1T6IA

Nickel superoxide dismutase (nisod) apo structure
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
111
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 42
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6iA00
1T6QA 3G4ZA 4NCQA 1T6UA 1Q0MA 1T6IA 1Q0GA 3G50A 3G4XA 1Q0FA 1Q0DA 1Q0KA
chains in the Genus database with same CATH superfamily
1RKEA 3K33A 2AVKA 3EGDB 2KSFA 1SZIA 3ECSA 5B1AC 3NDBB 3ZTMA 2KYHA 2LP4A 1LIHA 3C7JA 2YLDA 3IQCA 3FAPB 3HJCA 3VAYA 2KGOA 1I4YA 4IGGA 5KYUB 3JYYA 2R03A 1D0ZA 1QVXA 1VLSA 2YRFA 3H2VA 2HMQA 4XQ1A 3M1CB 3NKEA 2F22A 1RKEB 4HFKB 5F5HA 1M2OA 5KYYB 3MYIA 2R25A 3L1MA 4G7HF 3LEOA 4JIOA 3NKDA 1TWAA 2J7PD 1QSPA 4MS2A 4OD5A 1C02A 3EG9B 4G0HA 1YJGA 3HNKA 4AE4B 2XLOA 4NCQA 3EHNA 1RMVA 2EIKC 2HS5A 4MTOA 3K7DA 1GGQA 1H7IA 4F4BA 3RQEA 1M56C 1MMNA 4Q7CA 2P61A 1TFKB 3PMRA 4PJLA 3DAGA 3M4CA 2L6GA 4O6YA 1O5HA 3T6BA 5L3QA 3O10A 3LNMB 2PX3A 2QNLA 1QLEC 4XWJA 1TWHA 2XRHA 4AL1A 4D4XA 5JVEA 3FOOA 1T9KA 5GPGB 4ULVA 3MFNA 3UGPA 2XM0A 4MQ9F 4EWCA 1HY5A 3E70C 3LNRA 2J9UA 1MMAA 2BL2A 4O79A 2YLIA 3NRHA 5DS6A 3ZDLA 2LK4A 3L0IA 4BJTA 1NBBA 2C04A 2IXOA 1PD0A 3QW1A 1CGNA 1BR4A 4WGYA 3BEHA 3DJNB 3TD7A 3RF3A 1SF8A 1SR2A 2OEXA 2DI3A 2XS8A 3AG4C 3FAJA 4O7GA 3SNHA 3TQOA 2R7SA 2W9YA 1VB5A 1NSGB 4CJGA 1S7ZA 1LPEA 1YDIA 2CGEA 2EPMX 3IQ6A 4NTFA 2W4MA 2HUJA 3DE8A 2HSQA 1D1BA 3MYFA 3T6GB 2Y3BA 2Y69C 3WG7C 4NTAA 3GORA 3ABKC 2YKZA 2MHRA 2YL1A 1JPNA 3Q6MA 1OR2A 3U8VA 2ZPAA 4PR9A 1D0YA 2EILC 3R7CA 4E7ZA 2AU5A 3I5PA 3JRMO 4JRZA 1V4AA 4JTDB 1GQAA 2AP3A 4JURI 1H9GA 3ZG1A 3U3FA 5BQIA 2CDQA 5CI8A 1YA9A 3AG1C 4GEHA 4IJJA 1D1AA 2H8AA 1FMVA 3DI5A 2Q00A 5L3VA 2RD9A 3CEXA 1T5OA 3FDQA 2P0NA 3V5YA 1OQCA 3FHDA 2L6FA 2OOCA 4J7TA 4Z9HA 5JUAA 1OCZC 4E7SA 1ZHTA 4FWVA 2GFHA 2YEVA 2WVOA 2CCYA 3DXJF 5COMA 3FVYA 1YARO 2EPKX 3SXKA 3EH2A 3W2WA 5DS4A 4CSAA 3W8IA 2R7RA 3WAQA 4I44A 5L0CA 4G78A 2YVKA 3GANA 4KNWA 3PCVA 4ER9A 4A4AA 1YLMA 1AUEA 1MMDA 2LFDA 3B0VC 1K40A 3PHF2 1U6HA 1KU2A 3ZQVA 2OJED 4U5BE 1T6IA 4HEAJ 2A0UA 2GWWA 2LD6A 4LLEA 2XLDA 4CS8C 1Q0GA 4EUKB 2H7BA 2XXAA 3NG1A 1OCCC 2NSFA 2QTVA 1RJ9B 1WTYA 3CSKA 3EH1A 1FTSA 4JJFA 4NTBA 5DLJA 1JR8A 4JVSA 3RW0A 2ZD9A 3LLKA 5L0IA 3ZIBA 2HV6A 4K1OA 3O55A 1JRAA 2A69F 2EIMC 4PJJA 1IZMA 2CNWA 2J0WA 4YT2A 4C7OA 1WGWA 1BDJB 3QVZA 1YA7O 4YN0B 4BJ6A 3ZQYA 4QI2A 2J9VA 3EZHA 2XXAB 3B71A 1RJ9A 5F5FA 2PF4E 2XL8A 3U8PA 3CQZA 3DD7A 4JZAA 1MMGA 1OR3A 1VLTA 1ST6A 1XWJA 2HSBA 2PX0A 2Q7RA 3U5SA 2OEVA 3LAYA 1L7CA 2ETSA 3HNJA 4LDQA 4X0RA 1DOWA 1LS4A 4O6NA 3U3BA 4N6CA 4BJ6C 2OJQA 1ZU5A 3GODA 3RQGA 4E18A 2NPUA 1MNEA 4WABA 3S29A 3QZCA 1E85A 1HMDA 2J8WA 4C3EA 1Q0DA 3N0TA 2Q9AA 1H9TA 3LS1A 2ASRA 2ZXWC 4LDKA 1EI7A 1Q0MA 3AGUA 3EG9A 1OCRC 2YZSA 2PBEA 2CW0F 3JSEO 4XEKA 4AE4A 4E0IA 4DVYP 5KYXB 2MWQA 3AOUA 3NYLA 1T01A 2A1DD 3R2PA 4FX5A 3SEOA 3Q7LA 1HMOA 3FMSA 3TK0A 3W2VA 4D4NA 1E84A 5DS5A 2J0XA 4FESA 4XPYA 3L8JA 4O6MA 4MVSA 1VYKA 4MVQA 3KH2A 1ORYA 5COGA 5EK0A 1OXBA 2WZGA 4JTCB 3G4ZA 3KKBA 1G5ZA 1N1CA 1OW6A 3B29A 4MVRA 3RVYA 3I5QA 4AX2A 3GEEA 3IPMO 1DOVA 3GM1A 4K0DA 5KYXA 4BJ5C 4Q5SF 3G4XA 4JEAA 3EZIA 1CPQA 2R05A 4OD4A 4ZLDA 2NUTB 2YL7A 3GWNA 4I1MA 2B0HA 3OWTA 2XS1A 2VCAA 3C8ZA 5B1BC 1A7EA 1NU7D 1EA8A 3NYJA 3SYNA 3DMDA 1RXQA 2I8BA 2NG1A 3PDMP 4MVOA 4IARA 1JOGA 3Q7GA 1JMWA 4U9DA 5T3TA 1ZU4A 3W4YA 3TOLA 1JAFA 4BJ1A 4P6IC 1Z7Qc 5KYWB 1E83A 2WB7A 1TWCA 2OU6A 1ZVZA 1WATA 2I15A 4KBLA 2PNOA 5L0FA 1MNDA 4LACB 4N6HA 4YT8A 3RYLA 5CIVA 5JS5A 1A41A 3U9MA 2X0CA 3DM9B 1K04A 2ICWG 3SP1A 2XM4A 3A9CA 3QMKA 4YK5A 1UFBA 2KQ9A 2Q3TA 2XLWA 4JJGA 1A7VA 4BEMJ 3F47A 2XL6A 1UG7A 3DWWA 3UNGC 4P9TA 1FAPB 3VF0A 4DRIB 2O9XA 5KYYA 2CNWD 2FAPB 1GM5A 2GDCA 2IYLD 1G8XA 4XPWA 3X2QC 2J45A 3LLIA 1GS9A 1LE2A 1APCA 4LDRA 4ONSA 2B0JA 2D5RB 2KC3A 3Q6NA 4U5FE 4JC7A 3SXMA 3SXYA 5JT4A 5L0DA 3RKOF 2IXNA 3EJNA 3NMIA 5AC5A 2HZ8A 3J06A 2H7VC 3LJBA 1QQ3A 5A6KA 4JKVA 2VB6A 1B68A 4WJ0A 4CIPA 4UDVA 3ZC4A 1O87A 1Z23A 4W8KA 3EHMA 2KK1A 4WGZA 1QPUA 1JPJA 1F1MA 2WZLA 3BRJA 3HTKC 1G4WR 2A6EF 3S28A 2V26A 2RSEB 1ORSC 4PJMA 4YL0A 3K1IA 3HNLA 1HW2A 4XEVA 1M2VB 1E86A 3O6XA 5BUOA 5E33A 1NLXA 1BBHA 4KI2A 4E17A 1LS1A 3U0CA 1U0BB 3T9OA 2LIGA 3O39A 4RD9A 4EBBA 1U89A 2D4UA 2Y3GA 3TJ6A 4CS7A 3HNIA 4RDAA 3LUTB 4BEJA 4I3MA 5COFA 1M2VA 1VYIA 2XLMA 3T6JA 4XLPF 5FCLA 2DYSC 1Y4CA 5B3IA 5L0HA 4CSAC 2KJGA 2HJ3A 2XLHA 3A11A 4J30B 2IM8A 4YT4A 1EKYA 1J8MF 4XTKA 3RQFA 4CDAA 1W2WA 3EFOB 2R7XA 5A69A 2IBFA 3E9VA 4NY3A 4G7OF 4AL0A 4IRUA 1I4ZA 3TULA 2XSEA 4OIPF 1CPRA 4A2NB 4NC3A 4B6IA 3X1OA 4DJ9A 3F46A 2FGYA 4DBQA 1EQ1A 1LE4A 1YZCA 1G4US 2XL4A 1BR1A 1ZHWA 4R32A 3CZ6A 2Q9CA 2LCHA 3HLZA 4P9FA 3UMIA 5AC4A 2V3CC 1C03A 2JX0A 4OIQF 4MW8A 5E3AA 3ABMC 2AWYA 1Y6DA 3K1HA 4U5GA 3ZTZA 4RBNA 4JE9A 1AEPA 2UUIA 2EPLX 3B0PA 3DE9A 4U5DE 3RVZA 3B0UX 2HFIA 3C62A 5K0IA 1SYQA 1CGME 2OQMA 1V54C 4MVMA 4NQFA 5D92A 3ZWIA 4ZLCA 3DM5A 3DAFA 4CIHA 4JEBA 4BPMA 2LSEA 1SMYF 2WVQA 3U2LA 2VCCA 2QUPA 1QKRA 3JTLO 3ATPA 1V74B 4QI0A 3ZSUA 4U9EA 2A68F 3POVA 3DKAA 4Z9JA 5CI9A 3EPVA 2P6VA 2C03A 1OKKD 1A7DA 2Y3HA 1HE1A 2P1AA 3RH3A 1LI5A 1PV3A 1CGOA 2NUTA 3ASOC 3MX3A 1I5NA 2EPNA 2R7OA 2WZFA 2A0BA 4XPXA 3EGXB 2NUPA 4I1OB 2NSGA 3IQTA 3L8IA 4J32B 1MQVA 2QE9A 2DYRC 2M64A 5TJ5E 2BC5A 1LKXA 4EIYA 1ZHXA 1E2XA 2YL3A 1WN0A 4FAPB 3JCUQ 2YHSA 3GEHA 2Z15A 5DVWA 1Z63A 3AGTA 3EGXA 2NUPB 1VK5A 3LEVA 3JSZA 4J7YA 5BQGA 5IY5C 3S0XA 3FOPA 4BG0A 2KNHA 1NG1A 3CAXA 4PJNA 1LVKA 4BJ5A 3TOMA 2M4EA 4C3BA 5KYWA 1YZAA 2DGJA 4H54A 2L6HA 4EBKA 3HKKA 2ZXRA 4YT5A 3V5XA 2JPUA 3AQCA 4GQHA 3LS0A 3GWLA 3M4BA 5DQZA 4OIOF 4YL1A 1OW8A 2R02A 3M79A 1TR2A 4ULWA 2ZXPA 3SZRA 4KNVA 4DRJB 5EGYA 3U2MA 4DVZA 3AQBA 3V7OA 4U5HA 2PP4A 3LESA 4EKWA 4U5EE 2MYSA 3MLGA 1Z6AA 2HJMA 1FFTC 4Z9IA 1OKKA 4CBEA 5AGFA 3S27A 2H7OA 1ZHYA 2HV7A 5HV9A 4PACA 4MTFA 2GAQA 3MBGA 1PCXA 3U9JA 4E0HA 3UR3C 4MNDA 4CX9A 3I4UA 2OKUA 3QTHA 3V5ZA 3C8GA 1S05A 3US6A 4IB4A 4YL3A 2Q4FA 3VYWA 4CDYA 2FFHA 2YL0A 1TKNA 2GA0A 4IAQA 3S90A 3VRCA 1C17M 3C18A 5KYNA 1R4TA 5BQHA 4PK4A 4KC9A 2JD3A 1RCPA 2J9WA 4ANJA 3M15A 3UMKA 2X51A 5EHHA 3C8GB 2DB4A 1K05A 1NFOA 3ABLC 1M6TA 2UUHA 1Z3IX 3C8GD 4GYTA 4YJWA 1VOMA 2Y39A 5A6BA 4HFFB 3JT1A 2KW3C 2QY9A 2J46A 2VASA 3JRTA 3QVYA 2L9JA 3KPHA 4JTAB 5D91A 2CYDA 4XLNF 1ORJA 4MVUA 1WASA 5E3CA 2VH3A 3NMKA 3EFOA 1HW1A 5JP7A 5L0GA 5JSLA 2IOQA 3JYHA 3FXHA 3K1IC 2EPOA 3C63A 3DZAA 3UMHA 2XLEA 1M57C 2XLVA 4M63A 1R5ID 1Q0FA 4PFPA 3WHNA 1ZYRF 1L3PA 3IHUA 4OINF 1BZ4A 2R7TA 2L7AA 1RKCA 2OCCC 1PD1A 2HMZA 2W4BA 3RFYA 4JCHA 2WVNA 5A6BD 2TMVP 4DXWA 1FMWA 4JW1A 3UGOA 5B3SC 5E2QA 4HE8D 3GEIA 1QZXA 3NMJA 2YQYA 4H4KC 4XEFA 3AG3C 3H65A 4MTGA 1NFNA 2Q9BA 1FR0A 1ZW3A 1NZEA 3L34A 1T6UA 4Q4ZF 1LM3B 2BE5F 2R7QA 1OXKA 1LI7A 4CS8A 3ASNC 5DQTA 4MVZA 1A0BA 4DBRA 1ZZPA 1D0XA 1YVIA 2E87A 1XZQA 2L81A 1TQGA 3DJUB 1T6QA 3IEEA 2IXPA 2IXMA 3B9QA 2W45A 3NYMA 3JZ0A 3ZVRA 2P7VA 1WOLA 2OG2A 2VCBA 2R9RB 3SXZA 5HSWA 4EBJA 3KYJA 5T1DB 4CDVA 5JLIA 2VC9A 2EINC 2LQGA 1FNTc 1TFOB 2YWAA 3ITFA 1H6GA 1NU9C 2G62A 4W8PA 5L0JA 3S84A 2YLGA 1BR2A 3G50A 3KYIA 1YYXA 2A6HF 3N2ZB 4N4WA 1KNYA 2PFDA 4DRHB 4L6RA 1YAUO 2J7PA 4LLCA 3K6BA 4JCZA 2ZXOA 4U5CE 1ZHZA 1V55C 3KMIA 1OCOC 3OEOA 4QDLA 1Q0KA 3H2UA 3W8HA 2R7UA 2WL8A 3N24A 4AK9A 1WWPA 5JRAA 4CS9A 3IQ5A 2R7WA 4K7BA 4EHPA 3VM6A 3T4RA 2EIJC 4LERA 3WODF 5T3WA 3KL4A 4OIRF 5FZTA 4CJOA 4IWBA 2QLAA 1YYJA 2G3KA 3RIPA 5A6JA 2J9BA 4N06A 1ZW2A 4IAOA 1OW7A 5F28E 4G7ZF 4C7OB 1Z5ZA 1HE9A 3AG2C 256BA 2G3VA 2Y3DA 3EQLF 4PFOA 3S9OA 4DOZA 2R7VA 3EGDA 1AVOB 3GM2A 1FFHA 4MW3A 4CS9C 1O3UA 3K66A 1VMAA 2LFFA 1VTMP 1TWGA 1J8YF 1D1CA 4C3DA 1IW7F 5KYUA 3TJ5A 3AJMA 2AWCA 3QW0A 1KTMA 1XZPA 3GM3A 3OA1A 4YWQA 2HKVA 5A6AA
chains in the Genus database with same CATH topology
1T6QA 3G4ZA 4NCQA 1T6UA 1Q0MA 1T6IA 1Q0GA 3G50A 3G4XA 1Q0FA 1Q0DA 1Q0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6Q A;  3G4Z A;  4NCQ A;  1T6U A;  1Q0M A;  1T6I A;  1Q0G A;  3G50 A;  3G4X A;  1Q0F A;  1Q0D A;  1Q0K A; 
#chains in the Genus database with same CATH topology
 1RKE A;  3K33 A;  2AVK A;  3EGD B;  2KSF A;  1SZI A;  3ECS A;  5B1A C;  3NDB B;  3ZTM A;  2KYH A;  2LP4 A;  1LIH A;  3C7J A;  2YLD A;  3IQC A;  3FAP B;  3HJC A;  3VAY A;  2KGO A;  1I4Y A;  4IGG A;  5KYU B;  3JYY A;  2R03 A;  1D0Z A;  1QVX A;  1VLS A;  2YRF A;  3H2V A;  2HMQ A;  4XQ1 A;  3M1C B;  3NKE A;  2F22 A;  1RKE B;  4HFK B;  5F5H A;  1M2O A;  5KYY B;  3MYI A;  2R25 A;  3L1M A;  4G7H F;  3LEO A;  4JIO A;  3NKD A;  1TWA A;  2J7P D;  1QSP A;  4MS2 A;  4OD5 A;  1C02 A;  3EG9 B;  4G0H A;  1YJG A;  3HNK A;  4AE4 B;  2XLO A;  4NCQ A;  3EHN A;  1RMV A;  2EIK C;  2HS5 A;  4MTO A;  3K7D A;  1GGQ A;  1H7I A;  4F4B A;  3RQE A;  1M56 C;  1MMN A;  4Q7C A;  2P61 A;  1TFK B;  3PMR A;  4PJL A;  3DAG A;  3M4C A;  2L6G A;  4O6Y A;  1O5H A;  3T6B A;  5L3Q A;  3O10 A;  3LNM B;  2PX3 A;  2QNL A;  1QLE C;  4XWJ A;  1TWH A;  2XRH A;  4AL1 A;  4D4X A;  5JVE A;  3FOO A;  1T9K A;  5GPG B;  4ULV A;  3MFN A;  3UGP A;  2XM0 A;  4MQ9 F;  4EWC A;  1HY5 A;  3E70 C;  3LNR A;  2J9U A;  1MMA A;  2BL2 A;  4O79 A;  2YLI A;  3NRH A;  5DS6 A;  3ZDL A;  2LK4 A;  3L0I A;  4BJT A;  1NBB A;  2C04 A;  2IXO A;  1PD0 A;  3QW1 A;  1CGN A;  1BR4 A;  4WGY A;  3BEH A;  3DJN B;  3TD7 A;  3RF3 A;  1SF8 A;  1SR2 A;  2OEX A;  2DI3 A;  2XS8 A;  3AG4 C;  3FAJ A;  4O7G A;  3SNH A;  3TQO A;  2R7S A;  2W9Y A;  1VB5 A;  1NSG B;  4CJG A;  1S7Z A;  1LPE A;  1YDI A;  2CGE A;  2EPM X;  3IQ6 A;  4NTF A;  2W4M A;  2HUJ A;  3DE8 A;  2HSQ A;  1D1B A;  3MYF A;  3T6G B;  2Y3B A;  2Y69 C;  3WG7 C;  4NTA A;  3GOR A;  3ABK C;  2YKZ A;  2MHR A;  2YL1 A;  1JPN A;  3Q6M A;  1OR2 A;  3U8V A;  2ZPA A;  4PR9 A;  1D0Y A;  2EIL C;  3R7C A;  4E7Z A;  2AU5 A;  3I5P A;  3JRM O;  4JRZ A;  1V4A A;  4JTD B;  1GQA A;  2AP3 A;  4JUR I;  1H9G A;  3ZG1 A;  3U3F A;  5BQI A;  2CDQ A;  5CI8 A;  1YA9 A;  3AG1 C;  4GEH A;  4IJJ A;  1D1A A;  2H8A A;  1FMV A;  3DI5 A;  2Q00 A;  5L3V A;  2RD9 A;  3CEX A;  1T5O A;  3FDQ A;  2P0N A;  3V5Y A;  1OQC A;  3FHD A;  2L6F A;  2OOC A;  4J7T A;  4Z9H A;  5JUA A;  1OCZ C;  4E7S A;  1ZHT A;  4FWV A;  2GFH A;  2YEV A;  2WVO A;  2CCY A;  3DXJ F;  5COM A;  3FVY A;  1YAR O;  2EPK X;  3SXK A;  3EH2 A;  3W2W A;  5DS4 A;  4CSA A;  3W8I A;  2R7R A;  3WAQ A;  4I44 A;  5L0C A;  4G78 A;  2YVK A;  3GAN A;  4KNW A;  3PCV A;  4ER9 A;  4A4A A;  1YLM A;  1AUE A;  1MMD A;  2LFD A;  3B0V C;  1K40 A;  3PHF 2;  1U6H A;  1KU2 A;  3ZQV A;  2OJE D;  4U5B E;  1T6I A;  4HEA J;  2A0U A;  2GWW A;  2LD6 A;  4LLE A;  2XLD A;  4CS8 C;  1Q0G A;  4EUK B;  2H7B A;  2XXA A;  3NG1 A;  1OCC C;  2NSF A;  2QTV A;  1RJ9 B;  1WTY A;  3CSK A;  3EH1 A;  1FTS A;  4JJF A;  4NTB A;  5DLJ A;  1JR8 A;  4JVS A;  3RW0 A;  2ZD9 A;  3LLK A;  5L0I A;  3ZIB A;  2HV6 A;  4K1O A;  3O55 A;  1JRA A;  2A69 F;  2EIM C;  4PJJ A;  1IZM A;  2CNW A;  2J0W A;  4YT2 A;  4C7O A;  1WGW A;  1BDJ B;  3QVZ A;  1YA7 O;  4YN0 B;  4BJ6 A;  3ZQY A;  4QI2 A;  2J9V A;  3EZH A;  2XXA B;  3B71 A;  1RJ9 A;  5F5F A;  2PF4 E;  2XL8 A;  3U8P A;  3CQZ A;  3DD7 A;  4JZA A;  1MMG A;  1OR3 A;  1VLT A;  1ST6 A;  1XWJ A;  2HSB A;  2PX0 A;  2Q7R A;  3U5S A;  2OEV A;  3LAY A;  1L7C A;  2ETS A;  3HNJ A;  4LDQ A;  4X0R A;  1DOW A;  1LS4 A;  4O6N A;  3U3B A;  4N6C A;  4BJ6 C;  2OJQ A;  1ZU5 A;  3GOD A;  3RQG A;  4E18 A;  2NPU A;  1MNE A;  4WAB A;  3S29 A;  3QZC A;  1E85 A;  1HMD A;  2J8W A;  4C3E A;  1Q0D A;  3N0T A;  2Q9A A;  1H9T A;  3LS1 A;  2ASR A;  2ZXW C;  4LDK A;  1EI7 A;  1Q0M A;  3AGU A;  3EG9 A;  1OCR C;  2YZS A;  2PBE A;  2CW0 F;  3JSE O;  4XEK A;  4AE4 A;  4E0I A;  4DVY P;  5KYX B;  2MWQ A;  3AOU A;  3NYL A;  1T01 A;  2A1D D;  3R2P A;  4FX5 A;  3SEO A;  3Q7L A;  1HMO A;  3FMS A;  3TK0 A;  3W2V A;  4D4N A;  1E84 A;  5DS5 A;  2J0X A;  4FES A;  4XPY A;  3L8J A;  4O6M A;  4MVS A;  1VYK A;  4MVQ A;  3KH2 A;  1ORY A;  5COG A;  5EK0 A;  1OXB A;  2WZG A;  4JTC B;  3G4Z A;  3KKB A;  1G5Z A;  1N1C A;  1OW6 A;  3B29 A;  4MVR A;  3RVY A;  3I5Q A;  4AX2 A;  3GEE A;  3IPM O;  1DOV A;  3GM1 A;  4K0D A;  5KYX A;  4BJ5 C;  4Q5S F;  3G4X A;  4JEA A;  3EZI A;  1CPQ A;  2R05 A;  4OD4 A;  4ZLD A;  2NUT B;  2YL7 A;  3GWN A;  4I1M A;  2B0H A;  3OWT A;  2XS1 A;  2VCA A;  3C8Z A;  5B1B C;  1A7E A;  1NU7 D;  1EA8 A;  3NYJ A;  3SYN A;  3DMD A;  1RXQ A;  2I8B A;  2NG1 A;  3PDM P;  4MVO A;  4IAR A;  1JOG A;  3Q7G A;  1JMW A;  4U9D A;  5T3T A;  1ZU4 A;  3W4Y A;  3TOL A;  1JAF A;  4BJ1 A;  4P6I C;  1Z7Q c;  5KYW B;  1E83 A;  2WB7 A;  1TWC A;  2OU6 A;  1ZVZ A;  1WAT A;  2I15 A;  4KBL A;  2PNO A;  5L0F A;  1MND A;  4LAC B;  4N6H A;  4YT8 A;  3RYL A;  5CIV A;  5JS5 A;  1A41 A;  3U9M A;  2X0C A;  3DM9 B;  1K04 A;  2ICW G;  3SP1 A;  2XM4 A;  3A9C A;  3QMK A;  4YK5 A;  1UFB A;  2KQ9 A;  2Q3T A;  2XLW A;  4JJG A;  1A7V A;  4BEM J;  3F47 A;  2XL6 A;  1UG7 A;  3DWW A;  3UNG C;  4P9T A;  1FAP B;  3VF0 A;  4DRI B;  2O9X A;  5KYY A;  2CNW D;  2FAP B;  1GM5 A;  2GDC A;  2IYL D;  1G8X A;  4XPW A;  3X2Q C;  2J45 A;  3LLI A;  1GS9 A;  1LE2 A;  1APC A;  4LDR A;  4ONS A;  2B0J A;  2D5R B;  2KC3 A;  3Q6N A;  4U5F E;  4JC7 A;  3SXM A;  3SXY A;  5JT4 A;  5L0D A;  3RKO F;  2IXN A;  3EJN A;  3NMI A;  5AC5 A;  2HZ8 A;  3J06 A;  2H7V C;  3LJB A;  1QQ3 A;  5A6K A;  4JKV A;  2VB6 A;  1B68 A;  4WJ0 A;  4CIP A;  4UDV A;  3ZC4 A;  1O87 A;  1Z23 A;  4W8K A;  3EHM A;  2KK1 A;  4WGZ A;  1QPU A;  1JPJ A;  1F1M A;  2WZL A;  3BRJ A;  3HTK C;  1G4W R;  2A6E F;  3S28 A;  2V26 A;  2RSE B;  1ORS C;  4PJM A;  4YL0 A;  3K1I A;  3HNL A;  1HW2 A;  4XEV A;  1M2V B;  1E86 A;  3O6X A;  5BUO A;  5E33 A;  1NLX A;  1BBH A;  4KI2 A;  4E17 A;  1LS1 A;  3U0C A;  1U0B B;  3T9O A;  2LIG A;  3O39 A;  4RD9 A;  4EBB A;  1U89 A;  2D4U A;  2Y3G A;  3TJ6 A;  4CS7 A;  3HNI A;  4RDA A;  3LUT B;  4BEJ A;  4I3M A;  5COF A;  1M2V A;  1VYI A;  2XLM A;  3T6J A;  4XLP F;  5FCL A;  2DYS C;  1Y4C A;  5B3I A;  5L0H A;  4CSA C;  2KJG A;  2HJ3 A;  2XLH A;  3A11 A;  4J30 B;  2IM8 A;  4YT4 A;  1EKY A;  1J8M F;  4XTK A;  3RQF A;  4CDA A;  1W2W A;  3EFO B;  2R7X A;  5A69 A;  2IBF A;  3E9V A;  4NY3 A;  4G7O F;  4AL0 A;  4IRU A;  1I4Z A;  3TUL A;  2XSE A;  4OIP F;  1CPR A;  4A2N B;  4NC3 A;  4B6I A;  3X1O A;  4DJ9 A;  3F46 A;  2FGY A;  4DBQ A;  1EQ1 A;  1LE4 A;  1YZC A;  1G4U S;  2XL4 A;  1BR1 A;  1ZHW A;  4R32 A;  3CZ6 A;  2Q9C A;  2LCH A;  3HLZ A;  4P9F A;  3UMI A;  5AC4 A;  2V3C C;  1C03 A;  2JX0 A;  4OIQ F;  4MW8 A;  5E3A A;  3ABM C;  2AWY A;  1Y6D A;  3K1H A;  4U5G A;  3ZTZ A;  4RBN A;  4JE9 A;  1AEP A;  2UUI A;  2EPL X;  3B0P A;  3DE9 A;  4U5D E;  3RVZ A;  3B0U X;  2HFI A;  3C62 A;  5K0I A;  1SYQ A;  1CGM E;  2OQM A;  1V54 C;  4MVM A;  4NQF A;  5D92 A;  3ZWI A;  4ZLC A;  3DM5 A;  3DAF A;  4CIH A;  4JEB A;  4BPM A;  2LSE A;  1SMY F;  2WVQ A;  3U2L A;  2VCC A;  2QUP A;  1QKR A;  3JTL O;  3ATP A;  1V74 B;  4QI0 A;  3ZSU A;  4U9E A;  2A68 F;  3POV A;  3DKA A;  4Z9J A;  5CI9 A;  3EPV A;  2P6V A;  2C03 A;  1OKK D;  1A7D A;  2Y3H A;  1HE1 A;  2P1A A;  3RH3 A;  1LI5 A;  1PV3 A;  1CGO A;  2NUT A;  3ASO C;  3MX3 A;  1I5N A;  2EPN A;  2R7O A;  2WZF A;  2A0B A;  4XPX A;  3EGX B;  2NUP A;  4I1O B;  2NSG A;  3IQT A;  3L8I A;  4J32 B;  1MQV A;  2QE9 A;  2DYR C;  2M64 A;  5TJ5 E;  2BC5 A;  1LKX A;  4EIY A;  1ZHX A;  1E2X A;  2YL3 A;  1WN0 A;  4FAP B;  3JCU Q;  2YHS A;  3GEH A;  2Z15 A;  5DVW A;  1Z63 A;  3AGT A;  3EGX A;  2NUP B;  1VK5 A;  3LEV A;  3JSZ A;  4J7Y A;  5BQG A;  5IY5 C;  3S0X A;  3FOP A;  4BG0 A;  2KNH A;  1NG1 A;  3CAX A;  4PJN A;  1LVK A;  4BJ5 A;  3TOM A;  2M4E A;  4C3B A;  5KYW A;  1YZA A;  2DGJ A;  4H54 A;  2L6H A;  4EBK A;  3HKK A;  2ZXR A;  4YT5 A;  3V5X A;  2JPU A;  3AQC A;  4GQH A;  3LS0 A;  3GWL A;  3M4B A;  5DQZ A;  4OIO F;  4YL1 A;  1OW8 A;  2R02 A;  3M79 A;  1TR2 A;  4ULW A;  2ZXP A;  3SZR A;  4KNV A;  4DRJ B;  5EGY A;  3U2M A;  4DVZ A;  3AQB A;  3V7O A;  4U5H A;  2PP4 A;  3LES A;  4EKW A;  4U5E E;  2MYS A;  3MLG A;  1Z6A A;  2HJM A;  1FFT C;  4Z9I A;  1OKK A;  4CBE A;  5AGF A;  3S27 A;  2H7O A;  1ZHY A;  2HV7 A;  5HV9 A;  4PAC A;  4MTF A;  2GAQ A;  3MBG A;  1PCX A;  3U9J A;  4E0H A;  3UR3 C;  4MND A;  4CX9 A;  3I4U A;  2OKU A;  3QTH A;  3V5Z A;  3C8G A;  1S05 A;  3US6 A;  4IB4 A;  4YL3 A;  2Q4F A;  3VYW A;  4CDY A;  2FFH A;  2YL0 A;  1TKN A;  2GA0 A;  4IAQ A;  3S90 A;  3VRC A;  1C17 M;  3C18 A;  5KYN A;  1R4T A;  5BQH A;  4PK4 A;  4KC9 A;  2JD3 A;  1RCP A;  2J9W A;  4ANJ A;  3M15 A;  3UMK A;  2X51 A;  5EHH A;  3C8G B;  2DB4 A;  1K05 A;  1NFO A;  3ABL C;  1M6T A;  2UUH A;  1Z3I X;  3C8G D;  4GYT A;  4YJW A;  1VOM A;  2Y39 A;  5A6B A;  4HFF B;  3JT1 A;  2KW3 C;  2QY9 A;  2J46 A;  2VAS A;  3JRT A;  3QVY A;  2L9J A;  3KPH A;  4JTA B;  5D91 A;  2CYD A;  4XLN F;  1ORJ A;  4MVU A;  1WAS A;  5E3C A;  2VH3 A;  3NMK A;  3EFO A;  1HW1 A;  5JP7 A;  5L0G A;  5JSL A;  2IOQ A;  3JYH A;  3FXH A;  3K1I C;  2EPO A;  3C63 A;  3DZA A;  3UMH A;  2XLE A;  1M57 C;  2XLV A;  4M63 A;  1R5I D;  1Q0F A;  4PFP A;  3WHN A;  1ZYR F;  1L3P A;  3IHU A;  4OIN F;  1BZ4 A;  2R7T A;  2L7A A;  1RKC A;  2OCC C;  1PD1 A;  2HMZ A;  2W4B A;  3RFY A;  4JCH A;  2WVN A;  5A6B D;  2TMV P;  4DXW A;  1FMW A;  4JW1 A;  3UGO A;  5B3S C;  5E2Q A;  4HE8 D;  3GEI A;  1QZX A;  3NMJ A;  2YQY A;  4H4K C;  4XEF A;  3AG3 C;  3H65 A;  4MTG A;  1NFN A;  2Q9B A;  1FR0 A;  1ZW3 A;  1NZE A;  3L34 A;  1T6U A;  4Q4Z F;  1LM3 B;  2BE5 F;  2R7Q A;  1OXK A;  1LI7 A;  4CS8 A;  3ASN C;  5DQT A;  4MVZ A;  1A0B A;  4DBR A;  1ZZP A;  1D0X A;  1YVI A;  2E87 A;  1XZQ A;  2L81 A;  1TQG A;  3DJU B;  1T6Q A;  3IEE A;  2IXP A;  2IXM A;  3B9Q A;  2W45 A;  3NYM A;  3JZ0 A;  3ZVR A;  2P7V A;  1WOL A;  2OG2 A;  2VCB A;  2R9R B;  3SXZ A;  5HSW A;  4EBJ A;  3KYJ A;  5T1D B;  4CDV A;  5JLI A;  2VC9 A;  2EIN C;  2LQG A;  1FNT c;  1TFO B;  2YWA A;  3ITF A;  1H6G A;  1NU9 C;  2G62 A;  4W8P A;  5L0J A;  3S84 A;  2YLG A;  1BR2 A;  3G50 A;  3KYI A;  1YYX A;  2A6H F;  3N2Z B;  4N4W A;  1KNY A;  2PFD A;  4DRH B;  4L6R A;  1YAU O;  2J7P A;  4LLC A;  3K6B A;  4JCZ A;  2ZXO A;  4U5C E;  1ZHZ A;  1V55 C;  3KMI A;  1OCO C;  3OEO A;  4QDL A;  1Q0K A;  3H2U A;  3W8H A;  2R7U A;  2WL8 A;  3N24 A;  4AK9 A;  1WWP A;  5JRA A;  4CS9 A;  3IQ5 A;  2R7W A;  4K7B A;  4EHP A;  3VM6 A;  3T4R A;  2EIJ C;  4LER A;  3WOD F;  5T3W A;  3KL4 A;  4OIR F;  5FZT A;  4CJO A;  4IWB A;  2QLA A;  1YYJ A;  2G3K A;  3RIP A;  5A6J A;  2J9B A;  4N06 A;  1ZW2 A;  4IAO A;  1OW7 A;  5F28 E;  4G7Z F;  4C7O B;  1Z5Z A;  1HE9 A;  3AG2 C;  256B A;  2G3V A;  2Y3D A;  3EQL F;  4PFO A;  3S9O A;  4DOZ A;  2R7V A;  3EGD A;  1AVO B;  3GM2 A;  1FFH A;  4MW3 A;  4CS9 C;  1O3U A;  3K66 A;  1VMA A;  2LFF A;  1VTM P;  1TWG A;  1J8Y F;  1D1C A;  4C3D A;  1IW7 F;  5KYU A;  3TJ5 A;  3AJM A;  2AWC A;  3QW0 A;  1KTM A;  1XZP A;  3GM3 A;  3OA1 A;  4YWQ A;  2HKV A;  5A6A A; 
#chains in the Genus database with same CATH homology
 1T6Q A;  3G4Z A;  4NCQ A;  1T6U A;  1Q0M A;  1T6I A;  1Q0G A;  3G50 A;  3G4X A;  1Q0F A;  1Q0D A;  1Q0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...