1T5IA

Crystal structure of the c-terminal domain of uap56
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
159
Chain Sequence
GLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPEQTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of UAP56, a "DEXD/H-box" protein involved in pre-mRNA splicing and mRNA export
pubmed doi rcsb
source organism Homo sapiens
molecule tags Pre-mrna processing protein
molecule keywords C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT RNA HELICASE
total genus 57
structure length 159
sequence length 168
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2004-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1t5iA00
4YLGA 1SXJA 5DYGA 4M2LA 4ASUD 3B7GA 4EKDA 4WAUA 1Z6TA 2ZSDA 5BYKA 3T12A 1DOAA 4BQSA 2B6HA 1RRCA 3REFA 1VTKA 2CHVA 2J7PA 2Z0MA 2QM8A 2F1HA 3ICQB 2ZQ5A 3FMPB 1MOZA 2XNSA 3QBVA 2ZI7A 1G5TA 3CRVA 2OEPA 1SXJD 2IUTA 1G16A 2RCNA 1VPLA 2O52A 2X77A 3PUWA 4HI0E 5EXXA 5F2EA 5GJVC 4R9UC 4V02A 5SZKB 1GVNB 2ZR0A 3FKQA 1TEVA 4ZI3A 5EXTA 2VP2A 1RC8A 1J7KA 2ATXA 4A4DA 3W6PA 2R6CA 3AVQA 4MGZR 1SKYE 4Q7KA 5KNBA 2ZRJA 4PPFA 3TBKA 2Z4SA 2QUZA 3PIRA 1G20E 4AK9A 2QGZA 4DEXA 1Q1BA 1Z6YA 2XNDA 4LWZA 2IYQA 1UDXA 1HY3A 1GRQA 2DFNA 3BFVA 3RLFA 3SYLA 1XEXA 4FMDB 2QEQA 4Q9HA 821PA 2KBEA 2ZRLA 5GJBA 1SHZA 1R2QA 1HURA 4TL6A 4MRRA 4DZZA 1IBRA 4UNRA 3I73A 4LYJA 4MKHA 4B3DA 2JATA 5FTLA 4PO9A 2H7VA 3FFAA 5JEEA 1YZTA 1X8KA 4LYHA 1ZBDA 4JLDA 1NSFA 1RJ9B 4QRHA 3A37A 5JS8A 4BLTA 1OPXA 1T6NA 2ATVA 3VKWA 1KI8A 4Q9KA 5CB6A 4TYNA 5EE1A 4P32A 1NVXQ 1G18A 1KI9A 2ZYWX 4MKIA 3V4RA 1QRAA 1XJ0A 1S3SA 1HE8B 2XB4A 2W6JD 3DZDA 3RSOA 1GNRA 4TZ6A 5BXQC 3MG9A 4UJ5A 1A1VA 3TVTA 3BH7A 4QBFA 3B6EA 4A0FA 1RIFA 1YR6A 4URVR 2O8DB 1YJ5A 2CNWA 2I1QA 2QRZA 2CCGA 2ZI3A 4Q18A 3ASYA 1G6OA 1CULC 3K09A 2BC9A 3R8CA 5HPYB 4TSFD 2IS6A 4KVGA 1MV5A 3LV8A 4OYHA 1VYVA 1JEDA 1XMIA 3UPUA 5DHFA 2AXNA 2XJ9A 1I2DA 2JJ2A 4NH0A 2OCBA 1BO6A 4C7OA 1RPZA 1TNDA 2RGXA 4X8OA 3TSOA 4U7DA 3K9LA 4KV9A 1KSHA 4U5XA 2PMDA 5IHPA 2XGJA 4D4MA 2J7KA 2YHSA 3HJNA 4P4SA 2CE7A 3A1VA 2QMHA 1GOTA 1WRBA 3BWDD 3QKUA 4MQBA 2CVHA 2JLSA 4W5JA 4M9XA 4G5RA 3B85A 3OAAA 5FTMA 2JJ1A 4ZV4A 2W6ID 3QF4A 4NCKA 3CX7A 1DELA 2EFCB 4PPNA 3GJXC 1JXMA 1HYQA 2VHJA 5FTNA 4IDOA 3C5HA 3K70B 1NMZA 3OZXA 1AKEA 1E2PA 2J41A 1HQYE 5L3QA 3AGQA 3H1TA 4IXNA 1ZCBA 5JHGB 4CRWB 4OK6A 4PPGA 3OAAD 2J3EA 4C0JA 2GK6A 4OHYA 1E2KA 4KBGA 1NLZA 1E94E 4CVNA 2QROA 2XOKD 1KK1A 1US8A 3GJ4A 5DYIA 5FL7A 4DBLC 3PXGA 1LS6A 4KODA 4A0HA 3Q85A 3AVWA 2GF0A 5L3VA 2A5JA 5IRCD 3ZVLA 2JJ8A 2D06A 4FCTA 1FL9A 3CNLA 5JSZA 3LXXA 4A36A 2A5GA 2Q0HA 1ZNXA 1ZCAA 3KFXA 2J5XA 2V54A 2ZSEA 4Q1AA 3A58B 2EWWA 2NOAA 4LHVA 3E2IA 4JMPA 4A2PA 3K8YA 5DLQC 3BS4A 5C1BA 1OKKD 4OL0A 1RJ9A 3LNCA 2OXCA 5SZJA 4UXJA 4KO8A 2ERYA 2YOGA 3EZ6A 3SJAA 2UVQA 1N3BA 1MABA 1E99A 1KY3A 1P62B 3L0PA 1NVUQ 4US1R 3P20A 4IKEA 3ZZ0A 3AEZA 1G64A 1KY2A 1ZIPA 3V9PA 4KITB 1SXJC 2O0KA 4CEHA 4Z51A 3WXMA 1ZJ6A 1ZM4A 2X2EA 4HAUA 1OXVA 5LBIA 5CIQA 5KDOA 3P26A 3IBYA 3T15A 3OFNA 2VF8A 3GLGA 4MYTA 3EIQA 3REGA 2O8FA 4BE7B 2N1BA 2HF9A 4RD6A 3QF7A 4XTRA 1N2CE 2BEKA 2PZEA 2FE4A 3LLMA 1N0UA 2HYDA 2ZANA 2BCGY 4QGAA 4UXIA 3LRPA 1Q1ZA 3BB3A 3HU3A 3B60A 3TH5A 4C0HA 4DCNA 3WMGA 1L2TA 3R7WB 1US8B 4QBHA 2VHCA 4XVRA 1IM2A 2RHDA 3RS0A 4P4SB 3CNNA 5HCIA 2R65A 1W1WA 4OHVA 2EU8A 1I2MA 1U2RA 3SJCA 3IHLA 2X1VA 4D0NA 2ECKA 2VO1A 3GFTA 3QG1A 3GQBA 421PA 2Z43A 2AR7A 1EFCA 3OHMA 2QQ0A 3RSLA 1W5SA 4LJAA 6Q21A 1LFDB 5AUPB 2BHRA 3HR8A 2FF7A 3QKSB 3EZFA 2RGNA 2GJSA 1TF7A 1XJCA 4XWOA 2PCJA 4Q9IA 3SN6A 2R2AA 1JQJC 3O8BA 3U3MA 4URYR 1SVLA 3VU9B 1W36D 1MABB 2XSZD 2CLCX 4I1VA 4I1OA 4I81A 4Q01A 2QQEA 1OXXK 4GDFA 1Z0KA 2CNWD 4KSBA 4YC7A 3KKQA 3C8UA 3DL0A 4G5OA 1KDTA 3I8XA 4KFRA 2OLJA 2W2TA 2BVNA 1XPUA 3RRZA 4ASUA 2BMFA 4FN5A 1CTQA 1FZQA 3QOFA 4IFEA 4QBGB 1IN4A 3GLGB 1CIPA 4LK2A 3TAHA 2P67A 1AS2A 4NYMR 2FV8A 3Q5DA 2JLQA 4HB4A 2OBMA 4PAMA 1FP6A 3EIHA 3CX8A 2GJ8A 2ZYVX 4HLUA 1FQJA 2FG5A 1ZD1A 1E9FA 1WA5A 4B44A 4PFSA 2QBYA 1Z8FA 2P2LA 3EPJA 3WBJA 4XD7D 4X8MA 3SC3A 4EJSB 4WOPA 4I99A 2FWRA 2V4ZA 5JMTA 5JECA 4PC1A 1DAHA 1TPZA 1Z2AA 4KSCA 5G53C 4WZ6A 2QAGA 5L8VA 1NLFA 1NN3A 3VMFA 2WSMA 1S9HA 2ZETA 4TQUS 2HCBA 1Z6GA 2QP3A 5J4KA 1ETUA 4LHZA 1ZINA 2NMVA 2VYFA 1DVRA 1IONA 1SQ5A 2ZRBA 3KKPA 1T5LA 1ZC3A 3EZ7A 3KZ1E 1Z0AA 1SVWA 2RH5A 4GT1A 4B2IA 1FUUA 1AQUA 1O87A 2ZSFA 4TMVA 1N6HA 4HDOB 1XEWX 2YKGA 1KMHB 1F48A 3VHLB 2GKSA 4JLAA 2ANCA 2FZLA 2MSDB 2ODBA 3U44B 1XD2B 3WNBA 1UEIA 3SJZA 5K8TA 3AF0A 4K8OA 5LPNA 2J7PD 5EE0A 2D7DA 1GFIA 2KB0A 4JJKA 2WMNB 2YV5A 3EARA 2X2FA 1OYWA 2FPKA 2BDTA 2GZAA 2O8CB 1NSTA 2OAP1 2GA8A 1XZQA 1G3RA 5A0FA 2AK2A 1YZKA 4F7WA 3F5FA 3AF1A 4AI6A 4B32A 3H84A 4DLVA 3AKCA 4AKEA 3LXRA 1TQ4A 1CS4C 1G8PA 2WWIA 4ITRC 3DKVA 2A30A 5FOUA 2RGNC 4NCJA 1IJEA 1Q1QA 2C04A 4Y0VA 4QJ4A 4PQYA 2H16A 2XZPA 1KI6B 3EW9A 4JT2A 4F4IA 5CLLA 4PXAA 3AVOA 3QY0A 1EFRD 1O3YA 2BV3A 4BZPA 3SR0A 2IA5A 4R7ZA 3ZVRA 1XX6A 3OFND 4FI3C 4Q1EA 1TAGA 1Z28A 2ZE7A 2LCFA 4HLQB 2AWNA 1XEFA 5HZHA 5FR1A 4LYAA 1UKYA 2A5YB 1P4SA 2ZRFA 1R0XA 4HUTA 121PA 2VSOA 4N3NA 1W49A 4JSTA 1N5IA 2QTVB 3MWYW 3U7EB 3KTAB 4LJ8A 3T34A 2EFEB 3UMRA 2O8EB 1M7HA 1R7RA 2VEDA 3PEYA 2J46A 2CBZA 4KJZA 1XTSA 1J8MF 2EYUA 3THYB 1M7BA 2DPXA 1AA9A 1KI7A 2IYXA 3CLVA 1Q0UA 1CR4A 4CT4B 4YQFA 4DB4A 1DEKA 2AL7A 2RMKA 5EZ6B 2NO9A 3V00A 1EESA 4TLCA 4OI4A 4CYMA 4HB0A 4EDHA 4A6XA 1SZPA 1WDTA 1AN0A 1IN8A 1IY0A 4HUQB 3TE6A 4M53A 2A2ZA 1KTVA 3EC1A 1MO3A 3NG1A 1E9RA 3NVAA 2OHFA 2BKEA 3AGPA 2CVFA 3ADCA 2YJTD 1R5NA 1RKBA 1SVIA 2IYTA 3QKSA 2XB2A 3EPLA 4Q4AA 4H9GA 1T0JB 4TTPA 1MT0A 4M9QA 2WJHA 1PJRA 4FINA 3U44A 3WMFA 4KLZA 1R0WA 3RANA 2RGCA 3NBYC 2RHMA 4LSGA 4B33A 4MYCA 1E0KA 3VR4A 3JVUA 3GFOA 1JNYA 1TEXA 2XZOA 1VG9B 4NMMA 2W6IA 2A3RA 4I4LA 1U98A 3AF4A 3MFYA 4DT1B 1EFUA 5KTYA 1QHHA 3I92A 4HATA 4B71A 4CIDA 2H57A 4LJ4A 5TDHA 4LJ9A 5C4MA 2V1XA 2PEZA 4XSGA 2BIFA 4Z8XA 4V0LA 5JCZA 4PSVA 1QVRA 4IDQA 4FCWA 5CK4A 4Q9LA 1I4TD 2ZRPA 3MJRA 4B6EA 2OESA 1GL7A 1UM8A 2WZQA 3OEED 3UIEA 4ARZB 2XXAB 1Z0IA 2EW1A 3L0OA 4LYFA 3P4YA 5FI0B 2VIIA 8OHMA 3QEOA 5FTKA 4TLDA 2Q21A 4URZR 2FZ4A 2IWRA 4LBZA 5EP1A 2FFQA 2A5DA 3VR3A 1IOZA 3OF5A 4V0MA 3TRFA 1K6MA 3RAPR 2C9CA 1IN7A 2ZUDA 3QXHA 1DBSA 3ADDA 4CEJA 4TYYA 3JZMA 4DDUA 2P0EA 2F1IA 2D7CA 1E2MA 3QE0A 4GI7A 1NLYA 4D26A 3QI2A 4KFSA 4L8GA 4Q03A 1SHKA 4JYBA 2OZEA 1IXRC 2QENA 1Z3IX 2IL1A 1U94A 4TMTA 4XJXA 1J70A 4BZXA 3IO5A 4PC3A 2G1KA 3THXA 3A6PC 1BYUA 2WJVA 3C15C 1ZNYA 2KBFA 3FGNA 1SVOA 1UBFA 2G0TA 1NG1A 3LBNA 2CCJA 1BOFA 1UFQA 3ZZUA 4B6FA 3L0IB 2J0UA 3U6BA 1S8FA 2R6DA 5IK2D 2ZR7A 1H8HA 1YE8A 4AD8A 4RZUA 1T5IA 2J0QA 1VG1A 1G3MA 1F2UB 3CPHA 1GAJA 1UBCA 4TTRA 4PHTA 2ZU6A 2J0SA 1B23P 3DZ8A 4TQ9A 2HDNB 3W9YA 4D0GA 3BIFA 4B3FX 2QSZA 5H1YA 2F9MA 5K8UA 2WBLC 3IQXA 1NN0A 3L0SA 2Q6TA 1IXZA 3PUZA 2H1LA 1FW6A 2YYZA 4DUGA 1KGDA 4L4UA 4BRWA 2C99A 1RYHA 2CK3D 3AUYA 4G5GA 4LV6A 4HLDA 5DNYB 4NHOA 5FR2A 2D2EA 2GK7A 3RWMB 2AK3A 1K8RA 4HDQB 4U02A 1E6CA 3KQLA 3A4MA 5GJWC 1D2NA 1RRGA 1Q12A 1E9BA 3WBKA 1H65A 2GEUA 2IXEA 1P60A 5KNDA 4Q1BA 4OQXA 2GWHA 2IK8A 4NCNA 3T5DA 2AX4A 3SU8A 4ERNA 3GLFE 1UDWA 2Q9CA 3AH8A 3VX4A 1Z6AA 1A82A 2C9OA 1G5PA 1VECA 3QEJA 4X8LA 1CJTC 3BBPA 1M2OB 4Q9JA 3HP1A 3QSYA 3EA5A 3K0CA 3SQXA 2R44A 1W36B 3Q3JB 5FUVA 4M4SA 4RJLA 4G3XA 2IS1A 1W4BA 1C9KA 4DSUA 4M1KA 2DFKB 4KVAA 5DH9A 3GLFB 2EFDB 1EWQA 3RVBA 1YZGA 3TQFA 3I3SR 1SGWA 2ZTSA 3K70D 2CHQA 2GXSA 3TUZC 4GMXA 3QKTA 3NH9A 3NWJA 4B34A 4L5BA 4B74A 3FMFA 4QM7A 2PL3A 5D3QA 3AVXA 1WBDA 2OLKA 4A6PA 5KDLA 3I1FA 5TXGA 1MO6A 1ZU4A 4QNRA 2PBRA 3TUJC 3VKHA 4B2LA 3ASZA 3GEHA 1E9DA 1QHSA 3ZYCA 4AYTA 4Q4JA 1JPJA 1BH2A 4NCIA 2XJ4A 2J87A 5JEDA 1Q3HA 2VP9A 4OJKA 1XTRA 3L8ZA 4M8NE 2FSGA 4II7A 2ZJ8A 4Q48A 2A9KA 4Y0AA 1DG1G 3WHKA 2E87A 2BEJA 4FXPA 1QDEA 1IN5A 3U5ZB 4Q02A 1CRPA 3SBEA 3TJZA 1FTNA 4DLZA 2CCKA 2HUPA 2LKDA 3EZ2A 3JZAA 4RZ3A 2GCNA 3MUFA 3QPWA 5JCPA 3I61A 2IEZA 5EE3A 3BD9A 2IX3A 3BORA 1OIWA 4PC2A 5L3SA 1E2LA 5FOXA 3BRWD 3BH6A 2HYIC 4MRSA 3DMNA 3H0KA 4C0LA 3SFVA 1XPRA 1B0UA 1TU4A 5FBWB 2NG1A 4XTCS 1SXJB 4TYPA 1ZYUA 4PAQA 3GMTA 3OEHA 2FH5B 2C77A 2PCLA 1ANKA 1D6JA 2F3RA 1CXZA 2OFXA 2XX3A 1QHNA 5KNCA 1TQDA 4B3BA 3PQCA 1KO4A 4JLPA 5G40A 1F2TA 3KQHA 3ZIAD 1VHTA 5J5CA 4ZCIA 3KXLA 4DXAA 4FD2A 3BOSA 1VIYA 4TLEA 5F9FA 1ZUNB 5FBRB 2ZYTX 2FSHA 3BXZA 1S0UA 2F7SA 2GCOA 3I4LA 4A8JC 5KU1A 3LVQE 1KO5A 3EASA 3SFZA 4BGDA 2W83A 1EXMA 5KSYA 1NIJA 1ZAKA 4BLSA 1CU1A 3X1XA 4F4JA 2YWHA 3Q8XB 4HUQA 4DEYA 2AFIE 2ZJ5A 2PJRA 4R71A 1W47A 1S1MA 5HCNA 4YMSA 4A92A 1ONBA 2MSEB 3SYNA 1TTTA 3QKRA 1GKYA 4MRPA 1OH5A 3QG5A 1G8HA 4D25A 5HKKA 4PC7A 3ZH9B 4LV5B 1ZNWA 1YHNA 2CL7X 3WYFA 4B2PA 4M1TA 3D8BA 3QVVA 2WJGA 4GNKA 1ZW6A 2B8TA 1T9HA 1OT3A 3N70A 5AWFC 4Q1CA 5JI2E 1L4YA 2UZIR 2OM2A 1XD9A 2FFHA 2QTFA 5CDFA 2IS2A 5GVRA 1T91A 3LLUA 3PEUA 4IDPA 1OV4A 2GJ9A 5B2ZA 3SHWA 1S2MA 5DI3A 1DAKA 2BMEA 3LX8A 2QT0A 3CO5A 1E2NA 1EFHA 3CF0A 4V0NA 2DFTA 3THXB 4QGFA 3QF4B 4URWR 3TLXA 4XD7A 1G7CA 3QPUA 4TQAA 4Z1MA 3E5HA 2MMGA 2BJWA 2FEMA 3NIBA 4G5SA 4W9MC 1E98A 3AF3A 4O25A 3CNOA 4JLMA 4LUCA 3GFPA 3B13B 4E22A 3RS2A 1E2EA 1QHYA 2K5UA 3LAWA 1S4QA 1DPFA 1KO8A 2V7QA 2ZJOA 4JIMA 1WMSA 1CRQA 3OIYA 3DM5A 1FFHA 1GDDA 4LBWA 3U61B 3THWB 2G88A 2OBNA 3NC1C 2REBA 3E70C 1K5DA 2CHGA 2ZVQX 4AWXA 3U4QB 2VA8A 2GJKA 4KLNA 5C2JB 2ZR9A 4IEIA 5CLQA 2RAPA 1RE0A 4Q1FA 2JJ1D 3IHWA 3WNDA 3L82B 2O8CA 1G4UR 4CW7A 3TVDA 1MRNA 2B8WA 3U2QA 5E95A 4HSEA 5FH9A 1H8ED 4IFBA 2H8KA 3A36A 3WYAA 1BMFA 3L2OB 5DO9A 5EUQB 1DARA 4OK3A 2P6RA 1Q57A 3KQNA 1YZUA 3NDPA 1KMHA 1U90A 4D81A 4RY2A 4DSNA 2V8OA 4FMDF 4V0OA 5B30A 4NYIQ 2Z5FA 4G01B 4NZYA 1YR8A 5JJKA 1Q1EA 5FUXA 4EJSA 4BFVA 5TY0A 1Q21A 2IYVA 3GP8A 1M74A 3HPRA 1LVGA 2PZFA 2WIBA 2YWFA 3ETLA 5F3WB 1JJVA 4NE2A 3GJ7A 3MMPA 3H4MA 2HLDA 5SZIA 5FBVB 2NTYC 4ZKDA 4JL6A 1WB9A 3MCAA 3P32A 4OJQA 3S1AB 2LKCA 3QENA 3LBIA 3SQWA 4IOJA 2WKRA 4URXR 1E9SA 5E3HA 2Y8EA 3CR7A 4S2EA 3HWSA 1KJWA 4RCYA 3ADKA 3G0HA 2IYLD 4Z8YA 4EFLA 1N6LA 3X1YA 2IXFA 1GILA 2B92A 3EXAA 5FBLB 3R7WA 2HLDD 4B75A 3TUIC 3UMFA 4A9AA 4BLQA 4O2RA 3FKSA 2QNRA 4IOLA 4PR0A 1XTKA 4PO8A 3CR8A 1EFTA 1UJ2A 2GBLC 3EG5A 5HE9A 1GRRA 1N6IA 2HJVA 1GITA 1LS1A 1MRSA 1NVVR 5A5GA 1W0KD 3AVVA 4JT4A 1XD8A 2FFBA 3Q7PA 4LPSA 1OFHA 4ESHA 1RFLA 3K0SA 1NF3A 4IVRA 2BKUA 4URUR 4BFZA 2GDJA 2ZUBA 3SI7A 2E1RA 4JBWA 3FE2A 3NEYA 3QUSA 3VHXA 4EJSC 3ZJYA 1QHXA 4WIAA 2N42A 1QF9A 2QSYA 4LI0A 4J0QA 1CKEA 1KDOA 4YONB 2OCYC 3SEAA 4A8JA 5L3RA 2AKAB 1M6NA 2B21A 3EX7C 1N0WA 2NPIA 2FSFA 2HT1A 2ZRCA 4EPVA 5BW8A 4HEJA 2Z83A 521PA 2ZUCA 5BN4A 4IJMA 5KO2A 2O8BA 1Z0JA 1P7CA 2BWJA 1FNMA 4MUBA 2ZAMA 3TMKA 5E7JA 2NO0A 4RD4A 1DS6A 3GLHE 5HZKA 3WY9A 2PLFA 4WXPA 3VR6A 2HXSA 1TX4B 1G41A 4F38A 1GL9B 1KI3A 3BAFA 1KDPA 2CDNA 4QL3A 3PR1A 3SBDA 3EA0A 2PMKA 3O8DA 1W44A 4CGZA 3FTQA 3KTAA 2O0HA 3IGFA 1CR0A 1MR3F 4FCVA 5FI1B 1JB1A 1TUEA 3AQ4A 2D2FA 1RRPA 3CWZA 4JLBA 1M34E 5C18A 3X1ZA 3KB2A 1NMXA 4D4KA 4M0LA 2GAAA 4MA4A 4B43A 4TYWA 3NHBA 1YRBA 4C4PA 1GWNA 4YXWD 2F6RA 3H2YA 1UAAA 1GUAA 1JECA 4G1UC 1CJVC 1KZGB 4GOXA 4OQNA 1DADA 5DI3B 4IRUB 3K0FB 1M7GA 2JJ2D 1XDBA 2WPDD 1AK2A 1ZNZA 2ZM5A 3I62A 1AQYA 4A2WA 2GVDC 5JSZB 1F6BA 2WJJA 2BM0A 4AC9A 1P5ZB 2BBTA 1OFUX 1COWD 1R4AA 4M21A 4WA7A 3BGWA 4CDGA 3A4NA 2O8EA 1AIPA 3KJGA 4TT3D 1R6BX 1OSNA 5LD2B 1Z2CA 3DM9B 3J81k 3RS5A 2ZU0C 2P3SA 1I4LD 4ESVA 2XAUA 2P65A 1LF0A 1YZNA 4GSYA 1Z83A 3T06B 1FP7A 1NP6A 2VLIA 3A1SA 1UBGA 4JJZA 2ANBA 3IQWA 1E79A 1UBEA 5DE3A 1U8YA 3MRSA 4EPTA 5CB8A 4JLJA 1P3JA 3THOA 4DCSA 3FOZA 2JIZA 2VPPA 1KMQA 5P21A 2G6BA 1NBMD 5FUWA 1U0JA 4MYUA 2J0UB 1WCV1 3FPAA 1KNXA 1TUIA 2ZEJA 4AKHA 4D0LB 1II9A 1P2VA 4QC2A 2VBCA 3TAUA 2ORWA 2I4IA 4C2UA 3EWAA 1AZTA 1G19A 2D74A 2EQBA 3VU9A 3IILA 4DLXA 3GLHA 3CRRA 4GP6A 4X8HA 4U00A 3LY5A 3CWQA 1UKZA 2V6JA 3WRYC 2GNOA 5CYPA 2BMDA 1IN6A 1TU3A 1II8B 2GTPA 3B9PA 2GRJA 2BM1A 5J4VA 3GJ3A 5JZVA 1R5OA 2QAGC 3B2EA 3DO6A 3TNFA 1G5RA 1C1YA 2IT1A 1UPTA 3BK7A 2Q9AA 3E1SA 1E2GA 5UKDA 4HAZA 2JLUA 4L9WA 4TN1A 2OXRA 4A0RA 4CT5A 3V4FA 2B7BA 4BFTA 1G4AE 4JVSB 1OW3B 3RYTC 2GXUA 4Q1DA 4HZUB 5CJ2A 2NPFA 3RRYA 3KJIA 3K9HA 1IAQA 1OKKA 3KKNA 2BJVA 5EZ5A 5FFMA 4DCTA 4F93B 3CB4A 3C4JA 4IDNA 3AKEA 1E2HA 4MDEA 4YMUA 1RVDA 5J47A 4D4LA 3W3ZB 2GVZC 1XFAA 2ZI4A 4QHTA 4E09A 3EWSA 1XBTA 3VQTA 2ZJZA 1X86B 2ZRHA 1JEEA 4B35A 4XVUA 1GZSA 1DO0A 1X3SA 4MDFA 1EK0A 1ESNA 1HV8A 2FGJA 2DY1A 1E4VA 1E1RD 1A7JA 3LWNA 1RW4A 2DBYA 2IF0A 4L15A 3S1AA 4LOAA 2EFGA 5K8IA 2XOKA 4JLKA 1U8AA 4FMCF 3ZLJA 1E79D 1NBMA 5DISB 5EE5B 1S1CA 1P2UA 2KJQA 2ZPTX 1ZC4A 2SHKA 2JAQA 3SNHA 1P61B 4BEJA 1IY1A 3NDBB 1XCPA 3K1JA 4KI0A 1Q3TA 1Z0FA 3Q5EA 3BJIC 5F9HA 4Q4HA 3CUEF 3IEVA 1ESMA 2NZ8A 4HB2A 5FOSA 4DSOA 1ZRHA 3NBXX 4LBVA 2W2XA 3IO3A 2ODWA 3LQQA 3CH4B 4LV8B 2FOLA 4KHZA 1VCIA 1XMVA 1E69A 3TW4A 4HZUA 2G3YA 4BLOA 1N6PA 1NJFA 1A2BA 2CK3A 2DYKA 4DHEA 5JJLA 2H92A 2QPAA 3KL4A 3FFBA 4LY6A 1XWIA 4DUGD 2JLVA 4ZDIA 3TR5A 3KQUA 5JRZA 1UKEA 3M4YA 4QJ5A 2EVWX 2MSCB 4B3GA 2WAYA 4C30A 2Q3MA 1KHTA 4BASA 2XXAA 1VCOA 4PQFA 5EUMA 1G3IA 1EX6A 4BZQA 2PEYA 4Z54A 1XTJA 4RKFA 2UKDA 3CPJB 3GEEA 4GFDA 5JFGA 3AP2A 3VR5A 4KCGA 1DAFA 3O8CA 3NEJA 3ONWA 1TQ2A 3WRXC 2ERXA 3PUVA 2AKYA 4GPTA 5C4GB 4AG6A 1RZ3A 2P5SA 2ZVPX 1GG2A 2ZS8A 4YDSA 1V5WA 5FPSA 5B57C 3B1WA 1OYYA 4DCUA 1SULA 3T1VA 1G7SA 2F43A 5AJVB 2GZHA 4YMWA 1OFTA 4CEHB 1VMAA 4DDVA 2OAQ1 721PA 4W5HA 2IW3A 4OKSA 4BRUA 5KSOA 1OFIA 5A4JA 2WM9B 2WJIA 1CF4A 1XXHA 2ZRIA 2IUSA 2WAXA 4JBXA 2OFWA 4EPXA 1HT1E 2FPMA 2YINC 3MD0A 3SYKA 4FW9A 221PA 4EPRA 1GTVA 3UXMA 1NN1A 1N6OA 5LB2A 4LHXA 2D4HA 1OB5A 2N46A 1EG7A 4ACBA 4B3CA 4MGYR 1ZIOA 2WTUA 4F92B 1GNPA 1E2DA 2HCJB 4NYMQ 4XSHA 4ZDWA 1F5NA 2X8AA 4QHSA 1KYIA 4UQOA 1ZUIA 4GBMA 1KKMA 5JRJA 2AD1A 2QG6A 1TADA 3GLGE 3A8TA 1OHHA 1T8TA 3EIEA 1W4CA 4LJ5A 4GRAA 3IUYA 4OHZA 2G1JA 1Z5ZA 2G77B 3RWOA 3PEVA 5DIFA 2W00A 1DAIA 1N5JA 2IBMA 5D3MA 2QY9A 5LDDC 3DHWC 1ZM9A 4LZZA 1BIFA 4D82A 2A5FA 2CL0X 4E07A 4E5UA 3CF6R 5H70A 1DTSA 3TR0A 1U0LA 2IYYA 4HB3A 2JLWA 3RDPA 2YOFA 1ZP6A 1NNEA 4IHQA 2R62A 1W5TA 3CF2A 3T61A 1YU9A 3NBZC 3THYA 5DHAA 4BWYA 2F3TA 2GETA 5GJCA 3VR2A 2DWPA 1J2JA 5LB4A 4BFXA 3TSWA 3I5YA 3EPHA 1RYFA 2ZRGA 4CEIB 1KSFX 4LJYA 1XTIA 2IXGA 4ZDJA 2ZYUX 4NYJR 3M1IA 2WWYA 4EAQA 2GCPA 3B8HA 1QVAA 1R8SA 3HR7A 3AVPA 5ELXA 4BECA 3BH0A 3W6NA 4MGIR 5G3ZA 1T4GA 4TL9A 1E2QA 2EYQA 4MKFA 2PLRA 3W3AA 3ZD7A 1CJUC 2QP9X 4JLOA 4DLWA 2ASEA 2VP6A 3RS7A 2ZXUA 1UEJA 4FWTA 5CK5A 5FPTA 2F1JA 4HLUC 1CR1A 2W2VA 3IIKA 2QAGB 2V6IA 4P0TA 2WVJA 1SVSA 4TMXA 3THWA 3I8SA 3W8NA 1TL7C 3PEWA 3IIJA 5BN3A 2C03A 1T8UA 2ONJA 4AYXA 3Q9LA 5JI3E 2QMEA 2E9SA 1MH1A 2GEDA 1HT2E 3X2SA 2LWIA 1XXHB 3KFVA 1P2TA 4PQRA 5EJEA 1Q20A 4LC0A 3RC8A 2DCUA 1YZLA 4Q5IA 1Y3AA 1KK3A 4KBFA 4GZLA 2CMKA 4IXMA 3R9WA 2WWXA 1CP2A 2ODEA 1PUIA 2RGDA 5EQTA 2C9YA 4P4UA 4C9BA 2VL7A 3R8FA 5DSZA 1AS0A 1WE2A 2QP4A 2W58A 3QNUA 4KU4A 4C2TA 4UJ3A 2RGEA 1XD2A 4LBYA 1D9ZA 1OF1A 2F43B 1VIAA 2C2HA 1HUQA 3BFKA 1PZNA 4QGHA 1T3LA 4QFMA 1OH7A 1PVOA 4PZYA 4RD1A 3PITA 2R6GA 1AM4D 1G9XA 4P4TA 1JQLB 1ZMXA 2VSFA 3RNLA 3QBTA 1ZM2A 1NVWQ 4O3MA 2FEOA 3C7KA 3ND8A 3VX3A 2I1VB 3ZS9A 1DAMA 4M9ZA 4JL5A 3CZPA 1E9EA 4MRNA 1UKVY 4C0BA 4PAOA 3GLFA 1G21E 1X6VA 2XEXA 1EX7A 5F98A 5TARA 4DDWA 2Q3HA 2YWGA 2WWGA 2AFHE 2W6JA 3KJHA 5AJYA 4BPBA 1UF9A 3M6AA 1NI3A 1PUJA 4JVLA 1Z63A 2CEAA 4M1OA 4GZMA 3WP1B 2KE5A 1OJLA 3P4XA 2EWVA 4D2IA 4OBEA 1SKQA 4BFYA 4M1WA 4LJ7A 3N5CA 5EP3A 4CEIA 2PX3A 5JHHB 2JLZA 4MKGA 4P31A 3R20A 2XTNA 3A1UA 1XZPA 1JR3D 2XTMA 4LDJA 2ZI9A 3G5UA 4FMBB 5KSPA 1S3GA 3D6TB 1TF5A 5CDFE 5CM8B 4AG5A 4MH0R 5EP4A 4HAWA 2JLYA 2OT3B 3N2IA 3QXSA 1G17A 5FL3A 4B73A 3U7HB 2GXAA 1KZ7B 3ND9A 3K9GA 4JBYA 5CYOA 1CBUA 2VHTA 1G291 3A4LA 3D31A 3MWJA 2G83A 2WWHA 3OE7D 2OUKA 4UNPA 4EUNA 2V1UA 5HE8A 3AM1A 4JVMA 4ABYA 3H86A 3AB3A 1KJZA 2NO7A 2VP5A 4Q7LA 1ZD9A 1U99A 1IHUA 3OEHD 2KI5A 3PFIA 2H18A 5G41A 4MYHA 3FMOB 5AUNB 4TSFA 4UNQA 2EFHB 2FGKA 4OHWA 1TMKA 1RRFA 2WKPA 3K70C 4US0R 2CE2X 1P73A 3LH5A 2CJWA 1OXUA 3QJYA 2ZI5A 3QKRB 5AR1A 3TQCA 3W5IA 2YC2C 1ZD8A 3SS8A 621PA 3P27A 3SZRA 3MWKA 4QG7A 2FDCA 1QG4A 4Q7MB 3K09C 1KSGA 3U3OA 4KAXA 2XSZA 1HH4A 2G0NA 4E03A 3AKYA 3GJ5A 5J40A 2CXXA 1HE1C 3FDIA 1BS1A 3KX2A 4IVPA 4Q47A 2GCOB 2PT5A 5FOWA 4DIEA 2A7QA 1GRNA 2OCAA 3R9IA 2QTHA 4ACAA 4DT1A 1XJQA 3PVSA 1X8LA 2ZJYA 4OI2A 4EQ6A 4A15A 3K0CC 3U7FB 1G8FA 2ZRKA 2PT7A 3LA6A 4IVQA 1H8EA 2O8FB 4PTLA 3GD7A 4A82A 4B47A 4MGKR 3OIUA 1W0JD 2WMOB 3VKGA 2GESA 2AWOA 1MKYA 1JPNA 1KI2A 4NPHA 1Z29A 1Z06A 3LQRA 4Q4LA 3TGPA 4TLBA 1W7AA 3ECCA 3PUXA 1D2EA 3O47A 4KFUA 1JAIA 3C16C 3EC2A 4JLNA 5E4FA 2DWOA 4QXAA 3K9NA 1N6KA 2D3WA 2JCSA 3B1VA 5DN6D 3RRMA 3CX6A 4ZIRA 5J4HA 1G7TA 3UWKA 1LNZA 1G7RA 3CRQA 1E2IA 3NXSA 2GAOA 4LPKA 4HAXA 4JL8A 1P9WA 1AGPA 1U9IA 4Z1MD 1GIAA 1AGRA 2QZ4A 1M1YE 4JS0A 2P5TB 1XEWY 3SDZA 1N6RA 3FHCB 2OCPA 2IYRA 1JR3E 3B78A 1XCGB 3F0TA 3KJEA 4BFWA 2FN4A 3AVYA 2WJYA 2FSIA 5HTKA 2HJGA 4B48A 1DAGA 1KI1A 3KUDA 1IJFA 3QPVA 4QBIA 4XWKA 2IEYA 4QNMA 3LW7A 1D2MA 4NL4H 1FMJA 3M0EA 4OQLA 2PX0A 3MGCA 4MUAA 1P9RA 1ODFA 1N0VC 1YR7A 4Q4HB 1N5LA 1OE0A 3AF2A 4V0KA 3W6OA 3JVVA 4OQFA 4BFSA 5HR5A 5KDDA 1OXSC 5JBQA 1KAOA 1NIPA 3DOFA 2TMKA 1E0AA 4C0QC 1CJKC 3KB1A 1AKYA 1JBKA 2QE7D 5TVKA 2IS4A 3LX5A 2ZJBA 2VHUA 3GJ6A 4O2LA 1DAEA 5BQ5A 5IDVA 3DKPA 4RD2A 3A1WA 3HYRA 5JWHA 1E9CA 3BERA 4DCVA 2VF7A 2VTKA 3AVUA 4C3ZA 4BLRA 4RVCA 4JYCA 2DFLA 3WNCA 3K53A 2IYZA 3LVRE 2GZDA 1NG9A 4PZLA 1KK2A 1F2TB 1M8PA 2ORVA 2FNAA 5E7MA 1EFRA 1CR2A 5LD2C 2OFOA 1D8TA 1W0JA 1GL6A 3ZVNA 1V43A 4S35A 2AXPA 4A8JB 1UADA 1VYUA 2Z4RA 2VP4A 3NKVA 2FU5C 1U8ZA 4DLTA 2ZSBA 3CH5A 2OSBA 3OE7A 2QE7A 4BLPA 1E1RA 1P2SA 2RGGA 2OV2A 3CBQA 3QQ5A 4Q66C 4UNSA 5JWRA 3IDQA 1TQ6A 3UANA 3TW8B 2YOHA 2X19A 5H68A 3QIAA 3LFUA 1E3MA 1A2KC 1HQCA 1JJ7A 1Z07A 2WSSA 1QHGA 3LDAA 1L7VC 4P33A 3U6KA 1L8QA 1J90A 3DVLA 4N1AA 4QGGA 3TIFA 3ZD6A 2A78A 4WVFA 4XVQA 3SHFA 1SKYB 5BWMA 2JDID 1CJMA 3OEEA 4LHWA 1G6HA 2IYWA 1U81A 2XZLA 4HAVA 1N25A 4YXWA 2H17A 2IYSA 3K0AB 4GOKA 1XMSA 1XCMA 3GJ8A 4YMVA 1FUKA 3F8TA 2QMUA 3GCGA 2MMCA 4RD3A 4RZ2A 4XOIA 3F3YA 1F2UA 4P3YA 1JXOA 1LW7A 3TK1A 1BYIA 2AN9A 1JALA 4KFTA 4Q4JB 1SXJE 3MAAC 4NP6A 3AUXA 2Q9BA 3CZQA 3PCRB 3B1XA 1BKDR 1XEXB 1W36C 4Q00A 1ZU5A 1G8YA 4IW3B 3RHFA 4JKIA 2C8VA 3OESA 4US2R 5CM9C 4IEEA 3AP1A 2FFAA 1K5GA 3AVTA 4AURA 2C95A 2QA5A 4LC1A 4EPWA 5M04A 3GPLA 5AK0A 1QHIA 2ZROA 2ZSAA 2QMOA 1GKUB 1LB1B 4HDCA 5L3SB 3P1JA 4DLRA 2AD5A 2QAJA 3FWYA 4FWIB 4ZIRB 3DPUA 3BC1A 3HU1A 1N5KA 2R9VA 1L4UA 1KDRA 4RKEA 2OO7A 4PHGA 3WYGA 2HXYA 4ZI2A 2GJAA 3FMIA 4WW0A 5G3YA 3SOPA 1NRJB 3T1QA 4JLVA 5AJXA 1FOEB 3NC0C 3ZQ6A 3CRMA 2C5LA 4NONA 1ZUHA 1X8JA 3IEUA 4I1SA 5EE9A 3VNUA 4DSTA 3TKLA 3BFXA 4PPQA 5B58C 3O8RA 2HEIA 5EXSA 3U7GA 2ZIAA 1KK0A 3TSZA 3OIWA 1GP2A 2VSXA 1E0JA 5FL7D 4F4CA 1TF2A 2CLSA 2ORIA 3FKSD 4RZXA 4HLCA 4Q7JB 4A1FA 5CITA 1OH8A 3UG7A 1S96A 1XB2A 4L16A 4MITA 5EP2A 3AV0B 3NTUA 5IF9A 4TMWA 1Q22A 2IYUA 2WPDA 3IPXA 3LD9A 4IDHA 2GF9A 2R6AA 4QKQA 4TL8A 1KKLA 2HF8A 4QOSA 3PENA 2RGBA 3OIVA 1ZVQA 1Z08A 5J4LA 4G0NA 2L0XA 5K8LA 4OI1A 3DEFA 3ZIAA 4AKGA 4ILEA 3KXIA 1P72A 2YNMA 4R98A 1XU4A 1PV4A 1KAGA 1NJGA 4EFMA 3CRW1 2ZREA 5AUQA 3G82C 1U0HC 2ZE5A 4HZIA 2WHXA 5KSZA 3B9QA 4PHFA 2C96A 4H1VA 4BEBA 3FHOA 4K81B 5L3QB 2JIZD 1W2GA 4M1YA 5FBQB 4WZBE 2DB3A 1CLUA 4GL2A 5EXPA 5FOTA 1GM5A 1LV7A 1E96A 2V3CC 4BFUA 4DC9A 5FPHA 1W4RA 5CIWA 5JWOA 4ZCLA 4OK5A 2XNDD 3L43A 3AKDA 2YVUA 3GLHB 2GEVA 1E4YA 1HEIA 2ODNA 3X1WA 3ZDQA 4A2QA 2QT1A 2JLXA 1GSIA 1W46A 4TMKA 2O5VA 2JASA 3Q72A 2ZE6A 1G3UA 3K0FA 4PSAA 1ZM3A 4UKDA 4NYIR 4AYWA 3EZ9A 3WHLA 5TV2A 1IXSB 1OHHD 2QGNA 3PV0A 5D3MB 2BOVA 3QXXA 3X1DA 4EIWA 1E2JA 1VCNA 3KKOA 3W34A 1W4AA 5JLJA 5BYJA 5GADl 3GLIB 2R8RA 2PZGA 2IWHA 2PJZA 4R2IA 4QM6A 4ZCMA 1NL3A 1YKSA 2P6NA 1OXTA 1Y63A 2Z6VA 2RB4A 4UXHA 1COWA 1IY2A 2JDIA 2QL6A 2F55A 3HDTA 3K0AA 2O0JA 3KKMA 2XTZA 2JGNA 4LRWA 1XP8A 1VCMA 2F9LA 1W0KA 2ZJAA 3QXJA 3FYHA 2DR3A 3QVUA 4WXRA 2ZRAA 1QHHB 4YMTA 4D4JA 1F60A 1NBME 2WICA 2J59A 4M9SA 4WZAE 2VH5R 4Q19A 1YZQA 4IOKA 3KUCA 1WXQA 1FX0A 1A5TA 2DWQA 4AY2A 2D62A 2RGAA 4F91B 5AUOB 5KPJA 2FMXA 2FA9A 1JI0A 1PLKA 2BBOA 4ARZA 4WBSA 4RD0A 3SE0A 3EAQA 1FTSA 2WOOA 3GJ0A 4R2HA 3RS3A 1A4RA 2FJUA 1QG2A 3CONA 1NMYA 1NN5A 1NVVQ 1EWRA 2GXQA 2J45A 4LX0A 5AJWA 4C0AC 2UZ3A 1KOFA 4KXFB 4RFSA 1G1MA 2QU8A 3R9XA 3C5CA 4CEJB 4TMZA 3EPKA 3B1ZA 1DG3A 2BCJQ 3MJHA 3UG6A 1T0HB 2ZITA 3K0EA 2C98A 4M22A 1WQ1R 1T3HA 4ZKEA 1XF9A 4ZPXA 2OILA 2JLRA 3D7MA 4NKRA 3RS4A 4C0SA 2ZE8A 1S9DA 2VP0A 4H1UA 4XIGS 3KDSE 1NY6A 1PLJA 2AHOA 3A1TA 2JEOA 3W90A 5J4YA 2R6FA 1C4OA 2NZJA 1OLOA 5E7IA 1WBBA 3VFDA 1LY1A 1VKJA 4BUJA 4DVGA 1Z47A 4DKXA 1HTWA 1KI4A 3CIOA 1Q44A 2BBWA 2J0VA 2IHYA 3B5JA 3LBHA 4HAYA 1BMFD 1MO5A 2ZI6A 4D80A 4EQ6B 1E0SA 3ZVMA 2ZAOA 2WOJA 4C7OB 1XTQA 2PH1A 2VHQA 1MO4A 5BN5A 1F3OA 5FPKA 3KQKA 1Z22A 5C46F 4XWAA 4LCBA 1QZXA 1AS3A 2WSSD 2JA1A 1XMJA 5CJPA 1E2FA 4GP7A 3LO5A 1X1SA 2G9NA 2V9PA 4UNNA 1II8A 5IK2A 2OE2A 5KYKA 1JR6A 3W8RA 4ON9A 3T1OA 3VNVA 3UMSA 2J1LA 1VDZA 1XNJA 3SJBA 4JZKA 1N6NA 2C78A 1II0A 1XXHE 2GBLA 3U60B 1VYTA 1J8YF 3C14C 2WWWA 3W5JA 3BB4A 2V7QD 1J99A 1W2HA 4OQMA 4W5WA 4DLYA 4PC6A 1KJYA 3B82A 4ZDKA 2RKOA 4POAA 1AJEA 3ZS8A 4LHYA 3ZGXA 3N2EA 1Z0DA 2BMJA 4TLAA 1ZM7A 2QORA 4N0DA 1PLLA 4TZ0A 1FNNA 4TT3A 1R8QA 3AP3A 3UK6A 2QPTA 1W48A 5FTJA 2KWIA 3I72A 3U3KA 1QBKC 1FX0B 3BB1A 4K46A 1YRAA 1T3SA 4L9SA 2NO6A 4PO1A 2CJWB 2FX3A 4NBSA 3IBGA 3RRNA 4DJTA 2F1RA 2QI9C 3NBFA 2ZS9A 4TL7A 4ZO4A 3DMDA 3ZZTA 1DE0A 1LTQA 1XRJA 4NU0A 4EPYA 1U9IC 1VHLA 2QBYB 3I32A 4M1SA 3WP0A 1VG8A 2V55B 3RC3A 4TTQA 3MWLA 2XITA 1KO1A 1JAHA 4YDHB 1KI6A 5TB5A 1P9NA 2Q3FA 4DWJA 1NKSA 2QRNA 3I5XA 1OIXA 1ELOA 3ADBA 1AZSC 3LW8A 4OHXA 4LGMA 4B76A 5ANRB 1IQPA 4W7SA 2NQ2C 5DI9A 2HT6A 2ZRDA 3U3JA 3KXKA 2YC4C 3WMEA 3ZQJA 5SZHB 1H8HD 4I1UA 1OIVA 4RCZA 5H8WA 2I3BA 5KHOC 5FPYA 3VTKA 2OG2A 5IT5A 3HU2A 2ONKA 4Q4AB 4DB2A 3PUYA 4PSKA 2B7CA 3UKDA 3T1TA 5DN6A 2WWFA 4MRVA 2REXB 1D9XA 1G3QA 4OI0A 2NO1A 3UWOA 1HA3A 5AJZA 4FIDA 2FPLA 4XH9B 4PHHA 3T5GA 1NY5A 1G8GA 4DLUA 3BE4A 1SVMA 1I4DD 3B1YA 3NH6A 4CZ2A 1OH6A 5KPDA 5GVSA 4IOMA 2CL6X 4RSGA 1KO7A 3U4QA 4DDTA 3DDCA 2IUUA 3ICEA 4TYQA 2KSQA 2YZ2A 3Q7QA 4DRZA 1NKTA 2OBLA 3VR1A 1JR3A 1EGAA 1E1QA 2GHIA 5TMPA 2NGRA 2DHRA 1Z6XA 5B64A 2J9RA 1CEEA 2O8BB 4JVNA 3MSXA 4QHYA 1YVDA 4NCHA 1GNQA 2QPOA 2YWEA 2O8DA 1LF5A 4O0MA 4N0EA 2QM7A 1KIMA 3GEIA 2QN6A 3PJRA 1R0YA 1D5CA 3GLIE 1WF3A 4GOJA 3CM0A 2H5EA 1FPMA 3IPYA 4KYIB 5KOYA 3HYTA 3CW2A 2P6UA 3GLIA 2W0SA 1X1RA 1VG0B 2W0MA 4EFNA 3UATA 1R10A 3VAAA 5HKKD 2ZRNA 3RABA 4AKIA 4NYJQ 3QXCA 3C41J 4QJ3A 3L8YA 4FMCB 4RFSB 4V03A 1WP9A 1OB2A 2REOA 2NIPA 4PX9A 3FHTA 1P75A 3DOEA 4KYUA 1P6XA 4NDZA 4JSYA 4NTZA 5JJIA 4AIIA 4D6PA 2WKQA 3FVQA 1YQTA 5FUYA 2WIAA 3IIMA 1YR9A 2CLDX 1GKIA 4G5QA 4RFVA 4PANA 5DGXA 5JS7A 3PG5A 1E1QD 2HV8A 2VRWA 1DO2A 4PZZA 5FOVA 2IF2A 2IC5A 4CF7A 4M1MA 4B3XA 5KUTA 3D3QA 4JKYA 2ZJ2A 4GMDA 3IKJA 3CKLA 1SVKA 1FMLA 2VQSA 1R0ZA 2GILA 2ZRMA 3T35A 3U3RA 1E32A 4LJ6A 2IHBA 3FB4A 4Q21A 4A0GA 3HPQA 2BBSA 4HYYA 4DIDA 4DLSA 1R5BA 4C0KA 1XPOA 1KNQA 3MLEA 2ZS7A 4TWZA 3NHAA 1KSJA 1E9AA 3CPEA 4V0ME 2WV9A 1FQKA
chains in the Genus database with same CATH superfamily
4RM3A 1POWA 4YLGA 4WUVA 1BCSA 1V16B 2XQIA 4RJJA 5DYGA 4E21A 1BDBA 3AK4A 5BYKA 3LUAA 3CGWA 3C6MA 2XQGA 1VL5A 3PFWO 1Y8RA 2Z56A 1U1CA 3AIOA 4BQSA 3T3OA 2CHVA 1IZ7A 2O5EA 4RPJA 3V2GA 2PL1A 2ZQ5A 3C7TA 4I1RA 1ZVMA 4XIIA 2XNSA 1PFWA 4X1YA 1WOYA 1G5TA 3C87A 4LYDA 1QDUA 1NJ5A 1FYEA 4C6SA 2ZR0A 3FKQA 3G1TA 4ZI3A 5A0TA 2BFBA 2ATXA 3AMVA 1VPTA 3S8YA 3W6PA 1I13A 2V7BA 3N6RA 1EP9A 4Q7KA 1EAYA 2YASA 5CLHA 5KNBA 3LUHA 1OLSB 3O9MA 2I2BA 2QUZA 2Z4SA 4GOLD 4O02B 3LBAA 1D1SA 1SG6A 2GT1A 3H3XA 5DCUA 4CR8A 3GROA 3HCOA 1Q1BA 2NTNA 4WCVA 5FF9A 3ASUA 3T7RA 4WV3A 3RC8A 1HY3A 2Y1OA 4OA5A 5BQPA 4E7PA 3RTEA 4QUAA 1UJ4A 1KY4A 3G2KA 4AJPA 1XEXA 3U9SA 4DM7A 1YULA 1DUVG 4AZ0A 1PR9A 1KOGA 1A9PA 5TJ9A 3RARA 3NRJA 4TL6A 5LLDA 1USUA 3ZHVA 1IBRA 3ORFA 1ZQ1A 1NR5A 4MKHA 2FKAA 4B8ZA 4JYMA 5C8YB 4IXDA 4EF4A 1Y5RA 1N2SA 4PO9A 1GPJA 3FFAA 3TW6A 2XDAA 3AM3A 4LRYA 4PYKA 3OQ1A 4LYHA 2FMFA 4NBVA 2NZYA 4JLDA 4FHZA 4OGWA 3TGWA 5LR6A 4PIMA 1CQXA 1YDFA 3M6MD 3VI3B 1KH2A 4E15A 3T5BA 1DBIA 5ERGB 4BLTA 1OPXA 2W8BA 2ATVA 3HYLA 2WC1A 4WBXC 3NZEA 4RHYA 4MJ7A 4EK9A 1E62A 5EE1A 1WZNA 4P32A 1NVXQ 1KI9A 3FNHA 4H1HA 4MKIA 2QF7A 4ZVNA 5JYCA 1AQIA 2O2XA 1IL0A 5ENZA 2BR4A 4COKA 4JKOA 4Z4QA 3DZDA 4TZ6A 1O97C 5BXQC 3FETA 1ISFA 1W88B 3B6EA 4EHLA 3TEMA 4MS1B 1YR6A 4URVR 4LRUA 5FKJA 4M86A 2O8DB 1YJ5A 2CNWA 5CGZA 3MJCA 2CCGA 3V48A 3VHQA 4BZZA 1J23A 1G6OA 3R8CA 2BC9A 5TNXA 4L73A 5HIKA 2YJ5A 4DW8A 5E6RB 1U65A 4YUVA 2I7XA 3ZU5A 4PG7A 5DHFA 5GTDA 2YZGA 1K4MA 1I2DA 3IQHX 1J9GA 3L7AA 4M0KA 1BO6A 1ECPA 2OD2A 1RYNA 1Q92A 2RGXA 2V4UA 3LS2A 4WXEA 1TEZA 3I3OA 2HH9A 2PQMA 2PMDA 5IHPA 2MINA 4FHDA 3EOAI 5COAA 5K1ZA 4CF5A 2YHSA 4P54A 2WIJA 1KZ1A 1Y3CE 4HOYA 5I51A 1GUFA 1MGPA 3ZW8A 1T8RA 3COZA 3BWDD 3OQJA 2C2XA 2Y0BA 3PB3A 4IHJA 3L6DA 5TSDA 3NOQA 1E4OA 3B85A 1CQWA 4DS3A 5L7TA 1UPCA 2JJ1A 1A7AA 1E3QA 5IM4F 1M9NA 4DABA 1NVFA 2EKDA 1DELA 3CX7A 4MI3A 5AW1A 4TWIA 2PNFA 4FE4A 4ZCQA 4EB6B 3GJXC 4TWBA 2QN8A 3K70B 3C5HA 3H5NA 2ERCA 3K1AA 1AKEA 3MLBA 5AXBA 3W5HA 2J41A 1HQYE 1JP7A 3BCRA 4FOOA 4AM8A 1O94D 1RHRA 1RT9A 4UEKA 5JNUA 4DMKA 3HB4X 2Y0DA 1ORHA 2VRCD 4OK6A 4CRWB 1UC4B 2C2GA 3QJ5A 4GVPA 2GK6A 2FOIA 4OUDB 2EFJA 2QROA 2V7WA 2DRIA 2R5FA 2HADA 1K4KA 1M8GA 2P7IA 5CX1B 4YRIA 3Q85A 1UXIA 1WCIB 2GJ4A 4FKMA 4IS3A 4LWPA 2A5JA 4OU5A 4QOEA 4XYMA 3TX6A 1EK1A 5IRCD 2D06A 4FCTA 4NE7A 1FL9A 2FQWA 2PKCA 3DW1X 3EK2A 3GAAA 3WNZA 4A36A 4KQIA 4LQCA 1FB5A 1ZNXA 3FHLA 1WW3A 4FYVA 3GQBB 3D6VA 3QVTA 4K1LA 4TRMA 5ILGA 2ZSEA 5CTJA 2F3QA 2IXAA 3QBJA 3BG5A 3C6BA 2JS7A 3HKCB 1KMCA 1I0IA 2K7ZA 4BKUA 1CW2B 4DDMA 4HWKA 4JMPA 3WJ1A 5DLQC 4JJAA 1A97A 2B5OA 2OXCA 1W94A 2WJ4A 6NULA 4G0MA 2W43A 4WPGA 3OQIA 2A1IA 2X23A 4UXJA 2ERYA 2ZWPA 4E14A 3ONEA 1MABA 1N2GA 4I6JA 2HQOA 5I7OA 1P62B 1NVUQ 4L02A 2CMDA 3BAZA 4KE7A 1FFXB 5J58A 1F12A 1ZIPA 4UOEA 3HNOA 3V9PA 1QQAA 1SXJC 3M83A 1N8NA 3WXMA 4HAUA 4UBKA 4QQRA 1I51A 2RBGA 3I76A 5CIQA 3P26A 5DDIP 3TLKA 3ACCA 3OFNA 5KDOA 2UAGA 3ZCTA 4MUKA 3KQMA 5JNLA 3RAFC 2O8FA 1WSBA 1QX4A 1TCCA 1Z2PX 4UD2A 4TXJA 4UE2A 1LGYA 3RFXA 2AXQA 3OZVA 4R2JA 5DYYA 2BH9A 1P91A 5EESA 4LF7B 4WZBA 3QSGA 1NM5A 4GEKA 4JJFA 3QF7A 4WHMA 2EERA 3FTEA 4XTRA 3Q12A 2HA4A 4CF6A 3QQPA 4Q3EA 1N0UA 3KEQA 3OCJA 1PG5A 1VJ1A 2WM8A 3H2BA 3IHKA 3U4HA 3B1KA 4EJMA 3FFXA 4HYQA 3SPXA 1PT8A 1K8ZB 2A86A 4P92A 3D8TA 1GYRA 3IAEA 4IQ4A 1JQDA 2ENUA 3DMPA 1EJ0A 3R4VA 4FYWA 4TLLB 3I83A 2GDZA 5HCIA 1XELA 2FP4A 1W1WA 2WF5A 4OHVA 1LPMA 3OU2A 1I2MA 4A7PA 5IXSA 5IKMA 3IHLA 2X1VA 4TRNA 1KHHA 2VO1A 4R41A 3TOSA 421PA 3HUFA 5DYWA 2BZSA 3PHJA 3FGPA 1W5SA 3HJUA 4JQSA 4LJAA 7MHTA 1CZRA 2BHRA 2JC3A 2Z2ZA 1T6YA 4LDQA 4TTSA 2ODAA 4KDRA 5G0WA 3I6ZA 2ETXA 2OHXA 3BQMB 5DWQA 4L8LA 2RGNA 5ITZA 3I2IA 1E61A 2B4TO 3M6LA 5AHOA 2KX7A 1YL7A 1WOMA 1JQJC 3O8BA 5CH5A 3E1KA 4MWOA 2XSZD 4I1VA 2Q5CA 1D4FA 1XV5A 2XCIA 4KVZA 4UAGA 2WYVA 4FZRA 2GNAA 4L7VA 3TLEA 1I7LA 3NGLA 4TVKA 3UJ7A 3OLYA 4AXBA 5I4KA 2RD2A 4G5OA 3ZU6A 3NORA 2BGNA 4HR7A 2W2TA 4JUBA 1XPUA 3RPEA 5B4UA 2LBPA 3JQAD 3I9V1 4M49A 2NU8A 2WD8A 2Q8NA 4UARA 3RTBA 4N0MA 2BMFA 3AESA 4FN5A 2O05A 5BNZA 4IFEA 2UYGA 4QBGB 1IN4A 5KQSA 3KU4A 3J81k 3E18A 1PHPA 1S2IA 1YU6A 4L6AA 4UHKA 3WO1A 3ZHYA 4YJ2A 4DV4B 3ILXA 4HGZA 1T0PA 2CDBA 3DMFA 3AV3A 4XVCA 1MO2A 3AFIA 5DM70 1IHPA 1RM4A 1YZYA 3QE4A 3A3KA 4HFRA 5JO0A 2A0UA 4HLUA 2PYDA 3OP4A 3HO6A 1WA5A 4B44A 2PMCA 3NDJA 4PFSA 3OTHA 1Z17A 1ECLA 1CPYA 3D54D 4KP7A 3GRYA 1BQ3A 3WBJA 4GGOA 2HIGA 4X8MA 4NJEB 2QYOA 4NZMA 1AO0A 2JFQA 5AI4A 2PANA 1TZJA 3JAWB 2V4ZA 4ZK6A 2XGMA 5JECA 4PC1A 3DDSA 4AS2A 5G53C 2PKQO 3DYIA 1SWWA 3MS4A 3P9NA 2NYRA 1PK9A 1I8TA 2JGLA 2I4LA 3L0CA 4WLUA 3IVCA 1M34B 1Z6GA 4G36A 3WBFA 4YLYA 4MR8B 2VYFA 1DVRA 2QVLA 2ODQA 3GVXA 3VSEA 3TD9A 1IONA 3V1TC 2NAPA 3EMDA 2ZRBA 1C8BA 4ZQEA 3FZNA 2AMVA 5EJFA 1JH8A 4AQYB 1YMQA 1Z0AA 4B2IA 4GT1A 3IE2A 4MVJD 4WX2B 4BMZA 4BO4A 4X20B 2RGRA 5C7OO 2P2SA 1NATA 3ROKA 4EZBA 4MPJA 1JJFA 2J6CA 4NS4A 2GKSA 2ANCA 3MLAA 3JAWA 2YWXA 4ZZIA 5BUQA 3WYCA 1AKMA 2RGYA 3WNBA 5DVZA 5FV7A 4K8OA 3ADPA 1EA7A 3IP6A 5IPFA 1E18A 2G76A 1LLUA 1RLTA 1KJQA 2VNIA 2YV5A 3PVZA 5FB3A 5E0OA 1OYWA 1UOPA 3MM4A 1HX7A 4GOMD 3ZGYA 2O8CB 1YCHA 3A1FA 1RBMA 4YS6A 2CL5A 2HIAA 1BWPA 2QR5A 1XZQA 5IXYA 4GI5A 1RC0A 5ICFA 3T3HA 4R1OA 3DNPA 4F7WA 4X66B 1AO3A 1U6IA 1XLTA 5HFAA 4DLVA 1DX6A 5ES3A 2A0FA 2I4RA 1CUIA 5D7NA 2IUYA 1V71A 4BQQA 1O5IA 4FHFA 2XH8A 1TQ4A 3UWPA 1HLDA 5JNRA 4K9QA 3GEMA 1TCUA 3SYRA 1LQ2A 3NB0A 2Q0QA 1GJRA 5A0VA 4AY5A 1D6MA 4PQYA 5I7SA 3UOAB 2X0EA 3II6X 3N7AA 2H16A 2O0MA 3EW9A 1KI6B 4JT2A 5FEMA 5H83A 4F4IA 3AVOA 1E3EA 4YCDA 1EFRD 4MJ3A 2BV3A 3DE1X 4PAGA 2IIPA 3GJQA 4G1VA 5K0GA 3ZVRA 4M38A 4BMNA 3LPNA 3ME5A 4BGVA 5EJ9A 4KRXA 4X0EA 1Z28A 4N7JA 4R4JA 2BRUC 2PL5A 2C5HA 3IT2A 2CLMB 3K4HA 4WE3A 4YMIA 2HK6A 5BORA 5FR1A 5IARA 2PYIA 3RVNA 1H4QA 1J1UA 3ZE2B 5EWJA 3AR7A 2PH3A 3UHOA 5F7OA 1P5RA 2OWDA 2ZRFA 1NNSA 3I0ZA 2VSOA 3CMCO 4HZGA 2RHTA 3N86A 2QTVB 4DQVA 1YH3A 4TS1A 3T6KA 4IV0A 3UMRA 4L8FA 4RQBA 3GP3A 1ZXXA 1R7RA 1CZKA 2NZVG 3EAFA 4K88A 4LMAA 2GYVA 3JY6A 4N5NA 2CBZA 2AMLA 2O9JA 2HK9A 3DEYX 3G5TA 1IBSA 4AFNA 5JBIA 2YMLA 5FOQA 4F7DA 1Z2OX 5HUQA 1GARA 1Q0UA 2DLNA 4B4OA 4DB4A 5IF3A 4HAIA 5CPBA 4RGVA 3TRDA 2NO9A 4UVEA 4TLCA 3EGXB 2GBCA 1OMOA 3F6EX 3T7CA 3ITDA 2YY5A 1ZGBA 3EVTA 5LXTA 1WDTA 1MAWA 3SLGA 1AN0A 1IN8A 1IY0A 3ZZMA 3DBLB 4WTOA 3DZHA 3K92A 1X2BA 4YCBA 3C85A 1KTVA 3OE5A 4Z4GA 2CXHA 3EC1A 1B8UA 3I64A 1PGNA 4NZNA 3VUFA 4EUEA 1MO3A 2OHGA 3WBBA 4AJEA 4CG3A 5KYYB 2CDAA 4UCQA 2OHFA 2BKEA 1A9RA 3OJXA 4PS0A 4ALIA 2O06A 3RS9A 1PWZA 1R5NA 2YV4A 3NTLA 4R1TA 1SVIA 4X95A 3EPLA 5KYTA 4U2FA 1ODTC 1T0JB 1RMYA 2BAGA 4INAA 2V9ZA 1NC1A 3E9MA 4LW8A 5GV7A 1PJRA 3DE0X 1SEVA 3ETHA 4KLZA 3RANA 5I7WA 2RHMA 1PX2A 2P9YA 3O82A 5CBPA 3O2QB 3VR4A 4BNNA 5HQ3A 1VLJA 2H8GA 1UK9A 2A3RA 1W0CA 1U98A 3ICPA 3MFYA 4NFHA 2B9EA 4MS4A 3ZE6A 1EFUA 5KTYA 4HATA 2AOVA 4IQ8A 5TDHA 4YRNA 3OTWA 1CQIA 2AJ8A 3K6KA 4LJ9A 5HW0A 5HMMA 4V0LA 4EJ0A 4PSVA 3AG6A 3FCXA 1HRDA 3W06A 2OESA 4YT5A 2WZQA 4I55F 2MYNA 4U1RA 4GYYA 5EFZA 4R84A 3P4YA 2FPUA 3O73A 3WZMA 8OHMA 4YMHA 1Z0SA 4P9NA 1ZHFA 2DPGA 2QD4A 1FSZA 3KAPA 4PNHA 2IWRA 2BUCA 5JD6A 4DXHA 2ZUWA 2JD2A 1DJNA 1MHPA 2A5DA 1OTHA 2FFQA 2GSDA 1GZDA 1UDRA 1ULUA 2A3NA 2NXEA 3E9DA 1AUOA 1IOZA 2ECPA 3LG2A 3CQ9A 2P9BA 3GDWA 3WO0A 4BKQA 3TRFA 3GUCA 2ZUDA 4GF5A 4DDUA 2CB0A 3R5KA 1QMGA 4GI7A 4XUDA 4YCLA 1VI6A 2XUQA 2AN4A 5I48A 6PFKA 1LD3A 4KFSA 1Q6YA 4UM9D 1PX0A 3DC7A 3OJFA 3P71T 2OZEA 2Y0PA 4M88A 2XYRA 4B4DA 2JHGA 4MVJE 3WGLA 1QQ5A 5HS4A 3AR4A 1N2HA 4IUYA 1GTJ1 4WDRA 4ZRDA 4BJ5A 2G1KA 4BWVA 5J2TA 4ETWA 1EQAA 3THXA 1DXOA 2OCXA 4QOHA 4R68A 1LWOA 1TJ4A 2HCTA 4HCJA 4PYLA 4MCHA 2G0TA 2JGDA 4MAFA 3IV9A 4NPAA 4Q05A 2CCJA 3A7EA 2L18A 3KT8A 2HXGA 4X6XA 2C59A 4UULA 4B6FA 4LCEA 3HB5X 1V4VA 1E6MA 4ZGWA 5KAPA 3W2FA 1H8HA 3OO0A 4DANA 4MVWA 1FNBA 4M7PA 1KZ6A 3ZU2A 4AD8A 1XT6A 1E5XA 4LQDA 4OCZA 3E9NA 3SBOA 4MV8A 1U2TA 4DZTA 1EHIA 1VG1A 3ITKA 5ETJA 3U3XA 5EJ4A 6ADHA 1O89A 4TTRA 4Z7QB 3EFOB 1EWTA 1QH8B 1X7WA 3EOZA 4G86A 3U80A 4EITA 2V7EA 1L5SA 2BONA 1Y37A 2HDNB 3W9YA 1PHRA 3BM5A 5K8UA 2X41A 3O3NB 3WK8A 3WISA 2WBLC 1SCNE 5IKPA 2JD1A 3HL4A 3IQXA 4PF1A 3VDMA 3LCRA 4JEMA 1SZCA 1BTOA 1KGDA 2K2QB 1RBYA 1TVKB 3KYCA 1WLSA 4L4UA 3AINA 4FE7A 3ILYA 3B6IA 4G5GA 4NCAA 4FYIA 5DNYB 5F52A 3LQ4A 4HO1X 3R3XA 1I3MA 4BNXA 4BE4A 3RWMB 4K26A 2ZJ0A 3AZOA 1KA9H 4WFQA 1XVTA 1QO9A 3ZHRA 4LKOA 5B6PA 5JAOA 1U8FO 2VAXA 1Q12A 1E9BA 2BEVB 2P4SA 4KIWA 3WBKA 1FP4A 3P9IA 4BKMA 1QP7A 1QV6A 1L1FA 3BSWA 3LPMA 4N6NA 5DM2A 4OQXA 2IK8A 1C7FA 5I9LA 3BMXA 3L4JA 5A5EA 4ALMA 3SU8A 3UGKA 1WXDA 1KH3A 3CNHA 2B8EA 2Q9CA 2KMLA 3V8BA 4D5EA 4QE3A 1G21A 4LF8B 1U7UA 2FK8A 3AHEA 1CUCA 2YN0A 1B8OA 1CY1A 1FFBA 1R0KA 1V3QE 3OMLA 4Y6SA 5G02A 1U11A 3PPVA 3EVDA 3N8NA 1W36B 3HB9A 3QWAA 1YF3A 3ORQA 2P4UA 2DXIA 4FZ5A 2X7JA 3BBLA 5D5QA 1T2DA 1IHOA 5AICA 1TYCA 1QIDA 1M8KA 5JT1A 5TT0A 4HMPA 5DH9A 1BGWA 3PT9A 2MYTA 2A67A 3TQFA 4N76A 4HDSB 1HZZA 2HPAA 3BPSA 2VWHA 4GPIB 2BFCA 2FLWA 4O4LA 3OWXA 4EGQA 4C1NA 4QGSA 3PRKE 1OU4A 2PL3A 4L0QA 4Q9AA 5D3QA 5LA6A 3IQDB 1UJNA 5REQB 3SG0A 3U39A 2O4UX 4N7RA 2D1QA 2G63A 3NBQA 1OXKB 5IJWA 2WHRA 3HCBA 5C3UA 1NQAO 4CN8A 5G4LA 3F6RA 3AYZB 1RWQA 2AOWA 3ZYCA 4W5TA 1AKWA 3HDJA 1BH2A 4ETNA 2VDWA 1QIIA 4NCIA 2XXJA 3I04A 4NG5A 2VXYA 1BKSB 3P19A 2QRKA 2GOYA 1ODCA 4CWAA 3EXHA 3G7NA 3OCVA 1GAQA 3UAYA 3URMA 3VSCA 2X3FA 3GELA 4O33A 1MFZA 5JZMA 5ALGA 1VHQA 2DPHA 4I1PA 4BHTA 2G6TA 2J09A 4XJVA 1G63A 1YIAA 2SCUA 4M8IA 4Q02A 5IUKC 2P69A 5C1DA 4JQZA 4KGZA 4HPWA 4O5AA 1ZAYA 5K0TA 2CCKA 2C82A 1DIHA 3EZ2A 3JZAA 4I9GA 4RZ3A 2QTTA 2IX3A 3SKYA 1BZYA 3I1JA 3BORA 1OIWA 1NV8A 1V3TA 3JTMA 3BTUA 3KKLA 1ZSNA 3DMNA 5ICGA 4YBZA 2XR1A 3H0KA 4FZJA 2B4AA 4DIUA 4H3SA 4YV1A 4RA6B 2HDWA 2VNAA 4JR0A 4Y6LA 5FBWB 4NIMA 4XTCS 4TYPA 4D0RA 1XDZA 2BZ1A 2IITA 1ZYUA 4YPVA 1AKUA 2VHYA 4KDEA 2FH5B 1M33A 3TL6A 4BNZA 1G9SA 4C5AA 1CXZA 1AGXA 4EYQA 2OG1A 3S8EA 3QFRA 1PN3A 3PQCA 2AG1A 1R3DA 5IBQA 4F4UA 3KWMA 5I9NA 5IX8A 2HPZA 2QOEA 2M6RA 1FDUA 3JRWA 3KQHA 1VHTA 2V6GA 3EVNA 1NW6A 2FPRA 3IR6A 1J4AA 3W9SA 1VSVA 3KXLA 1XTPA 4L9RA 3AB8A 2G25A 3BOSA 1QANA 3GLVA 1CUWA 1EZ1A 2G9QA 3I9MA 1LH0A 3JPYA 4I4TB 4OSPA 1ICIA 1M6YA 1QRSA 3BXZA 3A9UA 2NSYA 3E82A 4DR2B 2JVJA 5AVKA 4BNIA 5KU1A 5IKXA 4BXOA 3FSRA 3EASA 2BMVA 4HEHA 4UUAA 4UDXX 3F5DA 4UMFA 3A25A 1NIJA 2G4CA 1BJTA 1HK7A 1P45A 1T4CB 3RYFA 3X1XA 2A9VA 4HUQA 4D9CA 4RORA 5BSEA 2ZJ5A 4R71A 3JQ9A 3ZZ1A 1VSUA 1W47A 2VXBA 3S55A 5F1OA 5HCNA 5CG1A 3ROZA 4C3OB 4U63A 4XYEA 1HTBA 4COOA 5BV7A 1VE3A 3TQHA 4YMTA 4TYMA 3QKRA 5JXGA 1U9CA 4TGLA 1HLGA 3CEHA 1G8HA 1F4PA 1YJCA 4BX0A 4D25A 4ZA2A 5TIIA 4E6EA 2G28A 3HKBB 1RXCA 1YHNA 1JILA 2F4NA 3K96A 4B2PA 1K6JA 2WJGA 4IXTA 2ZK7A 4GNKA 1NYRA 3DKKA 2MSLA 1L3IA 5B1HA 2VYVD 1AUXA 3AX6A 3Q9UA 5JI2E 2IKQA 1K27A 3P2EA 1JFRA 1BCRB 1FYVA 1L4YA 4HMQA 4MCJA 4KR6A 2PMBA 1OI7A 2FFHA 2QTFA 3EFOA 4AKSA 4F04A 4BQEA 4G6ZA 1T91A 5GVRA 3S99A 4ANFA 3PFBA 2GJ9A 2RKBA 3TSYA 1AKNA 4QYIA 4D8WA 5JAPA 3LHIA 1DBPA 3OMWA 1P1KA 1JU4A 3S29A 3DCYA 4UZSA 5G0SA 3UJHA 1PR3A 1ETHA 3LX8A 3K6RA 4V0NA 3GJSA 3ZCVA 3QF4B 3H04A 3O9VA 4URWR 1Q50A 4I19A 3TLXA 4BL5A 4OSEA 1H2ZA 3IESA 3NJRA 4TQAA 3ZY5A 2FEMA 2IPNA 3NIBA 3GRCA 4W9MC 3Q7IA 1XZFA 4PSCA 2CKMA 3CNOA 4JLMA 5DMXA 3GFPA 3UH0A 4TVBA 3ZWNA 1SUBA 1V1MA 4ZT7A 4HPJB 4RTRA 1S4QA 3D6MA 1I6WA 1X19A 3RIGA 3OIYA 3DM5A 2QN2A 3OOSA 5FI3A 4LBWA 1H9BA 2ZB8A 3B53X 1W19A 2ZUVA 3UTCA 3E70C 3MK31 1Z8HA 4W9RA 2G9RA 3QJGA 4XJSA 3PQ2A 2CVOA 1MTOA 2EBUA 2XMDA 2HA3A 1GNVA 4Q1FA 4OAQA 3WFJA 4DWVA 4CIWA 3UB2A 1G4UR 3U2QA 1BXZA 1K3UB 1XYVA 2B8WA 5DTMA 4EG1A 3BWXA 5CDUA 5G4KA 3S1SA 3BFPA 2BFOA 5BSRA 1IVNA 1H8ED 4KKVA 2H8KA 3A36A 5HWSA 2WU3A 4G5FA 3V4SA 4E11A 2DBZA 3L2OB 3H2HA 1TYEB 3K73O 3MRVA 1NHGA 4LEIA 4E5NA 2P6RA 2MIIA 3KZKA 1RD4A 1SY7A 3KCQA 4IPTA 1GGFA 1XZNA 4P93A 5FTWA 1TYDE 3IYLW 1ZOIA 4EB3A 2OVFA 3L5OA 4PLZA 2O3SA 4GX1A 4V0OA 4I6GA 4MS4B 4MIOA 2ZIWB 1ISSA 3RJMA 1GNSA 1Q1EA 2CKDA 4D97A 5JJKA 4AZTA 1OU0A 4LHSA 1U4SA 1O95A 2VOEA 3VZRA 1R74A 2GYYA 3WK7A 2IYVA 2CXNA 3GP8A 4LFBB 1LBIA 4HS9A 5F3WB 4PBRA 2J9FA 1WAMA 4QAQA 5FJIA 5F4BA 4B6SA 1YB5A 4V1CI 2J30A 1A9TA 4E0BA 1C9JA 4KGXA 3JQ8A 1BU8A 1SBCA 3MCAA 1OY1A 3NM5A 3M4JA 2P4EA 2ZSHA 4JL6A 3LBIA 4UHJA 3V5NA 4EF6A 4DMGA 4JGIA 3TZBA 4RFLA 1KMNA 3ZWXA 1OPRA 2JFHA 3A4VA 4IINA 4ZANA 5JVDA 3ADKA 4H7DA 1WNFA 4Z8YA 3WICA 2IVFA 3BWVA 4PSUA 3VNQA 4EFLA 3X1YA 4K6KA 3TBFA 4O4LB 1R9JA 3EXAA 3ELBA 4R16A 1M1NB 1N1GA 4ARCA 3TUIC 3LKDA 1KTIA 3EXEA 5U4QA 1SIBE 2QNRA 4CEIA 4HWSA 4UM5A 2OV1A 3D7SA 3THRA 1EFTA 5AKEA 5BMVF 4JC5A 5DM60 3K4QA 2GBLC 3QFSA 3GLUA 1JLRA 3FVRA 2B37A 3D0QA 1N6IA 4JBGA 4CCYB 2HJVA 1GITA 1DO8A 1MRSA 1APBA 1P19A 2PGLA 4TKUB 1QIFA 4IHAA 4RK7A 4BKPA 3TVYA 2DF8A 4JT4A 1SK9A 2WM3A 4YUAA 4JYZA 4LPSA 1O96B 1OFHA 1IQUA 3C8ZA 2P9GA 4EGJA 4IVRA 3K31A 4RH3A 4Q1VA 4URUR 3LWZA 2ZUBA 3UFXA 3LCUA 3SI7A 1JN0A 4HWTA 4ADSG 3VHXA 2R1VA 3QUSA 4G81A 3CN9A 3RT9A 4EJSC 3CKYA 3VR0A 4QOFA 1QHXA 3Q98A 1ZD2P 2W6ZA 4ND6A 4FR5A 3H8JA 1LBSA 1KDOA 3G2MA 4CLOA 5SYNA 4FSDA 1DXQA 1JI3A 1M6NA 2EJTA 1L7OA 1XRLA 1LVHA 2DT5A 4EG8A 5ADUS 3OQVA 4PWZA 3L1HA 3BILA 2NUPB 1O54A 4HV4A 3IOBA 1DQNA 1T0UA 3IXMA 3QWBA 4PBSA 1V39A 5LXTB 4WOCA 4HG2A 1RLMA 5C0OE 1Q1GA 1ZMRA 3DV9A 1IC6A 4HT3B 2F3SA 5F5LA 1FQWA 3O4VA 1FNMA 3QMMA 1Y6FA 1JMYA 1DS6A 2IDZA 3GLHE 2WIGA 4KUHA 5E6UA 4J1TC 3UY4A 3WS7A 2PLFA 3VR6A 5HP4A 1KPGA 4O8CA 1TX4B 3LGXA 3V8MA 2Z95A 4ZCSA 2R1ZA 4FZ3A 5AKJA 1KDPA 4RA9B 5F1KA 3PDJA 3PR1A 5ADVA 1XZAA 3O8DA 4L74A 3M1LA 5DTQA 3SR3A 4JX8A 3KTAA 2VT3A 4K9PA 1JMKC 3UENA 3WGNA 1MR3F 1TUEA 2GEFA 2R60A 3FNEA 3AO0B 3GZNA 5F2OA 3ICVA 5BY2A 2EGUA 4CLRA 1RQ2A 1XAHA 4TS3A 1L1EA 4WQMA 4UFPA 2IZZA 4M0LA 2PG3A 5KNDD 4DYVA 4TYWA 2GN9A 2JBHA 2X9GA 4NJMA 3RE1A 4L3VA 2ZT7A 5DASA 1EXVA 1YRHA 1JDNA 4G1UC 3QHQA 1W25A 2RGWA 4ZYUA 4GOXA 4AJ2A 4OQNA 1VBKA 4FR0A 5T4BA 1Q7TA 4P58A 4MZXA 3K0FB 4U9HS 3W5BA 3BGDA 4I08A 4ZO9A 2GSWA 3IQGX 5EERA 4MUEA 3OC0A 1YRWA 4EHIA 1KVUA 3HV2A 3PDUA 3F96A 4UTPA 3CTPA 3OT5A 4IHJB 3VZQA 4A2WA 5JSZB 4KUEA 2WJJA 1AXRA 2BM0A 1P5ZB 4A91A 4IJKA 4BDSA 1P80A 4KACA 1PJSA 3REQA 1NJSA 2E6KA 2WUGA 3EIWA 1COWD 3CVUA 1UCFA 1BRMA 4WA7A 2VPTA 3L7MA 3A4NA 3SXPA 3AY3A 1SUPA 3VZCA 3PR3A 2X6QA 1Z2CA 1YKGA 1XA3A 2XE7A 3G5AA 1DFHA 1V26A 1ZGGA 1E1CB 2EHJA 1LU9A 1X7HA 2ZU0C 4MICA 3V4ZA 1GTZA 3QIVA 4GPD1 3VSAA 3W04A 4D9IA 4ESVA 2P65A 2LCQA 4OLJA 3ZN2A 3CRZA 3PXUA 3OQOA 1T8SA 3PS9A 1RVV1 4D1YA 1NP6A 1Z45A 4ARIA 4R1PA 2W90A 4R3UC 5LMUB 2BFAA 3D0OA 4YAKA 4ZGGA 2VCEA 4M60A 1TT5B 1E79A 1UBEA 2QLMA 2XUKA 5DE3A 3GQVA 3VH3A 3MRSA 3ZV3A 5HJEA 2BH2A 1N5OX 5C7IO 1FX1A 3IUJA 3MTBA 3THOA 2RI6A 5F12A 1ND5A 2DHCA 1EVEA 4DCSA 5JATA 3PLAE 2QKYA 3CSUA 3H1FA 5P21A 5ENVA 4Q15A 2COUA 3EZNA 1ISHA 5FUWA 1TLLA 3EXIA 3P9SA 5TQJA 2NU7B 2YIVX 3C7AA 2QV7A 2Z30A 4S24A 3HKCA 4AAYA 1TUIA 2ZEJA 4H2DA 2PX5A 1II9A 2I66A 2ALJA 2SECE 5IMBA 3U16A 4LSMA 1YBMA 3G9QA 2I4IA 3EWAA 2EQBA 1G19A 3VU9A 3NOXA 3LT5A 1VJ0A 4OHOA 4RS4A 4OTZA 4HMOA 4OF4A 3CRRA 3GAMA 4TXMA 5K8VA 4WLNA 3TKAA 3QVSA 5LP6B 2PL9A 1UKZA 3CWQA 4QTYA 4QUGA 4J16C 2BMDA 2Q41A 3I2GA 5K0SA 1TU3A 3BRSA 1II8B 4UTRA 1CY7A 3WNQA 1KGSA 1ZVJA 2F3UA 3DDHA 3M1AA 2QHXA 4FONA 1HEYA 5JZVA 2QAGC 1U7WA 4X7BA 4DL9A 1IPFA 3WGMA 1HI9A 3TNFA 2J3QA 1UPTA 3BK7A 1TA4A 3M3PA 2Q9AA 4FDTA 4Y2PA 5I9SA 7MDHA 3JAKB 3P0FA 1GG5A 4DAEA 2LE0A 3I6IA 1LQTA 1ZHHA 3JALA 4H7EA 4M0CA 2ZZNA 1EBFA 5DM4A 5A06A 2B7BA 1CS0A 2YQ5A 2W70A 4LA4A 1IYZA 1JDUA 2GXUA 1TUBA 4B46A 5TLSA 2UU9B 4BB5A 2BGKA 1TFRA 1TVEA 4FFSA 1ZRSA 5EVJA 1GTMA 3KJIA 4PICA 2GD6A 4EH1A 3KKNA 5I7AA 4WADA 4F93B 2EKLA 1NJ2A 1O8BA 1QR6A 2JGKA 4IICA 4RIIA 3W05A 4D4LA 4PN7A 2XIJA 1UC8A 1AMOA 3J80A 4C88A 3EWSA 1XBTA 3QLVC 3STHA 1X86B 1GZHB 2BMAA 2ZRHA 3E7FA 4R1UA 3PSHA 4ZGBA 1H69A 4JB3A 1WIWA 1EU1A 2X15A 1A9OA 3SQLA 2J9YB 2YIJA 3BL6A 4NWIA 5K0ZA 5FWNA 2DY1A 1E4VA 5DLYA 1A7JA 2JVKA 2F67A 2X14A 1M1UA 1RW4A 2DBYA 2IF0A 3O2JA 3SMQA 3QE9Y 5A3RA 3ER9A 3IEKA 2WP0A 3S1AA 1IXYA 4HVTA 3KUKA 3NBMA 4JLKA 1Q7CA 4OFZA 1U8AA 1V8PA 3IUBA 4CTMA 3A32A 1NBMA 5B6JA 4YV2A 4PYMA 3M6IA 2JARA 1JLLA 2JRCA 4OHPA 2GRAA 2KJQA 3C4QA 1NE2A 2V97A 1LUAA 2P9FA 4I55A 1JHRA 4Q6BA 1XCPA 2JFXA 4AG3A 5ARDA 4EY3A 2ZXEA 3ZV7A 3N8HA 3E4CA 2JI4A 3CUEF 3IEVA 2Q8PA 1SHLA 3CUKA 3UFBA 1BA2A 5EZYF 2NZ8A 4N4AA 1VJ5A 1FMFA 4O4JA 4DSOA 3Q10A 1GN9A 1T35A 4LDZA 3N53A 4HVAA 1N4AA 1NXPA 5AK4A 4FEAA 4TQGA 4JI2B 3IMCA 3FLBA 3LOQA 2J5BA 3D1VA 2JJMA 5DBEX 3CH4B 4GUDA 1MVNA 4OVKA 1VCIA 5BURA 4HGPA 4AIRA 5BN1A 1Y8CA 1P31A 3UUFA 4LX8A 2GYWA 2I2XB 4S1PA 5EMNA 3FX2A 4LVNA 5B55A 2VTBB 2HNAA 4ZYVA 1SHTX 1JR4A 2EJBA 4MAMA 2FK7A 2IZ6A 3JQ6A 2C3YA 1QM5A 1VZ2A 3KLOA 5IJAA 1S7CA 1I7SB 4DUGD 1N1DA 4PYIA 1PTKA 4URFA 5HX7A 3SGLA 2H2IA 5AM5A 4WY5A 3UCFA 2YMQA 1EAMA 4LE0A 4MVXA 4QJ5A 2MSCB 2PXHA 3TCKA 3G9XA 3QX3A 4B3GA 3IAM6 2VTVA 1VSQA 4K9NA 5FWYA 2GFHA 4PQFA 4QQNA 3BWBA 4UUQA 5EUMA 1G3IA 1EX6A 4BZQA 1XTJA 4RKFA 3WIUA 2AG5A 3DGEC 4JX9A 3OZ7A 4IIUA 1Z88A 5JFGA 2HBQA 1RZVA 1EE2A 4JHXA 3F7TA 3O8CA 1VP9A 2C4VA 1YA4A 1D1TA 3WG9A 1HSZA 5IDXA 2R6R1 4ENQA 5CBPB 3M2PA 2JFBA 1DKUA 2ZVPX 4B5LA 2VWGA 3GRUA 5FPSA 2F1OA 1FSGA 1QYXA 3HFGA 3F4LA 1U9YA 3RUIA 3RUAA 4DCUA 4QULA 1HT3A 4CQMB 5AJVB 1E3LA 3O8LA 1GSHA 3VA7A 2HAEA 3QGMA 1IG3A 4D57A 3IVXA 4YMWA 2FYTA 5BR7A 1D7OA 3IPLA 4R8RA 2AN1A 4EUKA 3GZTB 2R5WA 4W5HA 721PA 1I0LA 3QX7A 5KYWB 1J39A 4K3VA 1XFDA 1N3IA 4QSHA 2WM9B 4ENWA 1CF4A 1BDJA 5HSGA 1V9CA 3RVOA 4YAUA 2ZRIA 2IUSA 3H2GA 5BNWA 2OFWA 4RSMA 5I4CA 1CEQA 2YINC 3MN1A 1EFAA 1H3NA 1SA0A 1Z2DA 2W7TA 221PA 1EPUA 1B6TA 1TJPB 4HTFB 1YCFA 3Q6NA 3OZAA 3LC0A 4EPRA 1NN1A 5BNTA 4KQ9A 1G98A 2PUJA 1G6KA 1SUEA 1JDJA 4LHXA 3SY8A 3U9TA 5AHRA 4JR1A 2FWBA 4I5DA 2R66A 1ZIOA 4RSHA 1PJBA 2WTUA 1GNPA 1UMKA 4ZTUB 4XSHA 1RYMA 4F46A 1W87A 4QDZA 1QMPA 1KYIA 1RQLA 1Z26A 4UQOA 4C6TB 4NNJA 1KKMA 1RAIA 1QU3A 1Z4JA 1TADA 1UQRA 1H9CA 3EVGA 3A8TA 1OX4B 4RAQA 4L72A 1T8TA 4LJ5A 1ZD3A 4GRAA 3PZRA 3IUYA 4S0ZA 1Z5ZA 4I3HA 3RT1A 2FDRA 1A4UA 1XJWA