2FGJA 1JBKA 1HEIA 1T3LA 4M9XA 1NMXA 3RVBA 2DY1A 3EPLA 2PX3A 5AWFC 4Q4LA 3U6BA 3AVXA 4D81A 5CLQA 4LV8B 1KI8A 3RDPA 1RVDA 1ZYUA 4I1SA 3IQXA 4QG7A 1WXQA 3TLXA 2JJ2A 1IXRC 1L4UA 1E2HA 1W49A 5E7IA 2VYFA 4AKEA 2ZJBA 3WNDA 2JAQA 3FTQA 4LYHA 4AKIA 4A0FA 4Q9KA 4R9UC 1Q21A 3GLFA 1T9HA 4R7ZA 1OIXA 1FMLA 3CM0A 3QXXA 2D7CA 4G0NA 4EFLA 4CF7A 3EPJA 1TNDA 4DLUA 2GJAA 1SXJD 2IYZA 4D82A 4LSGA 2VSXA 2QPOA 1N6OA 1W4CA 3T34A 1YZUA 3ASYA 3GLHB 4TMTA 3TJZA 3K70D 2MMGA 2FF7A 4QJ3A 4PHHA 1UPTA 4B75A 4NU0A 1ZUNB 2YWEA 3CRVA 4D4KA 3GD7A 1MT0A 3NIBA 5FOUA 3W34A 1TQ2A 2B21A 4A8JC 1KI7A 3CO5A 3CB4A 3F8TA 4MA4A 2YKGA 3THOA 3K0CC 5G3YA 3TSWA 3LLMA 4M21A 3ZGXA 4QBGB 4W5WA 2MSCB 2J45A 4RJLA 4ARZA 2IWRA 3MD0A 2VTKA 3MJRA 2ZROA 2WIAA 4N0DA 1J99A 1P9RA 3JZMA 4MRNA 1CU1A 3I92A 3UG7A 3UKDA 1SULA 2B92A 3CPHA 5CDFA 2FMXA 3U6KA 4LJAA 5JWHA 2D4HA 4M1MA 1G21E 4DCNA 3UG6A 1V5WA 2VPPA 5KNCA 3EZ9A 2ZJZA 4W7SA 3GLIB 5L3QA 4V0MA 4XSGA 1XWIA 1GOTA 4AYWA 4CRWB 2Q9BA 1AZSC 2XNDD 4Z1MA 3CWQA 5FOXA 2J7PD 2QAJA 4HUQB 1I4DD 4BLTA 2BVNA 1WBDA 2QN6A 3TAUA 3QIAA 4HUTA 1A7JA 3AGQA 1Q22A 1XEXA 4BEJA 4FWTA 1OB2A 2NQ2C 2P65A 3IIJA 4LBZA 4GSYA 2GJ8A 1CKEA 3GLHE 3IBYA 4B2IA 2DFKB 3CX6A 1PJRA 3VQTA 1FFHA 4HAXA 2IUUA 3RRZA 2FZLA 4LUCA 3WMGA 4Z54A 1E1RD 1VCMA 4A36A 3U2QA 1KI6A 1G4AE 4DHEA 2VEDA 2K5UA 4XTRA 3MLEA 2DPXA 4EPVA 1G17A 2OG2A 2JGNA 3NTUA 1T3SA 1CEEA 1NBME 3WYGA 4EPTA 1TF2A 1OH6A 4PPGA 2QRZA 4F92B 4Q02A 3D6TB 3ZZ0A 3QEOA 4P0TA 2GHIA 2PLFA 4BFXA 3VR3A 4ESVA 4D6PA 3HR8A 3THWB 3QE0A 4ZV4A 1COWA 2QNRA 2ZYWX 4MITA 1IOZA 3M4YA 3PEVA 4G5GA 4QHSA 2GBLA 5JJLA 4V0NA 3HP1A 2E1RA 2YC4C 5J4HA 4DB4A 1R0YA 2R9VA 4JJZA 3VHLB 4JLNA 2WZQA 1NIPA 4KU4A 4WZAE 5CYOA 1YZGA 2WICA 5HE9A 5LBIA 4C0KA 5SZKB 4BLOA 2ZJOA 3AVYA 3HU2A 4KXFB 1ZUIA 1RPZA 4LX0A 3EASA 4YDHB 1XXHA 1NKTA 4HB4A 1YR7A 2IYSA 3SR0A 2LKCA 1JNYA 4L5BA 4BFYA 1ZAKA 2AWOA 4NKRA 2WOJA 4IFEA 5GJWC 1YE8A 4IDHA 1NVVR 1Z0KA 2ZRCA 1GTVA 5FTJA 5G3ZA 1W36D 1B23P 3NH9A 1M1YE 2DB3A 1F2UB 3I61A 1NP6A 4Z8XA 3SEAA 4GMXA 4JKIA 3WNBA 1IM2A 4OHYA 3FKQA 3WYFA 1LF5A 1U81A 1ZC4A 2PEZA 2GTPA 4HLUC 4KFUA 1X3SA 4WZ6A 2CJWB 4DUGD 2VBCA 3AKCA 4D4JA 3MWKA 4S35A 2PJRA 5JSZA 5TV2A 1HYQA 1R5NA 3K0CA 2Q9CA 5JBQA 2ZAOA 4F91B 1JALA 1FP7A 5DLQC 4CW7A 3U5ZB 4HB2A 1NKSA 1W0KA 2O8CA 2FPKA 1KI3A 1NG9A 3EPKA 1ZU4A 3W9YA 2C2HA 3W3ZB 2QGZA 4YMUA 1T3HA 3PENA 1G291 4BZXA 1RRCA 4RCZA 3QXHA 3ZVRA 1KK1A 2C77A 1CULC 2MSDB 4EFNA 4OI0A 2C9YA 1X6VA 5JEDA 2YYZA 1IN6A 5J47A 2PJZA 1P7CA 3OIYA 4Z8YA 2F43A 1Z6AA 1US8B 4R2HA 2VA8A 3RS0A 2J0QA 4NYIQ 3Q9LA 2ZI9A 3UMRA 5HKKA 3QI2A 3TMKA 4HZUA 1DAFA 4Q7KA 3T1QA 4HATA 2AR7A 1X1RA 4LBWA 1E9AA 2F3RA 5JHHB 1CR4A 3U3OA 1SVWA 2XXAB 4XH9B 1D8TA 3C15C 2IA5A 2YZ2A 3WY9A 4C2TA 1Z83A 2QAGA 1Y3AA 4KBFA 2KWIA 3KUCA 4Q9HA 4NYJQ 2YOGA 1QHSA 2V7QD 4TLAA 5CIWA 4DC9A 1HT1E 1DAEA 2H8KA 4M1OA 2ZI7A 5IF9A 3QXCA 2OO7A 4BLRA 2CK3D 3C16C 1KO4A 4B34A 3H1TA 3KL4A 1Z29A 3LVRE 4B6FA 1J70A 2CLSA 3BS4A 1H8ED 3T61A 3T1TA 4C0BA 1JPJA 3QBVA 1KO7A 1XMVA 2ZEJA 3W5IA 4C4PA 5KPJA 1BMFD 4HAUA 2IXFA 3K9LA 4M0LA 4MDEA 4P4SB 5CITA 2OXRA 1GUAA 1TL7C 4JSTA 4C3ZA 2QQEA 4XWOA 1AJEA 1OW3B 3DEFA 4MKHA 3KFXA 4LV6A 4KLNA 1N6RA 2O52A 4YQFA 5KHOC 4W5HA 3A4MA 2XB4A 4B2LA 1GP2A 4GOKA 3IO3A 1A1VA 1Q0UA 1JEDA 1Q44A 5UKDA 2IS2A 3ZIAA 4C0SA 3LBNA 3Q7QA 3W3AA 1KJWA 1WQ1R 2X8AA 3LFUA 2FZ4A 3NXSA 4R71A 3NDBB 1OLOA 2WSSD 2VSFA 3RAPR 4DSUA 1VCNA 2ZYUX 4TQ9A 1UEJA 4G5RA 2QA5A 4PC6A 5FPYA 4ACAA 2A9KA 1KSJA 3X2SA 3IO5A 1X8JA 1P2VA 1EESA 3QKTA 4D0GA 5G53C 4HLUA 2G6BA 2N42A 4A0RA 1XD8A 4RFSB 5EXSA 2VHUA 4KFSA 4Q48A 4MDFA 3RANA 2WJVA 2J1LA 2O5VA 1UEIA 2B7BA 1E9EA 3H84A 2BIFA 1G18A 2EU8A 4NL4H 4LHWA 1F2TB 1CS4C 2OCAA 2BEKA 3U7EB 4NYMR 2UKDA 2BM0A 4EJSA 4Q4AB 4ITRC 3L0IB 4OQXA 1T91A 1T5IA 4JYCA 2ZE6A 2G9NA 2H17A 4QHTA 1YZNA 1IJFA 1TEVA 1Z07A 2EFDB 3ZS9A 4K81B 4YDSA 3FMOB 2GZHA 1Q1EA 2W83A 2RGNA 5FUXA 1IN5A 2ZRNA 1II8A 2HF9A 2OCYC 1DO2A 4PANA 2NO1A 3LBHA 4DSOA 1Z2CA 2V4ZA 5P21A 2NO7A 4KYIB 2WVJA 3KDSE 4ZO4A 4QNMA 4QBHA 1IQPA 2GK6A 1P73A 2O8FB 1PUJA 4TMZA 2QMEA 4QBFA 2WJYA 2VIIA 4URUR 4ZI2A 5FBLB 1BOFA 4JIMA 4LRWA 2J7KA 4FD2A 4ACBA 4M9ZA 3R8FA 1CRPA 3VHXA 1FX0B 2IT1A 3B1XA 3QG5A 4JL5A 2HEIA 4V03A 3FB4A 4QNRA 3DM9B 5AUNB 4A2WA 1Z0DA 2VP9A 4BASA 3SYLA 4D25A 1X1SA 1GFIA 4CEIB 3VR1A 2HLDA 1E0SA 2AKAB 3EZ2A 3PG5A 1IONA 4A6XA 1BO6A 1W47A 2C8VA 3AKDA 5CM8B 4ZDJA 1EWRA 2WWHA 4TSFD 3V9PA 4XVUA 3LO5A 1ZM7A 1RRGA 2JJ2D 4TL6A 2ATVA 1G19A 3PQCA 1E1QA 5A0FA 1XZPA 3MGCA 2FEMA 1YZKA 3V00A 2QZ4A 2Q6TA 3TVTA 5JEEA 1DE0A 2X77A 4C7OA 4NCHA 5HCIA 2AHOA 3BH6A 3U7GA 5K8TA 5DHFA 1MABA 1LY1A 1FW6A 3T12A 5SZJA 3NH6A 2PT5A 2QTHA 5KUTA 3BJIC 2J41A 2VHQA 3P26A 4PO1A 4U5XA 1GDDA 3PCRB 3GFOA 4IOKA 2G77B 2XJ9A 3DKVA 1OXXK 3CONA 4UXJA 4JYBA 2ZI6A 3QPUA 3R8CA 1SVKA 3A4LA 1K6MA 1CR1A 1MO3A 5DO9A 4Z51A 1E2NA 1XTQA 2GVZC 3VU9A 1C4OA 2DR3A 5K8UA 2XZLA 1JR6A 3K0EA 3NHAA 4MUBA 4NP6A 2XZOA 2ZANA 1RFLA 4U02A 2NPFA 2ZM5A 1KZ7B 1EWQA 2CCGA 3FOZA 1II9A 2W6IA 2WIBA 5H1YA 4MKGA 4D0NA 5DI9A 5TY0A 2GCPA 1RZ3A 3REGA 3U3JA 4C0QC 1KMQA 1YVDA 4BFUA 5D3MA 1XTKA 4GBMA 5EXTA 3RRNA 1M2OB 2XTNA 3U60B 4Y0VA 4H9GA 2QT0A 3ADBA 4B71A 4IVPA 1Q57A 3H2YA 3H86A 1E0KA 1AN0A 2D62A 2WHXA 1YRBA 3LXRA 1NVXQ 4LZZA 1XPUA 3BXZA 3U3MA 2ZYVX 1T0JB 1Q3TA 3RRMA 4ZIRA 3IUYA 2J87A 4Z1MD 4URWR 1VPLA 1H65A 3SU8A 3KKOA 2ZTSA 3A1TA 3IHWA 3MCAA 2FX3A 4IOJA 4YLGA 2AXPA 2Z5FA 4V0LA 2FU5C 4LJ8A 3JVVA 4MGIR 4M22A 2FFHA 1PLJA 3CRRA 5GJVC 5JI3E 2JJ8A 4IJMA 2E87A 3AF0A 3ZQ6A 2V7QA 5GVSA 1KSFX 5EUMA 3CIOA 2P5TB 4RD2A 1N25A 3SQWA 2ONKA 2RGEA 1LNZA 3KTAB 3AUXA 3FHOA 4RVCA 4DDWA 2O8EA 5DIFA 1XDBA 2AXNA 4DB2A 1WP9A 1Y63A 1R5OA 2DWQA 2IWHA 2G83A 4ARZB 1MRNA 2GF0A 1AS0A 2WPDD 3PJRA 2IEYA 3GCGA 3KJHA 3L43A 3QF7A 4S2EA 4KI0A 5FI0B 1KNXA 4HAZA 2GCOA 3X1YA 1VTKA 1L8QA 5B64A 3MSXA 1NL3A 1VYTA 1BMFA 1U9IA 1D2NA 1NSTA 3P20A 3W90A 1D2EA 2V8OA 4GP6A 3ZVLA 3BB4A 5JECA 1KKLA 4TLEA 4ZKDA 1COWD 1XMJA 1WMSA 3NKVA 4EQ6B 3VR6A 5GJBA 1AS2A 2R8RA 4ESHA 4QOSA 1G3IA 4QGAA 4YMTA 1VG9B 5TVKA 4LCBA 2OBMA 3BIFA 4LY6A 1NF3A 4FMCB 4JMPA 3AQ4A 3NHBA 2D74A 1JAHA 2FSHA 1XEXB 4DXAA 1DAIA 5ANRB 4DZZA 2FFQA 3BD9A 4W5JA 2ODNA 5BN4A 3F3YA 1YZQA 2GRJA 2NTYC 2RGGA 2WM9B 2FGKA 4ZPXA 3QF4B 3M0EA 5AUPB 5DN6D 4GMDA 2JCSA 2OLKA 2GETA 2O0KA 1UKEA 5CK5A 1GZSA 1J7KA 4HYYA 3EIQA 1NI3A 5KOYA 4TMVA 1ZIOA 2N1BA 4C0AC 5KO2A 1XTSA 3CKLA 1TAGA 3QJYA 2QRNA 5DI3A 1NN3A 4M53A 1KI6B 1AK2A 3AF1A 1E2MA 2KE5A 4JLKA 3EZFA 1NG1A 1CP2A 4Q00A 1GITA 4L8GA 5KSOA 1P6XA 2XTMA 2V55B 2J59A 3ZLJA 1G3RA 2NZJA 4P4TA 4A4DA 3RS7A 1NNEA 1G8YA 4N1AA 2BCGY 1G8FA 1ZW6A 2LKDA 4CVNA 3G5UA 1Z63A 1NN5A 3CNLA 2BMDA 1Q20A 1XP8A 5DYIA 4BFSA 2WMNB 1W0KD 2DWPA 5KU1A 5DISB 2O8DA 1NVVQ 1IJEA 4Q7JB 1YKSA 3EWAA 4UNQA 3UMFA 1U8AA 4MQBA 3AVWA 3AVOA 4J0QA 2ZUCA 3U44A 1DS6A 3DMNA 3DMDA 3QKRA 4JKYA 3AVVA 1M7GA 4A6PA 1A5TA 2QROA 4YMWA 3GJ8A 1SKYB 2WAXA 5K8LA 2DFNA 4C2UA 3HU3A 4MRSA 3RYTC 3FKSD 3K0AA 5CB6A 2EVWX 621PA 3U4QB 2JLSA 4M1SA 3FWYA 3C5HA 5GVRA 2F1JA 2JJ1D 2ZSBA 4QM7A 3WBKA 4OHVA 3PV0A 2NG1A 1GKYA 5FOTA 4M1TA 2P3SA 2TMKA 4MRRA 3RSLA 1HE8B 3G0HA 2OHFA 4IOMA 4RD6A 3L8ZA 1OXUA 2JDIA 1OIVA 4KYUA 1XJCA 1GRNA 4WW0A 5JSZB 3LW8A 3UPUA 1E2FA 3LV8A 4PPFA 4WIAA 1XJQA 2CMKA 1XTRA 2V1UA 4JBWA 2FWRA 5F2EA 2O8CB 3CX8A 2IK8A 4PHFA 4ZDKA 3EWSA 4PQFA 3OAAA 2B8WA 2CE2X 4TSFA 1KSGA 3AF4A 3LX8A 1G8GA 4BZPA 3QUSA 4IEIA 1SGWA 3AV0B 4TN1A 3A6PC 1NY5A 2BMEA 5FTKA 1S1MA 3I73A 1Z8FA 4Q1FA 5J4VA 4LYJA 3U61B 1RIFA 4X8MA 2GF9A 3UATA 2ZI5A 1VKJA 5EE3A 4GOJA 3Q85A 1TADA 2F43B 1NBMD 3WMEA 4P32A 3WP0A 4N3NA 5JFGA 1UFQA 2JEOA 1R7RA 4HZUB 3KJGA 1W2HA 2Z4SA 4WXPA 4V02A 5EE0A 3IDQA 4GDFA 1SKYE 1G4UR 1RC8A 1CRQA 2H1LA 4LBVA 4RD3A 4DEXA 2ZSEA 1XPRA 1HQYE 5B30A 4BLQA 2QMHA 4XSHA 2CBZA 1K5GA 3PXGA 1Z2AA 2QAGB 4K46A 1DBSA 5TDHA 3R9WA 4U7DA 2QP3A 3A37A 2ATXA 4KSBA 1FQJA 3ZIAD 3IPXA 4FMDB 3VX3A 5GADl 1CXZA 5EP3A 4DLXA 2AK3A 5HR5A 2A5DA 2G0TA 3CNOA 4CT4B 1M34E 4NONA 1NMYA 5JI2E 1ZCBA 1DELA 3T35A 4F4CA 2YWGA 3MUFA 3ONWA 4PHTA 4HDQB 1ZBDA 1FP6A 1GKUB 1XD2A 3DOEA 4HZIA 3RWOA 1VYUA 1E2EA 1TX4B 1GKIA 1T8TA 1TU4A 3SQXA 5HE8A 1QHXA 1KDOA 3C41J 2OFOA 2QUZA 4QHYA 3THYA 2O8BB 3WMFA 4G01B 2HXYA 4TL7A 3B78A 3TRFA 1OXSC 4LV5B 3SHWA 2VO1A 4LC0A 3KJIA 3WP1B 3D8BA 1SXJB 4IDNA 4TTRA 1LB1B 1ESNA 4OYHA 1UBFA 1D9XA 4EUNA 5CB8A 2Z43A 3OF5A 1ZNZA 4B3CA 1WCV1 2ODEA 2ZR9A 4URXR 3K70B 2GAAA 2XOKA 3KXKA 1KI9A 2BHRA 4GFDA 1NN0A 3TGPA 2IS4A 2WWFA 1R0ZA 4US0R 2P5SA 4US1R 4DSTA 4LJ4A 2CCKA 2GAOA 1E96A 4O3MA 1TU3A 4PSVA 4F38A 5E7JA 1E9CA 4DCTA 5CJPA 5J4YA 2VP6A 5LDDC 4PO8A 4EPWA 4Q4JB 4LC1A 4DCUA 1E99A 3N2EA 4FI3C 2HYIC 4DSNA 4DT1A 3UIEA 3BFKA 1KO1A 4UNRA 3M6AA 4BWYA 4NYMQ 3WRXC 1IY2A 1U0JA 2WPDA 4CEJA 2IF0A 1W1WA 1KGDA 1NVUQ 3CH4B 4NCJA 5EP2A 4YXWA 4EPXA 1VDZA 1OPXA 3NBFA 4JBXA 3LD9A 1TQ4A 4LBYA 1J2JA 3NEJA 4CEHA 2C99A 3S1AA 3B7GA 1JR3A 3BWDD 4G5OA 5E7MA 4BFVA 2YINC 3E2IA 1QHHA 1S1CA 1U94A 1YJ5A 2HLDD 2J5XA 5AJZA 1VG1A 1OFUX 3F5FA 4EJSB 4DCSA 1FQKA 2CNWD 2HDNB 4LK2A 4I1OA 4Q1AA 1E2QA 1VMAA 5E4FA 3L8YA 2WAYA 3GLIE 2ZVPX 4FCWA 2J0UB 1GRQA 1SXJE 2REXB 5FTNA 5IK2D 4MKFA 1II8B 2ZETA 1LFDB 1T5LA 2CCJA 3NBYC 1E1QD 4KSCA 5DN6A 3EXAA 2IHYA 1KAGA 2XX3A 3AEZA 3K53A 3ZZUA 2A2ZA 1S8FA 2PX0A 2IW3A 1IY1A 1JXOA 3GMTA 1SXJC 1ZP6A 2ZRBA 2ZRAA 4OI2A 4OI4A 5EZ5A 5A5GA 1ANKA 1JPNA 1KMHA 4JS0A 1V43A 1W48A 2VL7A 4OQLA 1G3UA 3K70C 4Q4HA 1KHTA 3OFND 1W4AA 3GJ3A 2R65A 5LD2B 3GFTA 2XGJA 1P61B 2OEPA 3LRPA 3K9HA 3X1ZA 2I3BA 2X1VA 1YHNA 4A8JA 3O8RA 5IDVA 2PMKA 1T0HB 3N5CA 2Q9AA 3T5GA 4D4LA 2B8TA 2R44A 4JVMA 2Z83A 5K8IA 1N6HA 1EFHA 2F3TA 2W6ID 1HT2E 1TTTA 4A1FA 1T4GA 1PLKA 2HJVA 4RSGA 2QM8A 1XNJA 2AK2A 4XD7A 3R20A 4TMKA 1DO0A 1W5TA 4M1YA 1P5ZB 1O87A 2C98A 1N0WA 1XD9A 4A2QA 2JLYA 4OI1A 4FW9A 4KLZA 2FV8A 3SJZA 1WDTA 2IXEA 4C7OB 4MYCA 5KSPA 3B2EA 3MJHA 3NVAA 3FKSA 4Q66C 3OEHA 3ZQJA 5FPKA 1MABB 3QKSA 1AGRA 1W36B 4D4MA 2KB0A 3LY5A 2FFBA 2JJ1A 2RGXA 3HU1A 1EFUA 2C9OA 4N0EA 2AD1A 1NN1A 1R0XA 1DAGA 4IKEA 1EK0A 1L4YA 3U7HB 1G7SA 2OFXA 1BH2A 1UDXA 4KFTA 1N2CE 4IFBA 4LPKA 1ZMXA 4XOIA 1CBUA 1CIPA 5KSYA 2OM2A 1DG3A 1DG1G 2PEYA 3LH5A 2OCBA 3X1DA 4WZBE 1Z5ZA 1KI1A 3VX4A 5C2JB 3ADDA 4V0KA 5AK0A 2VQSA 2JLRA 3LQQA 1L7VC 3TQFA 3OEED 1E2GA 2QORA 3GJ4A 4PZZA 5J4LA 3AKEA 3OIVA 2F9LA 5BXQC 3VNUA 3BB3A 3SS8A 3GLHA 2WOOA 3TNFA 4LJ5A 4PHGA 3RRYA 1GSIA 4GP7A 1GIAA 1AZTA 4Q9IA 1MOZA 3SI7A 4BLSA 5HPYB 1GM5A 2GXUA 2GJKA 4ASUA 3K0FB 3MMPA 1X86B 1ZINA 2D2EA 3CLVA 4JLPA 4NTZA 3SBEA 3GLGB 3PUYA 1QG2A 4AG5A 1D6JA 4US2R 5JRZA 5LPNA 4P4UA 4GNKA 2ZRMA 2YVUA 2BBTA 2HF8A 1NBMA 4PX9A 4KV9A 3A1SA 5CIQA 1XTIA 1KI2A 2ZIAA 1IBRA 2J3EA 721PA 2ZU0C 1UADA 2OBLA 4ZIRB 2JLUA 5F98A 3CZPA 3WHLA 4UNNA 1F5NA 5FBQB 2FEOA 2ZXUA 1HV8A 2FSFA 2FSIA 3QEJA 4URYR 1PUIA 3QKUA 3BE4A 4IHQA 5D3QA 5EJEA 4P33A 5FL3A 2W58A 1LW7A 1OYYA 1HY3A 1DTSA 3O8DA 4HI0E 1JAIA 2JASA 1CJTC 4IXMA 2Q3FA 1GWNA 3Q72A 4NPHA 5BQ5A 3E1SA 2LWIA 2OESA 3ZJYA 3GEIA 4M2LA 1GL6A 3WRYC 1EFCA 4RKEA 2RGDA 4KBGA 1KTVA 2V1XA 4OHXA 4PQYA 4WA7A 4WBSA 1G3QA 2OSBA 1KO5A 4TZ0A 5AUQA 1ELOA 1PZNA 2VF7A 3FYHA 4GT1A 3VR5A 4F7WA 4BRWA 2CDNA 2GCOB 3KKMA 4YMSA 4A9AA 1TQDA 1GL9B 4FMBB 1TF7A 4DLTA 2QPTA 2ERXA 2Z0MA 1S9DA 2HYDA 1ZM4A 3LDAA 4HEJA 1P9NA 4JLMA 2FOLA 4EAQA 3RC3A 4TL9A 4HAYA 2BBSA 4FCVA 2QP9X 2VSOA 2AD5A 2VF8A 1LV7A 2DFTA 2FNAA 2W00A 4DLRA 3KUDA 1P60A 3K9NA 1ZM9A 1QHIA 2EWVA 1UAAA 3KKNA 4QC2A 3AB3A 3AVUA 1SHKA 4LJ9A 4B3FX 2ZRIA 4Q7MB 2OT3B 4TYWA 5JCZA 2IS6A 2ZUBA 1OFHA 2QEQA 1R10A 2BCJQ 1GILA 4I4LA 1EFTA 4TQUS 2ZVQX 4KITB 3BB1A 5JHGB 4PAMA 2IBMA 2AKYA 1BKDR 2DWOA 3GJXC 2YOHA 5DI3B 4D0LB 2P6RA 3IHLA 4KAXA 2ZRDA 3K9GA 4B44A 1MKYA 2HUPA 1QDEA 4MRVA 1RKBA 4OQMA 3CUEF 2LCFA 2GWHA 2NO6A 5A4JA 2XJ4A 2AFHE 3I1FA 3LX5A 2CVFA 2JDID 4Q5IA 3X1WA 2ZJAA 4XTCS 6Q21A 2FFAA 2PMDA 2GEDA 2ZUDA 4AC9A 4JSYA 2SHKA 4UXHA 2CNWA 4DRZA 2F9MA 2OLJA 3LQRA 4LGMA 3G82C 2O8DB 3MFYA 1IN8A 3SOPA 3AVPA 4E03A 1FUUA 3R7WA 3OAAD 4QXAA 1ZC3A 3F0TA 5IK2A 2CJWA 1RYHA 5CK4A 5FUWA 4Q21A 1R4AA 4TTPA 5KDLA 4HB3A 4LYFA 1EX7A 4B76A 1NMZA 1E2KA 4FWIB 3QKRB 1QHNA 4LPSA 2FE4A 2CHGA 1YR9A 3P4XA 4KCGA 3TR0A 3LA6A 1G5RA 1MO5A 2BEJA 1O3YA 4QGHA 1KDRA 3K0AB 2BV3A 3OFNA 4CIDA 4OK5A 4AK9A 5HZKA 1N6LA 3AGPA 1AS3A 4JT2A 1AQUA 3ZVNA 3ZD7A 3CRQA 2F6RA 2N46A 2PZFA 1ZD8A 4IDOA 4GZLA 1A2BA 4CGZA 3MWJA 5L3RA 4PFSA 2EFCB 2VP5A 4PPNA 3L0OA 5C4MA 5C4GB 3TK1A 4ZDWA 3I5XA 4FN5A 2ONJA 1U90A 3W8NA 4G5SA 2OBNA 2RH5A 4C0HA 2FH5B 3EZ7A 5BN3A 4EPRA 2XXAA 1ZNWA 1L2TA 5JRJA 3CR7A 4WXRA 5DSZA 1HTWA 1X8LA 4TWZA 1P62B 3I8XA 2GEUA 2B6HA 3DHWC 1OB5A 2WKQA 2R6DA 3BRWD 4Q19A 3GLFB 2ZI3A 1EFRD 3PUXA 1KNQA 521PA 1SVSA 1FUKA 4AKGA 3ZS8A 5B57C 1LVGA 2YV5A 2WJGA 2CLCX 2NO0A 1UKZA 2C78A 4HLDA 4X8LA 4AWXA 3AUYA 2ERYA
chains in the Genus database with same CATH superfamily
1HRDA 1SUWA 4OA5A 2B1JA 4DIDA 3TBKA 2XOKD 3M4XA 1KP2A 3TQRA 1WD7A 2OQRA 5C5CA 2WKSA 3CH5A 5FA8A 3K2QA 5HWSA 5I9LA 2OHGA 3AM4A 5DLPA 5SYMA 3C3KA 5JVDB 2BFAA 2W2PA 3IIKA 4KG7A 4RDHA 3EA0A 4ZARA 1Q14A 3NATA 4P4SA 1J39A 3MWEA 4QQKA 4KXXA 5DF1A 4AG6A 4BQSA 5I45A 4I1UA 5KNDH 4KAJA 2BYTA 3W2FA 1YIAA 1E1CB 1YZHA 2W2LA 3VMFA 1VC2A 2XKAA 2ET6A 3LBAA 4TKUA 4U0JA 3VPFA 1NV8A 4DIFA 2AC7A 3O1LA 1DBIA 2J6IA 1T1SA 3DZ8A 3PQ4A 4RHUA 2IYQA 2EDCA 3K09C 3Q41A 1J5PA 4KO8A 4UTVA 1J0EA 1AXRA 1TMOA 1TF5A 1ITZA 2FMIA 4YRKA 2RJ3A 3SBDA 4RTMA 2QTFA 1U8FO 2IYEA 3P9QA 2GILA 2OZKA 3FN4A 3FJYA 3IIMA 2MIIA 3IESA 4P6VF 3BXFA 3L1KA 1ZNQO 4Q01A 3GUUA 1E3TA 2GCNA 1Z0AA 4MGEA 4WESB 2KQUA 1GPWB 3UOWA 1NQWA 1PS8A 3W5VA 3WQHA 2D8MA 4X44A 2YC2C 4YALA 2NXJA 3T3IA 4W8HA 3WYAA 1D0VA 4PYQA 5IHPA 2IC5A 5TE9A 1OBHA 2SCUA 4E6EA 5C46F 4TV8B 2LBPA 1P6QA 2PFGA 2RGYA 4XDGA 4D57A 2OOKA 1HL3A 5KYUA 1CUAA 1L3CA 3KWMA 2W93A 4MJ7A 3F46A 3TCKA 3EVCA 2V9PA 1YA6A 3CF4G 2HO4A 4B17A 5FX2A 3INTA 3ZI7A 5JS8A 4WGFA 2Z56A 3OURA 3RROA 1SOAA 1JG6A 1J9EA 2BM1A 2FPIA 3VKFA 3QE3A 3OOSA 1K3FA 3P8ZA 3EUWA 5AK3A 2XWSA 4IPTA 4JT9A 4PTLA 4JEIA 3T52A 4ENWA 3RS5A 4ZCMA 3KQLA 3CR3C 4QELA 4TYPA 1OA0A 3X1KA 5CYGA 1GNPA 2GPAA 2NXNA 3T9BA 1ZQ9A 2CLKB 1DQYA 3BWBA 3LX4A 1RYYA 2P0YA 4ZTZB 1E0AA 3BJZA 1RXUA 4FKBA 4R8MA 4MV0A 4L51A 2IYOA 4YUVA 2O0JA 3AI1A 3S3TA 4CEJB 2H0RA 1R4NB 1SCJA 5BV7A 3OA0A 4PC3A 4FBMA 1H2RS 1ICEA 4Z99A 4BU0A 4B0PA 2ZQ5A 3ETGA 4XX1A 3T41A 2PH1A 5LKRA 2EFHB 4NICA 4EB3A 3OCZA 3PBKA 1EXMA 2IBTA 3IEVA 1E79A 2IEBA 3IKJA 2E4WA 4WT7A 1N7HA 5EXPA 3S8MA 2R00A 2IHBA 1FE8A 4DQKA 5DTEA 1C30A 4MVCA 4WL0A 5EHIA 3IRVA 1CVLA 5EC8A 1AIPA 2FR0A 4N5IX 5IKOA 3IT0A 1SC1A 3E82A 3LPDA 4FJ2A 5DXAA 2EWMA 3UJ3X 3VTZA 4DLSA 1QHHB 2HRZA 4FBLA 1H1LA 1UDWA 4G6ZA 4NXMB 2QTVB 4FYXA 4N5LA 1OQAA 1AGPA 2Q3JA 4E5SA 5CDFE 3U5TA 1RQLA 1Y7LA 4TT3D 4BWGA 2K2QB 1M6YA 1GU1A 1PGPA 4DA0A 3WICA 3LVQE 4B4OA 3CX3A 5T4EA 2M6KA 2EW2A 3VSAA 4G65A 5AM5A 1QXSA 1YRQA 4F71A 3F96A 4KGVA 4MAAA 1E9DA 2GYYA 3EOBI 3MUEA 4XD7D 4MQEB 4JQYA 4OQNA 2EHDA 3NJ8A 4MI6A 3UMBA 4UC0A 1EGAA 3A70A 3C74A 1VHDA 1WKVA 2WUDA 1NPTO 2YWBA 4JC5A 1A04A 4QLAA 4BNGA 3UXMA 4EYGA 3GRYA 1GA6A 5G40A 2IXGA 5ITZA 4G5QA 2EFJA 4J7XA 4E2FA 1SH7A 3FSGD 4XJXA 1KMHB 2GZRA 4C14A 1OTXA 3ZG6A 3OM1A 3CX7A 5FH9A 1PNOA 2Y8EA 3K20A 1HKHA 3CEHA 3IHTA 2Z1NA 4DKJA 1Q1GA 3AW9A 4MRMB 5CB4F 3RC8A 5ALIA 1P2TA 4P53A 4WOPA 2YASA 4LC9A 4NOJA 5E6UA 4J0KA 4X54A 2D00A 3TW8A 1BYUA 4GUDA 3OQMA 1E1LA 1YR8A 2IUTA 5B2EA 4IR7A 3BVPA 1NC3A 4M4SA 3U3XA 3WMXA 1B4DA 3MINB 2ZUTA 1EVEA 1JTFA 2Q5CA 5SZIA 3VX3A 3CVJA 3R5FA 4DR4B 1GGJA 1S2OA 1WZUA 3BXEA 3SD7A 3TB4A 1XHLA 1O57A 2XLCA 5TVGA 5H0IA 1NASA 3DAGA 3SLKA 5JZSA 2RK6A 2XYPA 4LTMA 2CBXA 4I99A 3OIUA 4Q47A 1UBCA 2FRDC 1WEKA 4RKWA 1ZGBA 1PG2A 1ZSNA 3JPYA 3D4NA 4HVCA 4XFKA 1UZNA 2FN4A 2VHTA 3FMPB 4S1PA 4WKOA 5JJBA 5L40A 4ASUD 2G8LA 2W6JD 3HKDB 2HK7A 3I9LA 2D5LA 4X6UA 2EG9A 3MF4A 9MHTA 5A7GA 5C18A 4PGMA 4P92A 4TM7A 4J8PA 3L6BA 4H1VA 5EQTA 5CXQA 3ZW8A 5AVOA 2UZ1A 3VJMA 3AIMA 5HZGA 5IAGA 3N2GA 1MCZA 3QLUA 3ORSA 2BTOA 1JQ5A 2X9LA 3L8GA 3QVGA 1M10A 2N0SA 4GRIA 4C6SA 2GBLC 2JLQA 2PL3A 4N47A 3MRVA 1T9BA 2RI6A 1Q1ZA 4BAUA 3TLGB 4TMYA 3OQPA 5EZQA 1KEEA 3EGDA 3JQFC 4E15A 2V6JA 1YKFA 3NTVA 2W6ZA 2D3WA 1ZS9A 1U0EA 4M87A 3UGJA 1QYVA 4D9KA 3S5JA 4ZI7B 3M4NA 2PXCA 2V3WA 3D6VA 2DBRA 4LMRA 3RTGA 5KQGA 1E7SA 4K9QA 4F56A 5LDHA 2VHJA 5EYPA 1NW5A 1YR6A 3KWLA 2QM3A 2ZM6B 1IVYA 1C4KA 2A1IA 3NBAA 3QW2A 2W37A 3SVTA 3VV2A 1NIJA 5KSZA 2AJDA 2Z8YM 2X1LA 3DMTC 4OD0A 4V0RA 5AMXA 5EWLB 2PCLA 3ZIUA 4BFTA 4DNPA 2E9SA 1CUSA 4UVGA 2UUBB 3O83A 3H8JA 4EM6A 5A4FS 2LVBA 4L74A 3I76A 3TQCA 3JQ9C 2BI8A 3NMUF 2P1ZA 3K9BA 3WO0A 4MYHA 3BA6A 2NZUG 1PS0A 2RCNA 5EI5A 5H9VA 4MJLA 1UKVY 1KYXA 1Y8AA 3SLRA 1O9GA 5HOQA 1K4YA 4QFBA 5H83A 2ZB8A 3LMKA 4YI5A 2PFSA 3BMXA 3DEIA 3P7MA 1I7LA 1OH7A 1FFWA 1RQGA 2X13A 4IH4A 5DK6A 4ZJPA 3HCWA 5IN5A 3A05A 1JECA 3QBJA 1EFPB 1PNQA 2VDMB 3LF2A 1RKQA 1EVZA 1XC7A 2GM5A 4BQNA 4DHEA 3PXXA 2JLXA 4PV7A 2MYTA 5DHAA 3ECCA 5IXSA 4CR8A 5TF4A 4KVFA 1G5TA 4N3BA 3GPLA 4N3GA 5TB5A 2P9EA 3M9XA 1E3LA 4NBNA 2FMTA 1NJ5A 1TEXA 2D7DA 1ISFA 3QFFA 1NY6A 3VA7A 3ZVMA 5BPFA 3PHLA 1IU9A 3QEBZ 3DEKA 3K9CA 3W8FA 1HO3A 1Z6GA 3MQ2A 2HW8A 4GL2A 1KSHA 1A7KA 1SHZA 4NCIA 3W2GA 4TVSA 1A9ZA 3NOVA 3BA1A 3PPYA 3Q6NA 4MLDA 3OKPA 2BC9A 1Y42X 1N5IA 1FZTA 1E5DA 1JX6A 1XTUA 1URPA 4OJKA 4EL5A 3DFMA 4NNJA 1CUGA 4XUDA 2IIVA 1BX1A 4GDMA 1CY6A 3A9WA 4IZ6A 2P2LA 3PDHA 4C30A 2W5UA 3DLAA 1W73A 1RRFA 2IF2A 3MGAA 1YBMA 4I9NA 1KYTA 4M38A 3D4IA 1AMUA 2DYKA 1SBTA 3AILA 1OI3A 3R0XA 4IHJA 3RB8A 4I08A 1SOMA 1QPBA 3PLAE 3P0HA 1D03A 1JDBB 3QF4A 2NV6A 3NG1A 2BHLA 3WTCA 3EC1A 3N2LA 2PTGA 5JZVA 3FFBA 3CXUA 2DQKA 3IVRA 3QOFA 2K7FA 1R12A 2GDJA 2WILA 2G0NA 4DBVO 3TR5A 1T9KA 3ES9A 4HEA6 2VZ9A 3G7NA 2Y76A 3IUPA 3I6BA 4J4HA 4JJKA 4KQFA 1LF0A 3DCNA 2PRKA 4UOQA 3QPWA 4UQPA 3UO8B 1NT4A 3EC7A 4IMIB 3ZGLA 3PNKA 3AP1A 3W0LB 3A58B 1Q74A 1S96A 3VZQA 1JQ3A 2VXBA 3NEPX 5F9MA 2WUFA 3GJTA 3TTUA 5INTA 2H5EA 3N74A 1M6HA 1V0JA 3EMDA 3HPQA 4J0GA 1UJCA 2C96A 2DKNA 2H06A 2OHIA 2RJNA 2XXJA 4JN6B 2P78A 2GHQA 5KYVA 1JSZA 2E48A 3DVRX 2P6NA 1W96A 2ORWA 2HC9A 5J5CA 1IUPA 1ODFA 1YU6A 3M5DA 5SZHB 5CLJA 3G9ZA 1KIFA 2DFPA 2EFEB 2CHQA 3H18A 1FY2A 2J3MA 4PEVA 5ESRA 4ZOQI 1LDNA 3ROFA 1N6NA 3VPAA 1M6WA 1SG9A 2NO9A 3DA8A 3DVLA 5TC4A 3T5DA 1QTQA 4P82A 3CTPA 1VGRA 1G8AA 4U1RA 4NE9A 4FCTA 4LTDA 4CKEB 1GZDA 3WSVA 1FLAA 2ZJYA 3I0MA 1DHRA 1G16A 3VHXB 3RIEA 1YVUA 3GJ6A 4WCFC 5KOJA 2WUWE 1V8PA 3OO1A 3VHRA 2GEVA 5LB2A 1FRQA 1KK3A 3LX6A 4UTPA 3W9BA 2GBFA 3D6FA 1RKUA 1KI4A 1MIHA 2JD0A 4CYMA 2FPMA 4D96A 3I2YX 1B1AA 1GD1O 1Z75A 3AR2A 4PC2A 4UHHA 4KDFA 3KJQA 1E3MA 4QPCA 1W2GA 2IUYA 2EIXA 3LTEA 2HCBA 4BQEA 1CY0A 5EP1A 3H1BA 2YYAA 3L46A 4GMHA 1PR4A 4N54A 1JJIA 4TT3A 2HT6A 3F6EX 3UC9A 4HADA 2W2XA 1E2DA 4CM8A 2HL6A 2VJOA 1IB0A 3B3FA 3QQPA 3K5WA 4BBPA 1E5LA 4KFRA 3VKWA 2XEXA 2JI9A 5FPTA 3R41A 1WHTA 4BP1A 2V6BA 1TT5B 2Q4RA 2VDOB 4K8RB 2DHEA 3HDTA 3PT9A 4RTKA 3EZ6A 1LI7A 1LC3A 4RWZA 2ID9A 1HE1C 1SUFA 3PVSA 1Z7EA 3STTA 5FKJA 1C1XB 2GF2A 1I2CA 4DRXB 2PUHA 1QHEA 4KQXA 3FSGA 1A9QA 3B2NA 3W04A 1EGMB 2Z08A 2HWXA 4M88A 5GM2A 5I7EA 1VCOA 3BMQB 1AUVA 1EEXB 2NU6A 3C98A 3STWA 3PGJA 2HADA 3SJCA 3STXA 2QI9C 1FFEA 2Q07A 4JLDA 5JLAA 1SZPA 1X77A 1V1MA 4LDQA 3V32A 1DSSG 8LDHA 5GIPE 5EJ4A 5KNBH 5U4XA 4C3OB 3UT0A 1E20A 2FSUA 4BO0A 3VR4D 2Z57A 1WAMA 1TA4A 2A7XA 2O07A 2X0JA 1QWSA 1D09A 4NECA 4U8GA 2QWXA 5HF8A 1IRIA 2QI9F 1LWNA 3B9QA 4RJJA 5ALZA 3U4HA 1ZVQA 1NWCA 1SVIA 4BVHA 4DQUA 2JZNA 2QD4A 2G25A 3IILA 4C1NA 2QXTA 2E7ZA 3DEYX 2J3QA 4KVGA 2WK1A 1Y3CE 3I4LA 3LFHA 2O3RA 2I29A 1M5TA 2X3UA 3H2SA 3N0TA 3NBXX 4ON9A 3UAOA 2IQ5A 3TRJA 4LQ4A 2P75A 3E3OA 1NURA 4KV7A 1DPFA 1W4ZA 1E9RA 3EYAA 1I3LA 3FLBA 5TPZD 1PJ3A 2J30A 2R4TA 3HDHA 5REQB 3L7YA 2ZJ8A 3CNHA 4ZDIA 4DM7A 1U9YA 5BMVB 1OT3A 1S3IA 1UT8A 2XWJI 4FWBA 1V8FA 4J1NA 2W6JA 3A4NA 2C03A 4MKIA 3B6JA 3S4YA 1NVDA 3TN7A 2X1MA 4U7JA 5AXAA 3VYTB 5BSWA 4X41A 821PA 3H05A 2WFLA 2W6QA 4OFZA 4XIGS 1OIWA 3LYUA 5TMBA 2C04A 1YOBA 2RAPA 4IF6A 2X76A 1UJ2A 4FE3A 4MUJA 1SK8A 1MQSA 1QF7A 1IN4A 3N2KB 4UQLA 1HLDA 3NHKA 1CS0A 1M0SA 4ZA2A 1N5MA 1Z7WA 5KX5F 3L4BC 1FFAA 2OC4A 3W4JA 5L3VA 1E7MA 5JAPA 3L6EA 4BBZA 2HDWA 2AOXA 3AG6A 4WKCA 3ZD6A 4J0CA 3BDIA 3ACCA 3U49A 3L2OB 1LLUA 3CWCA 3EULA 4UZSA 4PG5A 1D9ZA 1Y1TA 2FJUA 4OUDB 3IAS6 3T8YA 3RYFA 1CQJA 2QTTA 4WKNA 3WGGA 1Z08A 2Q5QA 2ZRJA 4FTWA 4JBIA 4RQBA 3ZCPA 1EVKA 2C8KA 3H7AA 4LHVA 3NBZC 3REQB 1AXGA 4R1UA 2EGUA 1LRLA 4QTYA 3H3XA 4HOYA 5JQGF 1L8LA 2QLBA 1XYGA 1KZGB 1MX5A 2JANA 4HUQA 4J4BA 3EGIA 4D44A 1KORA 3K8ZA 1M8JA 1O08A 3PNMA 4Y2HA 2DERA 1R2QA 2QAIA 2WJ3A 1OVMA 1V4VA 3CEPB 2YMMA 5LA6A 2BFNA 3GFGA 2A94A 2XDQA 4RD1A 2Q3BA 3L4JA 3I5MA 1DAHA 2WBLC 3C5CA 1R3DA 4UE6A 3T9DA 3EIEA 4KUGA 1SG6A 1OSNA 2AQ8A 2V6MA 3BE5A 3EX7C 2YS7A 3I2FA 4LG1A 1UH5A 3MXTA 3GCZA 2O4CA 1FSPA 2EYQA 1VJ1A 4OYYA 1R5BA 4GR5A 5C8VA 3ZE6A 4D99A 4F6RB 4TMWA 3QZUA 2I6FA 1OFTA 1IQRA 2QP4A 2VP0A 4FSXA 1PNVA 1BX3A 2RHDA 3HV0A 5HTKA 4KO3S 1BHQ1 1G42A 4G84A 4R2XA 4JVNA 1ZD5A 2KBFA 3ER9A 2XYQA 2M1ZA 3ND8A 2ZR0A 1BDMA 2WJIA 2V6IA 4Q37A 1OFVA 2H63A 5IHXA 1KY4A 3ELDA 1JKXA 1AB5A 1GEGA 1G63A 3CKKA 1X38A 3DCIA 4OG2A 4CQLB 2V7BA 3N53A 3O4GA 3RU3A 1O89A 3FYDA 2W2NA 3UWMA 2Y1XA 2R8OA 3QXJA 1KP9A 1P5JA 4URZR 1RXEA 2J7PA 5CM9C 1ZD2P 7ADHA 2EX0A 2RG7A 4S1OA 3CF0A 3AIOA 4QJBA 4UQOA 4N5MA 3RIMA 4EJ2A 1I7QB 2BFPA 1FMJA 4D80A 3PQ5A 4X8HA 1GZ5A 3ZHXA 5BW8A 3QVVA 4MOWA 3LXXA 1JLRA 1ZGZA 4B6EA 2VPTA 1TK9A 4YRSA 4IICA 3E0QA 4MR8B 4ATNA 2H6EA 1N2CA 3ESZA 4LRYA 5AVVA 4NV0A 3HA2A 3M3HA 3TMAA 2ZREA 4EI8A 5BPHA 1THZA 1FMCA 1A3CA 3V5NA 4PC7A 3PTAA 1NT2A 3B82A 4BUJA 1V8ZA 4D4HA 4GKVA 5JD6A 4UJ3A 1QF9A 4HR7A 4Z7NB 1U1FA 3FVVA 5CBKA 1P5HA 4O63O 1XNRB 1GSAA 2D2VA 4INZA 4MUAA 2V03A 5A7HA 5C9ZA 2DTXA 1OH8A 4TTSA 1SAYA 3AKZA 2EFGA 1Z4NA 4QIHA 4CFZA 1N32B 1TZMA 1VECA 1WJGA 5FI3A 1Z0SA 1BFDA 3ANTA 3C6ZA 3HDGA 3DB1A 1HKUA 1PJ2A 2PPLA 2VP3A 3FWPA 4CF4A 3I53A 3GYBA 4RVDA 1N5LA 4L08A 1JLKA 4FCCA 3RS3A 5ADUS 2POQX 2GT1A 2YQZA 2JZOA 3S2UA 3IAM1 3VYRB 1HNZB 4MVJI 5LOVA 4MV7A 2HA4A 2Q99A 3ETJA 1G5PA 3UF0A 3BXXA 1H2BA 1IE3A 3DB2A 3DJFA 5CFNA 1ZD1A 3DZGA 5B3JC 2ZIEA 2DLNA 5ALJA 3Q15C 3CH7A 1XU4A 3SC3A 3N70A 2CWDA 4DTCA 1LS1A 3SDZA 1DGQA 2P0EA 4PCLA 2ZR7A 3B6KA 4XYGA 3QFHA 2Q45A 2DTDA 3USES 4CR6A 1AQ6A 3VI3B 1AZLA 1NM5C 1SQ0A 3GUYA 4BNYA 2Y1GA 4KR7A 1L3BA 3KYDB 5F3WB 3KT0A 2RHHA 1KVTA 5AXCA 4ZHQB 4BFWA 1ZHHA 1YOVA 4YGXB 3UB2A 4DILA 3SEQA 4XW2A 1NBOA 2VCEA 2PQ6A 2YHAA 3O7MA 2DHRA 1XB2A 1HG0A 1PQYA 3I9KA 3IS3A 4IV0A 1RXSA 2O57A 1WUJS 4JD5A 3D59A 4X1IA 5J2TB 2EZTA 3ND9A 2RE8A 4L2IB 5CH5A 3IQEA 3AKYA 3VH1A 1XVUA 4X9XA 3KBOA 1NW6A 2IY9A 5EKTA 3NC0C 5FUVA 3SHFA 1R6DA 1KJZA 4YCMA 1GEEA 2HSEA 5AM1A 4BNLA 2HK9A 3FUCA 3RBAA 3E3AA 1PFUA 1QLWA 1YIOA 1EXWA 1GTMA 2C94A 2P62A 3DMFA 3IBTA 4JUIA 1VMKA 4RL6A 2WJHA 3SIRA 4B43A 4ZYVA 1Z0UA 5JAZA 4I1YA 4YPFA 1YVPA 3KOUA 1C9KA 2WD7A 1BS1A 4LZWA 4EUSA 2OO5A 4LYYA 4PAQA 3TE7A 1W4BA 4E21A 2QMZA 1Q83A 4Q6WA 1ESMA 4M37A 4W9MC 2GZDA 2DKFA 4XVQA 5G0SA 1UDCA 4FYHA 1E6WA 4C4RA 1CJKC 1KK2A 4DJTA 1QDLB 4GICA 1OKKD 2OV2A 3JQGB 1MD9A 4PSAA 4HRVA 1FDRA 1XCGB 3DAPA 2DQYA 5BSUA 4DHWA 4F1WA 1EUCB 2ZI4A 3DVAA 1U7XA 4UFOA 1P3JA 4FFPA 2XVZA 4EDFA 1GRRA 3K0FA 3WA7A 2Y66A 2ZYIA 4MRPA 2F4NA 1ENPA 5EN4A 1XK7A 2BFFB 4P7KA 5ALEA 3VR4A 1CF4A 4FYWA 2WYVA 4X1KB 2KSQA 2Q6IA 2WJ4A 3KZNA 3FDFA 2C59A 4Y0AA 1JJBA 2APJA 4F5DA 3AEQB 3SX4A 4BMCA 4Z2AA 1N5OX 1P7VA 3K5IA 4XWAA 5JCJD 1F8GA 2QRKA 2QL7A 4YBZA 2IVZA 3VH3A 4O4IF 1L5QA 4YLEA 2UVQA 3PVZA 3QEAZ 3RFFA 1LZKA 1X80A 5HFJA 1H2HA 2CVHA 4M60A 5KDOA 3DLBA 4K2HA 3NHMA 4B81A 2YHUA 2Z6QA 1OASA 3WYEA 3JZAA 3K2BA 1FS4A 1XD2B 2BMJA 5EMJA 3ZVKA 1BSVA 5HRCA 7YASA 3L0SA 4K05A 1DRUA 1X7GA 2D5BA 2R2AA 3H2GA 5ARBA 5EEGA 5HGJA 1EQ2A 4E30A 2Q0QA 1QJCA 1M2KA 1QZTA 1S4QA 3LBIA 3N28A 4I5DA 1T13A 4OLFA 4O59O 3CFYA 3FDIA 3SFVA 1Q91A 1E8NA 1CY4A 1RWPA 4OL0A 3UB3A 4ISBA 1SU4A 1A4RA 2AFHA 2VYND 4IIBA 4L78A 3ZCXA 1DC7A 3ZHQA 3AI7A 4C0LA 4DDTA 2CK3A 3F78A 1K2VN 1GR1A 4G9BA 1UEXC 3ZWYA 2QPAA 2WYIA 4AO6A 2FAXA 3DOFA 2BOVA 3DKPA 2ZSFA 2IRWA 3SZUA 1SOUA 1X2BA 1IOLA 1H8EA 1NLZA 3OCUA 2QS9A 4URFA 2J32A 3UKJA 2IUSA 5E3HA 6REQB 3NBQA 1JHAA 3PICA 2B82A 4KEAA 2PU7A 2IZZA 2QMQA 3Q5DA 4P3XA 3LQ1A 3TW4A 4MWGA 3WE7A 5HCUA 2F1HA 3A25A 3W4IA 6ABPA 2Q21A 4BZQA 4NWIA 3GN1A 2DCMA 4HAWA 3UA4A 4BAZA 4K9KA 2HOQA 3PLRA 1BX0A 5ICSA 3GNLA 4RCYA 1KFEB 4X1OA 4RE6A 3KRTA 4Z3OA 2F62A 5CNIA 1DVRA 2QQGA 4EFMA 4A8TA 2E6KA 1QK4A 2BN4A 3C45A 4QUKA 1JAXA 2FVYA 2WZDA 2HBRA 4DVGA 2OK8A 2XZTA 3Q0IA 4ZGBA 3CPJB 3D2BA 1T36A 4HAVA 2BJVA 4XB2A 2XZPA 1MBZA 1HOTA 4DC1A 4HF7A 3V8QA 1CJUC 2QN2A 2J08A 1ZD9A 3JVDA 3V1NA 1KOFA 5IT0A 1QB7A 3BAFA 2WSSA 1FPMA 3QU4A 4RGVA 4CLOA 3ICEA 2I6XA 3LRXA 4OM8A 5C8YB 4HWPA 3DD5A 4FC6A 4B7ZA 4HV4A 1DIAA 1KYVA 2PBRA 3FKJA 1NF8A 2GN0A 3DZJA 3G0BA 3OOWA 4QOJA 1XQ1A 2GS9A 4WCVA 3WZ2A 4ARUA 3HO1A 1GUYA 3AM1A 3EGXB 1V4BA 3MOSA 1FL9A 1FX0A 2P41A 4NE2A 4RPJA 5CVEA 5TJ9A 1KK0A 2XMDA 3UK6A 2G71A 4E4YA 2PKQO 3TLYA 5F35A 3RTDA 1AH2A 1CUIA 1OYWA 2ZK7A 1B8NA 4PZUA 2FSVA 1Z56C 4WK2B 3KOYA 3QU9A 3L5OA 1DQSA 4HDMA 3FTCA 3DP7A 3C14C 3WRVA 1SIOA 4OK3A 4AJ1A 4EKIA 1U0HC 2PJDA 2AF4C 4UBLA 1BJTA 1ZZGA 2NZWA 5KVCA 1BU8A 3I4FA 3KZ1E 1DMSA 5IMBA 1JR2A 2WU0A 5F1PA 2WG2A 2X2EA 3C6BA 1GPLA 1XN4A 3H1AA 4Y8VA 3ZEIA 4LNHA 3B1KA 1LTKA 1VL6A 1JEQA 4PGFA 4F1JA 1C41A 4B2PA 1MLDA 4EVQA 2F2TA 2VPXA 3HJHA 1B26A 3OESA 4RIEA 3R7FA 4UHKA 1HMPA 2P2CA 3A6EA 2KJQA 2A78A 1I13A 1ZGHA 1OLUA 3GP8A 3NJ4A 5HJ2A 3KXIA 3SC4A 1GVNB 2IYUA 5G0WA 1ABEA 2FPUA 4I36A 5C51B 1SUAA 1OI4A 1QIKA 1R8QA 4AMVA 5LZ8A 2YR0A 4XYEA 1N2XA 2D7JA 1CUBA 2L17A 2J0VA 2ZRLA 3PD7A 3C6XA 3RLFA 5AM2A 8MHTA 1JR3E 3IEPA 3MHTA 1LH0A 2ZS9A 3RS8A 4KX5A 4QFDA 4M86A 3JYLA 1JUDA 1ODIA 2JIOA 3L0BA 4UEWA 1VLQA 5E9QA 3FGNA 5DYGA 3SYNA 1JEYA 4V38A 5GONB 2GN4A 4GQIA 1T3LA 1NMXA 2EAUA 5J43A 1NU6A 4W99A 5CX4A 2DPYA 1PEAA 1YS7A 3LT1A 1LDBA 2A84A 4PGAA 4Q4LA 3AVXA 4NF2A 1GXSA 1QAQA 2UUOA 3MWFA 2X9QA 2HGZA 5CLQA 3RDPA 1RVDA 4RHYA 1MJGM 2VDLB 1SC4A 3V8NA 3LJKA 1KVSA 1ZR2A 1Q2UA 4B0OA 2AUNA 2V0CA 1WXQA 1EE9A 3IUSA 1RQ2A 1E2HA 2VYFA 5EPOA 4I1IA 5A05A 1Z4PX 3RSHA 3ZC3A 3WNDA 4LXTA 4X00A 4AP5A 5EWJB 4H6WA 3WQQA 1P81A 4A0FA 1GTG1 3TYXA 1P29A 1TD9A 5AICA 3ECSA 3GLFA 4HL6A 3OZRA 1X7DA 1NF9A 1LDMA 3ZQKA 2OCLA 1PFKA 4CIBA 1EI9A 1XZKA 5E1OA 2PXHA 4RTRA 3L77A 2IYZA 4D6YA 5DTJA 5C1PA 2VDKB 5HM6A 2WIKA 1TYCA 1L6IA 4MS1B 4P93A 3RUIA 3T34A 5BSVA 3OFSA 5ISMA 1NVGA 2BFOA 4QJ3A 3T0FA 4ILKA 1PJQA 4H6XA 3G5LA 1R4MB 3P2JA 2YWEA 1KFKB 3CRVA 4NMWA 2ZTMA 5DT2A 1TQ2A 1N8SA 3CCCA 1NXWA 4QXQA 4A8JC 3QBDA 4RXMA 1IK6A 4ZP1A 1WY5A 4B7XA 4TKVA 2DOKA 3EK2A 3KM0A 1CIVA 4LF4B 2QRVB 4L4RA 3ZGXA 1JXAA 2Y0CA 1V48A 3W2TA 4XXHA 3P0IA 4A7PA 5FA5A 1H05A 3H5AA 4CKBA 2BGGA 2WIAA 4IYRA 1A8HA 4D9FA 2IHJA 4LXGA 4N0DA 3S2GA 1F9AA 3M3DA 1P9RA 2J9ZB 3N1UA 3I92A 4MRNA 1DV1A 4ROSA 4NZMA 4OGKA 4WN3A 4P08A 1TM7E 5B3KA 4RA9B 2FMXA 4E1VA 3MT8A 1ZVJA 2OV3A 5MFPA 4KNYA 2YRFA 1GQ2A 2GN1A 1TJPB 5KI6A 3WK6A 3JAWB 2G1AA 4NZOA 4CL3A 2VPPA 5JCJA 2UYHA 3PNYA 1A8SA 2D0OB 4HDKA 4W7SA 3VPSA 2ZBEA 5L3QA 4F46A 3GL9A 3V8PA 1H4QA 1XWIA 1GOTA 4AYWA 1T10A 2Q9BA 3SP1A 4URHA 1UUFA 4BU1A 4MCHA 4BLTA 1I4DD 2I76A 3NWEA 5ADWA 2AKEA 3PC3A 2QPLA 4KXVA 1YQWA 3AEKB 3QIAA 4GX1A 4ITVA 4NENA 5COAA 4HUTA 4WXEA 1VPEA 3GRKA 2P65A 1MAUA 3IIJA 3Q7EA 4L4SA 1DXQA 3MJTA 1XMQB 1ND6A 2ZWAA 1ZOPA 4ZD6A 4B2IA 1Z18A 5ALKA 4OIFA 1V1RA 2G9RA 4OP2A 1I4OA 3UNXA 3VJRA 3FZNA 5DTQA 1PJRA 2P9TA 5BV1A 2YJ3A 3VZRA 3V3TA 4HAXA 3G89A 4LUCA 4KPYA 3JR3A 3U4IA 4JVOA 2VYNA 3WMGA 3D3WB 1VCMA 1L5HB 2R48A 3L9XA 5ALRA 1HDOA 4LCJA 4ME6A 4XARA 3U2QA 3OM9A 2BGTA 4XTRA 4A2CA 3B3QA 3HXMA 2DPXA 4I46A 4AU1A 3NTUA 3V46A 4ETWA 2PWPA 4JEMA 3TIVA 3M5PA 1K1EA 2V59A 3V33A 1ONPA 1TF2A 4YYZA 2JRLA 3D6TB 4EHHA 3HHPA 2VRBA 3BE6A 3QEOA 4LFCB 5DZSA 1CJSA 1MC5A 1X9HA 5KWJA 3GGSA 3KYCB 4DY4A 3THWB 1JFRA 2FW9A 4G63A 2QNRA 1Q0ZA 4MCAA 4WUTA 2YXLA 1JEAA 1I7PA 3CG4A 5JJLA 3USZA 3HP1A 2OOSA 5E9JA 4DB4A 4S05A 3ZDZB 2WA2A 2W4IA 3OQIB 4NZNA 1H2YA 2BKAA 5CYOA 3BN3A 5A9SA 3WBFA 2WICA 5ADVA 3DMYA 1TEZA 1YQ9A 4BLOA 5FFFA 1YJCA 2BFDA 3IP9A 4BOYA 1S01A 2ZJOA 1ULBA 2M9MA 3RYHB 1V35A 3AVYA 3L1HA 1ZKDA 1ZUIA 4KXFB 4DR1B 2IU3A 4YDHB 1XXHA 1L5ZA 2GPWA 1YR7A 2UYQA 2LKCA 1TAQA 3I9FA 3WGLA 4MUHA 2PH5A 1JNYA 4BFYA 1M0EA 4X84A 2X0FA 4IFEA 2FDXA 2A9RA 1YE8A 1NVVR 4YUAA 5G3ZA 3UMGA 2YJ5A 1ECGA 4YJGA 1XA4A 2B30A 2PX2A 2R1TB 2XVYA 3E9DA 3KS9A 4ZRNA 2X9VA 3AESB 3CA8A 3Q9NA 2VXYA 1BE0A 1P2BA 4FYKA 4R2WA 1YI8A 4PRKA 4E33A 4YV7A 4RXUA 2O2HA 3IX7A 3UH0A 4KWTA 1EJ0A 1EXDA 3RR2A 5M7EA 1QFSA 4HLUC 4ZWNA 4KFUA 1L5VA 4DUGD 3CCFA 1QO0A 1TC1A 3T3DA 2NACA 4BYMA 1L1QA 5LZ7A 2PJRA 3I2IA 1HYQA 1QIEA 1XMXA 3BCHA 3K0CA 4UU1A 1N2EA 3OWHA 5JBQA 1FP7A 2OGWA 1Z4LA 4HRAA 4JHXA 4ECAA 4PE5B 4MVJA 3TQQA 1NG9A 3FTEA 4G5YA 3QFTA 4BJ5A 2C2HA 3U0BA 1M1NB 4F84A 4YMUA 1T3HA 3PENA 4GLJA 5CT4A 2CWWA 3FSJX 3ZCUA 4II3A 4BZXA 1T8RA 1KWKA 3LP6A 3O3CA 3OZWA 1DKUA 1G8KA 1WHSB 4RLFA 5T5QA 3BZUA 2QL5A 3NRCA 3HCAA 2C9YA 2Z8ZA 3ORRA 4YRPA 4ZQGA 2RGWA 5ECGC 5G4LA 4BO4A 3IOEA 2NZYA 1IDOA 5A9TA 4B35A 1C2TA 2Y99A 1LA2A 1FTQA 3BBLA 3DPIA 4Z8YA 7AT1A 3JVEA 4NYIQ 3UMYA 1NVKA 1CQPA 2OWDA 3OTQA 3ZWWA 4HATA 4MS4A 3UHPA 4D46A 3ZJVA 2DULA 3L3BA 4LBWA 1KC3A 5GZ6A 2WHPB 2FK8A 2B1IA 3M3PA 1XU7A 4OQZA 1D8TA 5F2NA 2YZ2A 3MYYA 3WY9A 2QAGA 1E66A 3DGEC 4TWBA 1GZ4A 2YW9A 4KBFA 3GIWA 2JARA 3BL8A 4Q9HA 4NYJQ 3EDOA 5BO5A 1CZLA 4JB8A 4G0YA 1XZCA 2HHHB 3HYCA 5AW0A 2O4UX 3LO8A 1DAEA 2HAEA 2ZI7A 4ZYWA 1L4MA 1QX3A 3SC2B 5BNTA 3PRYA 3QXCA 4BLRA 5K2MA 2ZXFA 4UTXA 3DBHB 1KO4A 3MRXA 4QUAA 5JXIA 3H1TA 3AOGA 3VYWA 3D0KA 4C4AA 5KTPA 2EJVA 3S0JA 1Z29A 4HLNA 2ZIVB 5JNUA 3BS4A 4O4JF 3RFXA 1AV7A 3A9TA 3T61A 2C29D 3KZXA 3SIPA 3MQFA 1XMVA 2ZEJA 5KPJA 5JG7A 4C4PA 1YL7A 3HN6A 2J3IA 3K9LA 2ACWA 4KQHA 3FRJA 2BEUA 4WJLA 1XZEA 3CLSC 1U3FA 3R5JA 4EABA 1TL7C 3KYIB 1QBGA 3IOMA 2JGDA 1OW3B 3HGQA 1HWYA 3KFXA 2RHJA 1PV1A 1BROA 2EBFX 3KALA 5BUCA 1KR2A 1N6RA 5EA2A 4MKZA 2J3KA 2BTQA 3K5HA 1IOVA 1IZ9A 2FWMX 4W5HA 4YRJA 5IYZF 3DXFA 5TQ0A 1L7BA 4GOKA 1AA6A 4IKPA 1JIIA 1BMTA 1FQWA 3TOSA 3SIWA 1XYVA 4YUWA 5CD1A 5IKMA 3W2EA 1Q0UA 5K3SA 4BNDB 1A1VA 1Q44A 5F12A 5UKDA 4MVXA 3GYGA 4QNNA 1I4EB 3QLTA 3ZIAA 5LD2C 3PFNA 4R9NA 1M54A 1HBJA 4RKRA 3LFUA 1RWKA 4R71A 3R3VA 3TX6A 4BLUA 4MV3A 3K92A 2BGWA 4DSUA 3I04M 5A6SB 2WSLA 5HBGA 2PX6A 1M8FA 1Z73A 4L95C 3M1LA 4Y98A 3RVPA 2A9KA 1KSJA 3X2SA 3M6VA 3WJ1A 1P2VA 3LQYA 4JKOA 5JV5A 2OFPA 3UAWA 1EESA 1I3NA 1Y6ZA 2HJSA 2PV0A 1V1JA 3OY7A 2AGVA 3TW6A 4MDFA 4LF5B 2YMLA 2B7BA 1ZEJA 5HTOA 5F2OA 1E9EA 4I55B 4HTFB 1G18A 2YRXA 3GRAA 4LHWA 2GM4A 4JI4B 3BRCA 4FFMA 3KSAC 3VJLA 4JUDX 1NQOA 4UM8B 3OE4A 1TZCA 1USIA 1V3VA 2H1FA 3KQTA 4NYMR 5BQXA 2V7EA 3WISA 1ZWKA 1PR6A 4ITRC 1A7AA 2C61A 1R1DA 1T91A 2JBAB 2QB5A 2WP0A 1T5IA 1TO2E 2FX5A 3L0YA 3L7IA 4QHTA 3HXOA 5HM8A 1NI4A