1T5IA

Crystal structure of the c-terminal domain of uap56
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
159
Chain Sequence
GLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPEQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT RNA HELICASE
publication title Crystal structure of UAP56, a "DEXD/H-box" protein involved in pre-mRNA splicing and mRNA export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
total genus 57
structure length 159
sequence length 168
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t5iA00
2JLSA 1AKEA 2Z4RA 2ZE6A 1VMAA 4WXPA 2IEYA 1KSGA 3UKDA 2NO0A 4Q03A 3RS7A 4M0LA 4DUGA 1P2VA 2IYXA 1Q3TA 1C9KA 1VG1A 4G5OA 4OI4A 1PVOA 1JAIA 1EX7A 2QTVB 4JLDA 4TL6A 3EZ9A 3VX4A 4YMVA 3K70C 3UANA 4EFMA 5KNDA 1M7HA 1DAFA 2AXPA 2H5EA 1E99A 1EFCA 1YRBA 3CWZA 4QHSA 4G3XA 4AI6A 4BECA 4MKGA 5GADl 1UDXA 1NMYA 3KXIA 4WZBE 4TSFA 4UQOA 4BLTA 2BHRA 2Q9AA 3L0IB 4B3GA 3A4NA 1W7AA 1DAMA 1G3MA 2XZLA 3CO5A 4EIWA 2ZANA 3RS5A 2F3TA 1SVIA 2OXRA 3RC3A 1KK3A 1ZYUA 4KVAA 3C15C 4HUQB 4Q9KA 3P27A 1U8YA 3VU9A 2OCBA 4L9SA 1XFAA 1ZW6A 3WP1B 2JA1A 4WBSA 1E2DA 4DDVA 5H70A 1Z2CA 1NY6A 2QT0A 3VX3A 4AK9A 4KJZA 2OILA 4EPWA 3QKRB 2HJVA 5KDDA 3DZDA 1R5NA 5CB6A 1W0JA 3BAFA 4DDWA 1Q1ZA 2P0EA 2J59A 3CW2A 1YZTA 4NKRA 4XVUA 2WIBA 3A1TA 2G6BA 1M6NA 5DSZA 1VG9B 3JZAA 3ZQ6A 5JBQA 3DZ8A 5L8VA 4TT3D 5KOYA 1ZNXA 4V0LA 1D6JA 2IS4A 2XB2A 3IBYA 2JLUA 5LD2B 5JZVA 1EFHA 4A4DA 2RGEA 4PC7A 5TDHA 2F9LA 1NY5A 1Q44A 1E2HA 1P4SA 1XP8A 1ZUHA 1R8SA 3AVQA 3ECCA 3N2EA 4GI7A 4RZUA 1KJWA 2OXCA 3I3SR 5KSPA 2IUUA 3R9WA 3B8HA 2ZRNA 1R5BA 5CITA 2IYWA 2PZEA 4BLRA 4IDPA 2J0QA 4Q1AA 4D0LB 2YOGA 1N6OA 2OFWA 4LC0A 2VA8A 1BMFA 4JL8A 1NJFA 2R6DA 821PA 1H8EA 3CRW1 3UG7A 1P72A 4MRNA 4M4SA 2F9MA 4M1TA 4WOPA 4HDOB 4FMBB 4DLRA 3U61B 4L4UA 1IONA 2P2LA 4K8OA 4PTLA 3QY0A 1KOFA 5L3VA 2CLDX 3IO3A 4ZIRA 1HTWA 3B1XA 3LFUA 4Z1MA 2V7QD 4M1MA 2BDTA 2PJZA 4NHOA 4HLUC 1IN7A 1G17A 3THOA 1TEVA 2FSIA 1MRSA 3N70A 4Q1CA 4US1R 1XF9A 1ZU5A 2HXSA 5KTYA 3CNOA 2FV8A 2O8CB 4DDUA 3T12A 3UK6A 4ERNA 2KSQA 1FNNA 2FFAA 2ZUCA 4GOXA 1DELA 2CLCX 3GLGA 1OFIA 4MKHA 2FPMA 4MRRA 3BORA 5C4GB 1P6XA 3SZRA 1LV7A 1ZD9A 3C5CA 1U9IC 4PHTA 4FMCB 2IF0A 2ZRAA 4C0QC 2ZYVX 4Q66C 4AYTA 4EFLA 1N6KA 1E9DA 2CMKA 2VHJA 4GMDA 4TQAA 2XOKD 4N3NA 3AUYA 2CL7X 4FIDA 3KUDA 1NLZA 4QBIA 3P4XA 2O8BB 4Q1FA 2ZI3A 1IN6A 1WMSA 2HF8A 4BASA 4CRWB 2FEOA 1G4UR 2R6AA 3LLMA 5EXPA 2WKRA 3SQXA 2FG5A 2E1RA 3ICQB 5FI1B 4WIAA 4JL5A 2IT1A 4EJSB 1JAHA 1W36C 3GJ3A 1BYIA 4F93B 1XZPA 4OJKA 3I73A 2K5UA 2QBYB 4TMXA 3HU2A 3H84A 5F9HA 1L2TA 4LHVA 2QORA 1JQJC 3LQQA 4CEIA 4OKSA 2WWHA 1RZ3A 4BLSA 4LJ5A 3THXB 4RD6A 5FUYA 2NMVA 4BEJA 5J5CA 3WY9A 1G5PA 4RD3A 5DE3A 2IW3A 2SHKA 4OK6A 3CR7A 1F2UB 1BH2A 4O25A 3UG6A 4LCBA 2RKOA 3EIQA 4A0FA 3BXZA 5G40A 1AS3A 1J8MF 1CLUA 1SHZA 5TVKA 3C8UA 2PZGA 1OH6A 1CJVC 2RHDA 1HT1E 1NVVQ 2XTZA 3BFKA 1ZD8A 3OHMA 2FSFA 2G88A 3FMPB 2ZI9A 1QHYA 4UKDA 4DSTA 5TY0A 3SYNA 3SEAA 3Q7PA 4C30A 1KMHA 3QENA 1E2IA 5DI3A 2MMCA 4NL4H 5JJIA 2IA5A 1NBMD 4HZUB 3IKJA 2FZ4A 3UWOA 1JBKA 1WDTA 2ZYTX 4LZZA 3LAWA 3NBYC 2QTFA 1M2OB 2F7SA 1G6HA 4IDQA 1IQPA 2YJTD 1EFUA 2CVHA 1IN8A 1VKJA 4FINA 4LC1A 3P26A 1Z3IX 1UEIA 2O0JA 3O47A 4JYBA 1QHHB 3SU8A 2WWIA 3RANA 3VQTA 3CH5A 1F3OA 3PEWA 2X8AA 1YZLA 1PLJA 3IPYA 1T3LA 5B2ZA 2ZS8A 2V4ZA 1HA3A 4JSYA 1NG9A 1HYQA 1N3BA 1L4YA 4K46A 1NSTA 1TUEA 2LWIA 2FSGA 3LBIA 1Z06A 4CW7A 3NBZC 4BFTA 1K6MA 1OKKA 2Z5FA 1HE1C 5KSYA 5M04A 4Q9LA 1R7RA 2D4HA 2EYUA 2WZQA 2OV2A 3ZD6A 1JECA 2YINC 1MH1A 4MRPA 4Z51A 3TR5A 4AY2A 4LBYA 4EQ6B 1FP7A 5G3YA 1TF7A 2BM1A 2WICA 4JMPA 3T35A 3G82C 3KJIA 4EUNA 3U7GA 4IJMA 3PEVA 1XMVA 2GZAA 3K9NA 3NBFA 4XD7D 3T06B 5A4JA 1GNPA 1OLOA 3EARA 3EZ6A 4B2IA 3B1WA 3TAHA 4PHFA 2H17A 2ZUBA 3SOPA 2J7PD 4U02A 3ZQJA 1IN4A 3L43A 2A3RA 2O5VA 1JJVA 1CIPA 1LS1A 1UF9A 2CEAA 4DCSA 3HPRA 4KU4A 2QROA 1WF3A 4CEHB 2ZXUA 2G77B 2R6GA 1UM8A 2FFQA 2REXB 4V03A 5GJCA 1KAOA 1G7CA 4LJ7A 3BB3A 1HH4A 3A4MA 4L16A 1Q21A 2JJ2A 1W4BA 3SNHA 4JS0A 3PXGA 4DLTA 5F3WB 2OM2A 2RGNA 1DBSA 4YXWA 1KK0A 1FX0A 2AK2A 5DLQC 2FE4A 3TRFA 1ZBDA 3EPKA 1A2BA 2DPXA 2GCNA 4KLNA 1CRQA 3T1QA 3M0EA 1U2RA 1NF3A 1I2DA 2OCYC 4LSGA 2V54A 5FR2A 1N6HA 3QKRA 5JWOA 1FMLA 3PUVA 3ZS8A 1D9ZA 4G0NA 2JJ8A 1Z0KA 4P33A 2UZIR 3FKQA 2VYFA 1JXOA 4LBZA 3AVTA 1UFQA 2AFIE 5FBRB 1KO4A 2Q3HA 1B0UA 4B47A 3FOZA 1E4YA 4M1YA 1E9FA 1T3HA 2EW1A 3CRRA 2ZJ2A 3RRMA 3X1ZA 2C78A 3TSZA 1NMZA 1GOTA 4KBGA 1X6VA 4F38A 5FUXA 1YR9A 4D2IA 1Z08A 3K70B 3LO5A 5TMPA 1SVOA 1T5IA 1RFLA 1Z83A 2JGNA 4NCHA 4KFRA 1GKUB 1GKIA 2ZJ5A 3EZ2A 3OEHA 5FL7A 4DLZA 4C0SA 1H65A 1ZCBA 1VECA 1ZIOA 2C5LA 3K8YA 5JLJA 2ZR0A 1E2EA 2ZSAA 3JVVA 1SZPA 2GZHA 4TYYA 4FI3C 2FX3A 4P3YA 2W6JA 3O8DA 2VP4A 4IDOA 4OQXA 1KDRA 4KODA 1KO5A 3GFTA 5H1YA 3SE0A 3GFOA 1W44A 3AF3A 4X8MA 2JASA 2QG6A 1KKMA 2FF7A 2VF8A 3RWMB 2XX3A 2O8CA 4TZ0A 3AF4A 3BBPA 5FBQB 2ASEA 1N0UA 1TEXA 3GJ8A 4D6PA 4CGZA 1CR2A 1E2MA 2FPLA 1P2UA 4NONA 2FH5B 4R2IA 4M22A 5DYGA 3NG1A 1K5GA 1GL9B 5LD2C 1E79A 4LJ6A 3OF5A 3Q5DA 4LI0A 1ONBA 2FWRA 3QG1A 2VHUA 2ZR7A 4Q9IA 1FTNA 2DB3A 1P9WA 2QMEA 1DS6A 4JLNA 1QHNA 3KXLA 4EPYA 4F91B 4RD4A 5IF9A 1UEJA 2QTHA 3M6AA 3WMGA 4JYCA 2OHFA 1OH5A 1ZC3A 3IPXA 3I1FA 3LWNA 5CDFE 3J81k 2A9KA 1F2TB 2GK7A 3NVAA 4RFVA 4BFZA 3O8BA 1CJMA 1N5IA 4WA7A 1GRNA 1HT2E 3HPQA 1V5WA 2A5GA 4CYMA 1IHUA 4BGDA 4UXIA 5GVSA 4HLDA 3QVVA 1M7BA 5IK2A 4GOJA 1E1QA 2JIZA 3IUYA 4MGKR 2KWIA 4EJSA 4JLKA 1SXJD 2B92A 5G3ZA 1E1RA 3BH0A 3GD7A 2HT6A 4B2LA 1ZU4A 1KDTA 3LXRA 5EXXA 3W9YA 2QBYA 2VH5R 3B7GA 1MO4A 5DISB 1G3RA 1D5CA 3VMFA 1DVRA 2QN6A 2DFNA 4OK5A 2ZRIA 4NYJR 1SHKA 2AKYA 5TARA 5J4VA 1US8B 2F6RA 2TMKA 3RABA 2CDNA 3CWQA 1S1CA 3LXXA 3THXA 1VCNA 1Q20A 3DOEA 2Z0MA 2V3CC 3EWSA 2CL0X 4ZDKA 1VCOA 4XVRA 3CPJB 3AKCA 4FD2A 1AZSC 1F2UA 1ELOA 4KLZA 2PCLA 1TQDA 2BWJA 3IEUA 3TUIC 2ZVPX 3A1WA 1DO2A 5C18A 4D26A 1PZNA 4PZLA 5F98A 2PMKA 1OIXA 3B9QA 4Q4AB 3B60A 4YMTA 2ANCA 5SZHB 3NIBA 3U5ZB 1T91A 1JPNA 1X1SA 2PT5A 3SBDA 1MKYA 2I1VB 1W0JD 2GK6A 2CNWD 2AL7A 3LBHA 1JNYA 2I1QA 4DIDA 2NGRA 2CHGA 4HZUA 4E5UA 3KKQA 4XTCS 3AVUA 2AHOA 4IFBA 3L8ZA 2XZPA 4JKIA 3NDBB 4RFSB 2JLQA 3U3OA 2BBTA 2GILA 4JT2A 4PR0A 5FUVA 2WIAA 2KJQA 2REOA 4H9GA 3I4LA 5JS8A 2Q9CA 3QBTA 1U0JA 4KCGA 1W36B 3HP1A 2X2EA 1VDZA 2GXAA 1N6RA 4IOLA 4QGFA 4HAXA 1OXTA 4B6FA 1J99A 1QHHA 2PCJA 4Q00A 5C4MA 4CT4B 1WBBA 3NTUA 3CNLA 1PV4A 5FOVA 1OFUX 2IYZA 2CHQA 1U99A 4XWKA 3KL4A 4BFYA 5F2EA 5AUPB 5KPJA 2DR3A 1XPUA 2WJJA 1ZVQA 1SULA 3QI2A 1B23P 4DCVA 2YNMA 5DN6D 1NN1A 4JLMA 4MRSA 3WYAA 3THWB 3KQNA 2DFKB 5A0FA 4A0HA 1NVUQ 3MMPA 4US2R 3AF0A 3GMTA 4QGAA 2JLWA 1RKBA 1XEWY 2ATVA 1KY3A 5EXTA 4X8HA 4P31A 1HEIA 2JJ1A 4JLOA 4TL8A 1F6BA 1CEEA 2BCJQ 1OXVA 1YE8A 4IOMA 2ZI5A 1SGWA 4UNQA 4UXJA 1K8RA 4B35A 2AKAB 5KUTA 5AJXA 4AKHA 4Q1DA 2O8FB 4RZ3A 4O2LA 5L3QB 4R2HA 1I4DD 2VSXA 1AIPA 3C7KA 4N1AA 2Y8EA 4PO8A 2ONJA 3ZH9B 4UNRA 3SYLA 3GLFB 1MABB 4DLUA 4Q9JA 3WYGA 3ICEA 2ZSEA 4K81B 4DC9A 3JVUA 3B13B 4JJZA 5D3MB 4MGZR 2ZRMA 5LBIA 1NIPA 3OE7D 2IEZA 3CX7A 4HAWA 4Q4LA 4AWXA 4GZMA 4JVSB 2XJ4A 4GRAA 4A15A 3KZ1E 4ZCIA 2IL1A 2QE7A 5TV2A 1S96A 5JRJA 4DT1B 1ZM9A 1UBGA 2IBMA 5CM9C 3D8BA 3AF1A 2IYRA 5EZ5A 1EFRD 4C7OA 4RKEA 4B44A 3VHXA 2QSYA 1SQ5A 3K9HA 2VP9A 4IVPA 2JLRA 2YWGA 3KXKA 3B5JA 1ZNYA 1P73A 3TSOA 4FWTA 4FMDF 2AXNA 5L3SB 2IS2A 4TTQA 1P9NA 1YZUA 3B1YA 1IJFA 3CH4B 1W4AA 3W6OA 4A82A 1Z0IA 1JEEA 2MMGA 2XNDA 2NG1A 5JHHB 2HCJB 4JSTA 4KBFA 1CTQA 4QM7A 2WWGA 1KI6A 4RJLA 5FOWA 1HQYE 4GPTA 3RRZA 3MCAA 2CK3D 3EWAA 2V6IA 1AKYA 1G5RA 2WJYA 1UKZA 2RB4A 4OK3A 2O8EB 4MUBA 1TNDA 3PEYA 3CBQA 2N42A 2ZUDA 1DEKA 4IDHA 3PVSA 3C16C 4RKFA 3R7WB 1Z8FA 4ACBA 4NCIA 1OH7A 3RVBA 4MDFA 1R6BX 2I4IA 4OQMA 2C98A 1KYIA 2QSZA 2D06A 2GXSA 1KTVA 4KITB 5JI2E 3GCGA 2OCAA 3GJXC 2WOJA 1ESMA 2GCOB 4NTZA 4JVLA 4HATA 1E2JA 1T0HB 5JECA 1XB2A 1ZM2A 4GBMA 3EZFA 2FFBA 4V0MA 3RNLA 2R9VA 4JJKA 1J2JA 2CHVA 3TKLA 1Q0UA 2WPDA 4M8NE 4M9QA 1GAJA 3QNUA 1W4RA 4M1OA 3VTKA 4Q7JB 2VP5A 2PH1A 1TUIA 2VHQA 3M4YA 4W5HA 3DMDA 1BKDR 4URZR 5B57C 4PC3A 4H1UA 5GJBA 2B8WA 3MWJA 2VP0A 3QE0A 2H18A 5LPNA 3SHWA 1RRFA 2X77A 1E96A 1OFHA 3CF2A 1RE0A 2F3RA 1SVSA 1MO6A 1OKKD 1JALA 4TN1A 5LB4A 3GP8A 1KAGA 1P60A 4HB3A 1F2TA 2ODBA 4RCZA 3RSLA 3TGPA 4IHQA 1O87A 1QVRA 4JKYA 3KQLA 4M21A 3U3KA 3REFA 3UPUA 4NCNA 4XIGS 2VF7A 5HKKA 3TQCA 1PLKA 4TQ9A 4NBSA 2I3BA 3FPAA 3UWKA 1KDPA 1HE8B 1DG1G 3SFVA 3ADBA 3B78A 4PPNA 3NDPA 5JMTA 4WZAE 1E2FA 2GAAA 1Z6AA 5DI9A 5BWMA 5FI0B 4TTRA 3TUZC 4DIEA 1PJRA 3QEJA 2QAGC 5CYOA 1OHHD 2ZJZA 3VR6A 4PANA 5JJKA 1VCIA 3H2YA 1YQTA 3SJBA 4HLUA 2IXFA 4JLAA 4TL7A 3IQWA 4UNPA 3KKOA 4E22A 4F4CA 5J4KA 2O52A 4B32A 1G64A 721PA 4HAVA 1KIMA 1OB5A 2P5SA 3A37A 3FTQA 3THYB 3KQKA 1L8QA 3EA0A 1E9AA 1GNQA 3I62A 2ANBA 3BFVA 3FVQA 4I4LA 4QL3A 3GLIB 3GJ6A 3KQUA 3CIOA 2YWFA 3QIAA 3RC8A 2ZI4A 2Z6VA 4X8LA 1XTIA 3TVDA 1CP2A 2OG2A 3NEJA 4YMUA 4LHZA 1U9IA 2QZ4A 3WMFA 3FGNA 2ZIAA 2P67A 3NH9A 5CLQA 1FOEB 5DNYB 4M9XA 2NTYC 2BCGY 1UKVY 3QQ5A 3I32A 4WAUA 3V00A 4TQUS 3WNCA 4FN5A 2GKSA 1COWD 1SVWA 4TMTA 1XCMA 1SXJC 3FE2A 4L8GA 4A0GA 1P2SA 3B2EA 1T4GA 4Y0AA 3K9LA 3T61A 3IEVA 3A6PC 3X1WA 1NSFA 2ZI6A 4YMSA 2JDIA 2J7KA 2HLDA 2WAXA 2WTUA 1NBME 3D3QA 2NO9A 3REGA 1AA9A 4A8JB 5JSZA 2R44A 3MWKA 5CJPA 4PQYA 1ZCAA 1XJ0A 4D4LA 4Z8XA 1XD2B 2YC4C 1CKEA 5FPTA 2BMDA 3CF6R 4B2PA 3A4LA 2AFHE 4MKIA 2PL3A 1XJCA 3SBEA 1GILA 1NG1A 2WKPA 4NP6A 3FYHA 5F9FA 3ZVNA 1NN5A 4ZI3A 1T6NA 4D80A 3CRQA 2GJ9A 3Q5EA 1Q1EA 3H86A 2DHRA 2ZSFA 2A7QA 2W6JD 2R8RA 2YVUA 1C1YA 4GFDA 5CDFA 2OO7A 2Z4SA 2C2HA 1UKYA 3C5HA 621PA 2OBNA 3H1TA 3MFYA 3NH6A 1OF1A 3T1OA 4LYJA 2FN4A 2Q3FA 2ZAMA 4QHYA 5DHFA 1FQKA 1OFTA 4P0TA 1KI1A 2H92A 1EWRA 2QA5A 1N5LA 1OV4A 3TMKA 3ZD7A 1ZNWA 2ODEA 4DSNA 5L3QA 4O2RA 1P7CA 1Q1QA 2CL6X 5DO9A 1GKYA 4UXHA 2Z83A 3IQXA 3RRNA 2AN9A 4D4JA 4A36A 5AJVB 1OJLA 3NEYA 3OEED 3ZZ0A 1JR3D 1SVMA 4XOIA 3GLFA 1RVDA 1S9DA 1A4RA 1VCMA 5D3MA 4BWYA 4PZZA 2OE2A 1ZINA 2WWWA 3IDQA 3QVUA 2QP9X 1E0KA 2KB0A 1TPZA 2GEDA 3QXJA 4BFSA 1CJKC 1DG3A 3B9PA 3BH6A 1XEFA 4D81A 5JSZB 4DT1A 2HJGA 2LKDA 1RW4A 3BB4A 1ZIPA 3V9PA 2HUPA 2ORVA 5FOSA 1E1QD 3S1AA 3FKSD 1D2MA 2JCSA 2ZS9A 5EP2A 4LBVA 3H4MA 3I5XA 3F0TA 4Q4HB 2NZJA 2VSOA 4KFUA 2VO1A 4KO8A 2IHBA 2WOOA 2WJVA 5CM8B 4A0RA 3BD9A 1QDEA 2FJUA 5L3SA 2QPTA 4DRZA 5HPYB 3DEFA 5AR1A 4HEJA 3WYFA 1E0AA 2O8DB 2IX3A 3ETLA 1AN0A 5SZJA 3OIYA 1WA5A 3NC1C 4KI0A 2YOFA 3HYRA 2ZR9A 3MRSA 5TB5A 1NN3A 4ASUA 1LFDB 1P3JA 1N2CE 3VFDA 3DOFA 2EQBA 3K9GA 4JLBA 2IUSA 1XMSA 1SKQA 2R6FA 3U7EB 4BRUA 5IT5A 5AJZA 3G0HA 2O8EA 1KZGB 2ZRJA 2QRNA 3I8XA 1GG2A 2JAQA 1I4LD 1M8PA 2C77A 3K1JA 2QPAA 1UJ2A 2RAPA 3TK1A 1P62B 4TWZA 3NC0C 2R2AA 2YOHA 4DWJA 1G21E 4DXAA 5AWFC 2YV5A 3IHWA 1II8B 4XJXA 2RGGA 3LVQE 4NMMA 3PG5A 4B73A 2OLKA 2W0SA 3BFXA 2P5TB 3KUCA 1AM4D 2ORIA 3SI7A 5ELXA 4EFNA 3E5HA 4ZPXA 4ZDIA 4LY6A 2GCOA 4D4MA 1QHSA 3OAAD 1XJQA 4TMKA 3O8RA 2GEUA 3AVVA 1W0KD 1DAKA 4QJ5A 1C4OA 2IYVA 1F60A 2XAUA 4BZXA 5JCZA 1G19A 4MYTA 1QHXA 4PHGA 4LOAA 2FNAA 4U5XA 5IDVA 3VKHA 3L0OA 2JLVA 2ZQ5A 1N6IA 4V0ME 4Y0VA 2Q6TA 2IUTA 2REBA 4CIDA 1YU9A 4LX0A 2UKDA 4LHYA 1XCGB 4R71A 1G7SA 1UAAA 1CRPA 1MV5A 4Q1EA 1Y63A 3QF4B 3WMEA 1NKTA 4BQSA 1NLYA 1NLFA 3WRYC 4DDTA 1ZRHA 1FUKA 3KTAB 3ZVRA 5J47A 1EXMA 2EFDB 4L5BA 1LVGA 1DARA 2XTMA 3FHCB 5KDOA 4URXR 3EW9A 1II0A 4XH9B 2ZE5A 4PC2A 5FTMA 3AEZA 4EPTA 1XCPA 2J0VA 3OIVA 3EZ7A 4IEIA 5H68A 2BOVA 2LKCA 2YHSA 1TL7C 2GRJA 1DAIA 3AP2A 4G01B 4HUQA 1S3SA 2OLJA 2ZROA 3TLXA 1N5JA 1TU4A 1Z28A 4HAUA 1UKEA 1ZAKA 1HUQA 3AF2A 2NPIA 4N0EA 2QM7A 3OIWA 1MR3F 3K0CC 1KJYA 3X1YA 2P6NA 1N6PA 5JEDA 2HT1A 3QXHA 1SXJE 5EE0A 5EP4A 1OXSC 3D31A 2GZDA 1IN5A 1XEXB 4G5RA 5KSOA 1MO5A 1NI3A 2D2FA 3Q72A 4QXAA 2XJ9A 4EAQA 5AUNB 2R62A 5JHGB 3MD0A 5FOXA 1NNEA 1UBFA 1W49A 4Q19A 5IHPA 2H8KA 3TW4A 2XEXA 2VTKA 1VYVA 2GEVA 2B21A 2GETA 1DPFA 1E0JA 2ZI7A 1DO0A 4B3BA 4LBWA 2ZEJA 1YR7A 1QHIA 2IYYA 1KSFX 1W47A 2CE2X 4ESVA 2D74A 3PUWA 4LHXA 1IOZA 3NHBA 2A2ZA 2PLRA 3PQCA 2EWVA 3VNUA 4Q7MB 5DHAA 2D3WA 3EAQA 3IGFA 2WHXA 3LX5A 4JBYA 1V43A 2IXGA 2XNDD 1WE2A 3OFND 5FBWB 1JPJA 3ZS9A 4BUJA 4ZKDA 5H8WA 3P1JA 4A92A 3X1DA 4QNMA 3H0KA 4FMDB 1MRNA 1P2TA 1AGRA 1BIFA 2ZE8A 1CXZA 3RS4A 4F92B 1IY2A 1ETUA 1XD2A 4F4JA 2AWNA 2EWWA 1OIVA 3FFBA 1LF0A 2QT1A 4OYHA 1W48A 2PX3A 4QM6A 4ZO4A 3ZIAD 1LTQA 2QAGB 1QRAA 1H8HD 1KI2A 1VHLA 3RDPA 2J9RA 4MITA 3K0FB 1HV8A 4JBXA 2R6CA 4O0MA 1G41A 1OPXA 2F43B 3HU3A 4OHWA 4OBEA 5P21A 4J0QA 2VP6A 1N6NA 3HJNA 2WSSD 1S4QA 2G3YA 3DHWC 3FB4A 3IBGA 3PFIA 4DB2A 2XOKA 1R5OA 4NYJQ 4MGYR 2WM9B 3QOFA 1R0WA 4A2WA 4LJYA 5FPYA 4NPHA 2GXUA 5HZKA 3Q8XB 5JS7A 3QJYA 2ZJ8A 1IBRA 4DKXA 1R8QA 2F1IA 2WBLC 1IY0A 3QPWA 3LW8A 3QF7A 4KVGA 3GJ4A 2O8BA 3SR0A 1VPLA 2VHTA 4URYR 1Z6GA 3ZDQA 2ZS7A 2EFHB 4LDJA 3DVLA 4CEJB 4DUGD 4M1WA 2HYDA 5IRCD 2C9CA 3RS0A 1SXJB 2QEQA 1KO7A 5E7IA 2VBCA 3QEOA 3RHFA 4A8JC 4MRVA 3I72A 4I81A 2FSHA 4I1UA 3BK7A 4OQFA 3LVRE 2IS6A 4FCTA 1GIAA 1T0JB 4YQFA 1AQUA 4JLVA 3TUJC 3W3AA 1KSHA 1S3GA 1X8KA 1XTJA 3GLFE 4ZI2A 4PSVA 1OXUA 1W5SA 4TSFD 1JEDA 4D25A 2FZLA 3K0EA 2WWFA 3AH8A 1Z0FA 4P4SB 3F8TA 4XWOA 4B3FX 5KPDA 3AM1A 4AKGA 2BMEA 3GEIA 3F5FA 3Q9LA 3WHLA 1W46A 2WJGA 5HKKD 2EFCB 2VL7A 2FMXA 4UNSA 4PFSA 3W6NA 2GJKA 4TLAA 4Q4HA 3N2IA 4Q01A 2WV9A 1T9HA 3FHTA 1CF4A 2J87A 4OHZA 5EP1A 5FH9A 1E2NA 1KI3A 1MO3A 4R9UC 3TIFA 3DPUA 4U7DA 3AV0B 4BZQA 1KI4A 1WCV1 5DGXA 4TYNA 3PR1A 2GJAA 1YRAA 2RCNA 5GJWC 1CBUA 3EXAA 4D4KA 5J4YA 4YLGA 3AUXA 1NBMA 5JJLA 4QGGA 2GAOA 5EJEA 1EX6A 4CF7A 1KJZA 5AJYA 3SDZA 1GRRA 2PZFA 1OSNA 4R98A 3W5IA 4DSOA 4GL2A 3C4JA 2B7BA 1I2MA 1OYWA 1UBCA 2BBSA 4AG6A 3PJRA 3VKGA 2H1LA 4PXAA 3SN6A 2RGAA 4RD1A 1GDDA 1Z29A 3W34A 4BLQA 5KO2A 1RYHA 1II9A 2CCJA 1II8A 1OW3B 3U3RA 1FPMA 5CIQA 3SYKA 3A8TA 4GOKA 1BMFD 2ZE7A 3K09C 4HLQB 1X86B 2P6UA 3OZXA 1H8ED 521PA 3WBJA 3U44B 1G8HA 2FU5C 5BXQC 3CF0A 3DDCA 2JDID 4L9WA 2HLDD 3DKPA 4ZCMA 3IIJA 5JFGA 1AK2A 1Z6TA 4RVCA 2RHMA 4N0DA 1NMXA 1VIYA 2JATA 4LJ4A 3C14C 2C9OA 4Z1MD 2W2XA 2R65A 1U94A 2W83A 3CLVA 4W5WA 4KV9A 4EQ6A 1BO6A 4PQFA 3QSYA 3BERA 4GP6A 1E9RA 4IOKA 1NRJB 4XD7A 4I1SA 1E9SA 2NO7A 4B43A 2ZETA 4HUTA 5FR1A 5A5GA 2RGDA 2B6HA 3WXMA 1IXSB 4AYXA 2GTPA 2J7PA 1ZUNB 1L4UA 3QF4A 4OL0A 1EG7A 2Q9BA 4JIMA 4B71A 2ZJOA 2OBMA 1GTVA 3E2IA 3KTAA 3KX2A 4P4TA 2Q0HA 2ZRKA 2NZ8A 3KKPA 4CEHA 3SHFA 1DTSA 1KI8A 4QBHA 2CBZA 2QQEA 2XSZA 4URWR 5TXGA 2V1UA 4IVRA 2H7VA 2VHCA 3T1VA 4MA4A 2OAP1 2QGNA 1RRCA 4RY2A 4M9ZA 3TAUA 3ND8A 2DFTA 5FUWA 1WRBA 1FP6A 4ZKEA 2DY1A 2BVNA 1D2EA 2C95A 1LB1B 1XTKA 5J4HA 3VKWA 3EASA 4DLYA 3LY5A 1QBKC 1G8GA 1XRJA 4I99A 1R0ZA 1JB1A 6Q21A 2DFLA 2OCPA 1BS1A 5HCNA 2RH5A 3RLFA 2ZJBA 4PC6A 4E09A 2JLYA 2IS1A 3AGQA 3N5CA 5C2JB 1XTQA 2PMDA 1O3YA 1T5LA 3LD9A 1ZM7A 2ZTSA 3OESA 1U98A 4NYMQ 4NU0A 5JI3E 2RGBA 3W3ZB 2YC2C 2D62A 5EXSA 2VEDA 1JJ7A 1GITA 5JWRA 3T34A 2QQ0A 4URVR 1J70A 3A1SA 1G16A 2CJWB 4IFEA 4HAZA 3MJHA 1JQLB 4AIIA 5BN4A 3ADCA 2JEOA 2LCFA 3LQRA 2UZ3A 3LDAA 1AZTA 1IAQA 2JLZA 3ADDA 2GBLA 2J41A 1KO1A 1OIWA 3PENA 2J0UB 3DL0A 4FCWA 4PSAA 4BFWA 1K5DA 3CB4A 2MSDB 1DE0A 4HB4A 1A5TA 1FNMA 5GJVC 5KNBA 3GLIE 2C9YA 2UVQA 1KK2A 4JVMA 3ZZUA 5BYKA 1SKYB 2DYKA 4NYMR 1NJGA 4QGHA 3TH5A 4LJ8A 3CX6A 5KDLA 2BEKA 1P61B 3NWJA 1HY3A 2YWEA 4NDZA 1G20E 1ZNZA 2FOLA 1GWNA 1LY1A 2AD5A 4WXRA 1YVDA 3AP1A 1KMHB 2IWRA 3ASZA 2VLIA 2AX4A 4F7WA 4BPBA 2EVWX 2GDJA 2XZOA 1L7VC 2ZSBA 3UMFA 2WWYA 5AJWA 2WJIA 3TVTA 2WAYA 3K53A 2IYLD 2WJHA 1CS4C 3QKUA 4RD0A 2FEMA 3FHOA 1XXHE 2EYQA 3E1SA 1AS2A 2QAGA 5K8LA 3LRPA 1XD9A 1G7RA 1UDWA 3K0FA 1FTSA 1ZD1A 4PO9A 1G1MA 4NZYA 3ZZTA 1FL9A 4G5GA 3MWYW 3UIEA 1J90A 2CCKA 1TQ4A 2GBLC 3NBXX 4MUAA 4LJAA 1G18A 1M7GA 3A1UA 2GJ8A 3AQ4A 2G1JA 5K8UA 5L3RA 3MWLA 1T8TA 4QJ4A 2KBFA 1S0UA 2Q3MA 3LBNA 4TLCA 4QHTA 3SC3A 4DCUA 3LLUA 2KI5A 2QP3A 3GJ5A 1WP9A 3MLEA 4YONB 1Z47A 5FOTA 4V0KA 1RC8A 1KNQA 1Z6XA 3U7HB 3X2SA 4OQNA 1P5ZB 4CEJA 1LNZA 3TE6A 2QP4A 5HE9A 3ZLJA 1OB2A 1SXJA 2HCBA 3GEEA 5DIFA 4OI1A 1AJEA 1FQJA 1TQ6A 1E0SA 4B3XA 2WMNB 3L0PA 3L82B 1FZQA 2GJSA 1G7TA 1JR3E 2XITA 3WNDA 2NO1A 2WSMA 4LK2A 2BJVA 1XX6A 1US8A 4C0KA 4C2UA 1YZQA 4P4SA 4JBWA 2JJ2D 2AD1A 1J8YF 3B1ZA 1DOAA 1YKSA 1NIJA 2V1XA 5EUMA 3ZYCA 4BLPA 3R8FA 4OHYA 3RS3A 3MSXA 3CNNA 4C3ZA 1R0YA 2BMFA 4QBGB 1JI0A 4A9AA 3GLHB 4HDQB 5LDDC 1E69A 3SS8A 4YXWD 1FX0B 2GWHA 2XTNA 3K0AB 1SVKA 1NVXQ 3W5JA 2B7CA 3GQBA 3EPJA 3ZVMA 4ARZB 4NCKA 5G41A 4LWZA 3QUSA 4Q4AA 4IXMA 3T1TA 2P6RA 4JT4A 4BZPA 2A5DA 4TTPA 1KO8A 2CNWA 3LA6A 2VPPA 3T5DA 1A82A 1IXZA 4B34A 3PV0A 4EPXA 4PPFA 1EWQA 1E3MA 5EE5B 5E95A 2W6IA 5AK0A 5GVRA 3CRMA 1NP6A 4RFSA 3I5YA 4Q18A 1JR6A 1N0VC 1S8FA 1OE0A 3CKLA 1N5KA 1XXHB 2OSBA 4LYHA 1RJ9B 2QPOA 4GP7A 4HSEA 1VG0B 3QPVA 4PZYA 1GL7A 1J7KA 4KFTA 2IYSA 4F4IA 1G8PA 1CR4A 3Q3JB 1KHTA 4PAOA 2ZPTX 2QMUA 3AB3A 5DH9A 4AYWA 2F1HA 2HDNB 4WVFA 3HWSA 4BFVA 5KNCA 1GRQA 4TLDA 1NKSA 2AWOA 5D3QA 4ESHA 5FL7D 4MH0R 5HCIA 1BYUA 1TADA 1E9BA 3OEHD 1XEWX 1W1WA 3KDSE 4W7SA 1G4AE 4D82A 5CB8A 4BEBA 2FGJA 1HURA 5DN6A 1RRPA 2PT7A 3U44A 4GDFA 3CX8A 4A1FA 2V55B 1OT3A 3WBKA 4HLCA 3THWA 5UKDA 1AS0A 3VR2A 5K8TA 4AD8A 3LNCA 1ZUIA 1U90A 1LW7A 1P75A 2ZYWX 4KYUA 1G9XA 1WB9A 1ZJ6A 1RYFA 5KHOC 1QHGA 4GNKA 1ODFA 4TMVA 3U6BA 1WXQA 4I1VA 3OIUA 1G3QA 3M1IA 4ABYA 5FOUA 2P65A 2ERYA 4C9BA 1UPTA 2C96A 1I4TD 3WRXC 4CDGA 5FPKA 2O8FA 3O8CA 1KNXA 4TYPA 1KKLA 5FBLB 1VHTA 3A36A 3ONWA 2W00A 4EKDA 1S1MA 2RMKA 2BKEA 1E79D 2QY9A 3B85A 4LPKA 1EESA 2QENA 1MABA 1HQCA 2ZAOA 3ZVLA 1XU4A 1YR6A 2X2FA 1E2LA 1XMJA 3KJHA 3OE7A 2W0MA 4US0R 4UJ5A 1GUAA 2VRWA 4XSGA 2G83A 4RZ2A 3NKVA 2GVDC 2CCGA 4HI0E 3W8RA 5BN5A 3L2OB 1E32A 2N46A 1KMQA 3NHAA 3IILA 1UBEA 3VHLB 1EFRA 3HYTA 4X8OA 5IK2D 3CR8A 2JIZD 1QG4A 5ANRB 3TNFA 5CIWA 5EP3A 2A5JA 5BW8A 2GNOA 1E1RD 3IIKA 4NYIQ 3WNBA 5CLLA 4B3DA 4WZ6A 3KQHA 1UADA 4MGIR 4LYAA 1KI7A 3ASYA 1TQ2A 4OJQA 5LB2A 1XPOA 1S2MA 4Z54A 2CJWA 2BBOA 3LX8A 1TF2A 1CULC 1QF9A 1W2GA 5FFMA 4RZXA 4IOJA 3TR0A 1A2KC 2CLSA 5FTKA 3FWYA 4LRWA 4PX9A 2CK3A 3AKYA 2ERXA 3MUFA 2J0UA 4JLPA 2DWPA 2EFEB 2F55A 3CM0A 4B48A 4Q1BA 4KYIB 1CU1A 2IF2A 1YZNA 3F3YA 2L0XA 4FXPA 4Q5IA 4CVNA 1T8UA 1DAHA 4NYIR 2GHIA 4YC7A 2KE5A 5G53C 3U3JA 2AK3A 4Q47A 1LS6A 3DM5A 3R8CA 1TU3A 4M53A 3HU1A 2X19A 1QG2A 3SJZA 2IYUA 1AQYA 1YZKA 3R7WA 3UXMA 4AC9A 5JEEA 1ZC4A 1CJUC 3B82A 4S35A 4A6XA 3W6PA 2ZRDA 4DEXA 4TMWA 1ZM3A 2OAQ1 2J3EA 1QVAA 4XSHA 1XZQA 3WP0A 2D7DA 3EPLA 4KFSA 4Q4JB 3D7MA 4A2PA 4Q9HA 2QU8A 3I92A 4G1UC 3QKSB 4ZDWA 3PEUA 3UMRA 1TX4B 3BJIC 3CZPA 3K0CA 4IKEA 1R2QA 3RS2A 3KKNA 1U0LA 5AUQA 3BRWD 3W8NA 2C8VA 1NVVR 3L8YA 1E94E 5EE3A 2HEIA 4MYCA 4NE2A 3TQFA 2V8OA 2BEJA 1FUUA 4TMZA 3RRYA 5HR5A 4ZDJA 4YMWA 2J0SA 3ZGXA 1IY1A 2NPFA 4DCTA 2ZVQX 8OHMA 5JCPA 5J4LA 3U60B 4P32A 4JL6A 2OT3B 1GL6A 1E98A 1N6LA 2HYIC 1N25A 1WQ1R 2QNRA 5BYJA 3SJCA 121PA 2D7CA 4NCJA 4QFMA 2BC9A 4S2EA 4EPRA 2KBEA 4FWIB 3VR5A 5K8IA 4V0NA 1F48A 2RGXA 4AURA 4Q48A 3MAAC 3P20A 1NVWQ 2Z43A 4BLOA 2IYTA 4HB0A 5HE8A 2JJ1D 3R9IA 5E7JA 3K0SA 4CZ2A 2QM8A 1QZXA 5EE1A 1D8TA 2ONKA 5CJ2A 4HZIA 2A5FA 3C41J 2C99A 2ZRGA 4PAMA 1OHHA 4EPVA 2QAJA 3EIEA 4P4UA 2XSZD 2VIIA 5JRZA 3KJGA 4ZCLA 4IRUB 1GP2A 4W5JA 4B3CA 3SFZA 4IXNA 5JWHA 5J40A 4MKFA 3GJ7A 4A6PA 1U8AA 4NH0A 3THYA 1IJEA 4QBFA 3R9XA 1Z6YA 2GF0A 5CK5A 3GLHA 4DHEA 4W9MC 2XB4A 4TT3A 4LV5B 2QE7D 2YYZA 3K0AA 3DMNA 3GLIA 4HAYA 2ECKA 4BFUA 4ARZA 4C7OB 3VR4A 1YR8A 4HB2A 3ND9A 1Y3AA 3GFPA 3SQWA 4DB4A 1EFTA 2BJWA 2GXQA 2F1RA 1MT0A 1M74A 2PBRA 2V9PA 3A58B 3KFXA 3KKMA 4Q7LA 5C46F 4TZ6A 1DAGA 5E3HA 3LH5A 4E03A 1XWIA 1RRGA 1E2PA 3DO6A 4HDCA 4BRWA 2XXAB 3QXCA 1RPZA 4TYWA 1Z0AA 1NL3A 1COWA 1X3SA 3U4QB 1EK0A 1E9EA 2ZRFA 2GF9A 4LUCA 3G5UA 1E2GA 1Q1BA 1KSJA 1N0WA 2H57A 3D6TB 1AGPA 3EA5A 2J45A 3CPEA 2FPKA 1KI6B 4LGMA 2P3SA 4TLEA 3KB1A 1XXHA 4PAQA 1RJ9A 3MJRA 2V6JA 2G9NA 1Q57A 4A8JA 2V7QA 4DLWA 4KHZA 4URUR 1KI9A 1D9XA 2OUKA 2WKQA 3AVWA 4RD2A 4ZV4A 3K70D 5EQTA 4PSKA 4POAA 4YDSA 4AKIA 2C03A 2GA8A 2ZJYA 5SZIA 2RGCA 1PUIA 2RGNC 2ZRBA 3HDTA 4FMCF 4C0LA 2QRZA 3VR3A 4CT5A 1XPRA 1E4VA 1KZ7B 2C04A 3BGWA 2ZU0C 5FTNA 3W90A 2QI9C 5EE9A 4V02A 4DLXA 2OBLA 4H1VA 4TL9A 1WBDA 4JVNA 4FW9A 4D0NA 2XGJA 5FPHA 2X1VA 2W2VA 1GZSA 3EG5A 3PUZA 4M1SA 1VTKA 4ON9A 5B64A 1U8ZA 1XNJA 1XD8A 2WPDD 3KB2A 2VQSA 3AVOA 3GEHA 1G291 3RWOA 1ESNA 2HV8A 2IC5A 2ZYUX 4QOSA 4TYQA 4MDEA 4IDNA 5DYIA 4DVGA 4II7A 1DADA 4Q02A 3OEEA 2GVZC 3U7FB 1JR3A 5CK4A 3KJEA 4B76A 4KXFB 4KSCA 4A2QA 4V0OA 4IVQA 2CXXA 1S9HA 3GLGE 1IM2A 1KGDA 4LV6A 1YHNA 1VYUA 2IXEA 2NQ2C 4YDHB 3AKEA 3AVPA 3P32A 1GM5A 1A1VA 3U2QA 3TBKA 3GPLA 1BOFA 3BIFA 1Z2AA 5BN3A 1R4AA 3KFVA 3AVYA 1OYYA 5FPSA 3I8SA 2G1KA 1ANKA 221PA 4BE7B 3CUEF 1G6OA 2WMOB 3TSWA 2BMJA 1XTRA 3A1VA 3FKSA 3BB1A 2ORWA 2A5YB 3PITA 3K09A 5AUOB 2O0HA 2ZJAA 3TW8B 3R20A 3VU9B 3LV8A 3QXXA 3DM9B 2Q21A 1IXRC 4GMXA 4ITRC 1NN0A 3AP3A 3VNVA 3SJAA 4DLSA 3GJ0A 1X8JA 3AVXA 2DBYA 4Q7KA 1TTTA 4QG7A 2O8DA 4LV8B 2IYQA 2EU8A 4IEEA 2D2EA 1G3UA 4DLVA 1FW6A 1Z22A 1M1YE 3AGPA 1Q3HA 2YWHA 4HYYA 2F1JA 4UNNA 5KYKA 4PPGA 2AR7A 3UMSA 2BM0A 1DAEA 1Z0JA 1PLLA 1XMIA 3PCRB 4ACAA 1GSIA 1Z5ZA 2PLFA 3RYTC 3FMOB 4M2LA 2OEPA 5FBVB 2O0KA 3CPHA 4PQRA 3WHKA 4DJTA 1R10A 2QL6A 2ZRPA 3U3MA 2PJRA 2J46A 4AG5A 5KU1A 3QBVA 1SKYE 2IHYA 4MQBA 4LYFA 4MYHA 4MYUA 3JZMA 4EJSC 3HR8A 3RAPR 1PUJA 2BV3A 4DBLC 1G3IA 4C0JA 1XBTA 1ZP6A 421PA 4OI0A 2MSCB 2W6ID 3PUXA 1JXMA 4KAXA 4Q4JA 2A78A 5FTLA 3OAAA 3ZJYA 2OZEA 1GVNB 3QPUA 4I1OA 1W0KA 2BBWA 3QKSA 2W2TA 1EGAA 1D2NA 3ADKA 5CYPA 4EDHA 3QG5A 2HF9A 2NO6A 1P9RA 2ZRHA 1CJTC 2CVFA 2OESA 3EC2A 4DSUA 4ZIRB 2BIFA 2ZU6A 2N1BA 3T5GA 2IK8A 5E4FA 4O3MA 1W36D 4GT1A 3FFAA 4XWAA 3NXSA 4R7ZA 1OH8A 4XTRA 3QXSA 4C0HA 3V4RA 4RCYA 3IHLA 1T3SA 3QKTA 4Z8YA 1A7JA 1LF5A 5SZKB 4G5SA 4U00A 2NOAA 3DKVA 5HTKA 2E9SA 3GLGB 2EFGA 4Q21A 5C1BA 1TMKA 1W4CA 2ZRCA 4M9SA 4OI2A 2QMOA 3BS4A 2A30A 2FGKA 2OFXA 4FCVA 2VSFA 3EC1A 3PIRA 1Z63A 3HR7A 2H16A 4DZZA 4OQLA 4LJ9A 1U81A 2MSEB 2PX0A 1R0XA 2WVJA 3IO5A 1E2KA 2HXYA 1KY2A 1VYTA 4PC1A 5EUQB 3X1XA 4C4PA 3I61A 3L0SA 2ZRLA 4KSBA 3LW7A 1CR0A 2GCPA 4OHVA 4OHXA 2ODWA 4ILEA 4QJ3A 4JZKA 1FFHA 2ZREA 2G0NA 3FMFA 3VR1A 1G8FA 3V4FA 1Q12A 4C2TA 1XEXA 1TAGA 3AKDA 4QNRA 5HZHA 2DWOA 2GESA 2FDCA 5KSZA 2FFHA 1YJ5A 2ODNA 2IWHA 4C0BA 4CEIB 3P4YA 2CE7A 4XVQA 3T15A 3BH7A 1E2QA 2G0TA 3BE4A 1XTSA 4IW3B 1VIAA 5B58C 1KDOA 3S1AB 1ZM4A 2FA9A 4RSGA 3IIMA 1G5TA 2ZSDA 1YZGA 3CRVA 1KK1A 3GLHE 4QKQA 3RSOA 4M1KA 1SVLA 1Z07A 2E87A 5FTJA 5E7MA 1GFIA 1G8YA 2QGZA 5EZ6B 3UATA 4B74A 1OXXK 2XXAA 3FDIA 2J1LA 2WWXA 2W58A 4JLJA 4B33A 3U4QA 4AKEA 2OFOA 2YKGA 1XDBA 2XNSA 4UJ3A 2BKUA 2YZ2A 3EIHA 1ZMXA 3B6EA 1W2HA 2VP2A 3EX7C 3OFNA 3B1VA 3CONA 4QC2A 4LPSA 4DCNA 2DWQA 5DI3B 2ZITA 1E6CA 2PEZA 1VG8A 5B30A 4PHHA 2J5XA 4ASUD 1RIFA 4G5QA 4PPQA 3E70C 4TLBA 1M34E 4D0GA 1X1RA 3U6KA 1TF5A 4E07A 3EPHA 4QRHA 3CZQA 1X8LA 3VAAA 5BQ5A 3TJZA 2JLXA 1Q22A 2B8TA 3ZIAA 4DEYA 1H8HA 3BWDD 4PO1A 1F5NA 4C0AC 2ZM5A 1FMJA 4GSYA 4WW0A 2NIPA 4L15A 5FL3A 1E9CA 4GZLA 3PUYA 3Q85A 4B75A 3Q7QA 3BC1A 4B6EA 2F43A 2QMHA 3BOSA 4LHWA 2WSSA 2QUZA 4BFXA 1U0HC 3MG9A 1MOZA 1W5TA 1CR1A 2DCUA 2PEYA 1Z0DA 1GNRA 3FMIA 2ATXA 3MGCA
chains in the Genus database with same CATH superfamily
2JLSA 2QUKA 3L6CA 2B4AA 2Z4RA 5E1MA 5L7WA 2OKCA 3FTEA 4WXPA 4FHFA 3UKDA 3SQNA 2NO0A 4FSXA 1MB9A 3U4IA 5KJ6A 3ED5A 1DWPA 2FZEA 2X0JA 2K2QB 4M0LA 5LZ8A 2IYXA 3ZX5A 2FKAA 1C9KA 1DDOA 1VG1A 3OD5A 2QTNA 4G5OA 4L74A 1EP2B 4NBLA 4F45A 4FILA 4TL6A 1RYNA 3VX4A 4WV3A 4V0RA 4G89A 4XFDA 3K70C 1QH1A 2J33A 5CFOA 5KSWB 2F62A 1JR4A 1DAFA 3RYFA 1E99A 1A8PA 1CB0A 1RQNA 1XA4A 2P4HX 4QUDA 1UDXA 3IXLA 4WZBE 3SX4A 1IBKB 4DR7B 1Z74A 2HZ7A 3N5KA 2F8MA 1LVHA 2NYRA 3KEOA 3PHIA 4XIIA 3WZMA 2QTLA 2RGWA 1WUHS 1U7PA 2L18A 5EIOA 2AMLA 3OKPA 4AF8A 4RF3A 3LX6A 3RS5A 4GLBA 3SM9A 2FZCA 4BKQA 4NH4A 4I8IA 2DRIA 3UFXB 2MYTA 2XYVA 3DP7A 2QVLA 1EBBA 3DBHB 3ONVA 4Y2GA 1Y4UA 1NPTO 2OVFA 2YTZA 4G4JA 3K5IA 4ZO8A 5GQSA 1ORTA 5H02A 5KVVA 2HIAA 2H52A 3NHKA 1T36B 5DLPA 4DFDA 1ZJZA 5ELLA 1VE5A 2RI0A 4R9SA 5JS2A 3DONA 2BHTA 5H70A 3G2MA 1I2BA 1XSEA 4Y2RA 1U3VA 3TIVA 4BX2A 2JJQA 2EFYA 1JA9A 1R5NA 2AF3C 1OX4B 5CB6A 3MM4A 5JNLA 1UBNA 3H6HA 3LVFO 4MVJI 1IL0A 2P0EA 3PXBA 4CTOA 4NKRA 1T9GS 2HA5A 1DHRA 1M6NA 1G4HA 5C7OO 2HHHB 5DSZA 1VG9B 1UANA 3EBOA 3HUFA 1QDLB 4Z1OA 5L8VA 1M34B 1FDRA 1ZNXA 1CPYA 3OZSA 3R3ZA 4V0LA 5TEVA 3TCNA 2XB2A 3JWEA 3OP1A 3R5FA 1C30B 1FDSA 1EFHA 1V25A 3KZXA 4A4DA 5I7EA 4PC7A 1TYDE 3IAS6 3QOWA 1XP8A 4GBGA 4P86A 3U4DA 4CL8A 2C4HA 1HGXA 5IDYA 1NI4B 3E53A 4I3FA 5LOVA 2EIXA 1MW8X 2HNAA 3VPAA 1FTQA 2V6BA 3G0IA 4Q3AA 3GCZA 4DLBA 4WVLA 1ZGAA 1A96A 1KMMA 4Q1AA 4KUGA 1K3UB 4D0LB 3ZDEA 1AKMA 3RHZA 4B6QA 1N6OA 4LC0A 4QULA 2ZIEA 3A06A 1C7IA 1BMQA 3KYBA 5BSKA 3ACBA 4JL8A 4C6TB 4HRXA 4IV8A 2FPSA 1P72A 4MRNA 1RYZA 4M4SA 3V8RA 1JB9A 2F9MA 4WOPA 2HGZA 3Q3HA 4JIGA 3H1PA 5T7BA 4K8OA 4PTLA 2OL4A 3QY0A 2WTEA 5GM1A 4K6MA 4V0SA 5L3VA 1Z5VA 2WVGA 2AG1A 2Q1UA 3HWX1 4Q4DA 4MAAA 4EKNB 2C00A 5IKMA 3B70A 3LCMA 2BTOA 3AC0A 1I2CA 2J5RA 4M0PA 4M1MA 4NHOA 4TWAA 2AEMA 2C2WA 3WQSB 3FUVA 1W29A 1TEVA 2PO5A 3QE9Y 1PX0A 1U7HA 9ABPA 5DEIA 1P31A 4CM5A 1XF9A 4OLJA 4U2GA 2VP3A 3STVA 1ECGA 3PUKA 1K97A 4GC5A 4E4TA 3T12A 1DKRA 4MPPA 1KBZA 1T0UA 2QX4A 4ERNA 4K7JA 1WKVA 2FFAA 1N2OA 4M98A 3RVMA 1XZHA 2FPMA 3IYLW 2Y1FA 3BORA 5K99A 4S1NA 3JQRA 5FLEX 3SVZA 3SZRA 2OAGA 1YA6A 1LV7A 3O4HA 4CIXA 3C5CA 3FB1A 1FBTA 4JK3A 3VI3B 4ZI7B 4EJ2A 2ZG6A 2ZYVX 3RSZA 3VVCA 3TNYA 1TCUA 3FWHA 4N3NA 3AUYA 1RHRA 4ZODA 3P2OA 5M2QA 2XUHA 1WS6A 2F3SA 2R47A 5FFNA 3RG2A 3RR2A 2XUGA 4OFWA 4E08A 2SKDA 2ZI3A 1IN6A 3RIEA 1X7DA 2HF8A 1KZ9A 1GPH1 4GGOA 4FKMA 4MMYB 2FEOA 4XOUA 5EIFA 4B81A 3LLMA 1UBKS 4GH5A 4LWPA 1LUAA 2WKRA 4WZAB 3T95A 2Z09A 3WGTA 3WK6A 1KAQA 1WVMA 5B37A 3LPMA 4YP6A 1JAHA 1W36C 2WTMA 4M54A 4PYMA 4R40A 4F93B 1XZPA 4OJKA 3I73A 3G1WA 2HCRA 4K6CA 2V96A 2YWRA 3ST7A 5JD5A 4IJKA 1H0SA 2G40A 4KO1S 5JNVA 1O97C 2FVXA 1WZCA 3A1EA 4N12A 1N3YA 1XOIA 4ZGWA 5ITSA 4U6NA 4CEIA 1PIWA 3IDOA 1ZD2P 2I78A 1RZ3A 2ZBQA 1Q7GA 2BSAA 2MR6A 3CLRD 4R9VA 3UY4A 4CMKA 5T4FA 1TLFA 3G0DA 3ZHUA 3THXB 4RD6A 2YZKA 1GGFA 1QKIA 1RD4A 3ZHSA 2JVJA 1RZVA 3WY9A 1PVVA 4EHJA 1QXSA 1U5BA 2I55A 1G5PA 4A0QA 4YPVA 4B7CA 2SHKA 3FA2A 4CM4A 4MYDA 4I2VA 4X62B 2NW6A 3R7LA 5AW2A 2H4WA 3PDIA 1RPTA 5CNIA 4AF7A 2ZB7A 4QODA 1OAOA 2VH2A 1Y48E 3KLOA 4CI9A 4ZMBA 2A0XA 3MELA 1CLUA 3MOSA 2VPQA 2R8ZA 3IOCA 1Z35A 5EESA 3QA3E 2FAXA 2ZUVA 2LZ0A 2V3VA 3FF1A 1UBTS 3UJNA 5A0TA 1J21A 3BFKA 1TJ5A 3OLCX 2G88A 3RVJA 3AONB 2ZI9A 3BL8A 4D97A 1G59A 5AW1A 4DSTA 4KYTA 1R6AA 4XPIB 3ZIDA 4MUNA 4IGKA 4OU5A 4IX1A 4X7RA 4DW8A 4E4YA 1J7JA 1H2AS 3P9CA 5D8DA 4N5LA 4HZUB 1X80A 2BFDB 5CA1B 1AUVA 4P08A 3IKJA 4UEJA 1JBKA 1WDTA 1SEPA 1RWWA 2XMCA 1TC1A 3D0RA 4HMPA 2GD0A 5JY1A 2QTFA 1M2OB 1QWSA 2F7SA 3HXOA 3I6YA 1IQPA 4WY5A 1W94A 2Y66A 1IN8A 3MW8A 3NRBA 4Y8VA 3MCVA 3UA4A 4E21A 1Z3IX 2YIVX 3V4ZA 2DKFA 2VBIA 1ZKDA 1RI5A 1W8DA 1GZ7A 2P5YA 1U2EA 4MA0A 4QFDA 3GFBA 2JI6A 3SU8A 3NYWA 1BDMA 1L1RA 1PHRA 3BQNB 1F3OA 4G0PA 3IPYA 3R7SA 3PEWA 1T3LA 2ZS8A 1FU4A 1P3Y1 4XGQA 5HFJA 1G60A 3AI3A 1BQEA 1HA3A 3QLUC 1PWEA 4UNIA 3DWEX 4JSYA 4YACA 1PJLA 1ULAA 4WKPA 1CZUA 1TUEA 4E5YA 3ZWYA 3AO0B 2LWIA 1LZKA 3ZU3A 2FSGA 1NW8A 1ULTA 3D3WB 3QE4A 4LYGA 1KVRA 3ZI0A 3D2LA 1K6MA 4X60A 4BO4A 5D3KA 3T9DA 3ZCUA 5KSYA 1J2EA 5M04A 1M1ZA 2EYUA 3ANLA 2HJRA 1JECA 2I4TA 4H7DA 1T2FA 1FP7A 1PNQA 2XVZA 4IDBA 2WICA 3U7GA 4HY3A 1R8XA 3I2HA 4HNSA 4WKCA 1NVAA 4HWTA 1Q0QA 4XD7D 1A1SA 3AHHA 5A4JA 2JGDA 4B2IA 2GM5A 4Q3DA 2GUGA 4WGGA 2Z8YM 4B6RA 5AVYA 3DE6X 1YULA 2J7PD 4U02A 1GQYA 2JFVA 3EGDB 3CS3A 2AVDA 3E9ZA 3L43A 2A3RA 3GOQA 4F8YA 2F00A 3O4JA 5K0BA 2GBCA 1A2QA 5T8KA 3M4ZA 1BVYF 1CIPA 1LS1A 4DCSA 4CWAA 1Y82A 1U0NA 1PJQA 2QTZA 3IOEA 4DR6B 1TAUA 4KU4A 1HLFA 1WF3A 2B4QA 2ZXUA 1MZVA 3LLVA 4PNEA 2C8KA 5DRYA 5GJCA 1YDGA 2HBQA 1NX9A 1KAOA 3B38A 2ZJ1A 3OOSA 4PFQA 4CN8A 1BAPA 4LJ7A 1EE1A 1ECBA 1INLA 1HH4A 1Q21A 2JJ2A 2PWAA 2XCOA 1C3EA 2YJ5A 3GF4A 4G4SP 1GHTA 3JAKB 2BGNA 4IFIA 3ZYZA 1WEHA 5IVPA 2XKKA 2K2WA 4TS9A 3UFXA 4YUXA 1X7YB 5F3WB 4FGWA 3GAZA 1G42A 1DBSA 2BP7B 2P6PA 2HU2A 1G8SA 1KK0A 1SEVA 2O3RA 1NW4A 1FX0A 1P19A 1SKBA 2ZPUA 3H75A 3ZWMA 4DAEA 4XVCA 1UJ4A 4X3PA 4J1TC 1H2FA 1CVIA 1A2BA 3OT1A 2GCNA 4GBED 2G5CA 4JC8A 4KLNA 5F77A 3MN1A 2C42A 3JW8A 1U2RA 5DTJA 2ZBEA 2J0EA 3HYLA 2YICA 3WVNA 3HJFA 1I4OA 1PL8A 3T3PB 3PPYA 3GEGA 4LSGA 3VAZA 5JWOA 2P0AA 3GLTA 3L93A 2VYVD 3PUVA 1OX4A 2FCAA 4G0NA 2MOKA 3P8ZA 5F1YA 1ENPA 2M6LA 5LXTB 3V8QA 4KREA 3QYAA 2VHYA 2P77A 3QMWA 4KXXA 3WKDA 2O6HA 3HCWA 1N7IA 1Y3HA 2AFIE 3DOCA 2FP4B 3D3KA 3IB3A 3ZI7A 2XW6A 1N2CB 2NAFA 1B0UA 3F5SA 3FOZA 1M34A 4R2KA 4HMQA 3COVA 3FZNA 2Y1DA 4QUKA 3QYJA 1K3FA 4HD8A 4Q1VA 3KR1A 3I9LA 1ISJA 2WIFA 1W1UA 1GG9A 4ZC8A 1GOTA 4TUYB 3KTOA 2GEBA 4HKTA 1WXGA 2I6UA 1LV8A 1NI4A 1Z5UA 2BGUA 2VCEA 2WM2A 1ZK3A 4L50A 5FUXA 2PMEA 1ISSA 4NQRA 1CJSA 3WSVA 4O33A 5TMPA 4I4TF 3T9EA 3B51X 1UWKA 4D42A 3FUTA 3M7IA 4DKJA 2OP1A 3QUQA 4PPYA 2Y3IA 1RRMA 2K7ZA 2PX4A 3GHHA 1RXSA 3O95A 3OEHA 4TTJA 4DLZA 1OOEA 3GHYA 1H65A 2P6MA 1MDFA 1ZCBA 2PPVA 4WK6A 3K8YA 3T3EA 2QJFA 2M6KA 5I7HA 2BGTA 1V47A 2K6GA 2ZSAA 3ILHA 1SZPA 4UDYX 4FMPA 3RCBA 2NSHA 3Q98A 2JVIA 2Z5GA 3EH2A 2GI4A 4FI3C 1XDGA 3D2AA 1RM4A 4ESOA 5JDIA 1A8QA 2OKGA 4KX3A 4IDOA 4WGFA 4TZKA 5B12A 2H8GA 4L95C 3D8HA 1KO5A 4KODA 1IULA 3ZTYA 2WB2A 1GTRA 2Q4OA 5E6RB 1R8YA 4ZQFA 3UK2A 2FF7A 2QN2A 2VF8A 3Q2KA 4H7HA 5K3EA 4Y1FA 5AVJA 2XX3A 2WD8A 4D96A 4EF6A 3AM1A 4TZ0A 1LBHA 2QR3A 3AF4A 3PB3A 3BBPA 1K88A 2J0QA 2C9ZA 4D6PA 1N0UA 1TEXA 3RT1A 1M9NA 1VLJA 2BKVA 1RNLA 4C4XA 5CLIA 3S1LA 1ZX1A 1GTZA 1K5GA 1U2SA 3NG1A 5JC8A 5K3OA 2EF1A 3Q5DA 1CZKA 4TV8A 4MO2A 2OCGA 1A9PA 4LMPA 3TLBA 3MS7A 2B61A 1VKOA 2HADA 2DB3A 4ZI7A 3CVVA 1JWBB 5HF5A 3ZR4B 2RI6A 4F91B 4HH4A 4Z7OB 1EZZA 1TT5B 5IF9A 1UEJA 2ONYA 1F1BA 2PJUA 2QTHA 4JYCA 5JG7A 1H2XA 5CPFA 2IW1A 3IPXA 4JDPA 4H4EA 1K7CA 3IUNA 4YO8A 3J81k 2E49A 3NVAA 2H2FA 5EIBD 4BFZA 3HCNA 3RYCB 1GRNA 3CUWA 1V5WA 2A5GA 3HPQA 4FDUA 4KI7A 1X70A 4PCUA 4UXIA 1CUVA 3WLAA 4AULA 2LXNA 3GWGA 4XX0B 2XDYA 1NP3A 2JIZA 4MGKR 2KWIA 2B0JA 2B92A 3IPCA 3VV3A 1AZLA 1E1RA 3BH0A 4B2LA 3HNOA 1LBEA 1KDTA 1CERA 4B6OA 3DNPA 4RDHA 2LNDA 2VH5R 5AVUA 5IEJA 2IHNA 5DW3A 1I33A 3PP8A 2R8PA 3ZE9A 2HUNA 1DVRA 2J48A 3QNMA 2DPGA 1RBZA 4KIGA 2HU5A 3GJQA 1H6CA 2AKYA 2W11A 3ISJA 3PC8C 3TRJA 5BVHB 2TMKA 1I7LA 1CUXA 5HM6A 1DQPA 1S1CA 3WQHA 3THXA 2V7XA 3VU1A 4FJ2A 1RWPA 2V3CC 2XHEA 4WY8A 4MIYA 1VCOA 3CPJB 3OQIB 3AKCA 3EMKA 2Q6VA 3NHYA 1IIBA 1QE0A 1AZSC 2Z95A 4FD2A 5HGXA 1ELOA 2AN3A 3L6BA 3AFIA 3LC2O 2MWMA 2QT9A 4J1QA 4N8EA 4JEUA 1E6LA 1FSSA 2CLKB 2WJAA 2Z2JA 2O2DA 2OZPA 3L41A 5CP8A 2E4AA 2W22A 3HBFA 2AJ8A 4JBHA 5C4IA 5BW4A 1DO2A 5C18A 4GYKA 4D26A 3AOGA 1C8LA 4Q4AB 2ANCA 4BNXA 3UT6A 1C0EA 1IG3A 2H85A 2ZIFA 1MKYA 5EMJA 1W0JD 1HK7A 2G7ZA 3TZKA 3UHOA 2GK6A 4F9GA 4C20A 4YCMA 3LBHA 3TZBA 4DIDA 4CU5A 2CHGA 3EQ7A 4HZUA 4J0CA 4K28A 3HUTA 4XTCS 5L45A 4UUQA 1RXEA 1YH3A 2Y9PB 3TBFA 2Z4TA 1U9CA 4DLPA 1UM9B 2JLQA 1RI2A 3U3OA 3RVKA 2BBTA 4G26A 4MQUA 1VPEA 3JASB 4C6RA 5FUVA 3UHJA 2OGSA 4FC6A 5BRJA 4H9GA 3SXUB 3FN4A 4IRMA 4NZNA 4UM9B 2C57A 3QYFA 4TGLA 3BRWA 3QBTA 1JDBB 1U0JA 1Y6JA 5JADA 1YFLA 1ULUA 1UPBA 1GFZA 3S70A 2PGJA 3F6PA 5H0IA 1N6RA 3JD2A 4HQKA 4J7UA 4QGFA 5DCYA 5BWOA 2R1VB 4ND4A 6ADHA 1WBBA 4RGVA 2O2IA 3ZV5A 1XAIA 5I7AA 1JR2A 3QV2A 3HBJA 4ARVA 4KMRA 5FOVA 2RSLA 3MBIA 1OFUX 4N03A 3PRJA 2NU7B 3VOAA 2IYZA 2P27A 5KNCD 1U99A 3IUQA 5F2EA 2QN7A 1VBFA 1Z2DA 2B2NA 2DR3A 2DTXA 2WJJA 3JTMA 3IR7A 4QYSA 2DFVA 5J1TB 1MC4A 1O4WA 2IHJA 3FDZA 5LD2C 4BFLA 4I9NA 1YUMA 1PT7A 4HJRA 6ABPA 2VK1A 3GFSA 3NTVA 4L8VA 1NN1A 4JLMA 2Y77A 2FWJA 2FN9A 4HBZA 1CHNA 1NFRA 2IE0A 3QM1A 3AIMA 2XYHA 5IVDA 3H1GA 3HN2A 2R84A 4ENTA 3AJRA 3DBIA 4CE6A 4JGBA 4N7JA 3GMTA 4E5MA 3SC6A 1T5SA 2ATVA 1X7XA 2X1MA 3I64A 1WWKA 1X1CA 1KY3A 1ODTC 3LMKA 5F76A 1NFFA 4NIMA 3UMGA 5SY9A 2JJ1A 2ZUEA 4ZT6A 3F71A 4IZHA 1F6BA 3V7FA 3KR9A 4L08A 1OXVA 1LRLA 3LUJA 3OFJA 1YE8A 2WHYA 2YN0A 2X22A 5ALWA 3PWKA 4ZJZA 3ZDRA 2AKAB 1SG9A 2WINI 4TVOA 5C8XA 2O8FB 4OEHA 3EGDA 3WB2A 3DPSA 4JMLA 1CY1A 3IVRA 3ICVA 3C7KA 1HDCA 4F1KA 1PGQA 2C1EA 5ECDA 3AM5A 4GU5A 2VOJA 1GPYA 2W48A 4DMFA 1TYBE 2GF2A 1DBRA 4D98A 3B13B 2OG1A 1PGPA 4PHCA 5LBIA 1NIPA 4DHWA 2JHAA 3JAKA 4Q4LA 2XMQA 4B46A 4BHTA 3TZQA 1AHIA 1XZJA 1P1JA 1X7YA 2PXAA 2R25B 2C8LA 3ITNA 4GRAA 4JXKA 1I13A 3KZ1E 1U0FA 3N05A 4YQEA 5BN5B 3HVIA 4UTOA 3H3JA 5KYWB 5JRJA 4K1XA 1UBGA 3SEZA 5CM9C 2X9GA 1YO6A 3AF1A 3EIFA 2WG1A 3C48A 1ACJA 3JYOA 1NJ5A 2QSYA 3E0QA 5CCDA 4JC4A 4KE8A 4M60A 4MS4B 2JLRA 1PJZA 1AG9A 2GM3A 3PCXA 3U4CA 4A16A 1KAHA 2HPZA 1ZNYA 2XE7A 4UHDA 1CUYA 2FOXA 4YHBA 2OPHA 3S44A 3TSOA 4WCVA 4BO7A 3QX3A 2I7TA 2IQIA 3BGOS 5HFNA 1U6KA 4H31A 1IJFA 2IDJA 1XNRB 2V45A 1UPXA 1Z0IA 5EHNA 4WLVA 4MO9A 1Z56C 2NG1A 4GOND 3NHWA 2CB0A 3ZOZA 3R3SA 2XMPA 4JSTA 2DQZA 4N5IX 1CTQA 4I9UA 4MV5A 3TEFA 4QM7A 2YVAA 4DCGA 2DPLA 1YQ9A 3HADA 4ZYTA 4GPTA 3VZCA 3OQ1A 1GTL1 3EWAA 1LBSA 4UVIA 1G5RA 1A2OA 1JBEA 1OZGA 3CZCA 2WJYA 3OLXA 1QFSA 4RWZA 4I55A 3NCHA 2RB4A 1HTBA 3PJDA 4OK3A 4B3SB 4K9MA 1JG1A 4RAOA 5CVCA 1DEKA 4ZTUB 1XQ9A 3AEXA 4BMYA 1KJ9A 2I2FA 3Q7SA 4LQCA 4OAPA 5GZ3A 1GPDG 4JBLA 5KKNB 4X71A 3OCCA 4RKFA 3R7WB 1Z8FA 1MC5A 1NM5A 2VDRB 1C9JA 4LJSA 4ACBA 2J09A 4IG9A 5HIKA 1OH7A 3RVBA 5IVKA 1QYIA 5H4HA 2TRSB 3G2JA 5CD1A 2GVNA 4N5MA 1W34A 3ZLBA 2D06A 2HC9A 5DHQA 5JI2E 4BPRA 2AOUB 2O3UA 4MX8A 4QYWA 3AZQA 2O05A 3GJXC 4JVLA 4HATA 1E2JA 5E6RA 3HZRA 1T0HB 2YASA 2FHSA 1QH8A 2B83A 1Y7IA 1Q74A 4IRXA 3ZHZA 3ZXYA 2FFBA 4NABA 3RNLA 4WT7A 3ROQA 2O8EA 1NAHA 1Q0UA 4YPOA 5ESDA 5F1KA 5LP6B 1W4RA 2AE1A 1AMOA 1KRWA 2C83A 3MS4A 4UZEA 4OQ4A 3UA3A 3VNAA 4L72A 2HBZA 2WKSA 4W5HA 1EZ1A 3CIFA 4DRYA 5AVXA 4URZR 2WG2A 3H97A 1QNLA 1SBQA 2NV2B 2RHTA 5ENZA 2B8WA 3JWGA 4W5TA 4NZ9A 2H18A 5EA2A 3SHWA 2Z3VA 2XADA 3UB4A 3L0DA 4G65A 1E96A 4FZ3A 5ALGA 1OA0A 4Z3OA 1TT5A 1ZVJA 1RE0A 1YJBA 2F3RA 3GY0A 1JLLA 3OX3A 5LB4A 3TSAA 4BCBA 1HR0B 5DBGA 4HB3A 4L8YA 1B15A 1F0KA 1Z5WA 4RCZA 4EW6A 3VR5D 1O87A 1PT8A 1V5IA 4RA6A 1B93A 5CVEA 3ZWXA 2A94A 1DJPA 5AKKA 3UPUA 4M9CA 2CWDA 1CVRA 1PLKA 1F3LA 3SOZA 2Q99A 3COPA 4OBWA 4MW6A 1YDMA 4HX9A 2Q2OA 1HE8B 1DG1G 1BJRE 2VDVE 3MZ0A 4PPNA 2XDQA 2I22A 5JMTA 1E2FA 2OC9A 2GAAA 1Z6AA 4QYXA 5DI9A 4YJHA 1F8FA 1BCRB 3DKRA 2QU7A 1UJ6A 3D6HA 1P74A 2X15A 5CYOA 1ZZGA 4RVNA 1I80A 4UBIA 4PANA 3H2IA 5JJKA 4BN5A 3H2YA 5B7QA 1YQTA 3O8QA 4HLUA 1YCGA 3S2IA 1YMQA 4I8XA 4P53A 721PA 1G64A 1KL7A 4L0DA 5CFMA 1MC8A 1QS0B 1SNYA 3UK0A 4U2BA 3OC0A 3JRWA 3OQIA 3PD0A 3IB6A 4UOEA 4KRGA 3EDCA 1QK3A 3THYB 3W5AA 3EA0A 1THTA 4C4RA 4INAA 3I62A 2ANBA 3OZFA 3IAM1 4H7FA 3O1HB 3WRVA 2UUCB 1LJUA 1SUWA 1MOSA 2ECOA 3QLJA 5IASA 2O8VA 5KX5B 1XGKA 2GD6A 3FGZA 3VR4D 1C29B 1CP2A 4LXHA 3NEJA 5GONB 3TVDA 5CVTA 1TAQA 4D81A 2QZ4A 4UQLA 1QAQA 1N2JA 2QR5A 3G2KA 4MWBA 5CLQA 1FOEB 1G20B 1USGA 1UBOS 2NTYC 2XH8A 4JLWA 4JEHA 4LWOA 3W4JA 3OA0A 4JOCA 3I32A 1WSAA 4WAUA 5DBOA 3V00A 1Q91A 2RIRA 3T7CA 1GZ6A 1KQGA 4PYKA 1LNQA 2Y0PA 3QOYA 1CRZA 1SXJC 3EFEA 1MU0A 4L8GA 4KWTA 4BX3A 4EL0A 3B2EA 1WNTA 4MMXB 3IEVA 1NC1A 1UM9A 2DUJA 1AB6A 3Q5GA 4LRXA 5FDFA 4YMSA 3JASA 4MB6A 2HLDA 3FZEA 1NBME 1ORRA 3D3QA 4C4AA 1SXGA 2XVMA 5JSZA 4EWLA 3MWKA 2FTKE 3FPFA 5CJPA 5LQCA 2NVBA 1NTOA 1L5GB 2R1VA 1CKEA 4JVOA 3MQFA 1I2AA 3RU2A 3E2MA 3IBSA 3ZWKA 2BMDA 2OP0A 3CF6R 1U65A 3C3CA 4ZPJA 5BNIA 3S2UA 1PR1A 1ICEA 2OOKA 2PHZA 3C3EA 3A4LA 3LBFA 4OJMX 4ID3A 1X0XA 2H4HA 4NZOA 1L1EA 2PL3A 5GMOA 3GR6A 3SDSA 3WGKA 1XVAA 5AW9A 5KREA 3FYHA 5FAKA 3ZD8A 1J24A 4H16A 4JC0A 2O06A 3C3XA 1T6NA 3ICPA 2ZAIA 3QLVA 3LQKA 1V5FA 3CRQA 4GWLA 2GJ9A 4H7IA 4ZARA 3DVAB 2ZSFA 2FRVA 2A7QA 2W6JD 2YVUA 1DRJA 2OO7A 4DMRA 3IOBA 5J3JA 2HJSA 2JKZA 1BS9A 3PPWA 4UHEA 2FKNA 2PYZA 3MFYA 3NH6A 3AFNA 2B0CA 4KAFA 3F7TA 2IYNA 3HJUA 4PIVA 5IBPA 1WUIS 4MW2A 2VG8A 5BN1A 1F51E 3E48A 3ESYA 1FQKA 4JUAA 4O4HF 3M2PA 4P7JA 3HCOA 1HORA 2H92A 4C29A 1CZRA 3FCXA 4J7CA 3IJPA 3FSGA 2EQ5A 3WA7A 2QA5A 1WMAA 5A2QA 1DX9A 1IQUA 2A33A 2ODEA 2E0IA 3EUWA 3FWPA 3RG8A 4HNQA 1QIIA 4GLJA 4HTFA 1UQTA 5A7HA 1Q1QA 3Q3VA 5C37A 1BA2A 5LQJA 4D4JA 2AN9A 1C1HA 1KP9A 3NEYA 5AOCA 3VNQA 2D2IA 3PFKA 1TM2A 1RVDA 5K0EA 1S9DA 3N2KA 3WWDA 4MINA 2E2WA 2F48A 1PT5A 2NYUA 2BFWA 4DQLA 5A5FA 5FI3A 3K30A 3HABA 1JQ3A 3KYDA 4ZEXA 1BHO1 2VRNA 4ZU6X 1GYQA 3EXFB 4RQUA 5F51A 3JARA 3WNVA 1Y4DE 3A3YA 3STXA 1NPDA 4YRFA 1LTKA 2P7IA 3B9PA 4GX2A 4M1EA 3JQFA 5DF1A 2POCA 4L4SA 3VVLA 2LKDA 2C4UA 2QNBA 4AT1A 3JYNA 3V9PA 4MAFA 1WQ4A 1YC2A 1XZBA 5LM3A 3PC2A 1Y3IA 3FKSD 1D2MA 2ZS9A 3NKFA 3NP9A 1BS2A 1ESEA 3DE0X 3R5XA 5CGZA 1H9AA 3G13A 3MWEB 4MS4A 4CFSA 4FFVA 5JQWA 2NZJA 3F74A 4KO8A 4FN4A 1IATA 1Z7EA 4R69A 1J2TA 3SEFA 4IDEA 1O08A 3KOWA 1XA3A 1PGOA 4UAJA 4XDZA 3DEFA 3VVBA 1XCLA 5E6UB 2GUWA 5HPYB 4YCSA 1U0BB 1UC8A 2XT9A 2O6LA 1RZRA 4FQ7A 5SZJA 3CVXA 4DILA 1DEOA 2C4KA 1B0ZA 1RKVA 4RTKA 1X2EA 2EATA 1CF9A 1WUJS 4GD3Q 2V6FA 3EHEA 5A4KA 5HZGA 3E84A 1YMUA 2FB9A 1IY9A 5JH7F 4B83A 1LFDB 3STYA 1FS5A 1KP2A 4GGMX 3OTQA 2EQBA 2IHVA 2Q1TA 2R6FA 4BRUA 3WDKA 2ZRJA 2QRNA 1GG2A 1I4LD 1M8PA 4U3JB 3ONDA 4MLDA 1Z16A 1BE8A 3GT0A 3K1JA 3E9NA 3HCPA 3IAS1 4OLFA 1UJ2A 2BEVB 2E89A 2I7CA 1SCUB 2J30A 3LUAA 3QVGB 2OQVA 1P62B 5E9JA 4PZPA 4TVBA 2R2AA 2YOHA 3O8OB 1G21E 3KPVA 5HWSA 1FNSA 3IHWA 4LDAA 1II8B 1K98A 1WSBA 4C4TA 2HK8A 2QW1A 3B5IA 2GKOA 2OHGA 4DM3A 1A04A 4B73A 3B8EA 3LK7A 1NUTA 3QTLA 1HLGA 2ORIA 3OPVA 4EFNA 2AOUA 3H3XA 3HXTA 1QOZA 1QHSA 5ER6A 1GEGA 1W59A 4TMKA 4YGXB 5DX8A 3BDIA 2BLNA 2KW5A 1U3UA 1R88A 2IP1A 3DFFA 3HN6A 4G81A 1P33A 1C4OA 1ZSYA 2COUA 4M88A 2IYVA 1F60A 5LU9A 5JCZA 5LP6A 2FNAA 1PUXA 1POWA 4U5XA 3OX2A 2O0MA 4GF5A 5K3SA 4AUMA 1VLLA 3VKHA 1CDOA 2CNOA 2VSNA 4EMUA 1N6IA 4V0ME 4WN9A 3ENWA 2Q6TA 4AP5A 4EATA 2REBA 2B99A 2IHZA 1M10A 1EFKA 1YU9A 2OMKA 2R7LA 3M34A 5FNZA 2Y4NA 1RU3A 4OUDB 3RE1A 2QTVA 3JZFA 1T4CB 1G7SA 4LXIA 1QIGA 3HZOA 2XYGA 4Q1EA 4X1YB 4Z4IA 3T5TA 1L5WA 3WMEA 3P0HA 4MP3A 3C5WP 5J2TB 3KTAB 5KAPA 1ISMA 4KNWA 3KB8A 3M82A 3RC2A 1DARA 1JAYA 1V7CA 4H3SA 4YRJA 3TPFA 2HIMA 3I01A 1D4FA 1HSOA 2W43A 4XH9B 4PC2A 2ODTX 4TM8A 4XUEA 3RUCA 2QI9F 1S6YA 1XCPA 3O9VA 1T3ZA 1QIJA 4IEIA 1U0TA 5B3LA 4CM6A 1NHGA 1SQFA 4UCXA 1TL7C 1R4ZA 4G01B 2W6NA 3Q4GA 2IZ7A 1EP9A 1KEWA 3WWOA 2OWDA 3PFGA 3WG9A 2Y9MB 4IMIB 2RHOA 2XQIA 4DNOA 3TGWA 1FNDA 5DBEX 2PLWA 2P6NA 5JEDA 1ZD3A 3TQOA 4C0XA 3QXHA 5HM8A 5KYXB 3GI1A 3NV7A 2FRDA 1ZISA 3BXHA 3SIPA 5AQEA 3VTAA 5LQMA 4G5RA 4P36A 1MO5A 3IP5A 1EXVA 4WKNA 6YASA 2EJBA 1OBCA 4MA5A 5B1EA 1ABEA 3A3KA 2V6GA 3QWAA 1KWGA 3E22B 3PKIA 1V1MA 2QB5A 3NANA 8ABPA 2PNJA 1M6YA 4PG4A 1UBFA 2CKMA 3OJXA 4O4JB 2X0RA 4PNPA 3D6AA 5BN4B 1EK6A 3NUQA 4QUGA 5IHPA 4DYHA 1G6KA 1SOUA 2A4KA 2GEVA 4DV1B 5FYQA 2B21A 3A6GA 4M0UA 1DPFA 4BQPA 5GONA 5HDQA 4OMFG 5J63A 1YR7A 5EHIA 3FVTA 5U9CA 3BAZA 2OD2A 4CT0A 3I9NA 5EINA 3PUWA 1PVDA 3MTGA 2XF2A 1QG0A 3NHBA 4X41A 2OLEA 1Q92A 3R6WA 4W63A 2CDBA 3GJZA 4HQLA 2Q29A 4Q7MB 1NBEA 4Z9AA 2WC1A 3E23A 3EAQA 3LX5A 3OFND 2IXGA 1WE2A 2GO1A 2O2EA 4ZKDA 1K5PA 4HYTA 5H8WA 2XIQA 3BJMA 1JFLA 2RH8A 4CM1A 5FT9A 4LVOA 4LF7B 1E7QA 2QVGA 2ZE8A 4BDSA 2HTFA 4DMUB 3RS4A 4RZHA 4UTPA 4R9RA 4CIAA 1OIVA 2QOEA 4K86A 4KXYA 3BJRA 5IUKC 2QT1A 3AWIA 4OYHA 3ETDA 4P8RA 4AQDA 4DMHA 4E33A 2DHCA 1K8YB 5JMWA 4HZGA 1Y8CA 4ZO4A 3EZGA 2WF6A 1GGJA 1WCIA 1ZMTA 4XEHA 5ADHA 3G9QA 2IZZA 1W5AA 2I03A 3RV3A 3FKJA 2PZAA 5A4DA 4Z7QB 2XNKA 1Y89A 1FB5A 4OHWA 2WSBA 4HAOA 3DVAA 3C1TA 2BPOA 3EBLA 2WM8A 2WSSD 2QMYA 3BD8A 2G3YA 2D5IA 1THMA 4OBBA 1GPUA 3V4VB 4EYKA 3PFIA 1RKXA 1GTSA 2QR2A 4Q37A 4DB2A 4NU6A 4NYJQ 4PYJA 3ESCA 4A2WA 4LJYA 4NPHA 2GXUA 4KKXB 4ZVQA 4A2CA 2Y0DA 2ZJ8A 1IBRA 3GPIA 3RUAA 2ACVA 4RYDA 2WBLC 4X1IA 5KJFA 3QPWA 1J0BA 1OA1A 3I12A 1FU8A 2IE8A 3GJ4A 4O2AF 1VPLA 2OBFA 3RC9A 3ZDQA 2O5EA 1TVMA 1A9YA 2EFHB 4QOJA 1GPNA 1GNSA 3AIKA 3DYIA 4LDJA 5AKJA 4UHFA 1NR7A 4CMGA 1ZPDA 2QG4A 3NT5A 4QTUB 3WK9A 2A14A 2W98A 3PF9A 4PLGA 3DBVO 4FDAA 3HN7A 4Y1EA 3ZWDA 1KO7A 3KUXA 5C80A 1BW9A 3RHFA 3WLRA 4MRVA 5L3ZA 1FYXA 4X94A 4M1QA 1DJLA 5EEHA 4DA7A 1NQTA 4YA6A 2G71A 1G1AA 2GJ4A 2XB9A 3JSAA 2G4VA 5FHQA 1N4AA 2HIGA 4JOSA 3SZLA 5KNDD 4M0MA 4FCTA 3AFMA 5F3RA 1GIAA 4E31A 3IEXA 1XKQA 3C1UA 4ENPA 4YQFA 5HJ7A 1KSHA 1S3GA 2JLBA 2ATCA 1TZCA 1VJ1A 3EXFA 4ZI2A 4II2A 1JKXA 5C5CA 4D25A 3K0EA 5AKXA 3OU7A 5I4IA 1JHPA 3LA8A 2OPBA 4B3FX 3AEUA 4E5VA 3WLMA 4OM7A 4LTNA 5HKKD 5BNZA 1GGVA 4N01A 5EFOA 2J32A 5CBPB 1E5LA 4R1OA 2AOXA 4IQ8A 5LZ5A 2GJKA 3GZ4A 3MWEA 3R6TA 4HGRA 4QTYA 1QKJA 3N2IA 4EX7A 4NBNA 4Q01A 5C8DA 2O54A 1XZAA 3GQBB 3CKMA 1CF4A 1GLNA 1HFWA 1TZ2A 1BDIA 4P0QB 3T7JA 4OHZA 1NQOA 4B6JA 2IOFA 3BWXA 2VR1A 5FH9A 3MNFA 4YYZA 1D6SA 3QU9A 4DV0B 5BV7A 5A6SB 1E77A 2UXCB 3S8YA 2AZ4A 3EB9A 2DFPA 5A3RA 4BZQA 4U7DA 3LCVB 1UZLA 3PR1A 4X7BA 5GJWC 1CBUA 5IN5A 1K63A 3H4VA 4EW3A 5IWAB 2FUG6 4UBJA 3G6WA 3JPYA 4Y9DA 1AF4A 8ATCA 2CVQA 5KOIA 2B4TO 2GAOA 1W35A 1NFQA 2IIVA 4KO3S 1KJZA 3DXFA 5AJYA 3O4GA 2LCIA 1J0XO 4R8RA 2A0KA 3KBOA 3P94A 4U3JA 4CM3A 4PQGA 5M34A 4ZAGA 1KRXA 3EXHB 1JHAA 4FGZA 4EL5A 2GZSA 4R98A 2CEKA 2AFHA 2ALJA 2B7BA 4H1HA 3ZJ5A 1UBCA 2DAPA 3CJTA 1WY7A 4WKOA 3WL5A 2I7XA 5C3MA 3VKGA 2RGAA 4RD1A 1FU7A 1Z29A 2CHFA 2Q5CA 5BSUA 5KO2A 1S7CA 3HTXA 1KY5A 5ALTA 5AK3A 4JBNA 1II8A