1T5XB

Hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
190
structure length
190
Chain Sequence
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Polymorphic Pocket at the P10 Position Contributes to Peptide Binding Specificity in Class II MHC Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 42
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t5xB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1t5xB01
4S1QL 4OCSH 4JKWA 1YJDL 4RFEB 3PHSA 4WW1B 4KQ3H 1SYVB 2VLRE 3T3PE 3W0WB 1FZJA 1AFVH 3CSGA 2CDEA 1PZ5A 4H0HB 5F7MC 4ELKA 2NY6B 1MCOL 4YQXH 4HZLB 5IVNA 1YEHH 4G43B 3H7BA 5I19H 4BSVA 1RZJH 3MRKA 4Y16A 1AGFB 1TITA 3VA2C 5EZIH 4TRPH 3DV4A 1XAUA 4KUCF 4LPXA 3EFFB 1X5GA 4Y4FA 3AS1A 1NGQL 2P5WA 1NGWA 5DUBA 3C5JB 1S5IL 3HRPA 1OAQH 5I71B 1MHHA 4Z7VF 1D6EB 3HFMH 3KPPA 1MWAL 5IV2B 5DJ0B 3ZDXE 3FRPG 3W9EA 4LPVA 4WHYH 3HAEB 5GGVL 2PR4H 2K9UA 3I3BA 4NSKB 1MCWM 1TVBB 1CFTB 3QIBD 5GZND 5D7IB 4Q0XH 1QFUH 3T65B 5A2JH 4KY1L 1HIMH 1MCEA 1NCTA 2HVKB 2HVKA 4DKAA 3H42L 4XP5L 3BP5A 1U95B 3QDJD 1CT8A 4U2YA 1KIUA 3BWAB 3RL1A 1CDJA 3IETA 4HCRL 3H2WA 3WL9A 4JFOA 1EIBA 3FQWB 3KLHD 3TT3H 4WWID 3N85H 2A6DB 1CDUA 3P30L 1ZA3B 3PL6D 4X83A 3TBSA 2Z8RA 4NNYA 3RVWD 4GO6B 1Z0MA 3SGEI 5F6IC 2B1HL 4NNXB 1QFWM 3IJSA 4PB0H 3MLWH 4QOKE 1FH5H 2C1OA 1VENA 2XXMB 3G5VA 4PRDA 5JQ6L 4G6JH 1JRHH 1XF4A 4Z6AT 2Y1VA 4MA7H 1R0AL 4Z7VB 3OAYK 5HHPA 3MLRL 4Q9RL 1QVOB 1J18A 1I8IA 4WWKA 3F58L 3HAEA 2FB4H 3TJEL 1BEYL 8FABA 1DBAL 3MOAH 3QQ9D 3MRGA 1W0VA 2DQCH 1KFAL 1XF1A 5EOTB 1RFDL 1D5XB 4L9DA 1OAYL 3ALXA 2PW1B 5DVOA 4FS0A 2PW1A 4IRZH 4WI6A 1EEYA 1QUNA 4XP4L 4XPGL 2J12B 2I25N 3QRGL 3OXRB 3IFOA 4XTRD 1BGXL 3E1F1 2QQLH 3JWOC 3EOBA 5TGBA 5TFSH 3ARED 2VSDA 3Q5YA 3CCHA 3SGJA 4DN4L 1R3LA 3STLB 2FHCA 4JDZB 3FO0L 4X5XB 4G7VH 5IF0B 4PJ5E 3RQ3A 5HGBB 1DQQB 1X9QA 1CFSB 4P0DA 3F7QA 3OX8A 5IHZA 3BPNB 4P3DA 3MUGB 3D85A 1BEYH 5I75B 3QXUA 5HHQA 2ZCLH 1B4RA 5I1HH 3TH3T 4X80H 4HK3J 1FYTA 4ZUWB 4P2CG 4IDJH 2FEDC 3FQUB 1E28B 3I85A 3A6CH 4X6FA 5SX4H 4OIIH 4PJGB 4C83A 4X7TA 2P5EA 2J8UA 3LQZB 3MA9L 4R4NC 4GW5A 1NCAL 2P4AB 1L7TH 3BKJH 3D85D 3O6FD 3QIWD 4DVRL 3DO7A 4UUJA 4LU5L 3OGOE 3NN8B 1MJJA 3P0VL 4I3GA 1U8KA 3SO3C 3ZHDA 1BLNB 1KJVA 2J6EL 3PWVB 5E6YA 3VXTB 4M1GL 4JANA 3HN3A 3SQBA 4ELME 2CR6A 1V8HA 2YHGA 4NRZA 2X4NA 3NTCL 3ILQC 5D96B 2OS7A 3WDHA 1AD9A 1FVDA 1T22B 2J3SA 4O2EB 3U36A 3L3OB 3OAZH 5J57B 2LTQB 3QDJB 5D7LB 3GZKA 4JRYA 3E6HB 4UBDD 3P40A 1CLZH 5TQ0H 3L7FB 5L7XL 2NNAA 4OF3A 5MEQB 1OP5K 2DTMH 5FGRA 4POZD 1HI6A 2VITA 3LEYL 3MUZ1 4OF8A 5E1AB 5D7JC 2CO6B 1KNOB 4YFLF 3RZCD 3WNNA 1ZKAA 5JHLL 4PTTA 1KEML 1P4BL 3M8OL 4YGVA 5EZJB 2OMBA 4L8BA 2PW2A 1T7ZA 4F57L 2X1PA 1EHXA 4L4TD 2HT4D 3UJJH 3D1MC 1MCSA 5MHSD 5ICYB 2HH0H 4DCQB 1V7ML 3JV4B 5LKNA 5GGSA 3SKMA 5DURD 1CLOL 4H8WC 3NIGF 2O5XL 2B5IC 3GKWH 3EOTL 1GSMA 3S3PA 3O4OB 5LGHL 2W65A 1ZHKB 3VDCA 2NY1D 1QNZL 5GJTL 2Q87A 5FXCH 3OKYA 4XP1L 5D1XD 3HG1B 4BH7B 3O45A 2FO4B 4WJ5B 5T5NG 3OBAA 2DTML 4MD4B 4PJIF 4PLNC 7FABL 5GGSB 2HN7B 4XNMB 3V6FA 1EHLL 5JOFA 5EB9A 1DL7H 1JPSL 5L2JB 4LSQH 1T1YB 3BQUB 2Q3ZA 2UV3A 3VXRA 5EZJA 3B5GA 4FFYL 3U4EA 2V5YA 3PP3K 3IU4H 4JRYE 4ELMF 5K9KA 4QO1A 4WY7L 3B9VA 2G60L 4JFHD 3V5DA 1UWGH 5JIPA 4NHUB 5I1GH 1OAZH 4XVUC 1R3IL 5HVHC 2X70A 1B0GA 5J9PA 2YPLB 4LGSB 1PX3A 1MAMH 5A2KH 3FQTB 3W11C 5F93C 5AG8A 4PJ8C 2AXGB 4PREA 3MRJB 3IDMB 1HCVA 4OD1H 4J12A 1RULH 4XP1H 1C7TA 4KKCC 4LLMB 4TSBH 4AENB 3ZL4H 3M07A 3LMJH 1Z9MA 3ZTNL 1NEUA 2E27L 2IALB 2BSED 4F37F 1EXUA 5FFLA 3C08H 2P49B 4PJ7E 4L8SB 4Z7UF 1OT2A 4XMPH 3ZO0A 2DM7A 4DZ8B 4PRNB 4M3JA 3JV4A 2FBOJ 2GCYA 1AD0A 5D2NA 3DO7B 4G80B 5JXAH 2HN7A 4G6FD 3UBXG 1WSST 4JFED 3V6FB 3WV0A 5K9OB 3T0XA 2YN3A 3O4LE 4DAGH 4RX4A 4NRXA 4WFFD 2GTZB 1NFDA 4P49A 4M7LH 1X7QA 5HHME 3NVQA 4K8RC 4MX7A 3VGGA 2AGJL 5CBAB 4MVBD 4HSQA 3UP1A 3MRFB 3TBVB 5DQ9A 2CKNA 1T0MA 3U82B 3BP7A 5HGGS 3D3VA 3MV9B 2VSCA 3BQUC 3QEQB 1S7UB 1UWXK 1MSPA 1FQ9C 3HA0A 4KDVA 4JKLA 4F7TA 4DUVA 4RCAA 3WIIH 4FP8L 3QNXB 3OMZA 2ADGA 3QDAA 4DEPB 1KTDA 4AYFA 2Q7NA 1NBQA 3RVVC 3UMTA 1KJVB 4XPTH 5EBWA 5DMGD 1GOHA 4I13B 3VXUB 2CKBB 2YA0A 4JY5L 3TVMB 1T1XB 2YZ1A 1E4KA 2BERA 1XMWA 3LD8C 5MEQA 1SJXA 2F58H 5T5FL 1FZOA 5KVDH 1NPUA 4XP9L 1J1PH 1JIBA 5FGSA 3IXAA 4NN7C 1PY4A 4BFIB 1CFQB 2HAZA 1U3HA 5D70L 5IBTL 1ZHNA 1XGUB 3CMOH 4OZGA 2OL3L 1NSNL 4JPIB 3H9ZA 5ISZB 4PBVC 3AS3A 1Q9LA 1CLYL 5HI4D 1Z3GL 3PQYB 4QTIH 2YD8A 3PHQB 4X99B 3OKLA 4FQ1H 2DQHH 2C26A 4M7ZB 3T8XB 3MRNB 4XNMA 2C3VB 1N0XL 5F7WC 1FFPB 3MLUH 4FXKB 1J0IA 5E00A 3D39B 1D9KD 1E4XL 1A9EB 1FV1B 2VLKB 1YEDB 1R3KB 2G75A 3WO3B 2RBLA 2A6IA 2DMCA 5D96C 1RZJC 1AQKL 1KPRA 1SM3L 3RWGA 4DQOL 1YEIH 2VDQL 4LRNL 5EUOB 5C09B 4ZNEE 5DDHA 1GIGL 4NQCB 4I2XB 1F3DH 3S96B 4M9OA 2A9ML 2JJTA 4KDTA 5I8EB 4N5EC 1KTKE 4WUUA 2CXKA 4GAFB 1T1ZB 3LY6A 4G9FB 3FO2B 5F7EL 2Y36H 2E9IA 4PB9H 4UI2A 4UTBL 1ZLUK 5JOPD 5KVEL 1A6PA 5ITFA 1JTPA 4ORGA 4IS6B 3TIEB 5F8QC 2AJXH 5J13C 3LV3B 1X5IA 4U1MB 3GIZL 1CBVH 2OMNA 4LLYB 4YDLB 3I6LE 5EZOH 3OJ2C 1TCMA 1B0RA 4KKNA 1IC7L 3SDXA 4O00A 1I9EA 1Q9OA 4JPWH 4NJAH 4U1NB 4ZO9A 1ZGLA 1RJYB 1ZK9A 4PJBA 4UMGA 4JEGB 5GRXG 4K23H 4X8JA 4PY7B 2DLEA 5IHUL 3RUGA 5AAMA 2EIEA 3MX0A 5EBLB 5KAQF 2DLGA 4GQPH 2VDQH 5IHBA 2HMIC 4KUZL 4LCYA 4QRTB 4NO2B 1GCFA 2A6DA 1CGUA 1PKOA 3S34H 3FZUC 1QYGL 3PP3H 2E9JA 3RWGB 1FDLH 3GSQA 3UPRA 4OLVH 5DZNA 3MRQA 2GJ6D 4K7FB 5MP6H 1IM9A 1UQSB 3KXFA 3SDXF 4U1JB 3LKQA 2H32H 3LB6C 4KROC 1AR1C 4L1HA 1G7MB 4ZUUB 1ZSDB 3GSVB 4GRLA 5T33L 4EQ3A 1BQHB 2XIDA 3NFNA 4TVSa 4D9LH 1S7VB 1G7IB 3REVB 3C6LD 3FN0L 4JREB 4PRDB 3D39A 3WCYA 5IUSA 1NDGB 1N64L 2F15A 1PW3A 1Z2KA 5T3ZH 4ORZC 3ZDZE 5DJYA 4XVSL 5DHVH 4Z7NE 4NFDA 3JXAA 2UZIH 1NBZA 3OQ3B 1FG9C 2QADD 2HTKC 5IEKA 2J2ZA 4KZEH 5CLWA 3BKML 5C8JA 4M6OH 1EEQA 4G9DB 1J1XH 5JHDE 3HNTH 3N1GC 1WBXB 3O3DA 4P23B 1H15B 1ZLVH 2HRLA 3P77B 3P73A 4HC1L 4JQIL 2EYRA 3MFFA 1LE5A 1HH6B 4KK9C 2R0WL 5EIQA 4OZGE 2GYSA 5AYQA 5MP6L 4OZHF 5C08B 1HYSD 1WC7B 2Q1EA 3P0GB 4GRLC 3C5ZD 2FX9L 4U0QB 2BY1A 4HS8H 3Q5OA 1AHWB 43C9B 5ITFB 1YEFH 4K3GA 3MCKA 4HJJL 2DQTH 4FNLL 4IMKA 5IJKC 2BOBA 3H3PH 1UXSA 3KS0H 5ADPL 2P5ED 2IAMC 5ANME 3V9FA 4Y4FD 1S9VA 2AV1A 1MLCB 3PV6B 1SQ2N 4LQ1A 4RGOH 5GZNC 1BVLB 4QHLA 4MXVE 3TFKC 2QV2A 1PY9A 4GKOA 4DN3H 2ICWJ 1KC5L 4HPOH 4XBPB 3PWPA 1UVQB 4V2CB 1CDIA 3U48A 1J88A 4C56B 5J06A 4NQVB 1RJLB 5LAXB 1R24A 4N0FB 2J8UF 3IKKA 4P5KB 5IFJB 1T1ZA 1ZTXH 4MXQD 1G7PB 4Z7WA 1YUHA 5E99H 3ARBC 3VMNA 3CVHL 1DANU 1A9BA 2IQ9H 5LBSH 4ZTOL 4GSDL 3WFHB 5DRZB 3TBVA 4U7SA 1KENH 5C09A 3O4LA 1GGTA 3SCMD 2IANB 4Y19E 2F74B 1BBJB 3ARFC 1JZ6A 3MJ8B 4IOIA 3LD8B 3KXFD 5HHOE 1YMMB 3QA3B 4WIQA 3BDYL 2IBBA 2NX5D 5CEYA 5ISZD 5D1ZC 4X9HA 2GFBB 5IJKA 2P44B 3GSWB 3TBTA 3BPOC 2GITA 2KZ1B 4M61B 1NJ9B 5GRUL 1OW0A 1NMBH 2IH1A 2WUCH 4LGRB 4ENED 5L9DL 4LEXL 3RUGE 3VXUA 2SEBB 1NCDH 3IYLW 2ESVD 3V7AG 3ZE2F 4EI5D 2OR9L 2IMMA 3TVMD 5E9DA 3BP4A 3I50H 5ISZA 3EO1A 3MRLA 4WHCA 3VI4F 1FCGA 1INEL 1LHZA 3B8SA 4ETQB 3O3EB 4PY7A 3QUZD 4E41A 1LO0L 3L3JA 3EYOB 1P9MC 4EKXA 4J3SA 2H9GB 5DJZB 3D69A 4O4YH 4H26A 1BREA 4X4ME 1QP1A 4EOWH 1XIWC 1UCBH 3GK8H 2FGWH 1EMTL 4BSVB 3VGHA 3MR9A 5HDBF 2ICES 5TH2B 4L29B 3BXNB 4P3CL 3MRDA 3HCVB 4G42A 2GW5A 4GRWH 4YDJA 2EH8H 3O8XD 3GJFH 3RUGF 1CWVA 1KIQA 3NFPB 4P2QE 3JUYA 5DHYA 2BCKA 3PE9A 4WCYH 2X6MA 5D6CA 3T2OA 4P46C 4FFZL 3F7YB 4KKBD 4S1RL 2B2XH 1NBYB 4WW2F 3MJ9H 3THMH 1TZHA 2X4QB 3GIVB 4BQ8A 3F5WA 2R9HC 2DQIL 1BWWA 1K2DA 4L4VA 2X4PB 1WWBX 1CD1B 5DRWA 2YMXL 5A2IH 5LCVH 1G6RH 3QJHA 4JFQB 4QRRD 4P2QD 2VXSH 4CKVX 5HI3C 5ACZB 1DEEA 4GMTH 4P5TD 4LLWA 5TF1H 4P9HL 2QSCL 2R29H 3BYTA 4HCRA 2FLBT 5BXFB 3PIQA 3QO0B 1W2KT 4WHDA 2BDNH 2CH8A 1F90L 1MUJB 3HR6A 3SKNB 3S8WA 1MJ7H 5J11B 2ADJA 3MO1B 1GC1H 2NTFB 4OZFG 2FJGB 1FH5L 5EA0H 3AAZA 2D31A 3OKDB 4NO3A 3FONA 2YPVH 3PUCA 5FCUL 4ERSH 3HNVH 1Y0LB 5I30L 5FOBA 1DTUA 5FOBB 4U1LA 5DUPH 1PVHA 2YOCA 3X12A 3O3AA 3WEXA 5HGAA 5MHSE 4POZC 1BX2B 3G04B 5MERB 4F7CA 5E94B 4PJHF 4U7KA 1H5BA 3MRJA 2NY7H 2ADJB 1GAFH 4HJGA 1HEZA 4ONFH 5TE7H 3ZYIA 3IT8D 3OG4B 2H41A 2D2OA 4K3HA 5ACMA 3OB8A 5GS0D 3SDCA 4BH8A 5DD5H 5IGXL 3O2WL 1NDMB 3R8BB 3BISA 1CD0A 2BVPA 4XI5C 4ESKA 1C5DA 4O2EA 5ESAA 6FABL 2QSCH 3WHXA 1RZKC 2PNDA 1A7BA 4Q2ZA 4QCIA 5BRZE 5CSGA 4KKAD 4O58L 4P46B 1EZVX 1BFOB 2GKIA 4R90H 1FZMA 5ICXA 5FA3B 1GC1L 3NN8A 3PG2A 2YD1A 5EFIB 1T5XA 5ICZB 3IVKB 4JZOB 3QEQA 3WO4B 5F7UA 4LAJH 4N8PA 4Y5YA 3FT4A 3MO1A 1RK0A 1YQVH 4JO4H 3IDNA 3HLAA 1TQCB 2YC1A 1TMCB 4KXZI 4FFWD 2WZPD 4KMTL 5IFHH 5K59F 3WMSA 1OVZA 4AL8H 1IM9D 2PYED 2XZQH 3SDYH 2H8PA 1J5OH 4X80L 4Y5XA 4JFYB 5BQ7B 1DUYA 4NQSA 1A5FH 3EFDL 3NH7H 5FOJA 5I1AA 2AXGA 5D6DA 4O2CA 4WDIB 5DD5L 2RR3A 4H26B 4MNQE 3UYPA 3ROOA 4JN1L 1UB5B 1V3JA 1CXFA 1UH2A 1JMZA 1IAIH 3U1SH 4PJXA 1Y6MR 4G8FB 3SE4C 4CJ1A 2Q76B 4I18B 5GZOC 1NAKH 1U8PA 3S5LA 3MXVH 1A02N 5FYKL 3QIUD 4NZRL 3A6BH 2OZ4H 3C6LB 1JPTH 1MCIA 4GW1B 4ODTH 4OZ4B 5IROA 1G7HB 5IQ9B 5IMLB 3IFLH 1ONQB 5HJ3B 5JO5B 32C2B 3MXWL 1PYWA 1WZMA 2CDGB 1KLFA 3DV6B 4PIRF 4DZBB 3SGEH 1KBGH 1J11A 5CUSH 1BLNA 5IMMA 4F8TA 4OCRL 4MXVF 3GIVA 2CUMA 1VFMA 5IB2B 1C16A 5BVPL 1DQML 3G5YA 1J87A 1FHGA 4NQDE 5D71H 3KLAA 1EGJL 1QFOA 2PXYC 2X09A 5T1KB 3V6ZB 4YXHH 4Y8AA 3T4YB 1KPUB 1KN2L 4Q0XL 2G9HB 2V17L 3AS0A 4CBPA 4YHLL 5H35B 5KBNC 4X5WB 3V4UL 1U92A 5DO2C 3BMVA 4G6KL 1IKNA 2XA8L 3RKDD 1QNZH 1IKFH 4O5LH 3P11L 3CZFA 3NZHH 3HI5L 2EYSB 3H3BC 4G6FB 1SY6A 2Y7QA 3G08A 1G9EA 4ZYKB 3AB0B 5IHZB 2MOVA 3DARA 3WNPA 4E9LA 5F6IB 3VFWB 1F3DJ 5E2JA 2ITDB 5TE4H 1PSKH 1KTRL 4Y5VC 2OTUB 4O9HL 3N06B 5IG7A 4LLYA 5DJDA 4FN0A 5CILL 4K3JL 3HS0A 2D03L 3IFPA 5CHNB 1UJ3B 3HC0B 4ZFOA 3ZT5A 4C58B 1U8IB 3LKPA 1FE8H 2CSPA 3D39D 5C0DB 1FZJB 2ZPKL 4O02H 2V17H 2BRQA 4EBQH 4ONHB 3F6LA 4ZS6D 1ZLSL 4JY6A 4ZXBB 2BNRD 2ERJB 3QEHB 3RGVB 4XCNA 1S78D 3I9GH 1CFBA 4KQ4L 1QSZA 1FG2A 1YY9C 4JN2A 5GSVB 4JO1H 1UZ6F 2DYPB 1AKJD 1A21A 4TSBL 3I2CL 5EORH 3UTSD 1XCQA 3DBXA 1ZT1A 2JELL 3QRGH 4BFGA 3E6FA 5SX4I 4B53A 5IW1A 3SE4A 1U58A 4YXKH 4KKCD 4J3OC 4RGNE 2HFEB 3VI3E 4IIQC 3EYSL 1PEZA 4OCYH 3MGAA 5HVHB 2IBZX 3RTQA 1ZHBB 3QIBB 1OP3H 4F9LA 5GGVY 3EO9H 3VXUE 3TN0C 1NC4D 4NKIH 2C4FU 3TZVD 1LGVA 5CHNA 2X4TB 4LCIH 3F12B 3U30B 1JNJA 2PUQT 1R3HB 4UINL 4ALAL 5BV7B 3DROA 4U6VH 4PRID 4LIQL 5C70A 4QT5B 2EDEA 4QRUB 2I9TB 1V7NH 1F4YH 5L2KB 4PJDA 3K2UH 3CXDL 4M03A 1TQBB 3OWEA 1UWEL 2GJ6E 2HKFH 3D39E 3V95A 5F9WC 5GRYA 1OW0C 3L3DB 4S11A 2VZ1A 4N9GA 1OTSD 2DMKA 4HFUL 3TEUA 1LK3H 4RMUA 2A77L 3GMOB 3IDYC 1XF5A 3T4YA 3MRPB 1CFNA 1WFUA 3BEVB 2F19H 4IOSD 4MCZA 1FGNL 5KVDL 3ZE0F 2UY7A 1FAKT 5DDHB 1JRHI 5JUEH 1W0VB 3OR6B 4NFCA 5I19L 3PGDB 1BIIA 1U8LB 2BNRB 2CGRH 3V6BR 4ODUA 2A38A 5DR5L 2OL3H 1UB6A 1A6ZB 1QO3B 5KSAA 5GHWL 4M4RA 1HKLL 4MZ2A 2DYPD 4YBHA 2I26N 1M7DB 3QZWB 2BJML 4YDIL 4UAOC 3EIFA 4LNRB 5E8OA 2HRPL 1FNEB 1CVRA 3BDBA 4AG4L 2VERN 1TVDA 3DYPA 5IMKB 2W9DL 2O5ZL 3KXFB 3VRLE 3GSUB 1NANI 3DX8A 1KIPB 1P7KB 5JDSA 5H94B 5ESVA 1FNHA 3ULVC 5F89B 3IJHB 4H1LG 4R3SB 3JV5A 1TVHB 4IJ3B 1JN6A 4TVPE 4PJAE 4KK9D 1P4LA 1DUZA 3TBYA 3OGCA 4IOFC 5GGTL 4MQ7A 1UM4L 3VFSB 3BMWA 3MNZB 3B2VL 5L6YH 2GJ6A 1XFPA 5A43C 4LSUL 5IFAH 2EDXA 4PFEA 4OGAD 3CFDB 5JPNA 1MHEA 2GAZA 1WEJL 4N1EA 2XZCL 1CXKA 1QHPA 4QXUL 5E4EC 3PWUB 2UZXB 4MNQD 2PR4L 2O61A 5CSZB 3QNXA 4UT7L 4GKSB 1SYVA 5SWSE 3PWLB 1QBLH 4H20H 5KTEL 4U0RB 4KGLA 4RISH 4GBXC 3CUPA 3VFOA 3VI4E 3FB8A 1ADQL 1G7JB 3DURB 3N1FC 3MV9D 3PL6C 1YNLL 2XN9A 3O8XB 2P8MA 4TTGA 1MY7A 3CZFB 3DVNA 3KJ6L 1EERB 3RP1A 1HZHH 4TSAL 3DIFB 4LLWB 4PPTA 1VPOL 1GJIA 1MFEH 4BQCA 3C5ZB 5HHVL 4UAOB 5B39B 5D1ZB 4PLKC 1QHOA 2W9LA 1T80A 3ZKQD 1JGEA 4I0PA 1LEIB 1HHIA 4PRBA 3DSFH 1RK0B 1OWWA 3UTOA 2EE3A 2CIIA 3JWDL 1FVCB 1FVCA 2FJHB 3MMEB 1QSFB 3RX8A 3KJ4B 1T03H 1DR9A 3CSYA 1UCTA 4LCUB 3LB6D 4KROD 4IJ3C 1NCWL 2E7LC 5DA0B 2ICWI 2P43B 2VL5B 3ZKMC 4I4WA 3QHFL 3NCJL 3NOIA 4HV8A 1CG9B 5I1IH 2V5TA 2YRPA 5JOEA 2ATKA 4L8CB 1FIGL 1KNOA 2K3TA 2VDPH 3ARGA 5F88B 2AEPL 5E6ZA 3MR9B 4HF5L 1FN4A 2JJUA 4XTRC 4ODWB 3UO1H 1DVFC 3CZJA 3W82A 1NMCB 2AKRA 3BT2H 2W0KA 1CICD 4IRZL 2GK2A 1A6TB 3GRWA 1IQDA 2AJVH 2HTKD 2Q8BH 5I8CA 3QEUA 1MCDA 2XY2A 1RU9H 4X4XA 1J8HE 4D0CA 1U3HD 3L3OA 3IDXH 3Q0HA 2DWEB 4D0DA 2Q86B 3L3IB 4RAVB 1DEEB 3RI5F 1CG9A 1FL6A 4TPRL 1RIVH 3ECBA 3MLSH 4RA0C 4JO2H 1VGEL 4HZAA 2I5YH 4XCFH 4CNIA 3ROLA 2B39A 1NCCL 2GJJA 2QQKH 1W0WB 3F5WB 3P0VH 3HMXH 3VFTA 4FQHB 4GKZA 1HXYB 3O8XC 3BIBX 3QXVA 4OI9A 4F3FA 5J8OA 4RIRA 3GI8H 1U8QA 4NYLA 1XGTB 3BD3A 1FCCA 3RA7L 1CN4A 5GXBB 2MHAB 4JFEE 2F58L 5C0ND 2BNUB 1OAUH 1YMME 2FX8L 4IMKC 2GK0A 4U1IB 2VXVH 2AEWA 5C07B 3V0WH 1I7RA 4GJTB 3V5KB 2ESVA 3CMOL 1AXIB 3IDNB 5F97E 3FO1A 5LQBH 2E7BA 2DLTA 3W0WE 1YY8A 4K3DH 2XRAL 2EIZA 1OB1A 3Q3GB 4P5TC 4DVRH 4S1QH 2OP4H 3H7LA 5LGKA 4UQ2A 4XCFL 1JTOA 4L3ED 5J6GB 1XGQA 5T3XD 3U83A 5D1XB 2IPTH 4PRHA 1SYSB 4XNXH 3WE6A 3IXTB 3B2UD 1XF3A 2Z8VC 4M00A 1N6QL 4R8WH 3K2MC 4BH8B 2C1PA 3RA7H 3EOTH 2JB6A 3R0NA 2OL3B 4JFFE 5BRZA 4F3FB 3DUUB 4B7IA 4Y88A 3V5HB 4URTB 3VXPB 4Y2DA 1L9NA 1OTTC 2FH6A 2ICWB 5HY9A 4PRPB 5GRZA 2R0ZL 1EEUA 4P4RB 2VKXA 2DJ4A 4MAUL 1KCVL 4CUCA 3HC3L 1JGUH 5CZVH 5D1ZD 4CNIB 5DI8A 3RWCA 3RNKB 3NAAL 1MHPL 3CXHJ 1UWXH 1ERNA 4JG1H 4R0LA 3BQUA 3FQNB 3I02B 1RHHB 1MCJA 5I0ZA 2I07A 3H9SD 1XR8B 5EIVA 1IGYB 1A9BB 3NABH 1IT9L 1LK2B 2ADFL 2YBRB 4LOUC 3VFGH 1A8JH 3S6CA 5D7LA 1OT1A 1BWMA 1R3HA 4X6BB 1BBJA 5DFVC 1CYGA 2PO6B 3TO2B 3OKKB 4QHMA 5CKGA 1JGDA 3VXOA 3EDEA 4MA3B 3VWJC 5EU4B 1FO0B 2AJ3B 5HPOA 1ZHLA 4NCC2 1WQVT 3VCLA 3QXDA 4D94A 3MLYH 1RURL 5HGHB 4I77H 2C3XA 1FL3A 2P5EB 4PB0L 3SO3B 4WV1B 4ZAKC 4QWWC 1FSKB 1Z9OA 2FATL 4Z7WF 1J0KA 2JJTC 3RVTD 4U1JA 3U6RB 2WSKA 1KJ2H 1T7XA 3MACH 3HMWL 5EO1B 2LFGA 4AEIL 3BP6B 3O4OC 1MRFL 4XMKL 2VB5A 4K7PX 3W11D 3QEQE 3D25A 4WENB 1DQDH 4WFHD 5DJ2A 4JY6B 5DMYA 2FYYB 5GZOD 1OM3L 2NY4D 1F6AB 1DCLA 4AM0B 4M6OL 3MLZH 4I0KA 2R2BB 1OSZB 5GGUA 3ORJA 3ZTNH 1QKZH 1VGKB 2D4FA 1K8IB 1WC7A 2V2WA 3HNVL 1NCUA 3VXUD 3ZDZF 2JIXB 1UXWB 2ZJSL 3UZEA 5IESL 2M2DA 2EDYA 3BI9X 1QBBA 4MNHA 5HTSA 3G6AB 1HINL 3KDMA 4M5ZL 1H3PH 1F6AA 1G6RB 1MOEA 2JJWA 4F9PC 3MJ7A 2NY7L 4MQTB 2HTLD 5MENA 3VWKC 1GAFL 1HH9A 3QWRA 2BY2A 3ZE1E 1A1OB 1GVIA 1P4LB 3WS6C 5GS1B 3VWJB 5KW9L 1JGVH 2XFXA 1NLDL 4HIJA 5ESVB 4L9LC 4JQXA 3FQXA 2YUZA 5E8NB 5I1HL 1S7SB 3FQWA 3JV0A 3CH8A 2EE9A 3BQUD 3IETB 1T3FB 5GJSH 5HDQL 1H8OA 4F2MB 4GMSH 2OM5A 3O6LH 2CUIA 3MJ7B 4C55A 2I9TA 4OV5B 4QXGH 4XT1C 1FL3B 3NA4A 1NKRA 4TULL 3L3KB 3HPLA 1I1AC 5E2VH 1ROWA 2MQ3A 4ZUTA 2D7NA 2C3VA 3QXDB 1DBJL 4KUCD 4RGNC 2YEZB 3WIHH 3BWUC 1EAPB 4LKCA 3MREB 1LNUB 4NQCE 2I9LA 4FQXA 1VGKA 4WHTB 3WSQH 3SDAD 4ZSOB 3LN5B 5EU6D 3QUYB 4JB9L 5HHMD 3BRDA 1I85C 3WJLC 4J8RB 5FM8A 3T0EE 4JFHE 4EZMA 2ERJC 4XP9H 3UTZB 3DV4B 3NZ8B 4DOHE 3O11B 1WZKA 4FHBD 3AY4C 1YEIL 2R23A 5C0CB 4XPBH 4ZFFA 4NRYA 2ATPA 5ID1B 1IC4L 4N9GB 1RHHA 2HVJB 2G5BB 4P4KA 2EKSB 2WIIA 3D0VA 5DC0A 2W60A 1T21A 1CD9B 3MSPA 1DQTA 5JHLH 5EULV 4QKXB 1RUKL 3K4ZA 1LE5B 1UADC 3BE1H 1QSEE 1I9RH 3NGBC 2W59A 4M43L 4QRUA 4X4YB 1KOAA 4JPKH 4E42B 3MRRB 5T1KA 2XZAH 3MLUL 2MQCA 1ORSB 3BZFB 5C8JB 5I15H 1XGRA 3G6AA 5B3JF 4N0CD 5DURB 5E08L 5D2LB 4PV9B 1F11B 1B4JL 4OLYL 5E7BA 1AQKH 3TPKA 1TIUA 4FQCH 1WBZA 5C0FB 4MNQA 3DMMB 5F1IA 3WIFB 2Y5TA 2WINB 3UYOD 5JO5A 4OUUB 4PJIE 1FFOA 1AO7B 1QA9A 3MODL 4OLZL 4XWOD 3QQ9C 5MEND 1EO7A 2I60L 5BW7A 2CKBH 5DLML 1W72L 2BRRH 3T0BA 2HG5A 2YKLL 4N0UB 4NHCH 4S1RH 2VLLA 3IDGB 5I66A 5D7LD 4D8PB 4EN3D 3QQ4B 1X3DA 1OLLA 4I1NB 4YC2B 3BEWB 5AAWA 1KLGB 3NIGE 4YHMH 2CMRH 4ZNEA 1T89A 3IAGC 2FZ3A 3GMLA 4XCNB 1VFUA 4MA1B 1DBMH 3EJZD 4MS8C 4ODXA 5I15L 2QQQA 3AREC 5ITBL 4ZTPH 3SPVA 4DFHA 1OAZL 3VXNB 1CE1H 2NZIA 3G5YB 4YHKL 9CGTA 1UXWA 3SE3A 3DRTB 3IFNH 3DOSA 5IB1B 4MDIA 2H8PB 4LLVB 4FXGA 1N3NA 2V7HA 4J4PD 3QI9A 5FF6B 5GGUB 1P53A 2L4OA 5D7IF 2HWZL 1P7QB 2PO6A 4PRIE 3RWFA 2E27H 4F7TB 2J6EA 4UQ2B 2BVOB 2R69L 3FO2A 2V9TA 3HLAB 2I24N 2CKBL 2D31B 4PRHE 2E9BA 2ZUQC 1E4XI 5DLMH 1QD0A 1MPAL 1MJUH 1U8JB 3P9LA 3BO8A 5GGQH 5IOPA 3FMGH 3VE0B 4UT9L 1KXTB 3TVMA 4DW2L 2ZWLT 4Z95H 3A67H 3KG5A 2E8YA 3QI9D 5C07A 4EXKA 3QUZB 1MCWW 3ETBF 1UYWL 2WBKA 2QL1A 3FT3B 3GSRA 3WS3B 2JB5H 4N5UA 4ZS6C 3BFOA 3QBTB 1ZHKA 4NRXB 2Y9RT 3MUHL 4NQXA 3FJTA 4Q58C 5BS0B 3FB7B 1IAKB 4A2LA 1RUPH 4QYOB 2P1YA 3HNTL 3MLVH 2Y4SA 4AT6B 5CEZD 4LLUB 5E8DL 3SKOB 1MIMH 1UKTA 5EO9A 2R39A 4XHQA 3V0VA 1JK8B 2VNCA 2HWZH 5IMOB 2RJMA 1N5YH 4JKPL 2J4WH 3INUL 2EDRA 2F5BH 4MD5A 2AEQH 2FX9H 1B9ZA 1IGCH 4LCCA 4MA1C 4UDUB 1IC5H 2EO1A 1J0YA 1LDPH 1M4KA 1YMMD 3BVNB 1ETZB 4Y1AB 3LHPL 5GISH 5KVMC 5EBMB 3RFZC 4GW4B 2VABB 1WFNA 4UT6L 1R5WA 2BVEA 5DK0A 2IGFL 1LK2A 2YBRA 3IKCA 3B9KC 4JRYB 3NH7L 5I9QB 4HS6B 3HC4H 5TPWL 5E5UB 4E41B 5EFIA 2KPNA 3FRPA 3BDYH 2ESVB 4P2OC 4YHPA 4OZIE 5F44A 5D2NE 2HT3D 3JWNC 1NSNH 2Q7YA 2ZUYA 4NBYB 2DQFB 4PRHD 3OJDA 4WHYG 3SCMA 2Y07H 1IAIL 4KQ3L 5DRWB 3U1SL 3EYVB 5CGTA 4RFOH 4ZDHB 4LEXH 3U7AA 5BV7L 2QSVA 4I18C 3CFDA 3MOBH 3WFDL 1K85A 1FFNA 1T7YA 5HYJE 2VDRL 4WI9A 4DCQA 1Y18B 3ARGD 1DDHB 3TT1H 2IQ9L 5LBSL 3KPSB 3TCXA 1KB9K 2ZSWB 1I7UB 2C7UB 3A6BL 4S1DD 2BCKB 4JRWA 4EXPX 3OGCB 3MNWB 4JY4A 3LHPH 3FL7A 4PJAB 1Y6KR 3NCBB 4RZCB 5J3HD 3OJDB 5IB4B 5FHBH 2PN5A 3IJHA 2XQBH 15C8H 3SQOL 4JR9L 1J1OL 4UOW1 3VW3H 4KI1A 4N90E 2HG5B 4N0UA 3ZYOA 2A6JA 3DX6B 5FK9A 3ZKMD 3L5HA 3GMQB 4OM1H 1A7RH 1HSAA 3HE7C 3IKCB 3MLWL 1G7PA 1HWGB 1IAKA 4GKNB 2DD8L 5MENE 2Y07L 4Y4HC 2Z8WC 1DVFD 4R7DB 1LD9B 2C9AA 1QG3A 1QOKA 3RWHB 3S37H 2ZP0T 3PWUA 2NY0B 4QRPE 1IFHL 3SBWC 5KANG 4JZJA 3TJEH 4MD5B 3QFJA 1F42A 4GAYB 4TOYL 3EYQD 4EI5B 1DSFH 1NC4A 3ARFB 1BM3L 3L9RA 2VXUL 4KJWC 1ZLUH 3E6HA 5IOPB 1CXIA 1EEYB 2APTA 4K94H 3K8MA 4NJAL 4JKMA 4RMRA 5KJRH 4ETYA 1D6VH 4YHZL 2XQBL 2IBGA 4OLUH 4H8WL 5ENWB 1BFVL 5CP3H 1DBBL 2WBJB 2QQLL 5E2WL 3FFCD 3N1MC 2EH8L 3G6DH 1C7SA 4KC3B 4LMQI 5TE6L 4CW1A 5KVGH 2L7JA 3GSUA 1U41A 4YO0B 5E1HB 4UOW0 1R3JB 5EA0L 5CILH 1OSPL 5I8CB 4C59B 1FORL 2J8UB 3DVIA 1CGSH 1YC8A 3CLFL 3QQ3A 3TYGL 5KOVC 2FH8A 1AO7A 4ELMB 4JRXE 4XAWL 2XI9A 3QWOA 1LO5A 4NM4H 4PGCA 3ARGB 5F88A 1A1MA 5ETUA 4KU1A 2OR8A 4I4WB 4G8GD 4NRZB 5I71C 2J7LA 5INCB 3SDCD 4JLRA 2VH5L 5I2IB 1A0QH 4EDWH 2DJUA 2VLLB 4TTDD 4EEEA 4JG0H 1F90H 2N56A 4HS3B 3F7YA 3TBWA 2H3NA 1AGDA 2HFGH 4IEFB 4PTUB 4PLKD 4PJGA 3PGFL 4OCSL 1LEIA 1V05A 2H45A 2QKIA 4R90L 4AIZB 1MRDL 1ZLWK 3RIFF 2P42B 1JHTB 4NC1E 5C0CD 4YHYC 3QJFA 4LSTL 5EU5A 2FHFA 1RUAL 5DUPL 5HHPB 3OR7A 1J8HD 2HJKB 3IFOB 2X42A 1I9IL 2X7LB 3CDCA 1VFBB 4QNPF 4OZHA 2R2HB 3UJIH 5HVWA 2R0KH 1ZS8A 2XQYG 4NN7B 2ORBH 1HH9B 1OF2A 1TTUA 2H9GA 5HYIA 3P0YH 4HPYL 5IF0A 3B5TA 4XZUB 4ALAH 2APXA 4GS7C 5C0IB 2BVUA 4OUUA 1RUML 4NNYB 3TA3B 3B4NA 3VFMB 3O3BB 4LOUD 1N3NB 3TV3L 1O7VA 3EO0B 3K2UL 3X14A 1UGNA 1WTGT 5IK3A 3QFJE 5DFVD 2VUOA 1OAKH 1JI2A 5IB3B 4M9PA 5I74C 3HPLB 4W6XB 4YHNB 2A83A 5DJXA 1D5BA 2YRLA 1E4XH 5FA4B 4G6AC 4KY1H 2BOBB 2E7CA 1UFUA 4DWHA 4KAQL 5HYJD 4WW2A 1I9IH 4DVBA 3PJSB 2F8XC 3FB6B 2IANA 2CQVA 1II4E 4HBQA 4KK5C 2Z92B 1QFHA 1J5OL 5FYJE 5C3TA 4NQDB 3BKYL 1I4FA 3DO3A 3RGVA 1AH1A 3RZCA 3BH9B 4LBEB 4M7JH 5C0NC 4HS3A 4IRJA 3TBWB 1FFPA 1JBJA 3T08A 1OAXL 2XRAH 1K3IA 4JHZA 5BOPA 1I7ZA 1OP9A 5D7IA 5JORA 2QHLA 3EDJA 4Q74A 1WIOA 1Z0NA 2VQ1A 1QFUL 4YDKL 5EN2A 3FB5B 4BZYA 5J12C 1OD7A 4X6DB 3TF7C 2OR9H 2W9DH 2GJZB 4MMXC 3A0OA 2VXTH 2V7NA 5IVXF 3BWAA 3RL1B 5HI5D 4RMVA 1P5VA 3T3ME 1S9YB 1ZVHA 2DN7A 1CK0L 2JK5A 3IXAB 4V1DD 5C08D 4XXCA 5FA4A 5GS1C 3FFCA 1HHGA 4N1HB 1I1CA 1KIRB 5CGYD 1YYLL 5CLTA 3NIDE 4MZ3A 5FYLD 3QG7H 3GSNH 5SWZA 3JV6B 4OLVL 1MEXL 4UV7H 2N1KA 3VWKD 5LGJA 3NBNA 1KBGL 2DMBA 3NAAH 4ODSH 4D3CL 3O3BA 5TFSL 1WAAE 5L2KA 3O81A 5EWIH 4V1DE 2EICA 1PSKL 3MGOB 1M1SA 1RVFL 4OFPA 1S7UA 4PJBB 4AIOA 3LEXA 5DJAB 3ARDC 5JXAL 3BAEL 2FX7L 1QLFB 4G7VL 2OI9C 3QQNA 4ODHL 2H2SC 4U3HA 1NGZB 1ZA3A 4LSSL 1H8NA 1X5JA 4OQ1A 4HUUA 3PP4L 1JGLL 2CDGA 1PZUB 1PYWB 1WIUA 4LRIC 3VFNA 2DM3A 5J1SC 1HHKB 3KJ6H 4BZ1H 1JVKA 3SDDC 4XPGH 4U6TA 1W72A 2VZVA 1MIEH 2OJZL 2NXYD 5IWLA 1I8MA 3ZT7A 3BJLA 4UV4L 1X44A 5IBLC 4UIKH 4HK0A 2X4RB 2BDNL 2Z31B 3U9UA 5C86A 1IGYA 2PYEB 5JW3L 3WIHA 4NIKB 5I1JH 3PWJA 2VE6B 2Z8SA 2P24A 4ZPTA 5EBWB 1KEGL 5CZKA 4PLJC 1FVEA 4K3JH 5EWIL 1D9KA 1I7RB 3KPTA 2JE8A 2YPVL 3L3HA 5HDLA 4PJ9A 1ZWIA 5I30H 1KYOJ 3NGBB 4DAGL 2J6EH 1I3VA 1G0YR 5CWSA 5DUBB 5ERWB 4P2RE 3RU8L 1JWUA 4ODBD 4YWGH 4PR5A 3VJ6A 1BFSA 3VCLB 2XTJB 4S2SB 3QULA 1GZQA 2Y6SD 1BD2E 4NCDA 4UNUA 3DMMC 1UACL 5BJTB 3GB7B 3WJJC 5D1XA 1BZQK 4X99A 3LS5H 4NWUH 5JHDD 4X7SH 1WWAX 4XNQB 1N2RA 5FCSH 5DI8B 1Q1JH 5BO1H 3QEUB 5I1JL 3B83A 2CIKA 5CD3B 3C60C 2AJYL 2GCYB 4U2ZA 4HH9A 5D2NB 3GHEH 3RWDB 1J0HA 3I6KB 4W4NA 4RX4D 1MCNA 3MV7E 4CDGC 3HMXL 5I1CH 4Z78A 4FZEL 4N8CL 4QLRA 1Q72L 1E6JL 4PP2A 3PWPD 5DQJA 3ZHKA 5BOZG 4MNGE 1A6AB 3D2UB 4OBRA 4RMWA 4N0RA 1KG0A 1C5DB 4M6NH 5ESAB 3AB0C 3VWKA 5HPMB 2NY5L 4HFWB 4EN3C 1YEKL 1H3XA 4Z8FH 3D0LA 4LLQB 2MCPH 1BP3B 3O6LL 4PV8A 4MAYC 4E5XA 4LKXA 2HLFC 2JCCE 4QRRB 4OAWA 4HAGA 3HE6C 1HHIB 4P5TB 2BJMH 4PRBB 4F57H 3U2SB 5HDBE 2EDLA 4L3CB 1A6AA 4KJPD 1XIWD 3L95A 4AEHH 4U1SB 5JDJA 1MQKH 3STBA 3HNSL 5I74B 1MFCL 5A3ID 5J56B 2WMPA 1QSFD 4MHHI 1CFQA 2O5XH 3ESUF 5DYOB 3BH8A 2XTJC 2HLAB 5I1CL 4HKZA 2VQTA 4G8IA 4R2GC 4KMLB 4KGJA 2DB8A 4E0RA 4ODTL 4PYHA 5DJZA 3HHRB 1HQ4A 4QRQA 5ALCH 3AXLB 4PJCB 3R4DA 2OK0L 4IRJD 1KB9J 4KKBC 4KZDH 5C0BA 1ETZA 1OQXA 2XQYK 4XAKD 2NY5H 3JVGA 5HHNB 1HQRB 1S7QB 1EXUB 4YHOL 2G5RA 3HZYB 4HG4J 1GGIH 5TQ2H 4APQB 1AP2A 3HC3H 1FJ1B 4MAYA 4IIQB 5CZVL 2H32A 4Q9QH 2DWEA 4PJ9D 5DQDH 2WM0A 1MREH 3V0VB 1YN7B 3D5OF 1DANT 3MV7D 1GOGA 2EO9A 3FN0H 3IJYA 5FYJU 1NUNB 4XMPL 4M43H 3D9AH 4ZODA 4PP1C 4HJGB 4XH2A 1A2YA 3AY4A 3MA7A 3DTXA 4OCNC 1MQKL 4OFYA 5EZOL 4JHWL 4NP4H 4Q9RH 2VLRA 2NYYC 2FB4L 4PJ9B 1RV6X 4NKOA 1JWMB 3HCVA 4IM8A 1JWMA 3U4EB 4OZIF 4PJHB 1QR1B 3TO4C 2IFGA 4M7LL 1JNHB 1FGVH 5E56A 4CVZB 1D7FA 4BKLA 5JPMA 3PWJB 3VG9B 1CZ8H 3GJFB 1UM4H 5L6YL 4LKXB 4X6CE 2L7UA 3CFJB 1UENA 5H37G 2ENSA 2KQMA 4I0PD 1MUJA 1H3TA 1A4KA 1INDH 1P6AB 3FFDB 4R0LC 1GGIL 3L5WA 3QDGB 4Q6IC 4MJID 3ES6B 3RI5K 1GPOL 4M93C 3QI9B 1HSBB 1D5MA 3JV6A 1RZ8B 1AXSA 1T03L 3TIDB 3K4DA 1JHLL 3EDDA 1ORSA 4XGZA 1JF6A 3QH3B 2X10A 3WS6A 1JWUB 1TNMA 3DI2B 1CFNB 4ZTPL 5C71A 1PKQA 4LVOC 3VRIB 1TJGH 2VZ3A 1JYNA 3IGAA 4ZUVA 3IFNL 5LGJB 2NX5E 1T6WA 1CDYA 3PABB 4YAQB 3MLZL 1JNNL 4HLJA 4JO1L 5E03A 2ARJQ 3T1FA 2HVJA 2O93L 4HUWB 2AXFA 3M1BA 5JORB 2PYEA 4NO5B 1TZGL 3VGAC 5ADOL 1ACZA 5IWLC 3KLHC 1MF2H 1TQCC 4HHAB 5E8OB 5IQ7L 2LTQC 1H3UA 3PHOA 5IFJA 4NZTL 4G9DA 1MJUL 5EBMA 1RIUH 1NANH 1WGOA 5D7IE 3REWA 1UB6B 4NQDA 3QJHB 4JFQA 4JANB 4NKIL 4NJ9L 3GGWA 1UT9A 4TUJA 2FNBA 3KPRE 1IQWH 5EBGA 1JUFB 1SEQH 4M8QB 5LG1A 3SKMB 5JTWA 1I8KB 3LDBC 3CH1A 2UZYB 3BP5B 5F1NB 4LASH 4OV5A 1NGQH 3QIUC 4CRPA 4J4PA 3C09B 1FIEA 4QOKD 1JGEB 4PLOB 4FABH 5L2KD 3LKQB 2QADB 5CIPA 2B5IB 3KPSE 4G42B 4YDJB 3RDTD 1YA5A 2GTWB 4L4TB 5GGSY 3V4VL 1UWEH 2YPLE 3MNVA 4NC1C 4Z18A 3NFSL 3MV8B 5T1LA 5GS1A 2AK4D 3AM8C 4PRPE 1GL4B 3P9LB 3QUYC 3H9HA 2A6KB 4JHAH 3GI8L 5KVFH 1BAFH 1W8NA 3O41A 3TO4A 4M6MH 4WO4B 2VLME 1WVZA 3TJHD 1LP9A 4W6WB 3QUYA 2X4OA 4X4ZA 4LRNH 3LKNB 2PXYD 4AMKL 4LAQH 5FO7B 5GQBA 1GIGH 3MNVB 3NIFF 4GRMB 4XBPA 3V0WL 4XPBL 1FLRH 3L5JA 5DD1L 1IC4H 4GAGL 5DO2D 3S34L 3MBEB 1M7XA 4JFDE 4Y19D 1EGJH 2MKWA 3LQZA 3WUZA 4WI3A 1A7NL 1U58B 3MJ9L 1U3ZA 1YMHB 5CEXA 4HUVB 5C9KA 4Y2DC 1YMMA 3QA3A 1VFAA 1WZ1L 1AE6H 1QEWA 4ISVA 3GJFK 3SJVE 2X7LA 4GUPB 5F9OL 5I1DB 3AVEA 3RJQB 2GJZA 5EIIA 4WY7H 1F8TL 3LDBB 4MA8H 1OGTB 3VMPA 5EBLA 1A1OA 2FD6H 4NKMA 1A1MB 5ETUB 5IHUH 4HK0B 4XP6H 1QRND 3WFEH 3IAPA 3ULUE 3D48R 4PJXE 5KS9E 3MYJB 2HFEA 4CMMA 1A7RL 5IJVB 5DT1H 4TUOA 2AAVA 3ILQD 5LAXA 4F2MA 1QLEH 3IF1A 3TWCL 1CGYA 4QXWA 4OT1L 1HHJA 5IBUB 4XXDB 5DJDB 2J8UE 4UDTA 1DFBL 2CDFA 4UBDC 5E95B 3W0WA 1SY6H 4NGHL 3MRIB 4MNGA 2ZSVB 3HMXA 2GQHA 4FTVE 1U3HB 4WO4C 3LEXB 5DJAA 5FECA 4U6HA 2R8SH 1EO8H 4JFZH 4U6HB 2VXUH 1S9WA 3MROB 4LVHB 5TDPB 1F8TH 1A3LL 2KDGA 1YECH 2EDJA 4ZD3H 3H9SE 3CVHB 3RDTA 4DN3L 1GHFH 1MFEL 1KC5H 3H3KA 2R23B 2R1YB 3U0PB 5C0CA 1V5JA 4Y16D 3C60A 1CVSC 1I7ZB 2CD0A 4IRSC 3FFCB 5IVXE 3MBED 3QUXD 4P23A 3V7MA 4KK5D 1NUDA 1YN6A 2VDML 2NY1C 4MD0B 4YNYB 4CADA 1GYAA 4QRPA 4F7PA 2MKLC 4XCYB 2CLVA 3OB0H 4FXLA 5E70A 5B8CB 5KSAC 1MQ8A 5D1XC 3RWJA 3OKLB 4JFYA 3OKNB 1ITBB 2W07A 5F6HI 2DM4A 4PJEF 5F7HA 3VD7A 2CK0H 3WUWB 3ILPB 4ISVB 1A7QH 4Z95L 3U6RA 1F4HA 1FZKA 2AS5M 1S9KC 3UC0H 1WCBA 1LEGA 3STZB 1BQLH 3QHTC 2N7AA 3H9YA 5J6HA 4HKBB 1TENA 4Z0BH 2GY5A 5FYLE 4NQCD 3T65A 2H26B 3CPLA 5D7KD 5HDQH 4MB3A 1HHHB 5DC4B 3HR5A 3K7UA 2AJ3A 3MRQB 1IGMH 1ZLVK 5C0RH 2ZUUA 3CFCH 1MCLA 4LSTH 1RIVL 2H1PH 1DBJH 3C5JA 4JJ5B 1G9ML 4ZTOH 12E8L 1R5VB 4LPUA 2F19L 5DJXB 1MFNA 1FGNH 5IQ9A 2HH0L 4U1KA 2QLVB 5CMAA 2ORBL 5TJWK 5DK0B 2UUDH 3MRFA 4JB9H 3EFDH 3LVEA 2HKHH 4OCXL 4NNPH 3FHAA 1JTTA 4JQVC 5C0JA 3HUJB 4DQOH 4EDXA 2IH3B 4K07A 1Z5LA 3QDMD 5IVXA 3JBG7 3HPJB 3MCLL 4IRSB 5GJTH 1BOGA 1HOCA 2BMKB 1VKXA 1JHTA 2D9CA 4NWTH 1HNGA 3L3IA 4P2OB 1NFIB 5CEZH 1FO0L 5GRUH 2W1NA 4BQ9A 5JQ6H 4WV1C 1T4KB 2VKWA 1OB1B 1YNTA 4TULH 7FABH 5TDOB 1VHPA 2X41A 4W68A 3ZKNC 1I8KA 4DGVL 1CICA 2YA2A 3P4NB 4OIBA 2WBWB 1T1XA 3LRSB 4PJGE 3TIDA 1U2HA 3HI1A 1RZGA 2NXYC 1JPTL 2A2QT 3I3EA 4EVNA 1INEH 3VWKB 3MOAL 5IBLD 3AREA 2IALA 4ZO7A 1D5MB 3HZVB 4XCEB 5C0GA 1DJSA 1MAKA 1U92B 1WK0A 5C9JA 3SE9L 2WP3T 3U4BH 1MWAA 4BSJA 1HK6A 5J6GA 2C3GA 3MXWH 4U1HB 3BSZH 3QEQD 3EYFB 4ELMA 4KV5F 4H1LH 1F2QA 4NNPL 4LSUH 3WYRA 4M7JL 3FOLA 3GMMA 4MSWB 4WFHE 3MC0A 4YDVA 4AEEA 1U42A 5HHMB 2XY1A 4JM4H 1C1EH 3H8NA 5K59E 3R8QA 4NWTL 5EG6C 1QYGH 3H0TB 2EECA 3DPBA 3ZL4L 4XVUD 1L7IH 3IGAB 3QXTA 5M7QA 1ZXQA 4UT7H 3DVGB 3HZMA 3U79A 4CU7A 4LCWD 2NY0C 4PJ8D 4QRQB 1JE6A 2P8PB 2WK2A 3OJMB 3DTXB 3B3IB 3GMNA 3K1DA 5D7JB 4TOYH 4Z76A 2WQ8A 5HI4C 4YHML 5TE7L 4IDJL 3S98A 3C60D 2MNUA 4APQA 2R1WB 3ULUF 1KLUA 3B8YA 4QRSB 1RD6A 2R1XB 3S3SA 1E27A 6FABH 4YHZH 3I2CH 4UOJA 5EORL 4MDIB 2AABL 1MEXH 1ZANH 4UV7L 3BD5A 5TE4L 3MLPA 1MJJB 2P24B 1D9KC 1DBBH 3OKDA 4NO3B 4M8VA 4JM4L 4XMLH 3GI9L 4BUHA 1SBSL 1U36A 2D7QA 2GSGA 2XWBB 2W9EH 1OSPH 1FE8L 3QUMH 1QA9B 2VABA 4OKVA 3BESR 2H6PA 3RBSA 5C0GB 4MS8D 2D7TH 3CLEH 2KL6A 4OFIA 1U8OA 5F89A 4LSSH 1U3HC 3MACL 3BGFB 3GDBA 3LN4B 1AIFB 3U46A 1GGBH 4WI7A 4UU9A 5I17A 4I3SH 3VXRE 2H2SD 2F8VA 5EU3A 1W0YT 4JO3L 5CP7B 4PJDF 1MVFA 1U6AH 4OSUL 5F3HB 5B3NA 5J1TC 2AJZB 2XWJA 2JJSC 3K8KA 2BOCB 4JKKA 3DUSB 5GS2H 2F54D 4KRLB 1URLA 2JB5L 3T4AA 5FA3A 1MHCB 1CIDA 3ARDB 3DX7A 3MRLB 2WINA 1VCAA 2X9YA 4MLSA 1N59A 5HPMA 4IRSA 3NFPA 1VGEH 2F53B 1K5NB 2HKFL 2P46B 3PWPB 5GGRB 1P4IL 3RTQD 4J23A 3U7YH 3BGAA 4HWZA 1F58L 4JO4L 4Z78B 4JAMA 4JQXC 4TYUA 1G1YA 2XWTA 4WFGE 4G9FE 1TZHB 2X4QA 2OXHA 4ONGL 1A14H 1MVUA 4NFBA 4XNZB 3MRMA 3VFOB 1LDSA 4HH9B 1R5VA 4F7MA 4XB8A 4E42A 3MPCA 1RZJL 1T89C 4KPHL 4UB0L 1S9YA 4PJ9C 3WUWG 3ZHLA 3O9WC 5EUOE 4PJEB 2ZOLA 5D9SB 5K9KB 1IE5A 4UINH 3KHQA 1AR1D 4OD3L 5JZ7C 1T21B 3O4LB 2V7HB 3OZ9H 1JGVL 3W2DL 5E1AA 5B8CA 4OAWB 3UBXI 1RAMA 2X4RA 3GMMB 3FOLB 1RUPL 4MSWA 1JWSA 5KSBB 3ME0A 1A6WL 1YN6B 2IPKB 3RY6C 1NMBL 1FNAA 5DFWH 3TO4D 3PDOB 2J5LC 2LU3A 2ZUQB 5BS0A 4MJIE 2CUHA 4KJYB 4TVPL 4EUPH 1FZKB 4OCMC 3SO5A 3K4AA 3ZKXC 3CXHK 1NAKL 4ETQA 4DUWA 3WKML 1TTGA 5FYKH 3I50L 1TVHA 1A3RH 3QUZA 3TM6A 5DVNA 2XPGA 1AQDB 5SX5K 2Z4QB 3ARQA 5D2LA 1M7IB 4KHXL 4KPHH 3HB3C 1EHAA 1ZGLP 1OTUD 2FRGP 3SGDH 3SJVB 5I1LB 4PRAA 5FYLL 1H5BC 2AV7B 5HD8D 3K3QA 1W72B 2QBWA 4QXTB 4OKDA 5CJQH 1DLFL 4LL9A 1YEJH 4LHUD 3W2DH 3RKPA 2G2RB 3JTTA 4ZOAA 2WIIB 3UTTB 1XEDA 3BIKA 5AWNH 2APFA 1HH6A 1R0AH 3VXSA 3F7RA 3U9PH 4AQ1B 2WLZA 1H3VA 3OR6A 2ADFH 3U30C 2HMID 4HGWA 1IM3B 5KTEH 2VDRH 4B0MM 3BIAX 3PWLA 4CGTA 2FR4B 3C5SB 1S3KL 1ZS8B 3RX5A 1J8HA 1HZHL 3QDGD 5FF6A 4Z5RA 1PD6A 5TF1L 4LFHD 5F1SA 1FP5A 15C8L 3SQOH 2ARJA 1NAMB 1F4AA 2BVQB 2H26A 1KTLB 3MRCA 3B6SB 1N4XL 4J3XA 4IRJC 3EZ8A 4Y4HD 4ZAKB 2FEDD 4OM1L 4TVPD 5CJXC 4WW1A 2AV7A 1CE6B 1Z6JT 3SCMC 2QADC 4OLZH 5ESQA 5F7DB 1PGRB 4FRWA 1OGAA 1Q9KB 1PDKA 2DS4A 3RWEA 3JUZA 5C2BH 5K9QG 4UDTB 1IFHH 3P4MA 2Z93A 3QHFH 5FUOH 4WFEE 4XAWH 4LKCB 3WFHA 1A6VL 1N7ML 1XF2B 3MUGA 3X11B 5DJCB 4WO4A 1YEDA 2B4CL 2A73B 5HHOD 3H3PL 4Z7WB 3TCLA 2J1KA 5D70H 3G5VB 4OTXH 4M02A 5F7FA 2HFTA 5ITBH 3E2HC 2HJLB 5F96H 1UM6H 4Y16B 3MRKB 4NN6C 2F9BT 4NNXA 3BH9A 4LBEA 4NO5A 2OJZH 3DSFL 1T0PB 4PRIB 3QNZA 5T3XH 2DIAA 4PY8J 3CVHA 4FQ1L 5KANI 1FYTD 1DBKL 1ZT1B 4ZNCD 4YAQA 1BIHA 5IESH 2RIKA 5TE6H 4YHIB 2HFGL 5D7JD 2ZUVA 3S88L 4X0KA 3WLWD 4FQIH 1ONQA 4HXAL 3FCTB 1YEGL 4O51B 5FDYA 4CN4A 3CFEB 4ZXBA 3BEVA 3T3MF 1ZTXL 4F58H 4A6YB 2VZTA 3SDCC 2XN9E 2DI8A 2V7NB 5FUOL 2CKBA 2ENYA 4R9HA 5H2BA 1KJ3L 3GMPB 2R0KL 1NAMA 4JZNB 1EEZA 4R6UA 4LQFH 3T0DA 3ES6A 5D2LE 4PJDB 3TA3A 5BS0D 1P7HL 5IJVA 1C5BH 4YR6A 4XRCB 1A4KB 2C1OB 5E2VL 4UIMA 1KGCD 1TZGH 4OI7A 5CCKL 4XHJD 1LP9E 2A9NL 2ICEB 5ALBL 5DVLA 2HRPH 1TPXC 3T8XA 2AK1H 4C54A 5M94B 4LHJB 4HFUH 3WE6B 5J1AA 3V4PH 2Z93B 4LSDA 3S88H 5BZDA 1RUAH 5FEBA 3KYMA 4H88H 4OCWH 3P4LA 2VUYA 3F7PC 2AEQL 2KZWA 4JFOB 1LP9F 4K7PY 5LGHH 3MNWA 1FRGL 1UH4A 4KAQH 4HCRH 1BBDH 1A2YB 4U6YB 1WFTA 1TZIB 5DWUH 5T1DL 3V2AR 3IFLL 5JLZA 5D2LF 3DUHA 3P0YL 5I1LA 5B4MC 4OUOA 2BXYA 3BKYH 3MBEA 4P23D 1O0VA 4LQFL 4WWKC 1FJ1A 2B1HH 4MAYB 5C6TL 3IAQA 1EK3A 1JGDB 2K7QA 4I48A 2DQFA 5HYSA 4N0CC 3KPPB 1OD9A 3VH8G 4QOKB 3L5WB 2OP4L 1T6VN 1U2CA 4G8EA 1T66C 1T5WB 2AEIT 3RGHA 5E7FA 2LU4A 2WNGA 4MA7L 2EDNA 4XI5D 2YD6A 2DJSA 1L0XA 2X70B 3TNMA 4LLDB 1XCTB 2X1XR 1FZOB 4RISL 4IRSD 4R2GB 1KCSL 4X5LA 2R2EB 5FIEA 2X9XA 4ZFOB 3FT2A 5C7XH 4Y4HA 3X12B 5D7SH 5FUCC 5DZOA 1NFDB 1EVUA 2VL5A 4NZUL 4AEFA 4R4FH 1RMFH 2PXYB 4PJXB 4P5TA 4RNRA 1UM5L 2FJGA 5KZCD 3ZTJH 2FYYA 1TPXB 3NCYP 4YDVB 1CL7H 4G3YL 4ZYKA 1AD0B 1RURH 1JYXA 3UX9B 4QYOA 4NQCA 4ODSL 2YK1L 1M7IA 2A0LD 3VXQB 3OAZK 1AP2B 4YC2C 5IT2H 3ARVA 2ZUTA 1AXSB 2DDQH 3CFBB 3D6GA 2VLMD 4QEGA 4WRLA 4QCIB 1AE6L 3FN3A 4CMHB 2A6IB 4JY4B 4NQEA 4FQ2H 4NP4L 3UDWC 4NQTA 2YD5A 4XC1H 1FFQA 5E9DE 5HSFA 1CK0H 4MYWB 2R0LL 2XWJB 1I1FA 4ZOEA 4LHUB 5C0EB 4CVUA 2NPLX 3NIFE 3VFTB 4XP6L 5GSRB 4C4KO 3IDJA 3WN5C 1L0YA 4HUMB 4HMCA 4NC0B 2YUXA 1A4JA 3I02A 4NZUH 4CVZA 3VXOB 4P2OA 2DLFL 3O4LD 3ECBB 1JPGB 2BNQD 2EDOA 1JPGA 3RHWF 3FONB 4LLVA 1NL0H 3OV6A 4FP8H 3OTTA 2FATH 4JREC 3B9KA 2VITB 3CD4A 5IIEA 4YZFF 5IR1A 2BNRE 5I1EL 2XWBA 1KJ2B 3KPSA 5EU6B 5GGQL 1BD2B 2FX7H 1DP0A 1RZ7L 1YQVL 4XPAH 4XVTH 4LF3A 1RZ8A 2F54E 3OAUH 5GPRA 3EJYD 1BQHG 3DX9B 3ZKND 2E7LA 1ZA6A 5IKCA 4XPHL 3ZTJG 2B4CC 5AD0B 4F9PA 4DUXA 3FOMA 1CDCA 3CJJA 5HY9B 4UNVA 5D1QC 5AUMB 1EBAA 2Q8BL 2AJZA 5CIPH 2J8HA 3D3VB 2W38A 2Z91B 3QIBC 5LQBL 3VD3A 3TN0B 3QDME 1P1ZA 3QUXB 1KIQB 2VLJD 4YXLH 2X4SA 4PGDA 5TF0A 4CL7A 1PKQE 3WSQL 3CFKB 4P57B 5E8PB 1C8PA 4RZCA 5DHXB 3EHBC 5BZDB 2W91A 1H3WM 3CSPA 4HJ0C 1BZ7A 4MJIB 3GKWL 4ODVH 4NO0B 3UPCA 3VFUA 4P5MA 4EOWL 2Z91A 2FWOB 4M1DH 4JDVB 4P3WA 1SEQL 1N6UA 5KOMC 1KCUH 3E3QC 3S4SA 1BFOA 5FO8A 1M7DA 1CF8L 5DJ8B 5B8CC 4BSWB 5B38G 1D9KB 1KCVH 4WGVB 2QEJA 3VDBA 2O5YH 2CR3A 5CEZE 2SEBA 3HI1B 2FJFA 4ZUSA 3LRGA 4X9BA 3ULUL 1S78C 2IMNA 4OM0H 2GSIA 2DQIH 3OHXA 1OAKL 4Y8DC 5D5MF 4OQTH 3SKJH 5ICYA 5IIEB 1KT2A 4BFBD 3N9GL 2IPTL 4EUPA 4YFEA 5HGAB 1NAMH 5JW4R 4BZ2H 1Q72H 3BN9D 4Y1AD 1RZFL 3L3GA 4XC3H 5GGTA 3UAJC 2ITCB 4HT1H 1VERA 4NDMB 3AAZB 4BK5A 4PS4H 2V2TB 4PRIA 3ET9F 1GZQB 1CTOA 5GSRA 4OLXH 5IVOA 3SKOA 4D9QE 4UIMB 4YGAB 4AT6A 3TN0D 4LCWA 3EYQC 1EUTA 3RKDC 1ZE3C 4OZIA 2Q20A 2GFBA 3T0WA 3RJDA 1ND0B 4Q9QL 2VOTA 5FGBA 4M3KB 1ES0A 1ITCA 1KLGA 2XTJD 1AGEB 5I73C 3BD4A 1TDQA 3EDFA 2BZDA 2N7BA 3HNSH 5L8LB 4WFGD 5D5ME 3RVXC 2AVGA 2O26U 1P6FA 4XVSH 4H25A 4OQTL 2X1WL 4GRLD 3C5ZC 1E4WH 5DS8B 4HUVA 1B4JH 4LCCC 1IKNC 1XIWB 4I3RH 1G0DA 3O9WB 3HE6A 3HRZA 4F15C 1S9XB 4M4PA 5HGBA 3M17B 3P4OA 1PQZA 3MV7A 1DQDL 2UWEB 3UTTD 5KN5B 3WDIA 1FGVL 4I0PB 5LWYH 1S8DA 3BZ4B 3DXAB 2VDNL 4HT1L 2BVTA 3E6FB 3O6FC 3ILPA 3KJ4C 3QIWC 4A6YL 4PTTB 4RGNB 3CCHB 1SHMA 3C2AH 5AEAA 4K94C 1LEKB 1NC2D 3O9WD 4U0RC 3VFMA 2EYRB 2J5LB 1CGSL 3CLFH 1AKJB 4XCYA 5SWQB 5JZ7D 1IVLA 1YY9D 3GHBH 5MEOA 5JA8B 1SJHB 3ABZA 5SWSD 1NEZG 1S5HB 2COQA 2FEEI 3EYOA 2E6JA 4JFEA 1DVFB 1LO2L 4Y1AE 4LARH 3VFRA 3GMOA 5C0BE 2NY0D 4RRPG 1F5WA 4JY5H 1E4KC 2CLRA 1A0QL 1OCWH 1J05B 3FB6A 2EDKA 4M1CD 4DVBB 4RSVA 5JPNB 1A3LH 1DN0A 1T83A 4OLEA 2ITDA 1RI8A 1QLRA 3WN5B 3ARRA 2GJ6B 3ARFD 2VXQH 3HE6B 3E3QE 3GI9H 5L8KB 1MIML 4RRPA 4P2QB 4ZUUA 3UTSB 4OGYL 4PJ5D 3RIFK 1GPOH 4UILL 2R56L 4QHUA 4XWGH 5IEKB 5INCA 2R4RH 1IC5L 4LVNC 2D7TL 3CLEL 4GSDH 1CR9H 2X4OB 4OZGF 4NZTH 1GGYA 32C2A 1XGRB 1LO2H 3MLTA 4KK8D 2W0FA 4HIHB 4MJ6B 1DQQA 1ZGLB 1SJHA 4Y89A 4GS7B 4X9GA 1CXEA 3QQ3B 2XTLA 1B0RB 3O6FB 3QIWB 5T1LB 2R1YA 5FGCB 5BVJB 4PGJA 5CBEA 3TBSB 4I2XE 4JFXA 3ZLQC 3F65A 1NCDL 4WTXA 2DLIA 4YE4H 4QRTA 5KG9A 4PB9L 4OZFA 4JQVA 1S9VB 2AV1B 3RGVC 4PJ7A 2EIBA 3BE1L 4V2BA 4NO0D 4XGZB 4PJ8A 4HULB 1G9MH 5KSVA 2CDFB 4CAGA 12E8H 4JAMB 3QP3A 5GRJH 1XF3B 3WFBH 2LQRA 3MRHB 3P2TA 5DMKB 3HI5H 4FTVA 3VGDA 3D3VD 2QQNH 1VADA 5I8KL 4MLIA 1EBPA 1IGTB 2HJLA 5CZXC 2FR4A 2NW2A 3JTSA 5D1QA 3G5XA 1PQZB 5KSUB 3ULVD 4Z8FL 5D72H 3VRLF 5FK9B 2MCPL 4JZOA 5BV7H 4PJFE 1LO4H 4MCYA 3T1FB 2YA1A 5D7KE 3NIDF 1WEJH 1J0ZA 1QPXA 2HJKA 2RCSH 3CGTA 3CFKA 4P57A 2YD7A 3KPMB 1A7PH 4ZPVB 4JPIA 1KPRB 3SGKC 5CJ5A 1Z9LA 5CIPB 1N64H 2R4SL 1CT8B 1KT2B 5HYFA 5DMIL 1PBYA 4X98A 5HBBA 3IB4A 4WV1A 4QTHB 4PG9B 2VQUA 1I7TB 3U0TA 3ARFA 1QBMH 4QHKJ 4S0TD 3BSZL 5C0DA 25C8H 3SEPA 1J05A 1N5AA 3I84A 4G5ZL 3W9EB 4TSAH 4LMQE 1EA9C 3TP4A 3MQIA 4D3CH 4JM2D 1VPOH 1ZA6B 4NPYA 5E2WH 3IDYB 5SX5H 4LCYB 4QHMB 4KI5C 3NCCB 4U1LB 4GBXD 3SOBH 4M5YL 3WHXB 1MCBA 2UVEA 2CO7B 4HWBH 4HC1H 4NQDD 5HYSG 1WFOA 4PRPA 5FCUH 4ERSL 4GXVH 2OQJA 4HKXB 3QWOB 4KKAC 5FDWB 5D6DC 3SDXB 5EDXA 4Q9BA 3B3IA 2DOCA 5DYOA 2DM2A 4HUXB 3VXSB 1VACB 4MJIA 1YEFL 5F3BB 4F7CB 4HJJH 3LKSB 4KHTH 4NGHH 3ZT6A 3ARPA 4MX7B 4ELKB 5ID0A 4M7KL 3W9DA 2XNAB 4GRWE 5ELIA 4LCCB 4UDUA 4YLQT 4Z7WE 5I1IL 3LQAC 1U8HB 5JQHC 1FL5A 4LSVH 4XCCL 2H3NB 1V7NL 4E5XB 3IDJB 4RWHA 4Y5YB 5T1LD 3BT2L 4Y5VB 4MJ5A 1KULA 2EYSA 4H25B 1QSVA 2NZ9D 1FO0A 3AROA 3JWOH 3SOBL 4GAYA 5FV1L 3RVWC 3S5LG 2FSEB 2YD3A 3NACH 4ZS7L 5ACZA 4OLWH 1INQB 3C9NB 1B6DA 4EQ2A 2F5BL 1KGCE 1B2WL 1KF9B 2PKDA 1ORQB 1IGCL 3TC9A 1BOYA 3FMGL 1SMOA 2XN9B 3O8XA 4NYLB 3BGFC 2NMSA 5HDOA 5HVGB 4JFZL 5K93A 3RAJL 4JZJC 3QG6B 5FYKU 4GW1A 1SEBB 2N4IA 3VXMB 2AXHA 4EDWL 4OTXL 2X05A 4I3SL 1OPGH 3VG0H 4U33A 2UY6A 4WUUE 1KCRH 3LN4A 1IGJB 3U46B 3UYRH 4L8SA 1YECL 2FECI 4ZUVB 1IBGH 2WQRA 2XN9D 2OXGA 5ID0B 1BECA 2WBJA 3PNWA 1TJGL 1RZKL 4Q2ZB 5IB4A 3TV3H 5E5RB 4YIQA 3SKUD 2VISA 1ZOXA 2V5RA 1BJ1J 3HZKB 4RBPK 1F6FB 1MRDH 4H5SA 4R7NA 3S36L 1A6TA 4KTDL 4A2MA 4K3DL 1F00I 1DDHA 3OXSA 1JZ4A 3OXSB 5BMFH 4HXBH 4JPVL 5E2UH 1YN7A 2OZ4L 3SDAA 2H1PL 2ATKB 4L8CA 1TETL 2FLRT 3BGMB 3PWNB 4NQEB 2APWA 4ZQKB 5GISL 1LO0H 1TFHA 5CJBA 1SJVA 1LO3H 4PP2B 3UEZA 4YBLB 3VXTA 1QTYT 5HHNA 3HE6D 1NBVL 3U0WH 4DKEL 2WBJC 2YPKA 1MHCA 2EEAA 5IB5B 3RAJH 1AJ7H 3HC4L 5TPWH 4X4XB 4JDVA 2VZUA 3G6JB 1QRKA 3KXFE 1HSAB 4GW5B 5A3IC 1C5BL 5JLZB 3X3FL 3KPQA 4JE4B 5D6CB 4MDJB 4HEPG 3GSWA 3TBTB 2PCPA 1JMXA 3JSSA 4LPTA 5F9JB 5C0RL 4Y1AA 3KPOB 2BSRB 3SY0B 3KPOA 5ILTH 1ZT4A 2VLRB 4TSCH 3OKNA 5BMFL 5L0QC 3MGTA 2EKJA 5FV2A 2CLVB 2IAND 4M7LT 4PJFF 4QY8B 1ZEAH 1Y18A 3OX8B 4X9FA 3RPIA 1YNLH 4S0SD 1BZ9A 2BFVH 4WGWB 4RFNC 1IGIH 3VFGL 3EYFA 4RAUA 4HK3N 4YBQD 4RNRB 3WFCL 5DD0H 2HA1A 2BHYA 2LVEA 3QG7L 3V6OA 4L8BB 4P2RA 3F7VB 2ZUSA 2P5EE 5CJQL 2HT2C 4L29A 4XNYH 4OCLC 3NA9H 1HYSC 1OOAA 4D0CB 5CJOL 3VXQA 4ZFFB 2NY5C 3QEGL 4U05A 2GT9B 4G8IB 1WBXA 4POYA 4H5SB 3BAEH 4I77L 2VXTL 5C0AE 1S7WA 3UBXB 3CX5K 3ARTA 4J8RA 3MRIA 1EVTC 3FQUA 3MRGB 3BVNA 3RWFB 2X4NB 4DGYL 1KJ2L 4J3WA 4AEIH 4OJFH 4KTYA 1NGYB 1NGZA 5IROC 3TGXA 5E6IB 1KPVB 4FQXC 3X3GL 2F5AH 4ZAKD 3TT3L 2A1WL 4FQQB 4GXUN 1CFSA 4L4JA 3CSBA 3K0WA 3EHBD 1INDL 1F13A 2VC2L 1UM5H 4LNRA 2IG2H 1JV5A 4IRJB 5BXFA 4BUGA 1WIPA 3LSOB 3OPZH 2C4XA 5F1IB 1T20A 3WJJA 3ARBD 4YX2L 3GSQB 2NR6D 5E8NA 5D7LE 1QKZL 5I16B 4EVNB 1FNFA 1G9NH 4NUGH 5C2BL 1QQDB 1YEEL 3O0RH 1KIRA 1Q9KA 3VE0A 4NM4L 5ESQB 2AW2A 2E6PA 1KJMB 1H3PL 5JNYA 1YUHB 5C3LD 3L5XH 4DEPC 2DQCL 4MWFB 1QACA 4OJFL 3WXVL 1IM9B 4K8RH 2F5AL 3MRDB 2H2PD 5C0JB 2GAZB 5J4MA 1EAPA 3CXDH 3IF1B 5JW3H 3LKNA 5I1KH 1VACA 2BX5A 5D93B 4Y5YC 5F70A 1BFTA 1T0NA 3NCMA 3PGFH 4JFEB 2EH7H 4PGEA 1QRNA 3O3DB 3UTZA 1KB5H 3E8UH 3QCUH 4QXGL 2AJYH 4PD4K 4Y4FB 2A6KA 4HIEA 5JXEC 5FKAA 4ZO8A 4FQIL 4NM8L 3MXVL 3OSKA 3O3UN 2M1KA 4X0KB 4R97C 1GRWA 3MJ9A 3WHE1 3O0RL 4HZLA 5DGQA 1E6JH 3J7HA 4NJ9H 2EXWD 1X5AA 4XWOC 4JZNA 4ZPTB 5JW4M 4P4KB 1P84K 2CGRL 1KJ3H 3QNZB 3D18A 3L5XL 4UQ3B 3KYOB 5MENB 1YEKH 5DA4A 3STZA 4QTHA 1JV5B 3SDAC 4HMEA 2JK5B 3VRJA 4ZMAT 3QCVH 2OSLB 4L8DB 1Q1JL 4X4MA 3UPRB 4OCRH 2RHEA 4JG1L 3MYZA 3P3YA 3BUTA 3LKRA 1YDPB 4JJHA 4XAKE 4LU5H 4S10A 3GNML 1BD2D 3EDKA 4WTZG 3RL2B 3IRZA 3GFUA 2ICEA 4TVPH 2Y06H 2YS4A 3V4PL 2G75B 3O6KH 3ZSSA 4ONGH 4ZUTB 4P2QA 4M6ML 3DNKA 1Q9OB 4JPKL 3MRPA 2XZAL 3MZTA 3WKNA 2QHRL 1FRGH 2V6HA 1AY1H 1TJIH 5DJCA 1MRCH 5J13B 3RZCB 2V5MA 2X44D 4YBLC 5FHBL 5GRVL 1NGYA 5ANMA 2D7OA 3PABA 3PHQA 5D93C 5ANMB 1MI5B 4I5BB 2JJSA 4G8FA 1PEWA 2AP2A 1T2JA 3HAEG 3KR3H 1MHHB 1OAXH 4G9FA 2UWEA 3T77A 3GRWL 1AGDB 4PTUA 1X5HA 4GG6B 5FKAB 3SN6N 1A7NH 3MODH 4WUUD 2ED9A 1WLHA 4NT6B 1QBLL 4KTEH 3S35X 1ULVA 3GNMH 1RJZB 5I16A 1MI5A 4WW2C 1AGEA 4KROB 1OTUC 5EN2B 3GUTB 4GRMA 4JM2F 4S1SH 2FECL 4BZ2L 2M8XA 4X5WA 4FQLL 1MCPH 3QIBA 1A7OL 4F7EA 2OK0H 2R2BA 1S8DB 3O6FA 3QIWA 1ZV5A 1S3KH 2GI7A 3I9GL 3MJ6A 4KQ4H 3VRJB 3FFDA 4LPCA 1AI1H 4YFDB 5FYLH 3BN9C 5K9OA 1S9XA 4FQQA 4LK4A 2NQCA 4GRWB 5FYKE 4EIZC 3QR2A 4OIAA 3WD5L 4N0YL 3QHZL 3LIZH 4OZHB 3CDYA 1YDPA 2AK4A 2Y72A 3G6DL 1Q9LB 1XH3B 2DI9A 2AQ1A 2FDBP 1ZT7B 3G9VA 3T2QA 2D0HA 3BZEB 1JRHL 2DQDH 2IEPA 3IDUA 4TUKL 5I76B 2Q8AL 4DK6A 4ZFOL 1B3JA 4FXKA 1S7VA 1A3QA 2DQGH 5HHOB 2OL3A 3RU8H 4OD2A 2I07B 2PO6C 3RVXD 4LEOB 3QFJB 4FQLH 1CXHA 4IIQA 4KV5E 1SYSA 4XX1G 1PFCA 3BX7C 1K6QL 3TNNA 1RU9L 5JMOC 4IMLB 1P2CA 3IDXL 1M71B 2DLFH 4PJBF 4L9LA 4PYGA 4KRNA 3R06B 1J12A 4WUUB 5I8EA 3GJEB 2ZZUT 3ROOB 4HGWB 1QRNB 1MF2L 4JHBA 5BO1L 4FMKA 3SGJC 4WI4A 4N8VG 5JR1H 2C5DC 3VA6A 2YWZA 4JRXD 1VFBA 1JNHA 3MV8E 2KKQA 3V5DB 2W0PA 3GBNL 3LV3A 2VLRD 4JGJA 2J4WL 3TIEA 4CU6A 1U8OB 5EU5B 4W4OC 1S7TA 2DIJA 3VXRB 1XGQB 2EC9U 3BZ4A 4N8VB 4N8CH 2YC1B 3I75A 5A40E 4AIXA 1MJ8L 1OAUL 5ENWA 2ZOLB 5D9SA 5BW7C 1BQLL 3VXMA 5F1NA 5GGRY 3QG6A 4HBCL 2EEBA 2FJHA 2AK4E 3PV7A 4M8QA 5DMJB 4PJFA 1ZHLB 2RQ8A 1D5ZB 5K9QI 3FB7A 1QQDA 4M1CC 3CC5B 5B39G 4F33B 1UKQA 3LQAH 4BH7A 1CU4L 4PBWD 2B1AH 4PGBB 3U7WH 2ARWA 4HW6A 3WNMA 1FL6B 3P9MB 4GLRI 3AREB 2R56H 1ND0A 1YNKL 1XR9A 2MPAH 3BXNA 3EOYG 4GQ9L 2A9NH 2YD4A 3UTQA 2F8OA 1IEHA 3ARDA 1RIUL 3DX7B 2GTZA 2EZ0D 4Z7VE 3MRBA 4ZFGL 4OZ4A 3IDIB 1EZVY 3NPSC 3CUPB 4FQHA 3VFVB 2P8PA 4R97B 3UCRA 1N6QH 2XA3A 1BAFL 4CN1A 4DKFL 5E6IA 1IQWL 1U91A 1CGTA 3TYFA 4WNQB 4YIQB 1C12B 3MCLH 4P4KC 4WFFE 4OF0A 4K71B 1I75A 1TJHL 1WAAF 3A6OA 1E0OB 4TNVK 3O2VH 3WBDA 2YRZA 1NUFA 5GIRA 2LVCA 4QRSA 5IBTH 1JGUL 1YZZA 2R2EA 1CLZL 4P99A 2I60H 3VGEA 2UYLB 1JZ5A 2E7MA 2YKLH 4LLQA 1U8QB 4NHCL 3VWJD 3K74B 1B0GB 1NFDF 1BJ1H 1NC4B 3GBMH 3PIQB 3VFPA 3K46A 3NPZB 3VD9A 1SBBA 4NN5B 4K55A 2CMRL 3J8F7 1ZWIB 5JHDB 3S37L 3KPMA 3WFBL 4K9EC 1MLBA 3PGCB 1F3JA 1NQBA 5H94A 4IHOB 1NAML 2NZ9C 3DX8B 3BDXA 3AU1B 4N68A 3FAXA 5FYJD 3KPSD 4P23C 5LXGL 1VESA 5ALCL 2YXMA 2VE6A 1CE1L 1HYRC 4HGMA 1RQ5A 5GS3A 1BM3H 1G9MC 5JA9A 1YNTB 4HKBA 4Z77B 4KHXH 3RZCC 2APVA 2R2CA 4TQEH 3ULSA 3CNKA 3VGAB 5DD1H 2Q6WA 2Y25A 3SE8H 1FN4B 2BVOA 4WJ5A 1AHWC 4JDZA 5TQ2L 5CZXD 3MUY1 4HIIA 1U3YA 2X9WA 4ZOBA 2HT4C 1X7QB 4HX1B 3HUJA 3HZVA 4XCEA 2OR7A 5FM5M 4EDXB 2IF7A 3HFML 5GRWA 1P1ZB 2V9RA 4HUXA 2YK1H 1JJUA 1I7UA 2C7UA 5EU7E 3ISWA 5IT2L 3WDJA 1BPVA 2ICCA 4LSPH 3D69B 4U1KB 5FDWA 4RIRB 4UT9H 3C8KB 1NBYA 5AUMA 1AR2A 3EGSB 1MAJA 4AH2A 3HUJF 2P5WE 4IMLA 3T0EB 1RSFA 3CX5J 2BSSB 5C7XL 1FSKC 3G6JF 1M05B 5I75C 5FYJH 2AABH 4I5BA 3HPJA 2R1WA 4ZD3L 1QR4A 4G5ZH 4D0DB 1KXQE 3LEVL 5LWYL 2G5BA 2VDNH 1SJEB 3BW9A 4UUJB 4UTAL 3KS0J 3SE8L 3MFFB 1DLHB 5J9PB 5GS0L 3P77A 4M61A 1FFRA 1F4WH 1FNSL 4D9QD 5ADOH 5B21A 5DJ6A 5BRZD 3B5HA 3KPLA 4X7EC 1ORQA 2VISB 4U1SA 4RGMB 3QPQC 5E6ID 3AFLA 1JZ2A 2AI0H 1OARH 4KHTL 1KIPA 2D4DA 5JDSB 2P7TA 5AZEL 1OWRM 5EUOF 2FL5A 1N5AB 1S7XA 3D85B 3QNYB 3WL9B 2X1QA 1D5ZA 4XVTL 2R9HD 4TUOB 2CJUH 3BZFA 4OB5H 2PETA 2ZCHL 1MNUH 3UDWA 2ZCKH 2B4CH 4E41D 1K4DA 1RFDH 4U6YA 3NMEA 4H1LB 5HI3D 3W39B 4GMSL 1G7MA 3LEVH 4BELD 1WF5A 2VZOA 3IS1X 5HI5C 4NWUL 2J88L 3U7YL 5IEHB 3RIAF 1X6NA 3NACL 3LKSA 2VL4A 1KACB 3RIAK 1FYHB 1D6EA 2OX5A 2GIYA 5IQ7H 4UILH 5C2UB 5FYKD 3GSOB 5BZWB 1UEYA 3GHEL 4HIEB 2UWEF 2HJFB 1MFAL 1YEGH 4XBEL 1A6UH 3EFFA 3FN9A 5FB8B 4XNXL 2BHZA 1T22A 1X5ZA 3U0PA 1BOGB 1HOCB 3W9DB 4HUNB 2X4TA 4Y4KA 4C56D 1N8ZB 4OGAC 4LDOB 3DRTA 5L8JB 4LAQL 2NNAB 2VLKD 3P73B 4KDWA 2IH1B 1WAAA 2RFXA 1I7TA 3U0TB 3VFWA 1F02I