1T6IA

Nickel superoxide dismutase (nisod) apo structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 42
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6iA00
1Q0GA 3G4ZA 1Q0MA 1Q0DA 3G4XA 1T6UA 1T6QA 1T6IA 4NCQA 3G50A 1Q0KA 1Q0FA
chains in the Genus database with same CATH superfamily
1A7VA 1M2VA 4CSAA 4M63A 2CCYA 3JZ0A 3AGUA 1T6QA 3RVYA 1GS9A 1M57C 2OG2A 2FAPB 4PJMA 1BBHA 2R9RB 2NSFA 5L3QA 2NSGA 2QNLA 4BPMA 3W4YA 2J9UA 4I1MA 4X0RA 4E17A 3LJBA 1MMDA 2PX3A 3LEOA 1B68A 2WVNA 4G0HA 4N4WA 3U8PA 1JAFA 4XEKA 4W8KA 4RDAA 5A6BD 5KYYB 2CYDA 4JEBA 4BEJA 1UG7A 1WASA 4U5BE 1BZ4A 4YL0A 4DRIB 4CS9A 2ZXRA 1LM3B 4NCQA 2Y3HA 3EGXB 2R7QA 3QW0A 3L8JA 1HW2A 2G62A 5KYUA 2RSEB 3L1MA 1TWAA 2HSQA 3N24A 3DI5A 1IZMA 1NG1A 2DYSC 2PX0A 2WB7A 3DKAA 3T4RA 1FNTc 2YLIA 2BE5F 4KNWA 3R7CA 4OD5A 3AG4C 1OKKA 4NTFA 4JW1A 1YYJA 3F46A 2VCCA 4PFOA 4WJ0A 3BRJA 3TQOA 3CSKA 2VB6A 4U9DA 1D0XA 256BA 4LDQA 4YL1A 2EPNA 3EH1A 4ULWA 4HE8D 4XPYA 3NDBB 2CGEA 1G4WR 5DS4A 4EWCA 3IQ5A 1LVKA 3C8GA 3S90A 3J06A 1APCA 4K7BA 1EI7A 1OR2A 3RH3A 3IQCA 4Z9IA 1MQVA 3TJ5A 2L81A 5DQZA 1GGQA 3DAFA 3WODF 4C3EA 4ER9A 5IY5C 3EZHA 1JPJA 5JUAA 3UNGC 4H54A 4HFKB 2EPOA 1N1CA 4OIQF 2HJMA 1Y4CA 1YJGA 3JYYA 2P61A 1LE2A 2KSFA 2LK4A 3DJNB 3VF0A 1A7DA 2J9WA 5L0HA 3UMHA 4C3BA 3V5XA 2P1AA 3FAJA 3EJNA 5KYUB 4CDVA 2TMVP 2G3VA 2ZD9A 2LCHA 4CDAA 1C03A 2J0XA 1FMVA 2OKUA 3UMIA 1DOWA 2IXPA 2BC5A 1YZAA 2QE9A 2DB4A 2PNOA 4JIOA 4IAQA 2XL6A 3LNRA 3SP1A 2J9BA 3MFNA 2YHSA 4PR9A 3U8VA 4EKWA 2D4UA 2Y3GA 3QVZA 1CGNA 5BQIA 1NU9C 2QY9A 1PCXA 2OU6A 2QTVA 3KYJA 2W4BA 1BDJB 1H7IA 4MVSA 1TQGA 4LERA 3RIPA 1XZPA 2R25A 1CPQA 1G5ZA 2IXNA 4FESA 4AL1A 1E2XA 3C7JA 3IEEA 1I4YA 3IQTA 1PD0A 3JYHA 4MTFA 4KI2A 2G3KA 3ZDLA 1ZW3A 2I8BA 2R7SA 2WZFA 2XLMA 4EUKB 2O9XA 3UR3C 4OIOF 5EHHA 2J9VA 3ABMC 4YJWA 3GEEA 1NSGB 2XS8A 3U5SA 4A2NB 2NUTA 1BR1A 1SF8A 4MVQA 2M4EA 3EFOB 3I5QA 3ZIBA 3JTLO 4MW3A 1T01A 1ZZPA 4XLNF 1Q0KA 3FHDA 2IXOA 4IWBA 1R5ID 4LDKA 2Q7RA 2ZXWC 4CS9C 4IB4A 1LS1A 1QZXA 4U5EE 2HJ3A 5AC4A 2PF4E 4E0HA 2C03A 1E86A 2EIJC 4CSAC 1RKEA 2Q4FA 1YZCA 1ZHTA 2EILC 3QVYA 4O6NA 2ICWG 4LLEA 3TK0A 3U2LA 3SEOA 1G4US 3FVYA 4XPWA 2IXMA 3HNLA 2R05A 4CBEA 1T6IA 5DQTA 5EGYA 2L6GA 5T3TA 3O39A 3SYNA 4Q4ZF 3G4XA 4O6MA 2OCCC 3ATPA 4JTDB 4U5CE 2VCAA 4MW8A 1VYKA 3O10A 4IRUA 3AG2C 3G4ZA 4DBRA 1K05A 3DAGA 3DE8A 2UUHA 3T9OA 2L9JA 3FDQA 1MMGA 3H2UA 4LACB 1JMWA 1CGME 1WN0A 3PMRA 5F5HA 1NBBA 3C63A 3S9OA 2A0UA 3KKBA 4GYTA 4C7OB 2OOCA 1HMOA 3EFOA 2FGYA 2AU5A 3SXKA 1PV3A 2DYRC 3HLZA 1F1MA 1YYXA 2X0CA 1CPRA 3M4CA 3MYFA 1W2WA 3ZTZA 3AGTA 2X51A 4AK9A 4YK5A 4YT4A 3POVA 1U89A 2XLHA 3V5ZA 2XLVA 1V74B 3A9CA 3QMKA 5BQGA 3AJMA 3SNHA 1YDIA 2Q00A 1G8XA 1VLSA 2LIGA 1BR4A 2YVKA 4O7GA 1K40A 3DXJF 3K1IA 1V55C 1OW6A 1V54C 1TWHA 4JRZA 1T9KA 2EPMX 2OQMA 3LS0A 5A6KA 1Z6AA 1AUEA 4CX9A 1H6GA 1A0BA 1R4TA 3JSZA 4FWVA 1Z3IX 4NQFA 2MYSA 4NY3A 2UUIA 4I44A 4W8PA 4PK4A 3C8ZA 3ASNC 4YT2A 5BQHA 2VCBA 4MVOA 3X2QC 4G7HF 4OIPF 5E33A 5L0GA 3CAXA 3ZC4A 2C04A 1L3PA 1LPEA 1OR3A 2OJED 1AEPA 1TFOB 4QDLA 2XXAB 1YARO 2P0NA 5DLJA 4FX5A 4E7ZA 2R7OA 3M15A 1OW7A 1TR2A 3US6A 3C62A 3Q6MA 4LDRA 2BL2A 1A41A 1PD1A 2OJQA 2YEVA 1LKXA 1ZU4A 2NUTB 3KYIA 4JCHA 4JJGA 5DVWA 3RQEA 2R7TA 3JRMO 2MHRA 2XL8A 1ORJA 1QLEC 3B0PA 3L0IA 3OA1A 5D91A 5KYWA 2OEXA 3MLGA 1OQCA 3MBGA 2LFFA 3EQLF 4IGGA 5A6JA 4YWQA 1NLXA 5KYYA 3SXMA 3W8IA 3N2ZB 4J7TA 3I5PA 3HNKA 5AGFA 3NRHA 3NKDA 2HV7A 3RVZA 1J8MF 3TOLA 3U0CA 3JT1A 4J30B 1C02A 2HKVA 4N06A 3PDMP 3B71A 4BJ6A 2KGOA 4J7YA 1HE1A 4PFPA 3JSEO 3GM3A 5CI9A 2A6HF 2A0BA 4MNDA 4BJ5C 5KYXB 2Y69C 1HW1A 3V7OA 4CIHA 2J7PD 2R7VA 1XZQA 1KNYA 4B6IA 1M2OA 2GWWA 1YVIA 1I4ZA 2OEVA 3JRTA 4JEAA 5COMA 5BUOA 2P7VA 1YA7O 3FXHA 5T1DB 3W2WA 1RXQA 3AG3C 1AVOB 3DJUB 4MVRA 3TD7A 4OINF 1SZIA 2KK1A 3X1OA 2R7XA 1JR8A 3JCUQ 3K33A 2CNWA 5CIVA 5FCLA 3UGOA 2F22A 2H7BA 5KYWB 4C3DA 2NUPA 1FR0A 3EHMA 3U3BA 4PACA 3M4BA 3RW0A 4ONSA 3GORA 5B3IA 1EA8A 1ORYA 1QVXA 3NYLA 2WL8A 1VOMA 3LNMB 4P9FA 4AE4B 3O6XA 3M79A 1HE9A 1O5HA 3RF3A 3U9MA 4JVSA 1WOLA 4JJFA 4F4BA 3K66A 2XRHA 1SMYF 4DOZA 4WGZA 3IQ6A 3ABKC 4XQ1A 1EQ1A 3EG9A 4JZAA 4BJ1A 2R03A 4DRJB 3B0UX 3H65A 1IW7F 3B9QA 4LLCA 4QI0A 1ZVZA 2KYHA 3EH2A 1M56C 3GEHA 5L0CA 4QI2A 2LD6A 2QLAA 2FFHA 4DVZA 2XLEA 2Q3TA 3GWNA 2IBFA 1ZHZA 5F5FA 4JE9A 3V5YA 5KYXA 2XL4A 2ETSA 4U5HA 2AVKA 1FAPB 2WVOA 2XSEA 3F47A 1QQ3A 3GM1A 3K6BA 4MS2A 5JP7A 2CW0F 2YL1A 3C8GD 3DZAA 1H9TA 4NC3A 3T6BA 3ZSUA 4ZLCA 2DI3A 3C18A 3IHUA 3R2PA 4DRHB 4P9TA 4YT8A 4CIPA 1RCPA 3HTKC 3MYIA 2YLGA 2EPLX 2KW3C 1YLMA 4D4NA 1O87A 4WABA 1QPUA 3GANA 1JOGA 1QSPA 2YRFA 3DM5A 3NMJA 5E2QA 3AQBA 1V4AA 2PBEA 4ZLDA 1RKCA 1VYIA 2CDQA 3WG7C 4NTBA 5L0DA 5L0IA 4KNVA 3EGDB 3K1IC 4WGYA 4D4XA 2EINC 2J46A 2YL3A 3DM9B 4RBNA 3ZG1A 3DD7A 1L7CA 4U9EA 3U3FA 5L3VA 1TFKB 1WATA 2RD9A 3DWWA 3LAYA 4O6YA 1LI5A 2E87A 1Z5ZA 2D5RB 1RMVA 1KU2A 4CS7A 1H9GA 1GM5A 2HV6A 3B29A 3CZ6A 5COGA 1ZHYA 3W2VA 1ZHWA 3EHNA 1MNDA 1OKKD 1XWJA 2MWQA 3Q7GA 1KTMA 5AC5A 4MVZA 2Y3DA 1E84A 4Q5SF 2Q9AA 4I1OB 4RD9A 1FTSA 5B1BC 4PJJA 4HEAJ 3CEXA 4NTAA 2A69F 2ZPAA 3VAYA 2J0WA 3EG9B 1VTMP 4GQHA 1RJ9B 3L8IA 5DS6A 3M1CB 4DXWA 4EBKA 4DBQA 4MQ9F 4IARA 1ZW2A 3SZRA 4AE4A 3LUTB 1E85A 1RJ9A 2HMZA 1J8YF 1LS4A 2JD3A 3HKKA 5TJ5E 3ZQYA 5DS5A 2KC3A 3AG1C 3PCVA 4OD4A 1JRAA 5D92A 3ITFA 3N0TA 4BG0A 1Q0FA 3ABLC 2R7RA 4MTGA 3KPHA 3K1HA 4JC7A 4BEMJ 1K04A 4U5DE 2R02A 4OIRF 1QKRA 1NFOA 2LP4A 1M6TA 1YA9A 3GEIA 2Q9CA 5L0FA 1RKEB 4PJNA 1C17M 4XTKA 1D1CA 2GA0A 4CDYA 1D0ZA 1OCZC 5T3WA 2I15A 2XLWA 3U2MA 4CJGA 2KJGA 3TJ6A 2W9YA 2H7VC 3HJCA 2JX0A 1D0YA 3KMIA 4CS8C 3EPVA 4C7OA 1FFTC 3C8GB 1T6UA 2L6FA 3HNJA 2LFDA 4XLPF 3TULA 3LLIA 3KL4A 3S27A 4FAPB 2LQGA 1LI7A 2R7UA 4EHPA 2V3CC 2J45A 3AQCA 3MX3A 2ZXOA 4U5GA 1U6HA 4Z9JA 3S28A 1NU7D 4HFFB 2B0HA 3ECSA 3FOOA 4KC9A 4MVUA 1Q0GA 4YN0B 2XLDA 3L34A 3UGPA 1OCCC 4KBLA 3Q6NA 1VK5A 5COFA 4BJ5A 3LLKA 3NYJA 4E0IA 3ZWIA 2B0JA 2YQYA 1YAUO 2YZSA 5GPGB 3GWLA 3T6GB 1LIHA 2IYLD 3QZCA 1TKNA 2HUJA 2YLDA 1FFHA 4N6HA 3ASOC 4EIYA 3DMDA 3FAPB 4G7OF 1LE4A 1ST6A 2GDCA 1CGOA 3HNIA 4K0DA 1ZHXA 3WHNA 1FMWA 1MMNA 3RQGA 1UFBA 2Y3BA 3SXYA 2HMQA 4EBBA 4JKVA 5A6AA 3Q7LA 3H2VA 5CI8A 3ZTMA 4CS8A 3FMSA 4DVYP 4L6RA 1WTYA 3LS1A 1Q0MA 4JCZA 2JPUA 1NZEA 4R32A 2XXAA 1D1BA 1E83A 5FZTA 3KH2A 1O3UA 2QUPA 4YT5A 2PFDA 2WZLA 1JPNA 1TWGA 2AP3A 2A1DD 4IJJA 4P6IC 2HZ8A 2H8AA 4XEFA 5A6BA 1EKYA 4MTOA 4XEVA 1DOVA 3I4UA 3B0VC 3IPMO 3GODA 5L0JA 4H4KC 5JS5A 5F28E 2ASRA 1GQAA 2DGJA 2H7OA 2KNHA 2IOQA 2W4MA 3A11A 3QTHA 4JURI 4XPXA 2XM0A 4U5FE 4MVMA 2Q9BA 3S84A 1OXBA 1WWPA 2VC9A 4AL0A 5JT4A 1U0BB 2HFIA 4EBJA 1HY5A 3AOUA 2YL0A 3DE9A 1Z23A 4BJTA 1Q0DA 4G78A 5JLIA 4BJ6C 1OXKA 2L7AA 1MMAA 2WZGA 3TOMA 3NG1A 2M64A 5EK0A 1A7EA 5B3SC 2Z15A 3RFYA 1ZU5A 3S29A 4AX2A 1WGWA 1Z63A 2NG1A 3EGXA 2AWCA 3S0XA 2Y39A 1OCOC 2NPUA 5E3AA 5A69A 5K0IA 3GM2A 3RKOF 3NMIA 3T6JA 4N6CA 1ORSC 1TWCA 3VM6A 4G7ZF 2YL7A 4Q7CA 1S05A 3O55A 1S7ZA 2VASA 4O79A 3U9JA 5JVEA 2J8WA 2WVQA 2YKZA 3QW1A 1SYQA 1OW8A 3RQFA 3W8HA 2J7PA 2W45A 2XM4A 1NFNA 2A6EF 3EZIA 4PJLA 3VYWA 2ZXPA 1BR2A 4J32B 5B1AC 1Z7Qc 4JTCB 4YL3A 3ZVRA 3K7DA 1ZYRF 3NYMA 3E9VA 5KYNA 5HV9A 1VB5A 1SR2A 5JSLA 1HMDA 1M2VB 3BEHA 4CJOA 1T5OA 2GFHA 4DJ9A 3UMKA 3VRCA 5HSWA 2CNWD 3NKEA 3OEOA 4E7SA 3ZQVA 2YWAA 4A4AA 2LSEA 1OCRC 1D1AA 1VLTA 2IM8A 2V26A 3CQZA 3WAQA 2KQ9A 4K1OA 2NUPB 3NMKA 3E70C 1MNEA 2AWYA 1VMAA 2PP4A 4E18A 3RYLA 2EIKC 3PHF2 2GAQA 2XLOA 4GEHA 3SXZA 2VH3A 1Y6DA 4IAOA 2A68F 3OWTA 4I3MA 2L6HA 4JTAB 5E3CA 3G50A 3EGDA 3LEVA 3FOPA 4UDVA 2R7WA 3LESA 5JRAA 1I5NA 2HSBA 2XS1A 4ULVA 4XWJA 4ANJA 4Z9HA 2HS5A 2EPKX 2P6VA 2EIMC
chains in the Genus database with same CATH topology
1Q0GA 3G4ZA 1Q0MA 1Q0DA 3G4XA 1T6UA 1T6QA 1T6IA 4NCQA 3G50A 1Q0KA 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0G A;  3G4Z A;  1Q0M A;  1Q0D A;  3G4X A;  1T6U A;  1T6Q A;  1T6I A;  4NCQ A;  3G50 A;  1Q0K A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 1A7V A;  1M2V A;  4CSA A;  4M63 A;  2CCY A;  3JZ0 A;  3AGU A;  1T6Q A;  3RVY A;  1GS9 A;  1M57 C;  2OG2 A;  2FAP B;  4PJM A;  1BBH A;  2R9R B;  2NSF A;  5L3Q A;  2NSG A;  2QNL A;  4BPM A;  3W4Y A;  2J9U A;  4I1M A;  4X0R A;  4E17 A;  3LJB A;  1MMD A;  2PX3 A;  3LEO A;  1B68 A;  2WVN A;  4G0H A;  4N4W A;  3U8P A;  1JAF A;  4XEK A;  4W8K A;  4RDA A;  5A6B D;  5KYY B;  2CYD A;  4JEB A;  4BEJ A;  1UG7 A;  1WAS A;  4U5B E;  1BZ4 A;  4YL0 A;  4DRI B;  4CS9 A;  2ZXR A;  1LM3 B;  4NCQ A;  2Y3H A;  3EGX B;  2R7Q A;  3QW0 A;  3L8J A;  1HW2 A;  2G62 A;  5KYU A;  2RSE B;  3L1M A;  1TWA A;  2HSQ A;  3N24 A;  3DI5 A;  1IZM A;  1NG1 A;  2DYS C;  2PX0 A;  2WB7 A;  3DKA A;  3T4R A;  1FNT c;  2YLI A;  2BE5 F;  4KNW A;  3R7C A;  4OD5 A;  3AG4 C;  1OKK A;  4NTF A;  4JW1 A;  1YYJ A;  3F46 A;  2VCC A;  4PFO A;  4WJ0 A;  3BRJ A;  3TQO A;  3CSK A;  2VB6 A;  4U9D A;  1D0X A;  256B A;  4LDQ A;  4YL1 A;  2EPN A;  3EH1 A;  4ULW A;  4HE8 D;  4XPY A;  3NDB B;  2CGE A;  1G4W R;  5DS4 A;  4EWC A;  3IQ5 A;  1LVK A;  3C8G A;  3S90 A;  3J06 A;  1APC A;  4K7B A;  1EI7 A;  1OR2 A;  3RH3 A;  3IQC A;  4Z9I A;  1MQV A;  3TJ5 A;  2L81 A;  5DQZ A;  1GGQ A;  3DAF A;  3WOD F;  4C3E A;  4ER9 A;  5IY5 C;  3EZH A;  1JPJ A;  5JUA A;  3UNG C;  4H54 A;  4HFK B;  2EPO A;  1N1C A;  4OIQ F;  2HJM A;  1Y4C A;  1YJG A;  3JYY A;  2P61 A;  1LE2 A;  2KSF A;  2LK4 A;  3DJN B;  3VF0 A;  1A7D A;  2J9W A;  5L0H A;  3UMH A;  4C3B A;  3V5X A;  2P1A A;  3FAJ A;  3EJN A;  5KYU B;  4CDV A;  2TMV P;  2G3V A;  2ZD9 A;  2LCH A;  4CDA A;  1C03 A;  2J0X A;  1FMV A;  2OKU A;  3UMI A;  1DOW A;  2IXP A;  2BC5 A;  1YZA A;  2QE9 A;  2DB4 A;  2PNO A;  4JIO A;  4IAQ A;  2XL6 A;  3LNR A;  3SP1 A;  2J9B A;  3MFN A;  2YHS A;  4PR9 A;  3U8V A;  4EKW A;  2D4U A;  2Y3G A;  3QVZ A;  1CGN A;  5BQI A;  1NU9 C;  2QY9 A;  1PCX A;  2OU6 A;  2QTV A;  3KYJ A;  2W4B A;  1BDJ B;  1H7I A;  4MVS A;  1TQG A;  4LER A;  3RIP A;  1XZP A;  2R25 A;  1CPQ A;  1G5Z A;  2IXN A;  4FES A;  4AL1 A;  1E2X A;  3C7J A;  3IEE A;  1I4Y A;  3IQT A;  1PD0 A;  3JYH A;  4MTF A;  4KI2 A;  2G3K A;  3ZDL A;  1ZW3 A;  2I8B A;  2R7S A;  2WZF A;  2XLM A;  4EUK B;  2O9X A;  3UR3 C;  4OIO F;  5EHH A;  2J9V A;  3ABM C;  4YJW A;  3GEE A;  1NSG B;  2XS8 A;  3U5S A;  4A2N B;  2NUT A;  1BR1 A;  1SF8 A;  4MVQ A;  2M4E A;  3EFO B;  3I5Q A;  3ZIB A;  3JTL O;  4MW3 A;  1T01 A;  1ZZP A;  4XLN F;  1Q0K A;  3FHD A;  2IXO A;  4IWB A;  1R5I D;  4LDK A;  2Q7R A;  2ZXW C;  4CS9 C;  4IB4 A;  1LS1 A;  1QZX A;  4U5E E;  2HJ3 A;  5AC4 A;  2PF4 E;  4E0H A;  2C03 A;  1E86 A;  2EIJ C;  4CSA C;  1RKE A;  2Q4F A;  1YZC A;  1ZHT A;  2EIL C;  3QVY A;  4O6N A;  2ICW G;  4LLE A;  3TK0 A;  3U2L A;  3SEO A;  1G4U S;  3FVY A;  4XPW A;  2IXM A;  3HNL A;  2R05 A;  4CBE A;  1T6I A;  5DQT A;  5EGY A;  2L6G A;  5T3T A;  3O39 A;  3SYN A;  4Q4Z F;  3G4X A;  4O6M A;  2OCC C;  3ATP A;  4JTD B;  4U5C E;  2VCA A;  4MW8 A;  1VYK A;  3O10 A;  4IRU A;  3AG2 C;  3G4Z A;  4DBR A;  1K05 A;  3DAG A;  3DE8 A;  2UUH A;  3T9O A;  2L9J A;  3FDQ A;  1MMG A;  3H2U A;  4LAC B;  1JMW A;  1CGM E;  1WN0 A;  3PMR A;  5F5H A;  1NBB A;  3C63 A;  3S9O A;  2A0U A;  3KKB A;  4GYT A;  4C7O B;  2OOC A;  1HMO A;  3EFO A;  2FGY A;  2AU5 A;  3SXK A;  1PV3 A;  2DYR C;  3HLZ A;  1F1M A;  1YYX A;  2X0C A;  1CPR A;  3M4C A;  3MYF A;  1W2W A;  3ZTZ A;  3AGT A;  2X51 A;  4AK9 A;  4YK5 A;  4YT4 A;  3POV A;  1U89 A;  2XLH A;  3V5Z A;  2XLV A;  1V74 B;  3A9C A;  3QMK A;  5BQG A;  3AJM A;  3SNH A;  1YDI A;  2Q00 A;  1G8X A;  1VLS A;  2LIG A;  1BR4 A;  2YVK A;  4O7G A;  1K40 A;  3DXJ F;  3K1I A;  1V55 C;  1OW6 A;  1V54 C;  1TWH A;  4JRZ A;  1T9K A;  2EPM X;  2OQM A;  3LS0 A;  5A6K A;  1Z6A A;  1AUE A;  4CX9 A;  1H6G A;  1A0B A;  1R4T A;  3JSZ A;  4FWV A;  1Z3I X;  4NQF A;  2MYS A;  4NY3 A;  2UUI A;  4I44 A;  4W8P A;  4PK4 A;  3C8Z A;  3ASN C;  4YT2 A;  5BQH A;  2VCB A;  4MVO A;  3X2Q C;  4G7H F;  4OIP F;  5E33 A;  5L0G A;  3CAX A;  3ZC4 A;  2C04 A;  1L3P A;  1LPE A;  1OR3 A;  2OJE D;  1AEP A;  1TFO B;  4QDL A;  2XXA B;  1YAR O;  2P0N A;  5DLJ A;  4FX5 A;  4E7Z A;  2R7O A;  3M15 A;  1OW7 A;  1TR2 A;  3US6 A;  3C62 A;  3Q6M A;  4LDR A;  2BL2 A;  1A41 A;  1PD1 A;  2OJQ A;  2YEV A;  1LKX A;  1ZU4 A;  2NUT B;  3KYI A;  4JCH A;  4JJG A;  5DVW A;  3RQE A;  2R7T A;  3JRM O;  2MHR A;  2XL8 A;  1ORJ A;  1QLE C;  3B0P A;  3L0I A;  3OA1 A;  5D91 A;  5KYW A;  2OEX A;  3MLG A;  1OQC A;  3MBG A;  2LFF A;  3EQL F;  4IGG A;  5A6J A;  4YWQ A;  1NLX A;  5KYY A;  3SXM A;  3W8I A;  3N2Z B;  4J7T A;  3I5P A;  3HNK A;  5AGF A;  3NRH A;  3NKD A;  2HV7 A;  3RVZ A;  1J8M F;  3TOL A;  3U0C A;  3JT1 A;  4J30 B;  1C02 A;  2HKV A;  4N06 A;  3PDM P;  3B71 A;  4BJ6 A;  2KGO A;  4J7Y A;  1HE1 A;  4PFP A;  3JSE O;  3GM3 A;  5CI9 A;  2A6H F;  2A0B A;  4MND A;  4BJ5 C;  5KYX B;  2Y69 C;  1HW1 A;  3V7O A;  4CIH A;  2J7P D;  2R7V A;  1XZQ A;  1KNY A;  4B6I A;  1M2O A;  2GWW A;  1YVI A;  1I4Z A;  2OEV A;  3JRT A;  4JEA A;  5COM A;  5BUO A;  2P7V A;  1YA7 O;  3FXH A;  5T1D B;  3W2W A;  1RXQ A;  3AG3 C;  1AVO B;  3DJU B;  4MVR A;  3TD7 A;  4OIN F;  1SZI A;  2KK1 A;  3X1O A;  2R7X A;  1JR8 A;  3JCU Q;  3K33 A;  2CNW A;  5CIV A;  5FCL A;  3UGO A;  2F22 A;  2H7B A;  5KYW B;  4C3D A;  2NUP A;  1FR0 A;  3EHM A;  3U3B A;  4PAC A;  3M4B A;  3RW0 A;  4ONS A;  3GOR A;  5B3I A;  1EA8 A;  1ORY A;  1QVX A;  3NYL A;  2WL8 A;  1VOM A;  3LNM B;  4P9F A;  4AE4 B;  3O6X A;  3M79 A;  1HE9 A;  1O5H A;  3RF3 A;  3U9M A;  4JVS A;  1WOL A;  4JJF A;  4F4B A;  3K66 A;  2XRH A;  1SMY F;  4DOZ A;  4WGZ A;  3IQ6 A;  3ABK C;  4XQ1 A;  1EQ1 A;  3EG9 A;  4JZA A;  4BJ1 A;  2R03 A;  4DRJ B;  3B0U X;  3H65 A;  1IW7 F;  3B9Q A;  4LLC A;  4QI0 A;  1ZVZ A;  2KYH A;  3EH2 A;  1M56 C;  3GEH A;  5L0C A;  4QI2 A;  2LD6 A;  2QLA A;  2FFH A;  4DVZ A;  2XLE A;  2Q3T A;  3GWN A;  2IBF A;  1ZHZ A;  5F5F A;  4JE9 A;  3V5Y A;  5KYX A;  2XL4 A;  2ETS A;  4U5H A;  2AVK A;  1FAP B;  2WVO A;  2XSE A;  3F47 A;  1QQ3 A;  3GM1 A;  3K6B A;  4MS2 A;  5JP7 A;  2CW0 F;  2YL1 A;  3C8G D;  3DZA A;  1H9T A;  4NC3 A;  3T6B A;  3ZSU A;  4ZLC A;  2DI3 A;  3C18 A;  3IHU A;  3R2P A;  4DRH B;  4P9T A;  4YT8 A;  4CIP A;  1RCP A;  3HTK C;  3MYI A;  2YLG A;  2EPL X;  2KW3 C;  1YLM A;  4D4N A;  1O87 A;  4WAB A;  1QPU A;  3GAN A;  1JOG A;  1QSP A;  2YRF A;  3DM5 A;  3NMJ A;  5E2Q A;  3AQB A;  1V4A A;  2PBE A;  4ZLD A;  1RKC A;  1VYI A;  2CDQ A;  3WG7 C;  4NTB A;  5L0D A;  5L0I A;  4KNV A;  3EGD B;  3K1I C;  4WGY A;  4D4X A;  2EIN C;  2J46 A;  2YL3 A;  3DM9 B;  4RBN A;  3ZG1 A;  3DD7 A;  1L7C A;  4U9E A;  3U3F A;  5L3V A;  1TFK B;  1WAT A;  2RD9 A;  3DWW A;  3LAY A;  4O6Y A;  1LI5 A;  2E87 A;  1Z5Z A;  2D5R B;  1RMV A;  1KU2 A;  4CS7 A;  1H9G A;  1GM5 A;  2HV6 A;  3B29 A;  3CZ6 A;  5COG A;  1ZHY A;  3W2V A;  1ZHW A;  3EHN A;  1MND A;  1OKK D;  1XWJ A;  2MWQ A;  3Q7G A;  1KTM A;  5AC5 A;  4MVZ A;  2Y3D A;  1E84 A;  4Q5S F;  2Q9A A;  4I1O B;  4RD9 A;  1FTS A;  5B1B C;  4PJJ A;  4HEA J;  3CEX A;  4NTA A;  2A69 F;  2ZPA A;  3VAY A;  2J0W A;  3EG9 B;  1VTM P;  4GQH A;  1RJ9 B;  3L8I A;  5DS6 A;  3M1C B;  4DXW A;  4EBK A;  4DBQ A;  4MQ9 F;  4IAR A;  1ZW2 A;  3SZR A;  4AE4 A;  3LUT B;  1E85 A;  1RJ9 A;  2HMZ A;  1J8Y F;  1LS4 A;  2JD3 A;  3HKK A;  5TJ5 E;  3ZQY A;  5DS5 A;  2KC3 A;  3AG1 C;  3PCV A;  4OD4 A;  1JRA A;  5D92 A;  3ITF A;  3N0T A;  4BG0 A;  1Q0F A;  3ABL C;  2R7R A;  4MTG A;  3KPH A;  3K1H A;  4JC7 A;  4BEM J;  1K04 A;  4U5D E;  2R02 A;  4OIR F;  1QKR A;  1NFO A;  2LP4 A;  1M6T A;  1YA9 A;  3GEI A;  2Q9C A;  5L0F A;  1RKE B;  4PJN A;  1C17 M;  4XTK A;  1D1C A;  2GA0 A;  4CDY A;  1D0Z A;  1OCZ C;  5T3W A;  2I15 A;  2XLW A;  3U2M A;  4CJG A;  2KJG A;  3TJ6 A;  2W9Y A;  2H7V C;  3HJC A;  2JX0 A;  1D0Y A;  3KMI A;  4CS8 C;  3EPV A;  4C7O A;  1FFT C;  3C8G B;  1T6U A;  2L6F A;  3HNJ A;  2LFD A;  4XLP F;  3TUL A;  3LLI A;  3KL4 A;  3S27 A;  4FAP B;  2LQG A;  1LI7 A;  2R7U A;  4EHP A;  2V3C C;  2J45 A;  3AQC A;  3MX3 A;  2ZXO A;  4U5G A;  1U6H A;  4Z9J A;  3S28 A;  1NU7 D;  4HFF B;  2B0H A;  3ECS A;  3FOO A;  4KC9 A;  4MVU A;  1Q0G A;  4YN0 B;  2XLD A;  3L34 A;  3UGP A;  1OCC C;  4KBL A;  3Q6N A;  1VK5 A;  5COF A;  4BJ5 A;  3LLK A;  3NYJ A;  4E0I A;  3ZWI A;  2B0J A;  2YQY A;  1YAU O;  2YZS A;  5GPG B;  3GWL A;  3T6G B;  1LIH A;  2IYL D;  3QZC A;  1TKN A;  2HUJ A;  2YLD A;  1FFH A;  4N6H A;  3ASO C;  4EIY A;  3DMD A;  3FAP B;  4G7O F;  1LE4 A;  1ST6 A;  2GDC A;  1CGO A;  3HNI A;  4K0D A;  1ZHX A;  3WHN A;  1FMW A;  1MMN A;  3RQG A;  1UFB A;  2Y3B A;  3SXY A;  2HMQ A;  4EBB A;  4JKV A;  5A6A A;  3Q7L A;  3H2V A;  5CI8 A;  3ZTM A;  4CS8 A;  3FMS A;  4DVY P;  4L6R A;  1WTY A;  3LS1 A;  1Q0M A;  4JCZ A;  2JPU A;  1NZE A;  4R32 A;  2XXA A;  1D1B A;  1E83 A;  5FZT A;  3KH2 A;  1O3U A;  2QUP A;  4YT5 A;  2PFD A;  2WZL A;  1JPN A;  1TWG A;  2AP3 A;  2A1D D;  4IJJ A;  4P6I C;  2HZ8 A;  2H8A A;  4XEF A;  5A6B A;  1EKY A;  4MTO A;  4XEV A;  1DOV A;  3I4U A;  3B0V C;  3IPM O;  3GOD A;  5L0J A;  4H4K C;  5JS5 A;  5F28 E;  2ASR A;  1GQA A;  2DGJ A;  2H7O A;  2KNH A;  2IOQ A;  2W4M A;  3A11 A;  3QTH A;  4JUR I;  4XPX A;  2XM0 A;  4U5F E;  4MVM A;  2Q9B A;  3S84 A;  1OXB A;  1WWP A;  2VC9 A;  4AL0 A;  5JT4 A;  1U0B B;  2HFI A;  4EBJ A;  1HY5 A;  3AOU A;  2YL0 A;  3DE9 A;  1Z23 A;  4BJT A;  1Q0D A;  4G78 A;  5JLI A;  4BJ6 C;  1OXK A;  2L7A A;  1MMA A;  2WZG A;  3TOM A;  3NG1 A;  2M64 A;  5EK0 A;  1A7E A;  5B3S C;  2Z15 A;  3RFY A;  1ZU5 A;  3S29 A;  4AX2 A;  1WGW A;  1Z63 A;  2NG1 A;  3EGX A;  2AWC A;  3S0X A;  2Y39 A;  1OCO C;  2NPU A;  5E3A A;  5A69 A;  5K0I A;  3GM2 A;  3RKO F;  3NMI A;  3T6J A;  4N6C A;  1ORS C;  1TWC A;  3VM6 A;  4G7Z F;  2YL7 A;  4Q7C A;  1S05 A;  3O55 A;  1S7Z A;  2VAS A;  4O79 A;  3U9J A;  5JVE A;  2J8W A;  2WVQ A;  2YKZ A;  3QW1 A;  1SYQ A;  1OW8 A;  3RQF A;  3W8H A;  2J7P A;  2W45 A;  2XM4 A;  1NFN A;  2A6E F;  3EZI A;  4PJL A;  3VYW A;  2ZXP A;  1BR2 A;  4J32 B;  5B1A C;  1Z7Q c;  4JTC B;  4YL3 A;  3ZVR A;  3K7D A;  1ZYR F;  3NYM A;  3E9V A;  5KYN A;  5HV9 A;  1VB5 A;  1SR2 A;  5JSL A;  1HMD A;  1M2V B;  3BEH A;  4CJO A;  1T5O A;  2GFH A;  4DJ9 A;  3UMK A;  3VRC A;  5HSW A;  2CNW D;  3NKE A;  3OEO A;  4E7S A;  3ZQV A;  2YWA A;  4A4A A;  2LSE A;  1OCR C;  1D1A A;  1VLT A;  2IM8 A;  2V26 A;  3CQZ A;  3WAQ A;  2KQ9 A;  4K1O A;  2NUP B;  3NMK A;  3E70 C;  1MNE A;  2AWY A;  1VMA A;  2PP4 A;  4E18 A;  3RYL A;  2EIK C;  3PHF 2;  2GAQ A;  2XLO A;  4GEH A;  3SXZ A;  2VH3 A;  1Y6D A;  4IAO A;  2A68 F;  3OWT A;  4I3M A;  2L6H A;  4JTA B;  5E3C A;  3G50 A;  3EGD A;  3LEV A;  3FOP A;  4UDV A;  2R7W A;  3LES A;  5JRA A;  1I5N A;  2HSB A;  2XS1 A;  4ULV A;  4XWJ A;  4ANJ A;  4Z9H A;  2HS5 A;  2EPK X;  2P6V A;  2EIM C; 
#chains in the Genus database with same CATH homology
 1Q0G A;  3G4Z A;  1Q0M A;  1Q0D A;  3G4X A;  1T6U A;  1T6Q A;  1T6I A;  4NCQ A;  3G50 A;  1Q0K A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...