1T6IA

Nickel superoxide dismutase (nisod) apo structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 42
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6iA00
1T6IA 1Q0MA 4NCQA 1Q0KA 1Q0FA 3G4ZA 1T6UA 1Q0GA 1T6QA 3G50A 1Q0DA 3G4XA
chains in the Genus database with same CATH superfamily
1HY5A 2CYDA 2PBEA 2H7VC 4LDRA 3ZG1A 2Q9AA 1APCA 1EKYA 3V5ZA 3AGUA 3DZAA 3T6GB 2XLHA 2LK4A 2NUTA 3L8JA 3QZCA 1V4AA 3VYWA 1Z3IX 4QI0A 3U9MA 2WZLA 5L0CA 4EUKB 1OCRC 4O7GA 1TR2A 4MVZA 4IJJA 3EGXB 2DGJA 2J9VA 3EGDA 1M2VA 1H7IA 2XLDA 1NFOA 3EZHA 4YT4A 5JVEA 1RKEB 4HEAJ 4LDKA 1H9TA 4DRIB 3GWLA 3W8IA 1M2OA 3IQTA 4AL1A 5F28E 2VASA 5BQGA 5L0FA 2A0BA 3EH2A 3DKAA 5AGFA 5KYWB 1GS9A 2IYLD 3FAPB 3U2LA 1MMDA 1I5NA 3IPMO 2Y69C 2NUPA 4EBBA 2AWCA 2PF4E 2Q7RA 4XLPF 2EIKC 3POVA 2J9UA 4MNDA 1PV3A 2UUIA 1D1AA 1Q0GA 3DJUB 4PR9A 3S27A 4DOZA 1G5ZA 1ZHXA 1XZQA 2Q3TA 5JSLA 4KI2A 4O79A 1OR2A 1E2XA 1Z5ZA 1RXQA 2A6EF 2YQYA 2YL7A 3F47A 3PCVA 3T9OA 3O6XA 4FESA 1FMWA 3NYMA 4JRZA 4IAOA 4R32A 5A6KA 4U5EE 3MYFA 1YYXA 3U8PA 4EBJA 4OIOF 4P9FA 2Q4FA 2XM4A 2L9JA 3K7DA 2R7SA 4NC3A 1OW8A 3E9VA 4BJ5A 2R02A 5A6JA 1U89A 4H54A 4P6IC 4JURI 3VF0A 4C7OA 5A6AA 2M4EA 2L6HA 2CCYA 3SNHA 2XLEA 1Y4CA 4YN0B 5A69A 4JEAA 3FHDA 1OCZC 5FZTA 1CPRA 3IHUA 5K0IA 2R9RB 2P61A 4LERA 2VCBA 4IRUA 1F1MA 3HJCA 4PFPA 3ZTZA 1OW7A 2A68F 4CDYA 3VRCA 1GM5A 3FOPA 3HKKA 1H6GA 1VOMA 4O6NA 3AG3C 2LQGA 2L81A 1VYIA 3AJMA 1BR1A 2TMVP 4GYTA 2B0HA 2H7BA 1J8MF 4JC7A 3Q7GA 1LE2A 3UMKA 1OKKA 4EKWA 4C3EA 2WZFA 1E84A 1C03A 3HNLA 1OQCA 1V74B 4P9TA 4WGZA 3EPVA 2HUJA 2L7AA 1RKEA 5D92A 1DOVA 1C17M 2KQ9A 3B71A 4DBQA 1LI7A 3I4UA 3ZWIA 4FAPB 1ZZPA 2KK1A 3RVYA 4QI2A 3KKBA 4RBNA 2W45A 4IB4A 4YT5A 1ZW2A 5AC4A 5KYNA 3U5SA 5TJ5E 3RVZA 2QE9A 1BDJB 2WVOA 4A2NB 4CS8A 3UMIA 3LEVA 1HE9A 3R2PA 4J30B 4MQ9F 4N4WA 1C02A 3GM1A 1I4YA 4YWQA 1TFKB 4YL1A 2EPOA 3IQ5A 3UR3C 3U2MA 2YLIA 2HV6A 2H7OA 3IEEA 2R7TA 2HJMA 2FGYA 4WGYA 3S84A 1K04A 3GORA 4XEKA 5E33A 2ZPAA 2R7UA 4IGGA 2R7OA 5DVWA 4LLCA 2YL1A 1YZCA 2YVKA 3K1IC 3B29A 3JSEO 2AP3A 1VB5A 2LFDA 4HFFB 3JRMO 1RMVA 1U0BB 3DM9B 3MLGA 1K05A 2J7PA 3FDQA 3FXHA 3EH1A 4YL0A 3SEOA 3CQZA 4BEMJ 3ITFA 1ST6A 4K0DA 2J0XA 4KNWA 4CIHA 1AUEA 2IXPA 3LNRA 3WHNA 4BJTA 1NLXA 3UNGC 3TJ5A 3I5QA 3HNIA 4AX2A 2L6FA 4J32B 4NQFA 3G50A 4DJ9A 2UUHA 2MWQA 4A4AA 4E17A 2A69F 4GQHA 5BQIA 3S9OA 5EK0A 1RCPA 2ETSA 3LLIA 5DLJA 3DM5A 2VC9A 3W2WA 2M64A 2XLWA 4NTFA 4CSAC 2Q00A 3M79A 1R5ID 2NSGA 3DAGA 1FMVA 1M57C 4JIOA 2XM0A 3L34A 3LS1A 3U0CA 3ZSUA 1JR8A 1RJ9B 3NYJA 1FR0A 1BBHA 3TD7A 1S7ZA 3R7CA 4ULVA 3SXYA 2D5RB 2OCCC 4N6CA 4BPMA 1A41A 5HV9A 2BL2A 3NKEA 5DS6A 4X0RA 5EGYA 3DAFA 3S29A 3US6A 2OQMA 1FNTc 4ZLDA 3DD7A 2KYHA 1QPUA 3Q6NA 5E3CA 3TQOA 3N24A 2EILC 2BC5A 1YVIA 2HSBA 5E3AA 3J06A 4XPYA 2ICWG 2XLOA 5KYUB 3WG7C 1B68A 4H4KC 1TWHA 2IM8A 2ZXRA 1OKKD 3QVYA 1CGNA 4ONSA 1NSGB 2YHSA 2R7WA 2YWAA 3GEIA 2XRHA 2KJGA 3NRHA 2J0WA 2P7VA 4YL3A 4OINF 3FVYA 4J7YA 1HMDA 4MVOA 1M6TA 4AE4B 5FCLA 2RSEB 2Q9BA 4Q4ZF 5B1BC 3ABKC 1Z7Qc 3C8GA 3NG1A 4CJOA 4MW3A 2PNOA 2IBFA 2WL8A 2D4UA 4U9EA 3GM2A 1LIHA 2DYSC 3EQLF 1G4WR 1OR3A 1T9KA 2VCCA 3HNJA 2EPKX 3OWTA 4G7HF 1LKXA 1CGME 4YT8A 3EZIA 3LJBA 3LUTB 3L8IA 4U9DA 3TOLA 1R4TA 4BJ6C 2OOCA 4CIPA 2EIJC 1K40A 1A7DA 5JT4A 3CAXA 3ZTMA 2J9BA 2VH3A 5JRAA 1T6IA 1NU7D 4JZAA 1VK5A 3Q6MA 5T3WA 4YK5A 4YT2A 4Q5SF 1HW1A 5BUOA 3HNKA 1ORJA 3I5PA 3ZQVA 1YJGA 2V26A 2DI3A 2HFIA 3K1HA 5D91A 2L6GA 4E0IA 3EFOB 4XWJA 5B3SC 2J7PD 1EQ1A 3H2UA 1RJ9A 1YDIA 1RKCA 4BG0A 2R7RA 3ZDLA 4XQ1A 3N2ZB 1L7CA 3EHNA 4PFOA 4D4NA 3TULA 1O87A 2CW0F 4DBRA 2HJ3A 3N0TA 2QUPA 2R25A 2RD9A 4CBEA 5B3IA 2OG2A 4U5DE 3PHF2 4KC9A 4C3BA 3AG4C 2WVQA 4CJGA 1M56C 1OW6A 1YA9A 4I1OB 3B0UX 3SXZA 1Y6DA 3TJ6A 4W8PA 4U5GA 5L0JA 3EGXA 3SP1A 2XXAB 1ORSC 1TWGA 2OJQA 2QTVA 1WGWA 1O5HA 1LPEA 2VCAA 3HLZA 3JTLO 3W2VA 5KYUA 1VYKA 2OKUA 1G8XA 4JEBA 4PJNA 1TWCA 3M4CA 4IAQA 1D1BA 1TWAA 3KYJA 1AVOB 2Q9CA 1NZEA 5KYWA 3AOUA 5B1AC 1ZHTA 3JRTA 4EWCA 3JSZA 1A0BA 1KNYA 4JVSA 1JMWA 1PD1A 3IQCA 1D0ZA 5L0IA 1YLMA 3PMRA 4AE4A 2PX3A 1E83A 3LNMB 3PDMP 3UGOA 3ABLC 4JTCB 2GAQA 2HV7A 1EI7A 1QQ3A 256BA 1YZAA 3V7OA 1QSPA 5CI8A 4JTAB 4NY3A 4CDVA 1FAPB 3VAYA 3ATPA 2IXNA 3H65A 4OIQF 1MQVA 1I4ZA 3EHMA 3JZ0A 1VLTA 3K6BA 4MVUA 1WN0A 2KW3C 2PP4A 2MYSA 4U5FE 4MTOA 3ZQYA 2YZSA 4ZLCA 1ZHZA 2C04A 1WASA 4OIRF 2X0CA 3RFYA 3ZIBA 4JCZA 4E7SA 2NG1A 5JS5A 3SYNA 3C18A 3M4BA 2DB4A 4CX9A 3DI5A 3GODA 1T6QA 3A11A 3NMIA 4FX5A 4MVSA 1ORYA 3RYLA 1NBBA 1NU9C 4Q7CA 4CS9C 3LS0A 5IY5C 2F22A 1T5OA 2B0JA 2YLGA 1TQGA 2AVKA 3EGDB 4MVMA 2AWYA 3RF3A 3S28A 1M2VB 5A6BA 3C8GD 1VTMP 1V54C 2X51A 1ZW3A 5DQZA 3O39A 4O6MA 3MX3A 1WTYA 1SZIA 2EPLX 1LVKA 2P6VA 2Y3DA 4GEHA 3O10A 2KSFA 4XTKA 4PJLA 4HFKB 3NDBB 3SXKA 2E87A 2KGOA 3QVZA 4DVZA 2G3VA 1EA8A 1SYQA 1OCOC 2C03A 2J9WA 2BE5F 3K66A 2GDCA 1QKRA 5COFA 3K1IA 1XZPA 2P1AA 5F5FA 1LM3B 2XXAA 1WATA 2G3KA 5L0DA 4E18A 2XS1A 4BJ1A 3GEHA 5JUAA 3A9CA 4JCHA 4JKVA 1E86A 3U9JA 3AG2C 1OXBA 1JRAA 3G4ZA 1A7EA 2QLAA 1IZMA 2XLMA 3BEHA 3CSKA 1IW7F 3GEEA 3RQGA 3S0XA 1Q0KA 3O55A 1KU2A 2HMQA 2XL4A 3ECSA 4JE9A 2W4MA 2GFHA 1J8YF 2FFHA 1SF8A 3C63A 4OD4A 4D4XA 1TKNA 3ASNC 1OCCC 1ZU4A 1YARO 1FFHA 2LP4A 3FAJA 2YLDA 1MMNA 2J8WA 3C7JA 1ZU5A 3RQFA 4CSAA 3LESA 1ZVZA 2Y3BA 1Z63A 3ZC4A 5COGA 3RH3A 4F4BA 3JT1A 2WVNA 2Y3HA 2KC3A 3NMJA 4RDAA 3RKOF 4AK9A 3JYHA 3QTHA 1T01A 2ZXWC 3W4YA 2CNWA 2JX0A 3T4RA 2FAPB 3T6JA 4YJWA 1QZXA 3LLKA 3F46A 3VM6A 4PACA 4DRJB 2I8BA 4FWVA 1SR2A 1D0YA 3EJNA 4M63A 4WJ0A 3SZRA 2A1DD 2OJED 2Z15A 4JJFA 3WAQA 1JPNA 4MW8A 1GGQA 1T6UA 1TFOB 2YRFA 5T1DB 3KPHA 1JAFA 5DS5A 4LDQA 2XL8A 5L3QA 2LIGA 2LSEA 5CI9A 2KNHA 3KMIA 2WZGA 1LS1A 2JD3A 3B0VC 1ZYRF 2W9YA 3GM3A 3LAYA 1G4US 2IXOA 3MFNA 4BJ5C 5KYXB 4KNVA 3AQCA 3CEXA 1A7VA 2H8AA 5HSWA 2O9XA 1UFBA 3DWWA 4I3MA 3KL4A 4N06A 3X2QC 4EBKA 5CIVA 4L6RA 4NTBA 4LLEA 3V5YA 4C3DA 2IXMA 5JP7A 3T6BA 4OD5A 1HW2A 2OEVA 4EIYA 4U5CE 1V55C 4KBLA 3FMSA 4IWBA 1SMYF 5L0HA 1GQAA 1ZHWA 5COMA 4CDAA 3Q7LA 2NSFA 2LCHA 2XL6A 3V5XA 4ER9A 5A6BD 1S05A 4J7TA 2GWWA 4CS7A 3ASOC 4BJ6A 4JTDB 3S90A 4XPXA 4O6YA 2HKVA 3EG9B 4G78A 2HZ8A 1PCXA 1D0XA 1E85A 2AU5A 1Z6AA 2J46A 3LEOA 1JPJA 4AL0A 3TK0A 1Q0MA 2NPUA 3K33A 4XPWA 5E2QA 5T3TA 3KYIA 4E0HA 3OA1A 1MNDA 2P0NA 3H2VA 1BZ4A 1MMGA 4IARA 4MS2A 1Z23A 5GPGB 2Y39A 1FTSA 1NFNA 5EHHA 1BR2A 3AG1C 1HE1A 2J45A 2OU6A 3B9QA 3X1OA 1LI5A 1D1CA 2WB7A 3FOOA 3RIPA 2DYRC 4Z9HA 5DQTA 4U5HA 4MTGA 2ASRA 3B0PA 4PK4A 4CS8C 1BR4A 4Z9IA 5KYYB 5AC5A 4ANJA 2OEXA 3CZ6A 3MYIA 1PD0A 1DOWA 2Y3GA 2A6HF 1WWPA 4K7BA 4MVRA 4WABA 1CPQA 4G7ZF 3IQ6A 2LD6A 2ZD9A 3RQEA 2QNLA 3KH2A 3U3FA 4E7ZA 1VLSA 4MVQA 4W8KA 3JCUQ 4NTAA 2R7XA 4K1OA 2HSQA 4QDLA 3L0IA 5KYXA 2LFFA 2R05A 2PX0A 2YEVA 2XS8A 2A0UA 2EIMC 4XEFA 3U3BA 2EPNA 1WOLA 2VB6A 2NUTB 3JYYA 3M1CB 2YL0A 3QW0A 4PJJA 1U6HA 4U5BE 2CNWD 2G62A 3BRJA 3GANA 4LACB 3UGPA 3E70C 2HS5A 2XSEA 3AGTA 4JJGA 4PJMA 4I1MA 2I15A 3OEOA 4DXWA 3EFOA 4HE8D 3U8VA 1W2WA 2HMZA 4DRHB 2ZXOA 2R7VA 2EINC 1L3PA 2JPUA 4UDVA 4MTFA 1Q0FA 2R7QA 1CGOA 1LS4A 1XWJA 3ZVRA 2YKZA 3C62A 4JW1A 1Q0DA 3DMDA 4OIPF 3W8HA 3AQBA 2NUPB 5L0GA 3NYLA 4ULWA 1ZHYA 3EG9A 4DVYP 4RD9A 5JLIA 1YAUO 3NKDA 1N1CA 3L1MA 3SXMA 4G7OF 4I44A 3C8GB 1KTMA 4XEVA 4G0HA 3DJNB 2QY9A 4CS9A 1UG7A 1OXKA 1O3UA 2GA0A 4B6IA 1AEPA 2ZXPA 3DE9A 1MMAA 5F5HA 1FFTC 4Z9JA 5DS4A 5L3VA 3C8ZA 2CDQA 3QW1A 3DE8A 3MBGA 3TOMA 2CGEA 1LE4A 1NG1A 1QLEC 1HMOA 3NMKA 2YL3A 3WODF 3HTKC 2IOQA 4N6HA 2V3CC 2XLVA 2MHRA 3UMHA 5KYYA 1YA7O 1YYJA 3M15A 4BEJA 1MNEA 1VMAA 4C7OB 5BQHA 1JOGA 3DXJF 2W4BA 2EPMX 4NCQA 3RW0A 3ABMC 3QMKA 1QVXA 3GWNA 1H9GA 2PFDA 4EHPA 2R03A 3G4XA 4XLNF
chains in the Genus database with same CATH topology
1T6IA 1Q0MA 4NCQA 1Q0KA 1Q0FA 3G4ZA 1T6UA 1Q0GA 1T6QA 3G50A 1Q0DA 3G4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6I A;  1Q0M A;  4NCQ A;  1Q0K A;  1Q0F A;  3G4Z A;  1T6U A;  1Q0G A;  1T6Q A;  3G50 A;  1Q0D A;  3G4X A; 
#chains in the Genus database with same CATH topology
 1HY5 A;  2CYD A;  2PBE A;  2H7V C;  4LDR A;  3ZG1 A;  2Q9A A;  1APC A;  1EKY A;  3V5Z A;  3AGU A;  3DZA A;  3T6G B;  2XLH A;  2LK4 A;  2NUT A;  3L8J A;  3QZC A;  1V4A A;  3VYW A;  1Z3I X;  4QI0 A;  3U9M A;  2WZL A;  5L0C A;  4EUK B;  1OCR C;  4O7G A;  1TR2 A;  4MVZ A;  4IJJ A;  3EGX B;  2DGJ A;  2J9V A;  3EGD A;  1M2V A;  1H7I A;  2XLD A;  1NFO A;  3EZH A;  4YT4 A;  5JVE A;  1RKE B;  4HEA J;  4LDK A;  1H9T A;  4DRI B;  3GWL A;  3W8I A;  1M2O A;  3IQT A;  4AL1 A;  5F28 E;  2VAS A;  5BQG A;  5L0F A;  2A0B A;  3EH2 A;  3DKA A;  5AGF A;  5KYW B;  1GS9 A;  2IYL D;  3FAP B;  3U2L A;  1MMD A;  1I5N A;  3IPM O;  2Y69 C;  2NUP A;  4EBB A;  2AWC A;  2PF4 E;  2Q7R A;  4XLP F;  2EIK C;  3POV A;  2J9U A;  4MND A;  1PV3 A;  2UUI A;  1D1A A;  1Q0G A;  3DJU B;  4PR9 A;  3S27 A;  4DOZ A;  1G5Z A;  1ZHX A;  1XZQ A;  2Q3T A;  5JSL A;  4KI2 A;  4O79 A;  1OR2 A;  1E2X A;  1Z5Z A;  1RXQ A;  2A6E F;  2YQY A;  2YL7 A;  3F47 A;  3PCV A;  3T9O A;  3O6X A;  4FES A;  1FMW A;  3NYM A;  4JRZ A;  4IAO A;  4R32 A;  5A6K A;  4U5E E;  3MYF A;  1YYX A;  3U8P A;  4EBJ A;  4OIO F;  4P9F A;  2Q4F A;  2XM4 A;  2L9J A;  3K7D A;  2R7S A;  4NC3 A;  1OW8 A;  3E9V A;  4BJ5 A;  2R02 A;  5A6J A;  1U89 A;  4H54 A;  4P6I C;  4JUR I;  3VF0 A;  4C7O A;  5A6A A;  2M4E A;  2L6H A;  2CCY A;  3SNH A;  2XLE A;  1Y4C A;  4YN0 B;  5A69 A;  4JEA A;  3FHD A;  1OCZ C;  5FZT A;  1CPR A;  3IHU A;  5K0I A;  2R9R B;  2P61 A;  4LER A;  2VCB A;  4IRU A;  1F1M A;  3HJC A;  4PFP A;  3ZTZ A;  1OW7 A;  2A68 F;  4CDY A;  3VRC A;  1GM5 A;  3FOP A;  3HKK A;  1H6G A;  1VOM A;  4O6N A;  3AG3 C;  2LQG A;  2L81 A;  1VYI A;  3AJM A;  1BR1 A;  2TMV P;  4GYT A;  2B0H A;  2H7B A;  1J8M F;  4JC7 A;  3Q7G A;  1LE2 A;  3UMK A;  1OKK A;  4EKW A;  4C3E A;  2WZF A;  1E84 A;  1C03 A;  3HNL A;  1OQC A;  1V74 B;  4P9T A;  4WGZ A;  3EPV A;  2HUJ A;  2L7A A;  1RKE A;  5D92 A;  1DOV A;  1C17 M;  2KQ9 A;  3B71 A;  4DBQ A;  1LI7 A;  3I4U A;  3ZWI A;  4FAP B;  1ZZP A;  2KK1 A;  3RVY A;  4QI2 A;  3KKB A;  4RBN A;  2W45 A;  4IB4 A;  4YT5 A;  1ZW2 A;  5AC4 A;  5KYN A;  3U5S A;  5TJ5 E;  3RVZ A;  2QE9 A;  1BDJ B;  2WVO A;  4A2N B;  4CS8 A;  3UMI A;  3LEV A;  1HE9 A;  3R2P A;  4J30 B;  4MQ9 F;  4N4W A;  1C02 A;  3GM1 A;  1I4Y A;  4YWQ A;  1TFK B;  4YL1 A;  2EPO A;  3IQ5 A;  3UR3 C;  3U2M A;  2YLI A;  2HV6 A;  2H7O A;  3IEE A;  2R7T A;  2HJM A;  2FGY A;  4WGY A;  3S84 A;  1K04 A;  3GOR A;  4XEK A;  5E33 A;  2ZPA A;  2R7U A;  4IGG A;  2R7O A;  5DVW A;  4LLC A;  2YL1 A;  1YZC A;  2YVK A;  3K1I C;  3B29 A;  3JSE O;  2AP3 A;  1VB5 A;  2LFD A;  4HFF B;  3JRM O;  1RMV A;  1U0B B;  3DM9 B;  3MLG A;  1K05 A;  2J7P A;  3FDQ A;  3FXH A;  3EH1 A;  4YL0 A;  3SEO A;  3CQZ A;  4BEM J;  3ITF A;  1ST6 A;  4K0D A;  2J0X A;  4KNW A;  4CIH A;  1AUE A;  2IXP A;  3LNR A;  3WHN A;  4BJT A;  1NLX A;  3UNG C;  3TJ5 A;  3I5Q A;  3HNI A;  4AX2 A;  2L6F A;  4J32 B;  4NQF A;  3G50 A;  4DJ9 A;  2UUH A;  2MWQ A;  4A4A A;  4E17 A;  2A69 F;  4GQH A;  5BQI A;  3S9O A;  5EK0 A;  1RCP A;  2ETS A;  3LLI A;  5DLJ A;  3DM5 A;  2VC9 A;  3W2W A;  2M64 A;  2XLW A;  4NTF A;  4CSA C;  2Q00 A;  3M79 A;  1R5I D;  2NSG A;  3DAG A;  1FMV A;  1M57 C;  4JIO A;  2XM0 A;  3L34 A;  3LS1 A;  3U0C A;  3ZSU A;  1JR8 A;  1RJ9 B;  3NYJ A;  1FR0 A;  1BBH A;  3TD7 A;  1S7Z A;  3R7C A;  4ULV A;  3SXY A;  2D5R B;  2OCC C;  4N6C A;  4BPM A;  1A41 A;  5HV9 A;  2BL2 A;  3NKE A;  5DS6 A;  4X0R A;  5EGY A;  3DAF A;  3S29 A;  3US6 A;  2OQM A;  1FNT c;  4ZLD A;  3DD7 A;  2KYH A;  1QPU A;  3Q6N A;  5E3C A;  3TQO A;  3N24 A;  2EIL C;  2BC5 A;  1YVI A;  2HSB A;  5E3A A;  3J06 A;  4XPY A;  2ICW G;  2XLO A;  5KYU B;  3WG7 C;  1B68 A;  4H4K C;  1TWH A;  2IM8 A;  2ZXR A;  1OKK D;  3QVY A;  1CGN A;  4ONS A;  1NSG B;  2YHS A;  2R7W A;  2YWA A;  3GEI A;  2XRH A;  2KJG A;  3NRH A;  2J0W A;  2P7V A;  4YL3 A;  4OIN F;  3FVY A;  4J7Y A;  1HMD A;  4MVO A;  1M6T A;  4AE4 B;  5FCL A;  2RSE B;  2Q9B A;  4Q4Z F;  5B1B C;  3ABK C;  1Z7Q c;  3C8G A;  3NG1 A;  4CJO A;  4MW3 A;  2PNO A;  2IBF A;  2WL8 A;  2D4U A;  4U9E A;  3GM2 A;  1LIH A;  2DYS C;  3EQL F;  1G4W R;  1OR3 A;  1T9K A;  2VCC A;  3HNJ A;  2EPK X;  3OWT A;  4G7H F;  1LKX A;  1CGM E;  4YT8 A;  3EZI A;  3LJB A;  3LUT B;  3L8I A;  4U9D A;  3TOL A;  1R4T A;  4BJ6 C;  2OOC A;  4CIP A;  2EIJ C;  1K40 A;  1A7D A;  5JT4 A;  3CAX A;  3ZTM A;  2J9B A;  2VH3 A;  5JRA A;  1T6I A;  1NU7 D;  4JZA A;  1VK5 A;  3Q6M A;  5T3W A;  4YK5 A;  4YT2 A;  4Q5S F;  1HW1 A;  5BUO A;  3HNK A;  1ORJ A;  3I5P A;  3ZQV A;  1YJG A;  2V26 A;  2DI3 A;  2HFI A;  3K1H A;  5D91 A;  2L6G A;  4E0I A;  3EFO B;  4XWJ A;  5B3S C;  2J7P D;  1EQ1 A;  3H2U A;  1RJ9 A;  1YDI A;  1RKC A;  4BG0 A;  2R7R A;  3ZDL A;  4XQ1 A;  3N2Z B;  1L7C A;  3EHN A;  4PFO A;  4D4N A;  3TUL A;  1O87 A;  2CW0 F;  4DBR A;  2HJ3 A;  3N0T A;  2QUP A;  2R25 A;  2RD9 A;  4CBE A;  5B3I A;  2OG2 A;  4U5D E;  3PHF 2;  4KC9 A;  4C3B A;  3AG4 C;  2WVQ A;  4CJG A;  1M56 C;  1OW6 A;  1YA9 A;  4I1O B;  3B0U X;  3SXZ A;  1Y6D A;  3TJ6 A;  4W8P A;  4U5G A;  5L0J A;  3EGX A;  3SP1 A;  2XXA B;  1ORS C;  1TWG A;  2OJQ A;  2QTV A;  1WGW A;  1O5H A;  1LPE A;  2VCA A;  3HLZ A;  3JTL O;  3W2V A;  5KYU A;  1VYK A;  2OKU A;  1G8X A;  4JEB A;  4PJN A;  1TWC A;  3M4C A;  4IAQ A;  1D1B A;  1TWA A;  3KYJ A;  1AVO B;  2Q9C A;  1NZE A;  5KYW A;  3AOU A;  5B1A C;  1ZHT A;  3JRT A;  4EWC A;  3JSZ A;  1A0B A;  1KNY A;  4JVS A;  1JMW A;  1PD1 A;  3IQC A;  1D0Z A;  5L0I A;  1YLM A;  3PMR A;  4AE4 A;  2PX3 A;  1E83 A;  3LNM B;  3PDM P;  3UGO A;  3ABL C;  4JTC B;  2GAQ A;  2HV7 A;  1EI7 A;  1QQ3 A;  256B A;  1YZA A;  3V7O A;  1QSP A;  5CI8 A;  4JTA B;  4NY3 A;  4CDV A;  1FAP B;  3VAY A;  3ATP A;  2IXN A;  3H65 A;  4OIQ F;  1MQV A;  1I4Z A;  3EHM A;  3JZ0 A;  1VLT A;  3K6B A;  4MVU A;  1WN0 A;  2KW3 C;  2PP4 A;  2MYS A;  4U5F E;  4MTO A;  3ZQY A;  2YZS A;  4ZLC A;  1ZHZ A;  2C04 A;  1WAS A;  4OIR F;  2X0C A;  3RFY A;  3ZIB A;  4JCZ A;  4E7S A;  2NG1 A;  5JS5 A;  3SYN A;  3C18 A;  3M4B A;  2DB4 A;  4CX9 A;  3DI5 A;  3GOD A;  1T6Q A;  3A11 A;  3NMI A;  4FX5 A;  4MVS A;  1ORY A;  3RYL A;  1NBB A;  1NU9 C;  4Q7C A;  4CS9 C;  3LS0 A;  5IY5 C;  2F22 A;  1T5O A;  2B0J A;  2YLG A;  1TQG A;  2AVK A;  3EGD B;  4MVM A;  2AWY A;  3RF3 A;  3S28 A;  1M2V B;  5A6B A;  3C8G D;  1VTM P;  1V54 C;  2X51 A;  1ZW3 A;  5DQZ A;  3O39 A;  4O6M A;  3MX3 A;  1WTY A;  1SZI A;  2EPL X;  1LVK A;  2P6V A;  2Y3D A;  4GEH A;  3O10 A;  2KSF A;  4XTK A;  4PJL A;  4HFK B;  3NDB B;  3SXK A;  2E87 A;  2KGO A;  3QVZ A;  4DVZ A;  2G3V A;  1EA8 A;  1SYQ A;  1OCO C;  2C03 A;  2J9W A;  2BE5 F;  3K66 A;  2GDC A;  1QKR A;  5COF A;  3K1I A;  1XZP A;  2P1A A;  5F5F A;  1LM3 B;  2XXA A;  1WAT A;  2G3K A;  5L0D A;  4E18 A;  2XS1 A;  4BJ1 A;  3GEH A;  5JUA A;  3A9C A;  4JCH A;  4JKV A;  1E86 A;  3U9J A;  3AG2 C;  1OXB A;  1JRA A;  3G4Z A;  1A7E A;  2QLA A;  1IZM A;  2XLM A;  3BEH A;  3CSK A;  1IW7 F;  3GEE A;  3RQG A;  3S0X A;  1Q0K A;  3O55 A;  1KU2 A;  2HMQ A;  2XL4 A;  3ECS A;  4JE9 A;  2W4M A;  2GFH A;  1J8Y F;  2FFH A;  1SF8 A;  3C63 A;  4OD4 A;  4D4X A;  1TKN A;  3ASN C;  1OCC C;  1ZU4 A;  1YAR O;  1FFH A;  2LP4 A;  3FAJ A;  2YLD A;  1MMN A;  2J8W A;  3C7J A;  1ZU5 A;  3RQF A;  4CSA A;  3LES A;  1ZVZ A;  2Y3B A;  1Z63 A;  3ZC4 A;  5COG A;  3RH3 A;  4F4B A;  3JT1 A;  2WVN A;  2Y3H A;  2KC3 A;  3NMJ A;  4RDA A;  3RKO F;  4AK9 A;  3JYH A;  3QTH A;  1T01 A;  2ZXW C;  3W4Y A;  2CNW A;  2JX0 A;  3T4R A;  2FAP B;  3T6J A;  4YJW A;  1QZX A;  3LLK A;  3F46 A;  3VM6 A;  4PAC A;  4DRJ B;  2I8B A;  4FWV A;  1SR2 A;  1D0Y A;  3EJN A;  4M63 A;  4WJ0 A;  3SZR A;  2A1D D;  2OJE D;  2Z15 A;  4JJF A;  3WAQ A;  1JPN A;  4MW8 A;  1GGQ A;  1T6U A;  1TFO B;  2YRF A;  5T1D B;  3KPH A;  1JAF A;  5DS5 A;  4LDQ A;  2XL8 A;  5L3Q A;  2LIG A;  2LSE A;  5CI9 A;  2KNH A;  3KMI A;  2WZG A;  1LS1 A;  2JD3 A;  3B0V C;  1ZYR F;  2W9Y A;  3GM3 A;  3LAY A;  1G4U S;  2IXO A;  3MFN A;  4BJ5 C;  5KYX B;  4KNV A;  3AQC A;  3CEX A;  1A7V A;  2H8A A;  5HSW A;  2O9X A;  1UFB A;  3DWW A;  4I3M A;  3KL4 A;  4N06 A;  3X2Q C;  4EBK A;  5CIV A;  4L6R A;  4NTB A;  4LLE A;  3V5Y A;  4C3D A;  2IXM A;  5JP7 A;  3T6B A;  4OD5 A;  1HW2 A;  2OEV A;  4EIY A;  4U5C E;  1V55 C;  4KBL A;  3FMS A;  4IWB A;  1SMY F;  5L0H A;  1GQA A;  1ZHW A;  5COM A;  4CDA A;  3Q7L A;  2NSF A;  2LCH A;  2XL6 A;  3V5X A;  4ER9 A;  5A6B D;  1S05 A;  4J7T A;  2GWW A;  4CS7 A;  3ASO C;  4BJ6 A;  4JTD B;  3S90 A;  4XPX A;  4O6Y A;  2HKV A;  3EG9 B;  4G78 A;  2HZ8 A;  1PCX A;  1D0X A;  1E85 A;  2AU5 A;  1Z6A A;  2J46 A;  3LEO A;  1JPJ A;  4AL0 A;  3TK0 A;  1Q0M A;  2NPU A;  3K33 A;  4XPW A;  5E2Q A;  5T3T A;  3KYI A;  4E0H A;  3OA1 A;  1MND A;  2P0N A;  3H2V A;  1BZ4 A;  1MMG A;  4IAR A;  4MS2 A;  1Z23 A;  5GPG B;  2Y39 A;  1FTS A;  1NFN A;  5EHH A;  1BR2 A;  3AG1 C;  1HE1 A;  2J45 A;  2OU6 A;  3B9Q A;  3X1O A;  1LI5 A;  1D1C A;  2WB7 A;  3FOO A;  3RIP A;  2DYR C;  4Z9H A;  5DQT A;  4U5H A;  4MTG A;  2ASR A;  3B0P A;  4PK4 A;  4CS8 C;  1BR4 A;  4Z9I A;  5KYY B;  5AC5 A;  4ANJ A;  2OEX A;  3CZ6 A;  3MYI A;  1PD0 A;  1DOW A;  2Y3G A;  2A6H F;  1WWP A;  4K7B A;  4MVR A;  4WAB A;  1CPQ A;  4G7Z F;  3IQ6 A;  2LD6 A;  2ZD9 A;  3RQE A;  2QNL A;  3KH2 A;  3U3F A;  4E7Z A;  1VLS A;  4MVQ A;  4W8K A;  3JCU Q;  4NTA A;  2R7X A;  4K1O A;  2HSQ A;  4QDL A;  3L0I A;  5KYX A;  2LFF A;  2R05 A;  2PX0 A;  2YEV A;  2XS8 A;  2A0U A;  2EIM C;  4XEF A;  3U3B A;  2EPN A;  1WOL A;  2VB6 A;  2NUT B;  3JYY A;  3M1C B;  2YL0 A;  3QW0 A;  4PJJ A;  1U6H A;  4U5B E;  2CNW D;  2G62 A;  3BRJ A;  3GAN A;  4LAC B;  3UGP A;  3E70 C;  2HS5 A;  2XSE A;  3AGT A;  4JJG A;  4PJM A;  4I1M A;  2I15 A;  3OEO A;  4DXW A;  3EFO A;  4HE8 D;  3U8V A;  1W2W A;  2HMZ A;  4DRH B;  2ZXO A;  2R7V A;  2EIN C;  1L3P A;  2JPU A;  4UDV A;  4MTF A;  1Q0F A;  2R7Q A;  1CGO A;  1LS4 A;  1XWJ A;  3ZVR A;  2YKZ A;  3C62 A;  4JW1 A;  1Q0D A;  3DMD A;  4OIP F;  3W8H A;  3AQB A;  2NUP B;  5L0G A;  3NYL A;  4ULW A;  1ZHY A;  3EG9 A;  4DVY P;  4RD9 A;  5JLI A;  1YAU O;  3NKD A;  1N1C A;  3L1M A;  3SXM A;  4G7O F;  4I44 A;  3C8G B;  1KTM A;  4XEV A;  4G0H A;  3DJN B;  2QY9 A;  4CS9 A;  1UG7 A;  1OXK A;  1O3U A;  2GA0 A;  4B6I A;  1AEP A;  2ZXP A;  3DE9 A;  1MMA A;  5F5H A;  1FFT C;  4Z9J A;  5DS4 A;  5L3V A;  3C8Z A;  2CDQ A;  3QW1 A;  3DE8 A;  3MBG A;  3TOM A;  2CGE A;  1LE4 A;  1NG1 A;  1QLE C;  1HMO A;  3NMK A;  2YL3 A;  3WOD F;  3HTK C;  2IOQ A;  4N6H A;  2V3C C;  2XLV A;  2MHR A;  3UMH A;  5KYY A;  1YA7 O;  1YYJ A;  3M15 A;  4BEJ A;  1MNE A;  1VMA A;  4C7O B;  5BQH A;  1JOG A;  3DXJ F;  2W4B A;  2EPM X;  4NCQ A;  3RW0 A;  3ABM C;  3QMK A;  1QVX A;  3GWN A;  1H9G A;  2PFD A;  4EHP A;  2R03 A;  3G4X A;  4XLN F; 
#chains in the Genus database with same CATH homology
 1T6I A;  1Q0M A;  4NCQ A;  1Q0K A;  1Q0F A;  3G4Z A;  1T6U A;  1Q0G A;  1T6Q A;  3G50 A;  1Q0D A;  3G4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...