1T6VN

Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lysozyme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
b'RVDQTPRSVTKETGESLTINCVLRDASYALGSTCWYRKKSGEGNEESISKGGRYVETVNSGSKSFSLRINDLTVEDGGTYRCGLGVAGGYCDYALCSSRYAECGDGTAVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Crystal structure of a shark single-domain antibody V region in complex with lysozyme.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Hydrolase/immune system
total genus 33
structure length 112
sequence length 112
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6vN00
1FFNB 3PNWA 3D0LA 3OL2A 2RGSA 1UZ6E 1FVEA 3WKML 4FN0A 4X6DE 1T0MA 3CLEL 4WI8A 4X6CF 1I3UA 3U4AA 3PWPE 4NGHH 1JNHB 2V9RA 1PKQB 3FO2B 2XZCL 3RGVA 4U6VH 1MIMH 4L4VD 1VESA 4BQ9A 3HPLB 5F9DC 4QRTA 2GK0A 5GS1C 5L8JB 3MRCB 3N1QC 5IQ9B 5E8OA 1RZ8B 4F7MB 1CICB 5SWZB 1JN6B 2M8XA 3WIHA 2EIZA 4S1QH 1BFVL 2AV7B 1ZT7B 1AC0A 2GT9A 4YDKL 4NDMB 3CD4A 3T3PF 2IADB 4H20H 3ZTNL 2YHGA 1J1OL 1FPTL 4R7NB 2OJEB 1P9MA 3GBNH 3JTTB 4NO3B 5EN2B 4DEPB 3X14A 4PP2A 3BYYA 2D7NA 5HGDA 1KBGH 4IOIA 4JDZB 1AGEB 3WHXA 5JOEA 1G7PB 4M6NL 3LRHA 5C7XH 3G08B 5DEFA 3C2AL 4APQB 2YXFA 1MCJA 5EUKB 2QLVB 5FYLH 1NUFA 1Z9OA 1PQZA 1N4XL 4XXDB 1AIFA 1JYVA 1VCAA 5IVNA 2DM4A 3MJ9L 3OWEA 4YXHH 3FOLB 2NY5H 3TJHC 4H5SA 3X3GL 4FNLH 1UWGL 4LCUA 4OGYH 5HYSG 4JCLA 4DZ8B 4DZBA 2XKNB 5IEHA 5FAAA 3BDYH 1KTLA 4N0YH 1JPGA 4HIJB 1CZ8L 1XGRB 4H25B 4OFVA 3QUYA 2O5XL 1KG0B 1EHLL 5TFSL 3HLAA 2F5AH 1FBIL 1RVFH 2R0WL 4P9ML 1R5WB 3QQ3A 4TRPL 5DK2A 1JNNL 4JFOB 4PRDB 2NY2D 4S1RL 5C0GA 1MHPH 4CN4A 3VFUA 2H26B 1RIVL 4XNUL 4WU5A 5KVGL 1NGXA 1T0NA 1MPAL 4M3KB 3SE8H 1T21A 4FFWC 4K23H 4ZODA 1MCPL 3MLYL 4QY8B 3SY0B 2VDNL 43CAB 4L3CA 3HE6D 4NN5B 4XI5D 2NW2A 4R2GC 2BC4A 2Z8RA 2R1YB 2VXTL 1TVHA 4KTDH 4PS4L 3ES6A 1UADC 4TVPH 3K4AA 2VITB 4MXVF 2AKRA 3HC0A 3KYOB 3QI9D 4GRLC 4N0UA 4YFEA 1S9XB 4YE4H 3QIBD 2PYFA 2DQJH 3LB6C 4XCNA 3FAXA 3G5VB 5KSAC 5D5MB 4BFGA 2HTLD 1CXKA 2WWMD 3KPRD 3CVHL 4JFXA 2D7TL 5BS0D 1H9VA 1JHTA 4QHMB 1EPFA 4ZXBC 3TZVD 3TH4T 3MODL 5ALCH 3RUGA 3D0LB 1QA9A 3E0GA 1FVEB 3MUGA 2W92A 3P2TA 4WFHE 3IDNA 1II4E 5ITBH 3T3PE 4HLJA 4PTTA 3BQUA 5E2TL 1N0XL 1LVEA 2D9CA 4OFDA 4PJ7A 3GSVA 3QCTL 1F4HA 3SGJC 1NCTA 1JYNA 3QHZL 4J3TA 5E7BA 5E6ID 1UENA 3V52H 3MZTA 3RPKA 2XA8H 3NIGF 3UJIH 1XGYL 3RGVB 3NCBB 4M8QA 4HFUL 4I3RH 5DFTA 4QRTB 5HHMD 3JWOC 3DURB 3BE1L 5FM4A 3W0WB 4KGJA 4M9OA 1N5YL 5E8OB 4GRWF 2DQEL 2G60L 2IG2H 3DMMC 1NLBH 3MLSL 1RUQL 1ITCA 1U8IA 2EIZB 4K7FA 5BRZE 3O11A 1UA6H 2ZCLL 2GT9B 4J3SA 2X4NA 5DLML 1D9KA 1ZLVH 5HSFA 2CUIA 4B50A 2VLKA 2VLMD 1T1XB 4YHKL 4GS7B 3QDGA 4PP2B 3X14B 2ITDA 4UNUA 5F1KC 5HGDB 4IOIB 3WHXB 2BXZA 2OS7A 4LPYA 4L3EB 3TNNB 2ATKA 4MQXC 3H9SD 1NCCL 3SDDC 4XVJH 4S0SD 3KYMB 3TCXA 4MJ6A 3MJ8B 1NMCB 4TUJA 4N0FA 5FYLD 4DZBB 3WLBB 2EE9A 3MRLB 4ZUUA 4QRUB 4Z9KB 1KTLB 4O4YH 1EEYA 4OI7A 3KS0H 4NKIH 2XT1B 4LIQH 2JIXA 3BKJH 4GQPH 1CCZA 3BH9A 3HI1A 2Q6WB 5GS0L 2W9DL 3S36H 2L4OA 1MLBA 3HN3A 3HLAB 3MTRA 3QQ3B 5DK2B 5C08A 2P47B 4TOYH 4PRPE 5TQ0H 1F00I 2FWOB 4PJEB 5I75C 5C0GB 1TPXB 4KKLC 2K3TA 5ICXA 1UM5L 1PYWB 4WU5B 5DVOA 2E7LA 4YDLB 2RFXA 2BVPA 2FHCA 4GKSA 4AQ1B 1GC1H 1KCRL 1J8KA 1T21B 3EUUA 3DETD 2SEBA 3TGXA 1FNLA 2NW2B 3FO0H 4DW2L 3IT8D 3CFKA 5C6TH 1MRCL 1TVHB 1G9ML 2VAAA 4DOHE 4JQVC 3ES6B 5JW4Q 4ALAH 2WINA 3ARZA 4YPGB 5EOTB 3W2DH 3TPUB 4JPKH 1U8JA 1HNFA 2AKRB 1QYGH 4HEPG 3WIHH 1BQHG 4XAKE 4WI5A 2PYFB 3NIGE 5B8CA 1BVKB 4KAQH 3FB5A 4PRHD 4TVPD 3TFKD 5JHDA 1NAMA 3OGOE 4GW5A 1XH3B 5DJXA 5LWYH 4GRWE 4J23A 5HI5D 3RUGB 5IVOA 1QA9B 3MUGB 3F65A 5I8OL 1W0YT 3IDNB 3J8F7 3OXRA 4ZNCD 2JJTC 3EYFA 4PTTB 3BQUB 3A6CL 3W2DL 5D8JL 3W11D 1A6WL 1FL6A 2XZAL 4ZS7H 3GSVB 5GISH 2A77H 5L2KE 3AUVA 3MBEA 4YHOH 2I9LB 3RI5F 3RWGA 1OAYH 4LAJH 4IRJC 4B7IA 4M48L 1AXSB 1KULA 2HT3C 5GPRA 4I3SH 3K0WA 3L5XL 1BIHA 1V7NH 2IQ9L 4XMPL 2BVUA 3N06B 3O11B 5JR1H 3OF6D 3MFGB 3OJDA 4Z7QF 2X4NB 1LE5A 4K71C 1D9KB 4ZDHA 2VLKB 3CXDH 5E99H 1DSFL 3BJLA 5GGRY 3QDGB 2VIRA 2ITDB 1S3KH 5ETUA 4QWWD 1DQQA 1ETZA 4FQIH 4XBEH 2ATKB 1NC4A 4JQIH 2ICWA 3LV3B 3BDXA 1U3HA 3AMLA 5CJOH 1MJJA 3H6JA 5CBEB 3IAQA 2CDEA 4C56A 4MJ6B 1FNGB 5FOBB 1K3IA 3SQOL 4AG4L 2ZOKB 4JKPL 1QZ1A 4N0FB 4XBGA 1CFQB 2ZZUT 4ZUUB 1CDIA 4CU6A 4XZUB 4MWFA 4OCRL 5JXED 2WAHA 1AP2B 1EEYB 3ARED 4LPCA 4NC1E 3WKMH 2ICWJ 3FAWA 2JIXB 3CLEH 3BH9B 4K94L 3HI1B 5CZKA 3OGCA 5C09A 3B83A 2P5WA 1JJUA 4RCAA 3MNVB 5MERA 5IV2A 5C08B 2P5EA 5T5NG 2XZCH 3G6DL 4YWGL 1NLDL 3QUXD 1BZQK 2X4UB 4MCZB 4PTUB 2H9GB 2P45B 2BVPB 5EFIA 4GKSB 1UWEL 1QBML 1I8KA 5HYJE 2FX8L 1BFVH 1JWUB 25C8L 2SEBB 4YX2L 4YDKH 5DHYB 1VADB 2HVJA 3NIDF 3ZTNH 5JMOC 4GBXD 1J1OH 3CFKB 5E5UB 4YPJA 3ULVD 1FPTH 2ADIA 2NX5A 1PSKL 4PJDA 1A21A 1YUHA 3S98A 3G9AB 4N1EA 2Z31A 5HYEA 2WINB 5FO9A 4M6NH 1P2CA 1U8JB 4YHIB 3C2AH 5IEKA 5B8CB 3OR6A 5DA0B 4QXWA 1EEZA 3O81A 3VFMB 4X9GA 1N4XH 1U0QA 5GGUA 2EC9T 4U3HA 3MJ9H 1NAMB 1DE4A 1YDPA 5DJXB 4RFNC 5T1LA 3GMQB 3X3GH 1T1ZB 1UWGH 3B9KC 2R15A 2A73A 5IF0A 1NFDA 4U7KA 4KKCC 3EYFB 1TCMA 4NWTL 4Z7QE 4WV1A 1CZ8H 1OTSD 3RHWF 3GSRA 4UILL 5JDSB 3UTTE 2V2TA 2O5XH 4U0RB 3HNVL 3MBEB 4WUUA 1OT1A 3LQZA 1EHLH 1D5XB 5TFSH 3RWGB 1FBIH 2R0WH 2VXQL 4P9MH 4TRPH 2A9NL 1JNNH 4PJ8C 2W0FA 5ACZB 1CDCA 1YQVL 4S1RH 3O2DL 4KK8D 4JLRB 4IRZL 4O51A 3QEQB 1RIVH 4XNUH 5KVGH 5DJ6B 1MPAH 3BX7C 5GS2H 1JGDA 3TBTA 3VWJC 4LNVA 2Z93A 1MCPH 2CRMA 3OJDB 3MLYH 3V4UL 2NPLX 1KPRA 1U8OA 2VDNH 1LE5B 4Y4FA 3AM8C 4E41E 2Q7NA 2QQLL 2XZZA 5KS9A 4PJXA 2VXTH 1PG7L 3KDMA 5IMKA 3ARFC 1LO0L 3P9MB 2VIRB 4PS4H 5ETUB 1ONQA 1DQQB 1ETZB 2A74A 4AEIL 4ODSL 2ZSVA 9CGTA 1LO2L 2CXKA 2IJ0C 2X89A 1NC4B 5GGSY 5T33L 2ICWB 4MD5B 3EKCA 1U3HB 5H8DA 5L8LB 5L88L 4HJ0C 1BLNA 2CDEB 2W0PA 1UB6B 2WQRA 2DQGL 3CVHH 3SE3C 2D7TH 4LU5L 4PY7B 1NEUA 4XBGB 1BD2A 3MODH 2K7PA 4ZNEA 1G6RA 2JJWA 3MCKA 1EUTA 3OKDA 5E2TH 1N0XH 3BT2L 1HOCA 3RX7A 4WEUD 3OKLA 3QCTH 2DM3A 5GRVL 1SQ2N 3C08L 4HBCL 3QHZH 3OGCB 2P5WB 4QRRD 2HFEA 4KROD 5MERB 1ACYL 2P5EB 1XGYH 3I02B 4ELKA 4FZ8L 3ARGC 1C16A 4HFUH 2JB6A 3T0WA 2EDKA 3BE1H 1AHWC 4NO5A 5I16A 5D7SL 3HPJB 3MO1B 1N5YH 4P2QA 2EEDA 2DQEH 1W8NA 2G60H 5EFIB 5T1MA 3MLSH 1RUQH 3NMEA 4PJIF 3HA0A 4OF8A 5FYJL 1URLA 3O8XC 2ZCLH 2IMNA 4LBEB 3MV8E 4HIXL 4KI5F 2HVJB 3D3VA 2BMKB 1NFIA 5DLMH 3V5KA 4KJYA 4QOKD 4X5XA 5E9DA 1F2QA 2ADIB 4S1SL 2NX5B 4PJDB 1YUHB 4YHKH 4RRPA 5C0NC 2Z31B 5DQ9A 5E7FA 3UAJD 4F9PA 3Q3GA 1P2CB 3JWNC 1UVQA 5M7QA 3T2NL 4RMVA 5BZDA 1OW0A 1FFQA 2NY4D 2EXWC 1NCCH 3OR6B 4NKMA 2ZOLA 4FOMA 3VJ6A 4OD1L 5EULV 2FLBT 5ISZA 4XVSL 5DQDL 2APTA 4Z78A 3V5DB 3EIFA 5T1LB 1M7DB 3TIDA 5GGTL 5HVFB 2A73B 5E56A 5IF0B 4CVXA 1UFUA 1AR1D 3S35L 1AC6A 4C59B 3EHBD 4WV1B 5CZXC 1LO3L 1ZVSA 1A6VL 3GSRB 4D9RE 4FQQA 3QZWA 5EU7C 1U92A 5GS0H 2WUCL 2W9DH 3LQZB 3N0PB 4PIRF 3VXUA 1Q8MA 2DIJA 1C12A 2R56L 1TIUA 3K8KA 4UOW1 1QPPA 1W0VA 1VKXA 2EDBA 1UM5H 1MCBA 4NP4L 5IESL 4EVNA 5LVEA 1JGDB 5T1DL 3TBTB 1KCRH 2Z93B 2XWJA 4WCYL 2DJSA 4LEOA 4Y4FB 5E1AA 4O5LL 1B4RA 3CFDA 4EI5A 4DW2H 3VD5A 4PJXB 2BCKA 1MRCH 4K3HA 3KDMB 1G9MH 5IMKB 5GS2D 4X7EC 1UXWA 1ONQB 2A74B 4PJ9B 4OLYL 3BPOC 4RIRA 2IPUK 3GMOA 4Y19B 3GSUA 2ZSVB 3BN9C 3VFOA 3QXWA 1P1ZA 4MA8L 3SO3C 1NBZB 2X44D 1BLNB 4YFDB 3ZKNC 2MHAA 2D0GA 3L3DA 3RP1A 2D7OA 4R97C 3M07A 2B4CC 1XR8B 2YWZA 4PJIE 5C0BA 3MYJA 1G6RB 2YUWA 3MCKB 5I8OH 1FNEA 3U30C 1E0OB 2CO7B 4KI5E 3A6CH 1AI1L 5D8JH 3RBSA 4JREC 2VZ3A 1A6WH 5J12C 2XZAH 4P48A 3N1FC 2VLJE 5K9QG 1S5HA 4JHAL 3RWDB 4M48H 5E6YA 2CDGA 5TE4L 3O4OC 5I16B 2EYTB 4AY0A 4ONOA 3QEGL 3VGFA 1CI5A 3L5XH 1DBJL 3B6SA 2IQ9H 4XMPH 3I6LD 4IRSC 1FVDB 1U9KA 2P8LA 2VAJA 5EZIL 2OXHA 3FTGA 1F6LL 4KK9D 3V5KB 3D3VB 1NFIB 4KJYB 1VEPA 2FDBP 3WO4C 5E9DB 2RAMA 1DSFH 2ZNXA 3DXAB 4LCCB 4PB0L 3Q3GB 4WO4C 5D93B 1UVQB 2IBZY 4GG8A 4MS8C 1R3IL 3R0NA 4J3VA 3HR5B 4YHZL 3VJ6B 5GXBB 4K9EC 3G5XA 5ISZB 4Z78B 3X3FL 3SQOH 4PRNA 4AG4H 1ITBB 3JV6A 3BD3A 2VLME 4JKPH 4OCRH 4U33A 1ZVSB 1CD8A 5DHXB 4Y4KD 1DR9A 3MRHA 3H9SE 2A6DA 3QZWB 4FQQB 4KU1A 4K94H 2EDRA 3MRIA 1U92B 3BH8A 3VFTB 4NFDA 3VXUB 2EXYC 3TO4C 3FB8A 3LSOA 3ISWA 2C1PA 3TV3L 4E42A 3G6DH 4YWGH 3TVMD 3OKKA 3V4PL 1W0VB 1NLDH 2WBJC 2GITB 1AGFA 4M7KL 1OF2A 1SBSL 2CK2A 4PD4K 5K9OA 1S7WA 5F6IC 1IILE 1UWEH 1QBMH 2FX8H 1RJZB 3DIFA 2HJLA 3MV9D 2XWJB 25C8H 2IPKA 4YX2H 4MNQA 3PHOB 3ZLQC 4EI5B 5HVWA 2DLHA 1SJXA 2BCKB 3B5GA 4X4YA 3A67L 1PSKH 4EN3C 1PZ5A 4TVSa 2XKUA 1UXWB 5SX4H 1JMZA 4RIRB 3QDJB 3GMOB 3GSUB 1RUKL 1T7YA 3VFOB 4YBHA 5AZEL 4QGYA 4OZ4A 1ZVYA 5IB4B 2GJZA 2ZUYA 3H3KA 5GGRA 5CJ5A 1F5WA 4OIBA 1NGZA 3SO3B 1H5BB 5CSGA 3ARBC 2AJZA 1RUAL 3DUUB 5HPOA 3IYLW 5D1QB 4OCSL 4DAGL 1TENA 5IT2L 5KVEL 5DJAA 1X5KA 3U9UB 3MRMB 2M2DA 1FNEB 5HHOD 1WZKA 3UBXA 4NWTH 4MDJA 3LCYA 1QFHA 4LDLB 4UILH 3CDCA 1I4FA 5D5MF 3OKNA 2PXYA 3HNVH 4PRHE 4KKBD 1S5HB 2VXQH 1FYTA 2A9NH 4HV8A 3S7GA 5D7IF 1LK3L 2CDGB 1YQVH 4G9FE 1RQ5A 3O2DH 5ICZA 2V17L 5JHLL 2B1HL 4IRZH 1DL7L 1LDPL 3B6SB 4X9FA 4NQVA 3KPLA 3PXJA 1J12A 2P8LB 4XNMA 5B21A 1GL4B 3FTGB 5CD5C 1GGTA 1G6VK 3V4UH 3WUWG 3L7FA 3SN6N 4M02A 1EFXA 4FABL 2QQLH 5JZ7D 4JFFD 4MA7L 1PG7H 2ZCHL 3TO2B 1LO0H 2VLRE 3PXHA 4AEIH 4ODSH 5HPMA 4GG8B 1LO2H 2QADC 5T33H 5L88H 3IS1X 1ZV5A 5FECA 4JGJA 1MLCA 2DQGH 3G5XB 4DCQA 3KHQA 4PRNB 2BNQD 4LU5H 4L5FL 4W6XB 3V6FA 3MV7A 2E8ZA 1WEJL 1Z0MA 2A6DB 3BT2H 2CLZB 3BH8B 1CXEA 4HBCH 3C08H 3ILQC 4QEGA 1HHGA 1GVIA 1RZKL 1ACYH 3LSOB 1IM9D 5C0CE 1S7VA 2C1PB 4FZ8H 3OKKB 4H1LG 3MRNB 1T5WA 4KUCD 3ZKMC 5CP7A 5D7SH 1AGFB 1OF2B 4HH8A 3T0ED 5K9OB 1S7WB 4L1HA 4GG6A 4KTYA 2F8XC 3P30L 5FYJH 3DIFB 3JXAA 3KLHD 5TF0A 4HS6A 4HIXH 4RGOL 4ZPTA 3INUL 4KXZH 1IGML 5HHPA 5EU3B 1Y6MR 5C0EA 4S1SH 1OVZA 3HUJF 1BHGA 4KTEL 4LIQE 4PJHF 4G8GD 3C60D 3MACL 5ADPL 3VXSE 2VL4A 1JGVL 2ESVA 2DTSA 2CIIA 3BPNC 1F3RB 1Z0NA 1SY6L 3T2NH 3PQYD 4XTRC 4OZ4B 1RK1A 2ZG1A 3VFPA 5IFJA 5GGRB 3I3BA 2X9XA 2YPLA 2QBWA 4Y5YA 5D7IE 5T3XD 4OD1H 5A2LH 3O9WD 4LMQE 4MDIB 5FA3B 4XVSH 5DQDH 3TBVA 2AJZB 4Y2DC 3JBG7 4NZDA 1CL7L 3VXQB 3CX2A 2OJZL 5GGSA 5GGTH 1BGXL 1JGEA 2M26A 3LKSA 1OAXL 1Q9KB 3O6ML 4HWBA 3S35H 4MDJB 1LO3H 1T66C 4GAYA 1A6VH 2DI7A 2KZ1B 4P2CG 2PXYB 4NKDB 3LKPA 3HNTL 2WUCH 3LRSA 4QRPD 1ZLWK 3THML 3MNWB 1IKNC 2CKBL 4HV8B 1A47A 2R56H 1E4KC 2VR4A 3FB6A 4YHPA 3RUGF 4I0PD 3B9DA 2HWZL 3QDHA 1Y18B 2YBRA 3PHSA 4NP4H 1DQJA 3KVQA 1I1AA 5I1HL 4LOUC 2J1KA 5IESH 4PJ7F 3KPLB 4WWKA 5T1DH 5ESAA 4XNMB 2XOTA 4WCYH 3L7FB 3DHJA 2WBWB 2R2HA 5I71C 1EFXB 1BF8A 4O5LH 3LS5L 3SKMB 4U1GB 5FYKL 4X99A 5DRNA 4YUEL 2BP3A 3WN5A 3UYPA 3NZ8A 5HGGS 4OCMC 1F45A 4G6JL 5D2LE 4U1SA 1FFRA 3BD4A 3JV4A 4OLYH 1ZLUK 5TF1L 3IETB 3HE7D 2C1OA 1UT9A 4MA8H 3VDBA 2VWEE 5DK0A 4RGNB 5FB8A 3RY6A 3OJVC 5FECB 1OAUL 4RISL 1MLCB 1MF2L 5DVLA 4DCQB 4JDVA 4W81A 1TITA 3TN0D 5J11B 4P2OB 2QV2A 1AQKL 1QUNA 4S2SB 1DVFC 3QNXA 3V6FB 2XY1A 1DUZA 4MJ4A 1AKJD 2I60L 4L4TA 3MV7B 5C6WH 2HA1A 4OZIA 1AI1H 2DQTL 4PBWD 5CILL 1G84A 3HUJE 4PJHE 1ZHKA 1HHGB 4Y1AD 5HGAA 4HJGA 4JHAH 1S7VB 2D03L 3WFBL 4PLKD 2Z4QA 5TE4H 1KACB 5C2UB 1PX3A 5CP7B 4R96A 5EZOL 3QEGH 1DBJH 1FLTX 4DQOL 4X7CC 3REWB 4GG6B 1A6PA 2UWEA 3U9PL 5GS1A 4LHUG 5EZIH 4HS6B 4ZPTB 4CNIA 4KKAC 3F6LA 5HHPB 5C0EB 4PRBA 4N0UE 3WV0A 3RA7L 1N2RA 3MROA 4Z7OF 4IJ3B 1UH4A 3PWLB 3ZKSD 4HIHB 4PB0H 3RTQD 2ESVB 2CIIB 4J3OC 1FDLL 1RK0B 3JWOL 2YOCA 3GSOB 3ZL4L 1R3IH 3VFPB 2BZDA 3QISA 4P49A 1T4KA 4YHZH 2ID5A 4FRWA 4OZGE 3I2CL 2WQ8A 1ULVA 2HT2D 5HYSA 4NBXB 4KMLB 4FZEL 3TBVB 3X3FH 3CZJA 1XGUA 4LRIA 5GGSB 4PJ7E 1NCDL 1IGYA 1JGEB 5FA4A 4OLWL 3GSWA 3Q2CA 5TDNA 4UIKL 4RFEA 1E4JA 4U1NB 3W5MA 3LKPB 3BFOA 2AEWA 5D1ZA 1JZ5A 1KJ2L 2VUOA 2LE9A 4CGTA 5KTEL 4F9LC 4AH2A 5E4IA 4AEHL 3TV3H 3MGTA 3V4PH 3PWNA 3V7AG 4M7KH 3EOBB 1SBSH 1DQJB 1I1AB 4QTIL 5CIPA 4TUKL 4WWKB 3QO0A 4EQ3A 3NPZB 5KAQG 5ESAB 1OSZB 3MJ6A 4R4NC 2R2HB 2DWDB 2L7UA 3VW3L 4X99B 4XVUD 5DRNB 5K9KA 3HAEA 5J6HA 3RKDD 4NWUL 3WN5B 3A67H 2N56A 4M5YL 1IT9L 4U6HB 2JTDA 4PV8A 1I3RA 4U1SB 2CD0A 3JV4B 5CMAA 3HI6L 1OWRM 2EDHA 4M6OL 1MY5A 1RUKH 4Y5XC 5CUSL 2GTWA 3WDIA 2C1OB 5DD1L 1TVDA 5AZEH 5LBSL 5DK0B 2B7DT 3C6LD 1X5ZA 4MX7A 1FNFA 4JDVB 4KJWD 5B4MD 3AFLA 3DGCR 1G9NC 4OQTL 1RUAH 4PGEA 1HXMA 3QNXB 4OCSH 3OB0K 4DAGH 5IT2H 1TZGL 1DUZB 4FTVD 5KVEH 1H8NA 4R90L 4L4TB 2VDRL 5C08E 1YYLL 3P73A 5IKCA 3CDFA 3ROOA 3ARWA 1ZHKB 3E6FA 6FABL 1LEIA 4P4KD 4HW6A 3C5JA 4M1CC 1FG2B 1LK3H 1OD7A 2NMSA 2MQ0A 2AK1L 1DN0A 4R96B 1QACA 2V17H 5JHLH 2B1HH 2XYCA 1DL7H 4PYGA 2I9TA 2FJFB 1LDPH 3ROLA 3IU3A 3EGSA 2G75B 4WGVB 1ZOXA 5FKAA 4NQCA 5EWIL 4HFWA 3KHOA 4WGWB 3WD5L 1OTTC 3RZCD 5I2IA 1FYHB 2DL9A 4CNIB 3UPRA 4FABH 4XPGL 2DWEA 3BIBX 4X6EA 1F4WL 4PRBB 3QH3B 1N2RB 2VL5A 1EZVX 1P5UA 4MA7H 2ZCHH 3IDMA 1NSNL 4XB7A 2VABA 1W72L 3TA3D 1TQCC 4WHTB 1JFQL 5GRZA 2COQA 5E8DL 2HVKA 5EBGA 5JHDE 3X13A 1T89C 3ARDC 1UWXH 1X5AA 5F72S 4HZAA 1NL0L 1G7QA 1ACZA 4WTXA 1T4KB 4NQED 3NPSC 2OX5A 5D1XD 1I9EA 3D2UA 5J3HD 2C9AA 3ARYA 2B8OT 4PJDF 1U8KA 4L5FH 5FV1L 3BZEB 5L7XL 3OR7A 5FA4B 1FV1A 2Z92A 4WI4A 2A6KB 4O2EA 4W4OC 5TDNB 1BQUA 1N6VA 4OGAD 1WEJH 3GKZA 1B4JL 4RFEB 1S5IL 3D39A 5C0DA 4CW1A 4YHNA 4N90E 3QB7C 5D1ZB 4WTZG 5DTFA 5I0DA 3SDAC 2IC2A 3FN9A 1RZKH 4JRYA 1AGDA 2YRLA 1T03L 1NFDF 4F37K 4NHCL 3PWNB 3TBSA 2YS4A 1U2HA 4TYUA 2DRUA 5DT1L 4XRCA 3QO0B 3P30H 5IROC 1FCCA 5ANME 4RGOH 3NFSL 5JOFA 3INUH 4G8EA 1IGMH 5K9KB 4YIQB 2GJ6D 5K9QI 4KTEH 3HE6C 2OR7A 4OZHE 4XI5C 3ZYOA 2XI9A 4PV8B 4NUJA 4LPVA 1I3RB 1BQHA 4PG2C 3MACH 5CMAB 3C8KA 5T1KA 5ADPH 1MFEL 4XNZB 4UAOC 1JGVH 4LSUL 4C56E 1K8DA 1SY6H 2P46B 4P5TC 1HXYA 4LQ1A 4JQVA 5FO7B 1H0DA 3QI9C 4YDVA 4WENB 4JZJC 1WT5A 5DO2C 5D7KD 1Z3GL 3QIBC 3QNZA 5KS9F 4MX7B 4PJXF 1W0WB 1RULL 2HTLC 1HXMB 2D0HA 2WWMC 1CL7H 1CICD 2AJ3B 3Q6GL 5SWZD 5LGHL 4M03A 2OJZH 4X9HA 5LQBL 1BGXH 3P4MA 2R29L 4LLYA 5C09E 1OAXH 2P5WE 3JTSA 3O6MH 1R5VA 4Q6IC 5IKCB 5CFHA 5DRWA 1IC4L 3ROOB 3HNTH 3VWKA 3THMH 3E6FB 4PJFA 2CKBH 1LEIB 2F54B 4FQLL 3C5JB 3RVTC 3FMGL 2HWZH 4APQD 1W72A 1HIML 1EGJA 5DYOB 4Z5RA 2I9TB 3ROLB 3SJVA 5I1HH 2BVOA 5FKAB 3WFHA 5JPMA 4NQCB 4HFWB 4FXGB 2GQHA 2DDQL 5I2IB 2XTJE 4UV7L 1UXSA 2DWEB 3LS5H 4X6EB 5FYKH 2Q86B 4YUEH 1AJ7L 2VABB 1F02I 4PGBB 4YXLL 2FD6L 4G6JH 5F89A 5TF1H 2HVKB 4S1DC 3RWIA 4HDIB 1AD9A 1D6EA 2NXZC 1G7QB 1TQBB 3ZHKA 3HZVA 1OAUH 2NYYD 4RISH 1NFDE 3C5SA 1CBVL 5FOJA 3HAEH 1MF2H 8CGTA 2IFGA 1OTUD 2J7LA 4OTXL 1U8KB 4NFCA 3CVIL 1AQKH 1A4KB 1AXTL 1QSEA 4ZAKA 2Q1EA 1FV1B 3KPSA 4IMLB 1BBJA 4WUUE 1XF1A 4O2EB 2I60H 1S7RA 1XZ0A 2YA2A 3BEWA 5IM7A 4KRPD 3V9FA 2DQTH 5CILH 4MB5A 3D39B 4CW1B 3HS0A 4YHNB 2AXJA 5CKGA 3RWJA 2V2WA 4PP1D 4JFYA 5DTFB 2G9HA 3KYAA 3LH2L 3MRFB 4JRYB 3MA7A 1AGDB 4YFLF 2D03H 3WFBH 3CU1A 4P2RA 2IALA 4GH7B 3TBSB 1WAAA 5EZOH 1LNUA 4MJIA 4MSWA 5SV4A 5KS9E 1C1EL 3O6LL 3U9PH 3OKOB 3E2HB 5IVXB 3WUZA 5T5FL 4RA3A 5JOFB 5DSCA 3DETC 5E08L 3DX7A 3RA7H 4C83B 1DQML 2DTMH 4BQ6A 4LKCA 1BQHB 1KCSL 5T1KB 1FIGL 3O3BA 3PL6A 4ZFGL 1K8DB 1FDLH 1HXYB 3JWOH 3EJJX 3ZL4H 1H0DB 1BD2E 4YDVB 3DOSA 2ITCA 5ID0A 3QNZB 4TNWK 3I2CH 1ZT4A 4WW2C 3SDYL 1G0YR 4JFPA 3W0WD 2DQUL 1XF3A 4FZEH 4F3FA 3TFKC 3VGDA 2FL5A 1NCDH 3P4MB 3UTSD 3MBXL 4OLWH 5F8RC 5HI5C 3JTSB 3UROR 3QG6A 3FT2B 2JCCF 3QUMA 3VI3F 1R5VB 3B9KA 1KXQE 5DRWB 4UIKH 3KWWB 2X1PA 1LEGA 5GZOD 3U7WL 3GGWA 3TH3T 3W11C 4CL7A 2GFBB 3VWKB 1KJ2H 4NOFA 4P2QE 2OCFD 5INDA 1SJHA 5KTEH 5E2UL 5FHBL 4AEHH 1S7TA 4L3ED 4PV9A 3UZVB 4LVNB 1N8ZA 2QR0A 3PV7A 2FIRT 2BVOB 3WFHB 4G6FD 5JPMB 4QTIH 2BNUB 4TUKH 5C1MB 2WBKA 1Q9WA 1CU4L 1X5FA 5EBMA 4KJPC 2J3SA 1T6VN 4QHKI 5IOPB 1BFOA 1L7IL 4KWUA 5IB2A 3VW3H 2ARWA 4NWUH 3VWJA 5BQ7A 4M5YH 1IT9H 1ORQA 5I6XC 2QJDA 4OBRA 1JP5A 3HI6H 3VXMA 3RWIB 3JV0A 1T2JA 4M6OH 5CUSH 2GSGB 5DD1H 1AD9B 1D6EB 2MSPA 4XGZB 3AS0A 5LBSH 5I1DA 4HLZH 2BSED 1WSST 4Y7MA 5HI4C 1XIWC 3HZVB 5JW3L 4FHBD 5FGBC 5D96C 2O26U 2OSLA 4OQTH 4ZAKB 1QSEB 3D25A 1P84K 3K81A 1TZGH 1HQ4B 1BBJB 1FL5A 4R90H 4R26L 1UEMA 5GRXG 4FQXA 1S7RB 4QHLA 5IM7B 1KELL 2VDRH 1YYLH 3DX9A 4FFWD 5GGVY 1D5BB 1U58A 2V2WB 5C07B 3SE4A 1SJVA 4R2GD 1VEMA 3EO1A 3H2WA 4H8WC 1VACB 4M61A 4UNVA 6FABH 1OSPL 3MA7B 5JW4M 1QSFE 2PO6C 3WCYA 1P7QA 3MLVL 4XAWL 1HQRA 3IDUA 1NBVL 3WNPA 2N7AA 3Q6FA 2IALB 4P2RB 2AK1H 5D7LB 4YZFF 4GRLD 4MSWB 1OARL 3QJFB 3QUXC 2B4CL 3C8HA 5EWIH 3LB6D 3ALWA 1YEKL 4KUZL 5KSAD 5ACMA 3WD5H 1AHWA 4KK6D 2V5YA 2R1WA 2F74A 3U7YL 1D5MA 5DSCB 4XPGH 4WHYH 1F4WH 1EAPB 4MNGA 3DX7B 3UZQA 3MUZ1 5I1JL 4HC1L 4ZXBD 4GBXC 2JCCE 3VI3E 3ULVC 1NSNH 1KF9B 1W72H 4LKCB 1JFQH 3O3BB 4PY8I 1GC1C 5E8DH 3PL6B 1XT5A 5C9JA 4LF3A 5DJDB 1NL0H 1F90L 5EH1A 1AH1A 2BSTB 3LKRA 5EOQL 5ID0B 1A7PL 3O3DA 5C0BE 1QLRA 4OFYD 1F4YL 1ZT4B 4JFPB 1XF3B 2HFGL 4K07A 3V6OC 1X7QA 4NQDA 5L7XH 4OJFL 3VCLA 2FL5B 3AB0B 3CFBA 4X98A 3QFJB 1X6NA 5E2VL 4ESKA 5FYJE 5F3BA 3P0VL 3DMMD 3F7YA 3QG6B 3I50L 5GRYA 3L3KA 3QUMB 1B4JH 1FC2D 1S5IH 1LEGB 1OTSC 2APFA 4XCCL 4OLZL 4HHAA 2XWBB 3KPMA 1AGCA 4L9LC 4CU7A 4PV9B 1T03H 4NHCH 4K9EL 5EU5A 4GXVL 3RWEA 3NFNB 3ZKXB 1XF5A 5F7FA 3UC0L 5I66B 4MQXD 5DT1H 4FP8L 3T0XA 3SDDD 4HWZA 4GMTL 1A6AA 1Q9WB 3FRPG 4KMQA 5EBMB 4QHNB 4LVHC 1CFSA 1KXVC 5DMGC 4A6YA 3NFSH 5IB2B 4PB9L 1N59A 2XQBL 4L8SC 2G5BA 4ZFOL 1T7VA 1MH5A 1ORQB 3QUZA 3BWUC 2J8OA 1K2DA 1MFEH 4LSUH 5I19L 3BRFA 3I75B 3L3GA 3TM6A 5I1DB 4Z76A 1GPOL 2YZ8A 1KLGA 1Z3GH 5K33A 3SDCC 2QEJA 1Y0LB 4HKBA 1RULH 2OSLB 4YZFE 3QDMD 3HC3L 4G80A 2YD5A 3VXRD 4K7PL 3Q6GH 4X6DA 3D25B 4KKLD 5LGHH 5HHNA 1U8LA 5LQBH 4ELMA 1FL5B 4GKNB 3VFSA 2R29H 5IWLA 3K2MC 4FQXB 4QHLB 4KRMB 3O4LD 5C86A 4S0TD 1KJMB 3OG4B 3QIWB 1IC4H 3DYMA 5DJ2A 4LVOC 3EO1B 4M61B 4ZO8A 1QKZL 2J2ZA 5J13C 3VRIA 2BSRA 1JTTA 4FQLH 4KROC 4JM2A 1HQRB 2XZQL 2AJXL 3FMGH 4OLXL 2VDOL 3Q6FB 1HIMH 2PO6B 3IFPA 5EIVA 1UCBL 4MNQE 3RNQA 3MPCA 1H3GA 5BW7C 4JQXC 2XKSA 4JFEA 2DDQH 4UV7H 1Z2KA 3FHQA 4RMRA 5DMJB 1AJ7H 3D85A 3IDIB 5HVHC 3ETBF 3MRBB 1DLHA 4YXLH 2FD6H 3UYRL 1I1FA 4UNTA 1IZKA 4KDTA 4P23C 2OTUA 5ICYA 4GG6F 1L0XA 3RL2A 2HYMA 4LF3B 3NN8A 2W59A 3W9DA 1QLRB 1MHCA 1ZGLM 1J5OL 1CBVH 4OTXH 2FRGP 1QFWL 3CVIH 3QEQD 1X7QB 1FO0L 4NQDB 1AXTH 5E4EB 3CFBB 4I18C 5I76A 2H45A 4BSJA 5F3BB 1XMWA 4LFHG 3L3KB 4X7TB 1FYTE 1AR1C 5H37H 1EHXA 3EHBC 4NQEE 4I9WE 1FRGL 5KVFL 2BY0A 4HHAB 3LH2H 5EOCJ 2V9QA 5MI0B 3KPMB 4X80L 1DFBL 5HHQA 4Y8DC 5EU5B 1RAMA 2EIDA 4U1JA 1NC4D 2YRZA 3RWEB 3LHPL 5DS8A 1YMHA 2YSSA 1XF5B 5C0IA 3HTLX 3KPQB 1C1EH 2YK1L 3O6LH 4Q0XL 4ZOCA 2WBJA 1FFPA 5T5FH 4WFEE 1N59B 2EDWA 5E08H 4I5BA 4J3UA 2Q7YA 2GI7A 1DQMH 1WBZA 3QUZB 1A1OB 2PYEA 1YEDA 1KCSH 1K2DB 2DMBA 1FIGH 3MZGB 5HY9A 1JIBA 1VFMA 1MCEA 1EHAA 4ZFGH 5A40E 2V7HB 5L9DL 1JPST 4Z76B 3IS0X 4PYHA 5EUOE 3VFWB 1KLGB 4ZO6A 4XPAL 2AJYL 2BNRA 4HKBB 3SDYH 2DQUH 4X6DB 2YN3A 2ZG3A 2IFFL 1IAOB 4HIIA 5HHNB 4HKJA 3MBXH 3VFSB 1OGAA 2APXA 3ARBA 2FGZA 4JFDD 1J0YA 4LGPB 4KJQD 3U7WH 2NX5D 5FUCC 5D7KE 4BJLA 1ES0A 4RDQG 5E2UH 5FHBH 2BSRB 4OF6A 4WFFD 1I1YA 5BRZA 1CT8B 3IFPB 4HUUA 3NVQA 3NABL 4MJ5A 2H3NB 4OZIF 3RNQB 3CH1A 5CGYC 3RAJL 3WUWA 3OHXB 4XNYL 1CU4H 3QAZC 4G3YL 2VB5A 5C0AA 4CVUA 2ESVE 1B3JA 1L7IH 4LSVL 4BH8B 3D85B 1XCQA 2LVCA 4OD2B 1DLHB 3ZE2F 4S11A 3ZT5A 1QD0A 1I1FB 2YPLE 4KKCD 5ICYB 3RL2B 2UWEF 1EO5A 1WCQA 3BMWA 5LXGL 2FBJL 1C7TA 3SCMC 1TVBA 3NN8B 4M6AA 4JFQA 3HRZA 1A3RL 3DX6A 3FOMA 1MAJA 1MHCB 1IKFL 5JW3H 4PJ8D 1HHJA 4EBQL 2BHYA 5SWSD 5DRXA 5BVJA 2NY0B 5I76B 2OLDA 4LK4A 4WNQA 4M9PA 3TLRA 4R26H 3W39A 4U1IA 4RMUA 4J2XA 1UACL 4PRIA 1KELH 4BELD 2EDDA 2B2XL 1MCNA 4G8FB 1CD9B 3VXTA 1IQWL 4G9DB 2CPCA 4PJ9D 1OSPH 1ZHBA 4H1LA 4AJ0A 3ARFD 4I48A 1PFCA 1A7OL 4Y19D 1HWHB 5IW6A 5HHQB 3DPBA 3MLVH 4XAWH 1NBVH 4U1JB 5I74C 5MHSD 3PJSA 5DS8B 1G7HA 4QHKJ 1YMHB 1U41A 5CP3A 3TVMC 1OARH 5F1IB 2B4CH 3QBTB 4U6TA 1DQDL 4HJ0D 1YEKH 3MGAA 4KUZH 4XPFL 3OKMA 1MI5D 1FFPB 4ZS6C 1N5AB 4J4PD 3U7YH 2NY3B 2JJSA 3GBLA 1YEHL 1YJDC 1WFTA 4I5BB 5I1JH 1IAIM 1ZHLA 4HC1H 2Q7YB 5C3LD 3STZA 4ZUVA 1M71A 1WBZB 2C26A 5ENWA 3OTTA 5T3ZL 5AUMA 1HYSD 3K46A 32C2A 1OPGL 2DYPA 1CVRA 4P3WA 3VG9B 4XNXL 1F90H 4W68A 1R3KA 3NA4A 1JF1B 5EOQH 1A7PH 4Z7UE 1RIUL 1F4YH 2XWTB 3QPQD 2HFGH 4OZIE 4G5ZL 1HSAA 4Z95L 5IHZA 5F9AC 4HIIB 4OJFH 4YC2B 1U3ZA 1Z9LA 5E2VH 2L7JA 3T3MF 4HKJB 1A6UL 1K8IA 2UUDK 4I13B 2YPKA 2Q76A 3P0VH 4Z0XA 2GSIB 2Q87A 4P5KA 3EFFB 4Y2DA 3I50H 1RURL 4ACPA 5IG7A 3D3VD 3RI5K 2Y36L 5E9DD 1Q9LA 3RDTB 1IJ9A 3DXAD 4XCCH 4HX1A 4OLZH 1ES0B 1JGUL 4KKBC 2UWEE 5C0ND 1I1YB 4K3GA 5BRZB 5IJVA 4HIEB 4Z7NF 3KPOB 4K9EH 2OR8A 3QA3A 4GXVH 4QO1A 4MJ5B 2Y6SD 3CH1B 3UC0H 2VH5L 4K3JL 3WUWB 3EJYC 4FP8H 1ED3A 1QRNE 4GMTH 4WDIA 3PGCA 4PY8J 5C0AB 4F15C 1S9VA 1J8HD 4N0CD 4PB9H 2XQBH 2GYSA 2YEZA 4V1DE 3MXVL 4TPRL 3VE0A 2R8SL 5JZ7C 3S35X 4DK6A 4YAQA 2CIKB 3WS3A 3C09C 5CZXD 5JIIA 2IBGA 5I19H 1EO8L 5F7YC 4JO3L 4OUOA 1UC6A 2R2EB 1EXUA 4Q9CA 2ENYA 1TVBB 3HRZB 4M93C 1GPOH 4OM1L 3DX6B 5H2BB 1KOAA 2NTSP 1FE8L 3HC3H 5F9WB 4K7PH 5IBUG 3EDFA 2AAVA 5DGRA 2C3GA 4WNQB 3W39B 3QIUA 1HEZA 5FYKE 1DVFA 4EI5D 1MQKL 4PRPB 1WWAX 5GQBA 3A6BL 3B43A 1GZQA 3U7AA 2KL6A 2N4IA 1KIQA 3VXTB 4ZFFA 2A2QT 5D2NA 1I9JL 1NCUA 1QKZH 5I9QB 1ZHBB 3HMXA 4R7DA 1QO3B 3W5NA 3QDJD 1X5HA 4I48B 5IW6B 1A4JA 5F7EL 3EOYG 4O58L 2XZQH 2AJXH 4OLXH 3UMTA 2VDOH 3QWQB 3BN9D 1G9NL 1UCBH 3MLUL 4LHUA 2ZUQB 2WP3O 3TT1L 1ZAGA 5IMOA 1FGNL 4K94C 4FFVD 1IAKA 2J6EL 3T0EC 2BVQA 3ZKND 1XFPA 3OKMB 3AAZA 4NNYA 4UQ2B 5D1QD 4J6RL 2PUQT 3GM0A 3ZT6A 3T3ME 3KLHC 1M4KA 1GGYA 4ZUVB 1M71B 1FFOA 4QRSB 4XP4L 5AUMB 4P9HC 1MJ8L 3UYRH 32C2B 4PJ5A 5E03A 3C60C 1R24B 2DYPB 4KK5C 3SE9L 2IAMA 5BZWA 2X4PB 4GRWB 1R3KB 2JK5A 2C3WA 4JY6A 1J5OH 1T2XA 1JF6A 3ALXA 5SV3A 3KXFA 1VGKA 3O9WC 4OCXL 1QFWH 3E1F1 4LRNL 1FO0H 4NN7C 43C9B 1CTNA 1K8IB 4KZDL 2YC1A 4X4XA 2Q76B 1CGXA 4Z0XB 5DHVB 4P5KB 4PBXA 3VGEA 1SYSB 4IRSD 5IG7B 3ESVF 1Z5LA 2Y25A 4P3DB 1WJ3A 4M62L 3CXHJ 4FMKA 2BOBA 1Q9LB 4TSBL 1WIUA 1FRGH 2VERN 5KVFH 4HX1B 4B7LA 2GAZA 2BOCA 5CAYB 1OHQA 4MA1B 4X80H 5IJVB 1R3HA 1DFBH 2EO9A 1E6JL 3B8YA 1H3UA 3B5HA 3QA3B 2IH3B 3LHPH 4I0PC 2D3VA 4E41A 4Y16A 1XGQA 2YK1H 3N1GC 4ORZC 4Q0XH 5TE6L 1ZLSL 2G5RA 3MFFA 4WDIB 1FIEA 3KYNA 4PJFF 4Q9BA 1JZ7A 1S9VB 3L6FA 3CIQA 5DDHA 3ZHLA 3I3DA 2YEZB 3T2PA 1X9QA 2HMID 2V5TA 3VE0B 1NJ9B 3NGBB 1IFHL 1F11A 3RKPA 1EXUB 2IAND 5L9DH 4W6WB 2LTQC 3AS1A 3GMPB 3HE7C 5L0QC 1MOEA 4NSKB 2YA1A 2EXYD 4XPAH 2AJYH 3VGHA 1TTFA 4HH9A 5IIEA 2UZIL 2IFFH 2FJGA 4YNYA 4F2MA 1MWAL 4RFOL 1JCKA 2X05A 2DLEA 4HF5L 3QIUB 3CMGA 3L5HA 3B9VA 4NO0A 3X12A 3ZYIA 2HJFA 3AY4A 1GZQB 3P0GB 1KIQB 15C8L 3O6FA 3K4DA 4ZFFB 4LMQI 5D2NB 1U8MA 4R7DB 4EN3D 3QDME 1NANH 3T1FA 2EH7L 3VXRE 1AQDA 5HYJB 1EX0A 2WZPD 3MV8A 3NABH 3DUSB 4HQQL 4LHUB 3PABA 1CDGA 2KUTA 5IMOB 3O4LE 2KZWA 4IIQC 3RAJH 2AEQL 3ARXA 5T5NF 1QHPA 1LDSA 2BVQB 5KJRL 3L3OA 4L4VA 4XNYH 3MQIA 1I85C 4NNYB 4G3YH 2HT4D 3WKNA 3DSNA 3MNZA 3SOBL 4LSVH 1J86A 3VMNA 3WE6A 3HB3C 4ORGA 1OB1A 3RZWA 1E27A 1WAAF 1YEGL 4M7LL 5DVNA 3G6AA 2PXYD 1WTGT 2IAMB 5BZWB 1OP5H 3PG2A 5LXGH 2FBJH 3G5ZA 5AAMA 2JK5B 4Y4HC 3LPFA 1A3RH 1WIOA 1E4XI 2WP3T 1KIUA 3IDJA 3NOIA 1T89A 2Y5EA 1IKFH 3KXFB 3RBGA 4RMWA 1VGKB 4EBQH 5HDLA 3NZHL 5E94A 4MJ2A 3UTTB 4F7EB 3VD9A 2YC1B 1WZ1L 3RU8L 1CR9L 1I9IL 3MOAL 5HI3C 4PJFE 1MSPA 1UACH 3LDBC 1ERNA 1L9NA 4RMQA 1B9ZA 1Z5LB 4WTZA 1YA5A 3VG0L 1MCWW 1X4XA 2BOBB 1HHIA 5CD5D 2B2XH 2N1KA 5B3JF 2W0KA 3BUYA 4Z7WA 2XN9E 5IW3A 1IQWH 2BOCB 3OAYH 3SJVE 4J12A 5C8JB 3S5LG 3T4AA 1A7OH 1I3GL 1R3HB 2ADJB 5I0ZA 5ACLA 3L5WA 1QLFA 1NQBA 4RGND 4E41B 1KEML 1BEYL 2QADD 4Y16B 1M7IA 2EH8L 1DQDH 3MFFB 4XPFH 4LCWD 3KYNB 4P2OD 4OV5B 4MAYC 1YEHH 1IRAY 2YKLL 3GJFK 2R2CA 1KN2L 2WUBL 4U6XB 2JKXA 3GMRB 4CVWA 5T3ZH 3LKQA 2DF3A 1F11B 3MX0A 1OPGH 3Q0HA 1KJVA 2GKIA 3IJYA 4XNXH 1O5DT 1QSEE 1SYVA 3B9AA 4PG2A 1BJMA 3ILQD 3KPSE 1ZSDA 4U05A 4Y5VC 3QXVA 1NGWA 5ECJE 1KENL 1FN4A 1RIUH 4MXQD 3C6LC 2XACC 4AL8L 1A5FL 4HH9B 5IIEB 3UX9B 4QNPF 4HK3J 3QI9A 4G5ZH 4NQUA 4Z95H 2FJGB 5B4MC 4YNYB 1FNSL 4F2MB 4BZYA 2QSTA 1TETL 1LD9A 1A6UH 5FK9A 5J1TC 5TPWL 1FNHA 1S9KC 1RURH 2C7UB 3KPRA 1ZLWH 3X12B 1R3JA 4LQFL 2HJFB 3EYOA 2ZG2A 3VH8G 4WI2A 3WEXB 5BS0A 2AABL 2Y36H 5F93C 1DEEA 1ND0A 4J3XA 3TZVA 2H41A 3O6FB 4YDJA 5GSVB 1TLKA 1WAAE 1U8MB 2HP4A 5CEYA 4MJIE 2PKDA 3C9NA 1JGUH 1D5ZB 4MLIA 3T1FB 5FM5O 4GT7A 2P8MA 1AQDB 3TCLA 4P4KC 1BWMA 3MV8B 1CLCA 3FL7A 1O7VA 4GXUM 4GAJL 2VH5H 4K3JH 5E6IA 2X09A 3UPCA 1PY9A 2DMCA 2NW3B 3GSNL 3VXOA 3K1DA 1MCQA 4J7RA 3L3OB 1MIEL 1BQSA 3BEVB 5CZVL 2AEPL 3KAAA 1OQXA 4RBPH 3MNZB 3RZCC 1U95A 3WE6B 3BZDA 3FKUS 3MXVH 4ORGB 5IJKA 1OB1B 1M7XA 4G6ML 4HUXA 4TPRH 1E27B 2R8SH 1CXLA 1F8TL 1OWWA 1NKRA 1A64A 3G6AB 3TA3C 4CMHC 1T66D 1V3KA 5B3JE 2FNBA 1UZ8A 1HILB 1EO8H 4JO3H 4LKXA 3G5ZB 4NHUA 2YMXL 1VFBA 1MRDL 4RX4A 4OM1H 2GJJA 3LQMA 5GJTL 4WIQA 3EJZD 4J1UA 5IBTL 2VZUA 4OT1L 1K85A 1FE8H 2WNGA 5J3HC 5JLZA 1GYAA 1I1AD 3H9SA 4J3WA 2H32B 4LOUD 3NBNA 3BPLC 4MMZC 4XB8A 3ARUA 5DK3A 1MQKH 3A6BH 5KOMC 4OGAC 3BUYB 4Z7WB 2Y5TA 4LSQL 5DI8A 3L7EA 2BXYA 5IB3B 2NQCA 4QF1A 1I9JH 4NRZB 1A9BA 2XXMB 2F53D 5F7EH 3FRUA 1INEL 4O58H 5FM5M 1NBYA 3GFUA 3L5WB 3JVGA 1G9NH 1I8LA 3MLUH 3TT1H 2X2YA 1ZLVK 1FGNH 5F7MC 1M7IB 2J6EH 4JRXE 1CE6A 4QNPE 2NY2B 4YBLC 3IDYB 4UZGA 3VXME 1ODAA 2VDML 4J6RH 4OGZA 1Q0XL 3KR3L 1KB5L 4DWHA 2E3VA 4H8WL 5CEZL 4XP4H 1MJ8H 3FQRA 2CQVA 3C2SA 4Z18A 1KJVB 3SE9H 1C08A 3FQTA 5ERWA 1NEZG 3QHTC 2BVEA 1ZSDB 3FT4A 2OR9L 4HAFA 4PJIB 1FZKA 4TQEL 1FN4B 4P4RA 4OCXH 4JN2A 4LRNH 5ITFA 1CIDA 3OPZL 4BZ2L 1FP5A 1LD9B 1CICC 3LN4A 5FK9B 4KZDH 4WW2A 2VLJB 4PRHA 4B41A 3X17A 3ULVL 3KPRB 1A6TB 5J7CC 1R3JB 2CRYA 3EYOB 5B22A 4NYLB 4M62H 4TSBH 3TZVB 1RHFA 5DC4B 4KKAD 5D71L 1O7SA 4YDJB 3FFDA 5CEYB 2FGWL 4X6DF 3C9NB 4YEFA 3ME0A 5CS7A 2LABA 4LGSB 4DEPC 3GSQA 4LSSL 4ELMF 1E6JH 3F7QA 3BZFA 3SBWC 3NFPB 1J87A 2VQ1A 1G7LA 5DUBA 4XWOC 5E6IB 4UDUA 4APQC 2B39A 3GMMA 4MNGE 4LVEA 5TE6H 4PLJD 1ZLSH 4P57A 3DTXB 3AS3A 2Q3ZA 2YN5A 1P4IL 1A02N 3WS6A 4JM2F 2O61A 4HUXB 5I1EL 1OGTA 2A9ML 4D3CL 1KB9K 3FQUA 2ATPA 2EYSA 3OF6A 3O3AA 1UZ8B 5CGTA 4EKXA 1NGQL 4LKXB 5KANI 4CAGA 3OB0H 1SM3L 4HMEA 4K2UL 4J1UB 1J8HE 2ARJA 2OM5A 4DTGL 2UZIH 3D1MC 5JLZB 4G43A 3B3IA 3X11A 1BECA 1OTUC 2AV1A 3H9SB 2ICWI 4LLQB 1KYOK 1MWAH 4RFOH 3FQNA 4HF5H 4WFGD 5D6CB 3MRPA 1RUPL 1WV7T 5C0CA 2H8PB 3GJFB 3SGKC 5EU7E 5HJ3A 1YNKL 4R4ND 3LN9A 4ONHA 3WDHA 2Y5TB 1F3DH 4NN5C 3ZZ1A 15C8H 5DI8B 3L7EB 4U6YA 4QF1B 5JXEA 1A9BB 3AREA 3RVUD 4PP1C 2EH7H 3FRUB 1NDGA 3GRWL 1MNUL 3L95A 3PWUA 5IFAL 1FVCA 1NBYB 1CK0L 2MKWA 4HQQH 1LQSR 4HK0B 1JZ8A 4MNHA 2IWGA 5JA8B 2AEQH 1CE6B 5KJRH 3KPNB 4LLVA 1H3PL 3UTPD 1EVUA 5HGBA 2A38A 3SOBH 3V7MA 3CPLA 4JKWA 5AG9A 1U93A 1YEGH 4HGMA 4M7LH 3SEPA 4UUJA 3FQRB 1UKSA 1EJ6A 4GBXA 5H94B 4OAWA 3FQTB 3KS0J 5ERWB 2EO1A 2VISA 1IZJA 3FT4B 3DROA 5EBLA 2F54D 4ELME 1TZIA 1FZKB 4DK3A 3RGVC 2IBBA 4P4RB 4JN2B 4M1CD 4OF3A 3NZHH 3NCMA 4QXTA 5ITFB 1NUDA 3BXNB 1XF2A 5IHBA 4NQCD 2PTVA 1WICA 1WZ1H 3RU8H 1CR9H 3QT2A 4PRHB 1I9IH 2X70B 3MOAH 4LNRB 1D7FA 3D48R 4MB3A 2R4SL 5DJ8B 5B3NA 3VG0H 3IXAB 1OTTD 3L3HA 4B0MM 4OSUL 4G9FB 3PWJA 1P9MC 5A43C 3WNMA 2OP4L 5GZOC 5ALBL 3RJQB 4GS7C 2I25N 3GSQB 1I3GH 3B5TA 1ORSB 1RY7B 1L4IA 1HH6A 3BZFB 4JFEE 4WEBL 2VQ1B 3GJEA 1G7LB 3ARDD 4HWUA 3AROA 4NCDA 5DUBB 3FRPA 4IS6B 4R0LA 1KEMH 3MRGA 1BEYH 1GH7A 3GMMB 1VEOA 3HKFA 1CVSC 4L9LA 2EDLA 4YGAB 1JRHL 4I1NB 2EH8H 5KBNC 3DUHA 4D9QE 1KB9J 4HJJL 5D2LA 1DQLL 2VLRB 1NMCC 4L1DA 2X4TA 2VWEC 1KTKE 3KLAA 2O61B 5JPNA 2PR4L 2YKLH 1WC7A 3R1GL 1F3JA 1OGTB 1EERB 1KN2H 1T1YA 2WUBH 2Y9RT 3FQUB 4JPIB 3PDGA 1ADQL 2EYSB 1GOFA 1P4BL 3T65B 1OCWL 4L8SA 1J1PL 3RQ3A 2K9UA 3E3QC 3U6RA 3KJ4B 1MFNA 1T1WA 4ZOBA 2C3XA 3MLWL 3V0VB 5F3HA 1KYOJ 2QTEA 3SDAD 1KENH 1UJ3B 4HS3B 4L8DA 2I5YL 4AL8H 1A5FH 4F33A 4G43B 3B3IB 1TPXC 1P6AB 3X11B 1WBYA 4E5XB 4L29A 3H9HA 3GRWA 1FNSH 3HUJA 1TETH 4GO6B 4YDLC 4PJHA 5TPWH 4E9LA 1NGPL 2DM2A 3PWVB 1A3QA 2J4WL 2ZSWA 4LQFH 4KGLA 5C0CB 2DQIL 2AABH 5D7JA 1FJ1A 4ONHB 5AD0A 3F62A 4HKXB 1Q94A 1XR9A 3WSQL 4U6YB 5EA0L 3QRFM 2FO4A 3AREB 3MREA 1OP9A 4BYHA 3GO1L 4FG6D 3SKNB 1NDGB 4XPHL 4RGMB 3HAEG 2FHFA 4P5TD 5DFWH 4GAJH 4MNHB 4QRQA 1TTGA 3GSNH 1BZ9A 1JPSL 5DO2D 4IMKC 4DUXA 1MIEH 2PYEE 5SX4I 5CZVH 3VXSB 4HWNA 5HGBB 2AEPH 1KPVA 4KK6C 2I24N 2QL1A 3GHBL 3L5JA 1IBGL 3CPLB 5D9SA 4G6MH 1X6LA 1P7KB 1U93B 2G2RB 2H2PC 4N8VG 3L5IA 3TNMA 1BREA 4F7CB 1F8TH 1KEGL 3GSXA 3STZB 3IF1A 5D7IB 3BQUC 2BNRE 3PNWB 4DVBA 4OZGA 2XICA 2EIBA 2OZ4L 2P49B 4QOKA 4OAWB 4OCYL 5DGQA 3DGGA 1T0MB 2YMXH 1G7IA 3RVVC 1MRDH 3DROB 5EBLB 5GJTH 5C70A 4KV5F 1OGAE 1GGIL 2AP2A 3K4ZA 5IBTH 4XPTL 4OT1H 2WV3A 1CGTA 3DECA 3RVTD 4MMXC 4NO2A 4QXTB 2W91A 1XF2B 4W4NA 2DQDL 2GK0B 1CD1A 4EOWL 1U8HA 2W9EL 3F8UB 4HPYL 3CFCL 4OQ1A 1HE7A 1D9KC 3W81A 5C71A 4YFLI 4LSQH 5L8KB 2JE8A 1KCKA 3K74B 3MJ9A 5E8NA 1HK6A 1INEH 2GY7B 4S1DD 1BAFL 5C0AE 1FSKB 4R0LB 2NXZD 3EO0A 1OP3H 4XHQA 5DEFB 3HZYA 3HNSL 3MMEA 4BKLA 4ZAKD 1PQZB 5D2LB 1PGRB 2VDMH 1AIFB 4OIAA 1Q0XH 2X4TB 3KR3H 3U82B 3KLAB 1KB5H 5E2JA 2CDFA 3WXWL 5JPNB 4AK1A 4H5SB 1T1YB 5IMLA 4H8WH 5CEZH 4LCUB 4M1DL 5IEHB 5C07D 2OL3L 3U6RB 1JPGB 1T1WB 3GEWB 5D6DA 5A1AA 2A0LC 3QUYB 4LCWE 2RIKA 1HHHA 4ZTPL 2OR9H 3F58L 4L8DB 3TEUA 4TQEH 5CLWA 4MCYA 5K9JL 5KSVA 4PRIE 4P2RD 1AO7D 2HAZA 4G42A 3MRQA 5D7LD 1YMME 4F33B 4WI7A 1Q9OA 3FT3A 1WBYB 4Y2OA 4EXPX 4JO2L 2GCYA 3OPZH 3HUJB 4BZ2H 1YJDL 2E7LC 3MJGX 4PJHB 2ZJSL 3VFUB 3ULVH 3BD5A 2ZSWB 1NGXB 1T0NB 4KFZC 1IGFL 2IQAA 1PAMA 2D9QB 3ABZA 4QGTA 5D7JB 1FJ1B 1X4YA 5D71H 2E9WA 1XR9B 2IF7A 3AS2A 4L3CB 3HCVA 2FGWH 2FO4B 3MREB 4KKNA 4U7SA 2BC4B 4HLZG 5F6HI 3CVHA 1HHKA 4LSSH 1NCNA 1X5LA 4JB9L 5F1NA 1TJIL 4QRQB 5BMFL 2XRAL 4H26A 4KV5E 4KXZI 5B8CC 1BZ9B 3HC0B 4N0UB 2DOCA 2ZCKL 1YPZA 4LLDA 1L7TL 1JHLL 3TPKA 4GAGL 3IFLL 4HGWA 4XCNB 1P69B 1P4IH 3WBDA 3QFJD 4HG4K 1L6XA 4U49A 4AIZA 2X42A 1DANU 4JFXB 2YD3A 5D9SB 1JHTB 1U8QA 3S4SG 5I1EH 1REIA 2P4AB 2A9MH 3ULUF 4D3CH 2DM7A 2WLYA 4OZGB 4I3GA 3CZFA 1NGQH 1XCTA 3DO7A 3RGHA 2CR6A 2OXGA 3DGGB 4U0RC 5CJXA 1J1XL 1G7IB 3MBEC 4PJ7B 4U1HA 4KMTL 4L4JA 4XMLL 1SM3H 1GXEA 4K2UH 3DV6A 5BOPA 4CJ0A 4DFIA 4X83A 3NTCL 4DTGH 4NO2B 4M8QB 1A3LL 3IGAA 3D9AL 2I26N 4N8CL 3VGGA 4WHYG 1U8HB 3RL1A 1RUPH 5GRWA 1U8IB 4K7FB 3L3IA 4KJPD 1YNKH 3TJEL 4IDJL 3DYPA 5CSZA 4JN1L 2Y06L 4S10A 1K6QL 5E8NB 1KGCD 3GRWH 4Y4KA 1MNUH 5IFAH 3C5ZA 4TNVK 1VGEL 5ANMA 4FFYL 1CK0H 1YYML 3D69A 3WDJA 1U3HC 2OL3A 5HI4D 1XIWD 4OZHA 3HZYB 4BKLB 1WK0A 4PG9A 3BKCL 1H3PH 3TVMA 2QSVA 3MLTA 2XQYK 2CDFB 2VSDA 2VE6A 4TUJB 2OI9B 1KCUL 5IMLB 1QR4A 3EDJA 2DN7A 5JW4N 4HUWA 1IAIL 5EPMA 5KAQF 4WVRA 3MV9A 4G7YL 3QIWD 3OKYA 1NMAL 4ZD3L 1TNMA 5LCVL 1HHHB 5CEZD 4PJBE 1FZMA 4R6UA 4MCYB 4R8WL 5KSVB 1MLBB 4G42B 3MRQB 2PO6D 2X4OA 1UM4L 3EOAA 3I9GL 3FT3B 1P5VA 5KZCB 3MRJA 4WU7A 4KRNA 1HDMA 2Y07L 5D2NE 5HVGB 5ICXB 5K93A 5JO5A 1X5GA 4M3JA 4X4ME 2R4SH 2IQAB 4P9HL 2RFXB 1AGBA 4X4ZA 4HCRL 4OSUH 1BJ1H 3ULUE 1RD6A 1NAKL 4KJQC 4P2YA 5T3ZE 3VRLF 2OP4H 3HCVB 4P3CL 5ALBH 5HHOA 3UBXI 1U6AL 1RJLA 1CFNA 2Z31C 3CVHB 1HHKB 1VFAA 2VAAB 5HYIA 5MEND 4NNXA 4YHLL 4FQHA 5T3XL 4CDHA 4WEBH 1NPUA 4PR5A 5F1NB 2Y72A 1X5IA 1KPUA 3N1MC 4HG4J 3QXAA 4H26B 2NY7L 4FQCL 1LO4L 4OKVA 1JRHH 1F13A 4LLDB 5E70A 3D18A 4HJJH 5HD8C 1HH9A 4HGWB 3BIKA 3FB5B 3T77A 1KFAL 1DQLH 4PJ5E 2E6JA 5JHDB 3EDEA 2YD7A 4GW5B 2PR4H 4GUPA 3R1GH 3R06A 3RVWC 4P46A 3VA6A 1ADQH 1P4BH 4JVWA 4WV1C 1OCWH 1J1PH 3KXFE 3OXRB 3CZFB 4DJMA 1XCTB 3DO7B 5D4QA 4JFFA 5FDYA 1FL6B 2F19L 3MLWH 4MQTB 5DJZA 3DV6B 2QQKL 3T0BA 2I5YH 4LCYA 1IAMA 1V8HA 4OF7A 2BFVL 1F4XL 5DRZA 3EZ8A 5I17A 1VFUA 4YDIL 4BM7A 1N26A 3IGAB 3WIFA 2ILLA 3VMOA 3NIFE 3SKJL 3P0YL 1NGPH 3JSSA 5SWQA 4WW1A 2J4WH 2K7QA 1KUMA 3V7AE 2BNQA 2DQIH 2EDQA 4NOBA 4AMKL 3L3IB 4Y4FC 2Q20A 2VDPL 5DMGD 1QVOA 1G0DA 5CSZB 3QUZD 2ZPKL 3WSQH 5EA0H 4ZDHB 2FX7L 1HSBA 3GO1H 5J4MA 2W60A 3ARPA 4RZCA 4Y4KB 4PJ9C 4XPHH 3C5ZB 4YHML 4NBYB 5ANMB 3LEXA 4GKZA 4MZ3A 2QKIA 4WFGE 5KG9A 5MEOA 3O2VL 1IM9A 1JPSH 2FIKA 4OZHB 2VZ1A 5TE7L 5TJWK 4Z7WF 4V2CB 3T1WA 1BBDL 1V7ML 3SDCD 1JUFA 1MJJB 3VA2C 1FLRL 3FFCD 4OI9A 4JE4B 4K7PX 4C56B 3PWPD 4HUNB 4J4PC 3GHBH 3T0EA 1IBGH 5H37G 2VE6B 5FV2A 5EPMB 1S7XA 2VN7A 3CFJA 4NM8L 1EEUA 5FYJU 1KEGH 1PBYA 1LEKA 4MWFB 4HAGA 4UT7L 1HYSC 2OZ4H 1RFDL 4EUPH 4NM4L 4OCYH 3VRLE 3MRRA 2VZOA 2JELL 2CRIA 4G8GA 3C87A 3C60A 1FZMB 1GGIH 5C09B 3N1PC 2X4OB 4XPTH 5JOPE 5IV2B 4YXKL 3PQYA 3WNOA 3QPQC 4ZSOA 3MRJB 4WU7B 2DB8A 2DQDH 1HDMB 4EOWH 2OMBA 5JO5B 3O9WA 3KNBA 5J9PA 5GSRA 2W9EH 4HPYH 3CFCH 3WLWD 5DZNA 1AGBB 1I8KB 4Z77A 4U31A 2GEEA 1B0WA 3UCRA 4PJAE 1CFNB 1T20A 2DLTA 3DVNA 4LCCC 1VFAB 4L4VE 4F9PC 4NT6A 5D93C 1ZKAA 1CIUA 4FQHB 4P23D 4P5MA 1GCFA 2XTJB 1BAFH 1JI2A 1OW0C 4PR5B 5FO9B 1RI8A 4QRPA 3QXAB 2Y6SC 4XXCC 5IEKB 3D18B 5FGCB 3V0AC 3HNSH 3PGDA 1HH9B 2ICCA 1EEZB 3AU1A 2NY0D 5HDBF 5GGUB 1T7XA 5LKNA 1DE4B 3WXWH 1FORL 1YDPB 4GUPB 3TYFA 3QEUA 3R06B 4N0CC 3HHRB 3DV4A 4P46B 3WJLC 4GQ9L 1IEAA 1NFDB 2P44B 3BP5A 4M1DH 5A16A 3F7PC 1BP3B 3O2DA 2OL3H 3UDWA 2FCBA 3PDDA 1P4LA 5DJZB 5IR1A 1HN1A 1KJ3L 3O3UN 4JVUA 4ZTPH 2V2TB 1J10A 3F58H 4X6BA 4WRLA 5IBUB 4WUUB 5K9JH 3OG6B 4AEEA 4NRYA 2W0FB 1BOYA 4JO2H 3WIFB 5BV7B 4NC0B 1YJDH 4Z7WE 3OJMB 2AXFA 3G5YA 2ZJSH 4O51B 3V6ZA 2NY3D 2P43B 2UY6A 1IGFH 3TN0A 1KN4L 1QSFA 1CDBA 3HG1D 2WLZA 3LPWA 1YC8A 4EI5C 1KPRB 1FHGA 1U8OB 4XH2A 1NDMA 1A7NL 3JWDC 4EDWL 4Z7VF 1HSBB 5KS9B 2W60B 4RZCB 1ZHNA 2AK4D 4GKZB 1NCBL 2FEEI 4XCEA 4JB9H 2QKIB 2I07A 1TJIH 5KG9B 2OTWA 4Y1AA 5BMFH 2XRAH 4YJZL 5DVKA 1WUNT 2ZCKH 4WFHD 1L7TH 1JHLH 2DQFA 2JCCA 1PG7W 1H5BC 4FFVC 3IFLH 4GAGH 1JUFB 2VO5A 5EU6D 3QULA 3LEYL 1MEXL 5D1QC 1CLOL 1BVLA 4W70A 1S7XB 5H35A 3R4DA 1BD2B 4PUBL 3CFJB 3B2UD 3OBAA 2X5PA 2N7BA 1LEKB 3RDTD 4XC3L 2ZKHL 2E7CA 4PREA 4PJCE 1U8PA 3OKDB 3MRRB 1YECL 4KDWA 1J1XH 1CL7I 4M4PA 1CLYL 3BRGC 1HOCB 1H3WM 2HFTA 5MEQA 3OKLB 4KMTH 4XMLH 5KVDL 3GMNA 3RTQA 1TXKA 2HFEB 3EO9L 3KPRE 3NTCH 3PQYB 5BS0E 4ELKB 1C16B 4NKOA 4ZSOB 2JB6B 1A3LH 1GGBL 3D9AH 4N8CH 3VFGL 3ZDZE 4NO5B 5CGYD 4P2QB 5HDBE 3KNBB 5J9PB 3QFDA 5F6HJ 5T1MB 3CLFL 3S5LA 3TJEH 4IDJH 4JN1H 1T6WA 2Y06H 1GZPA 3LOWA 3H7LA 4X5XB 1K6QH 3BVNA 3V0WL 1T5XA 4WW2F 4ENED 1WISA 4NT6B 1VGEH 1T0PB 4P5MB 5HHME 4FFYH 3BZ4A 1YYMH 5GGTA 5DQ9B 3ELAT 4HUKB 4EEEA 3SCMD 1TFHA 3FQWA 5BZDB 4G7VL 1OLLA 5J0BA 1H8OA 3PGDB 2WWKO 2ZOLB 4NKMB 3BKCH 4XX1E 1U91A 4Q97A 7FABL 3QJHA 3H9YA 4Q6YA 1IGTA 3CGTA 3QEUB 3UEZA 2FATL 3SDXA 1KCUH 5C0FA 1IAIH 3TIDB 4PRPD 2HMIC 4CVXB 4G7YH 1SMOA 5A16B 1K4CA 4UOJA 2ICEA 1NMAH 4ZD3H 4Z7VE 4CJ1A 1P4LB 2DQCL 4WI3A 4NUGL 4YK4B 5EZLA 5LCVH 5EZJA 4X6BB 2Z35A 4MYWB 4OV6F 4X7FC 4R8WH 2UUDH 1UM4H 3I9GH 4NRYB 1C12B 5LGKA 5HXMA 1EHNA 1BVZA 2EYRA 2D7PA 3VH8A 3CU7A 5FYLE 1VKXB 4I8DA 2Y07H 2IPUG 3BGMA 1QLEL 1H3XA 1KCLA 4EVNB 3TN0B 4P9HH 1R3LA 2LV4A 1QSFB 4ZS6D 4F7TA 4HCRH 4AIXA 5I1KL 4XAKD 1GOGA 4FTVA 1NAKH 3MLXL 4XH2B 1NDMB 4LEOB 1H3TA 5E1AB 4P3CH 3CFDB 1U6AH 1ZHNB 2D0FA 1G1CA 5ID1A 1M05A 1EDQA 2HLFD 3AMKA 4YHLH 4EIGB 5T3XH 1EIBA 4XCEB 1WFOA 4OZFH 2OTWB 2WM0A 2NY7H 4FQCH 1LO4H 3S3PA 1P1ZB 4OCLC 2DQFB 3H0TA 2JCCB 4P4KA 3QDAA 1KFAH 2MHAB 5IB1A 3QULB 3L3DB 5L2KD 2HT4C 2LU3A 2BVYA 5H35B 4KZEL 3BKML 5C0BB 3MYJB 3LRGA 3P11L 1PZUB 1UEYA 4PREB 1U8PB 2PXYC 3L9RA 12E8L 2F19H 2J8HA 5MEQB 1FZOA 1I7RA 4Y0GA 2J8UA 3RRQA 2QQKH 3GMNB 3RTQB 4TVPE 2BFVH 1F4XH 1ZA6A 2WIMA 4NKOB 2MNUA 4RA0C 4YDIH 4A2MA 4NQEA 4BQBA 1CG9A 3SKJH 3P0YH 3CUPA 4H0GA 1EEQA 3EJYD 5D1XA 3LKNA 3QFDB 4AMKH 2VDPH 1J05A 3S5LB 4U1GC 2ZPKH 1GZPB 2FX7H 3VD7A 1CGVA 1S8DA 4HKZA 2VLLA 3OZ9L 2CLVA 3BVNB 1SBBA 1T5XB 3BGFB 1XAUA 4YHMH 3DRTA 4WI6A 3BZ4B 1QNZL 1WFUA 2BHZA 3O2VH 3FQXA 4RGNC 4NN6B 1X5YA 5TE7H 5FEBA 4LPTA 1BBDH 1V7MH 5E1HB 1C7SA 2NXYB 5DD6A 1YY9D 4AQOA 1QBLL 1FLRH 1U91B 3O41A 5J11C 4P2OC 1IGTB 2FZ3A 3TBYA 4ZO7A 3QIUD 2VZVA 3JV6B 2BDNL 5C0FB 4YHYB 2QHLA 4JKKA 5EUOA 4NM8H 4PGCA 1NEZA 3DVGA 1KTDA 4UT7H 4ETQA 1JHKL 4URTB 1RFDH 2ICEB 4NM4H 2GJ6A 1A0QL 2RCSL 3MRHB 5EZLB 5D2LF 4KRLB 2JELH 2VUYA 2Z35B 3MRIB 5HYJD 5AWNL 3FB8B 1N7ML 4LHUD 4C58B 4MXQC 4YXKH 3OV6A 2WWKT 4LSPL 1JNHA 1CS6A 4E42B 3VH8B 3BGMB 3HPLA 4UIMA 2VYRE 4NPYA 1X4ZA 5IQ9A 1RZ8A 4NKQB 5EG6C 4F7MA 1JN6A 2HJLB 4FTVB 2IPKB 5I73B 4MNQB 1ZT7A 3CJJA 4IJ3C 4AT6A 4JM4L 4ZFZA 2IADA 4X4YB 2IAMD 5ID1B 1M05B 3BW9A 1PZ5B 2OJEA 4KK5D 5GRUL 1WBXA 1SEBA 5EN2A 2XNAA 1AGEA 3SKOA 5F9OL 2ENSA 3A6OA 2GJZB 3H0TB 2QSCL 2DLIA 4PGZA 1OAQL 5EUKA 5IB1B 1NGZB 3V4VL 3IJHA 3UTTD 5GS3A 1ZT1A 1ZEAL 8FABA 4XXDA 4LP4A 1FORH 3I6GA 3ULVE 4ZG1A 1XGTA 1PEWA 1GGUA 4GKOA 5MENE 4GQ9H 4BFEA 1OAZL 5DJAB 1E4XL 2X9WA 4DZ8A 2W1NA 5FYKU 3UBXB 2EDJA 3L9RB 4JY4A 2CSPA 1I4FB 3BRDA 4JG1L 3OKNB 1KJ3H 1XGRA 1CQYA 4H25A 4C55A 3C6SA 4F80A 2EDOA 3T04D 3V6OE 3EJZC 2HG5A 4FQJL 1FYTB 4E41D 1LMKA 1ZA6B 3DHMA 4NQEB 1R5WA 1LP9A 1A1MA 1CG9B 1VHPA 4OZGF 1I1AC 3MJ7A 4PRDA 3CUPB 5ICZB 2HN7A 5HTSA 5D1XB 4WWKC 3LKNB 3EOTL 1BJ8A 2OBGA 4NQVB 1KN4H 1J05B 3LD8B 5GGQL 4EDWH 1A7NH 3WN5C 3LIZL 3SY0A 4QY8A 1S8DB 1VB9A 2CLVB 4M7ZB 3DRTB 1NCBH 4OCNC 2CXGA 2A83A 2MKLC 3BAEL 4H88L 4HWEL 4O2CA 3GK8L 2Y23A 5JQHC 4YR6A 3VFRA 5HPMB 1B0RA 1I8MA 1LK2A 1UB5A 5DD6B 4BFBD 3O41B 1RZIA 5IK3A 3ZDXF 3LEYH 2FZ3B 1MEXH 3G5VA 5DF0A 1CLOH 4PJGE 1C8PA 2QSQA 4WUKL 3TP4A 4PUBH 4IOFC 5EUOB 4PGCB 2ZUWA 1NEZB 3W82A 3DVGB 1KTDB 3P3YA 4Z7UA 4XC3H 1NC2D 3WHE1 4ETQB 4K8RL 2ZKHH 3O6FD 2GJ6B 1YECH 1QQDA 4IBLT 1CLYH 2MFNA 1IGJA 1MCDA 1QSVA 3FFCE 4D94A 5KVDH 1INQA 3MV8D 3EO9H 2NY6B 3V8OA 1MY7A 2NZ9D 1GGBH 2F5BL 4GFTB 3VFGH 1T5WB 4UIMB 3DURA 4NPYB 3UO1L 3W0WA 3ZYZA 3S37L 1SY6A 3LPGA 3CLFH 2FBOJ 2X6MA 5JIHA 4UU9A 3UTSA 3HB3D 1YN6A 4QRRE 4AT6B 3CSYA 4ZFZB 1DCLA 2XG4A 4XVTL 3V0WH 1QRNA 3BW9B 3D87B 2DTML 3OB8A 1WBXB 5KSBF 1I1RA 2MQ3A 4L3AA 1SEBB 1T1XA 4I2XE 4Q74A 4NJ9L 1N64L 2XNAB 5HHXL 3SKOB 4Y4HD 4RDQF 2D7MA 5DVMA 4V1DA 4G7VH 2YD9A 1RK1B 5IGXL 5IFJB 3GJFH 5FF6A 4L3EA 3TNNA 4PLJC 2YPLB 4Y5YB 4D9RD 2AI0L 7FABH 3IJHB 1ZT1B 4LRIC 4XP1L 8FABB 4QOKE 3I6GB 1BFTA 1INDL 3VRJA 2FATH 3P77A 3KYMA 3G6JE 1XGTB 1MHEA 2CKBA 4LSRL 1L0YA 2B5IB 3MJ8A 3MLPA 5HI3D 5DZOA 2LU4A 2ED7A 1UGNA 3LKSB 1A14L 3DSFL 1YPZF 3WLBA 2MTPA 3MRLA 2MMXA 4GAYB 4QRUA 2DQCH 4JY4B 4NUGH 5D1ZC 3NCYS 1BPVA 1FGVL 4FXLA 1NMBL 3C6SB 3LRSB 5C0JA 2NY1C 2Q6WA 2HG5B 2YPVL 1GOHA 2E6PA 4YHPB 3FB6B 2I27N 1I8IA 1LP9B 1A1MB 5IW1A 3R8BB 2VNCA 4LARL 3MJ7B 2YBRB 2HN7B 1PDKA 2FWOA 4PJEA 3RIAF 1QLEH 4RWYL 4Y88A 3ZDXE 3P9WB 2ERJB 4NC2B 1PYWA 3U46A 4O9HL 5DUPL 1DLFL 2B20A 5I1KH 1RJCA 4HEME 2KQNA 4MAYD 3MLXH 3TT3L 1A2YA 2Q3AA 1S78C 4KRPB 1MRFL 5E00A 2ARJQ 3NZ8B 5I1LA 3RVUC 4XNZC 2A83B 3RWCA 2EEBA 4O2CB 3PP3K 2P7TA 2WW8A 4ODTL 1S7QA 5J1SC 4YR6B 3VFRB 1I8MB 1B0RB 3PGFL 5FGSA 4X6CE 1LK2B 4YPGA 5EOTA 3TPUA 3HG1E 4KI5D 1E28A 1J0JA 1UB5B 1JPTL 3KLDA 5FB8B 1RZIB 1IEBA 2YD1A 4LAQL 2EE2A 4N1HB 4N8VA 5DURB 5IK3B 1G9EA 3BSZL 4GRLA 4XP5L 1BVKA 1S9WA 5EC2A 2VLJD 4IMKA 5FM8A 2GIYA 2AK4E 4KZEH 5KSAA 3BKMH 1XH3A 3MCLL 2HRLA 4Z7UB 4D0DA 3P11H 1IL1A 4GXUN 4OZHF 1TNNA 4RAHA 5DD3L 3EYQD 4OZIB 3M1BA 1QQDB 4ZXBA 12E8H 2NLJA 1DBML 1IGJB 2HH0L 4JKLA 1X3DA 5EU6E 3HI5L 5BOZG 1INQB 3LEVL 5KSBE 5HGAB 4HJGB 1NAML 2I9LA 3EYSL 1AR2A 3SGJA 2Z4QB 3QWRA 1MCKA 1DJSA 2X1OA 2PTUA 1AXSA 2DICA 4OFYA 5J89A 4NNPL 1K4DA 2NNAA 2UWEB 5FUCE 3GNML 5GS1B 3MOBL 3UTSB 4UU9B 1BMGA 1FH5L 3DMMA 1YN6B 3CSYB 3OZ9H 4JAMA 1YPZE 3MROB 1QRNB 3QNYA 1DDHA 1QNZH 4RX4D 2IGFL 4MD4A 5C0RL 1MCLA 2E6QA 1TQBC 3K2UL 4V1DB 3I6LE 5FF6B 5DJ0A 3Q5TA 2D2OA 3U36A 1WLHA 1QBLH 3T09A 3IXTA 3LV3A 5HYSB 5BJTA 1KJ2A 3WFZA 4G6FB 5CBEA 3VRJB 3P77B 2CKBB 1MHEB 1XGUB 3SDDA 2BDNH 5FOBA 1FNGA 1F42A 3QHFL 1IGYB 4PGJA 4UT9L 2ZOKA 3SO5A 3GSWB 1CFQA 1JHKH 4JANA 1CN4A 1CFBA 3D6GA 1A0QH 4XZUA 2RCSH 1AP2A 5AWNH 5C0JB 5F7DA 4LGRB 2IH1A 1N7MH 4AH2B 4HPOL 4LSPH 3MNVA 3MGTB 1I8IB 2NY1B 5IW1B 3K8LA 5DWUL 2DBJA 2BY2A 4MXVE 4ETYA 2O5YL 3E2HC 5CIPB 3QDMA 4TNVF 3U46B 3VXRA 2JLLA 2X4UA 4MCZA 4PTUA 2H9GA 4D0BA 1P6FA 1ZVHA 1J0KA 1NGYA 1JWUA 5AZ2L 2R1XA 1A2YB 4JM4H 3HAEB 5CBAA 3O4LA 5J6HB 5DHYA 1VADA 5E00B 5I1LB 3AGVA 1MJUL 2JJUA 4FG6C 4OQTA 5GRUH 3RWCB 3SKUD 2P7TB 4R2GB 1S7QB 3I85A 4MA3A 2GTWB 5F9OH 1HI6A 1WT5C 5IBLD 4YHIA 2QSCH 1E28B 1OAQH 5FHAL 3QWOA 3MV9E 3S4SA 1IEBB 2E8YA 1A9EA 4N8VB 5A2KH 3V4VH 3ECBA 4GRLB 4FS0A 1S9WB 1ZEAH 3VFMA 2Y7QA 5EC2B 4PGEB 4FQ1L 5KSAB 1OAZH 3GMQA 1T1ZA 4D0DB 1E4XH 2EC9U 4G9FD 2K1MA 1IL1B 3UJTL 1FC1A 2R0KL 3M1BB 3P73B 4ZXBB 1LGVA 2NLJB 3VWKC 4KUCF 4JG1H 2RJMA 5JDSA 2JJTA 3H7BA 4BSWA 2Y4SA 4FQJH 1D5XA 4LVNC 1BF2A 4XWOD 2XN9A 1DN0B 5F1OB 4AENA 5ACZA 5HHOE 1N3NA 3IU3B 3EOTH 3EGSB 4IRJA 6CGTA 2VLRD 2YA0A 4JLRA 1K4DB 2NNAB 3QEQA 4K7PY 2VDQL 2X41A 4DKDC 5DJ6A 4OIIL 1FCGA 5GGQH 3DMMB 3UPRB 3LIZH 4JAMB 2VL5B 2PETA 3IDMB 5FGCE 3QNYB 1DDHB 5BV7L 3BAEH 4H88H 3UP1A 1CWVA 4HWEH 3P9MA 4MD4B 3GK8H 3X13B 1IQDA 5ABDE 3UTZA 1WCBA 4XX1G 5DJ0B 3GKWL 4RSVA 3GMLA 4MHHG 3U36B 3IXTB 4MD5A 3D2UB 4ZAKC 5BJTB 3MRKA 1KJ2B 3NA9L 4JFFE 1UB6A 3SDDB 1EK3A 1QHOA 4WUKH 1MAML 2JJVA 3OR7B 5IHLB 5C0CD 4PY7A 2L0DA 2Z92B 5AYUL 3MC0A 4KDVA 4K8RH 4JANB 4UBDD 4C57C 2X1WL 3CCHA 3IU4L 4OFKA 5C0DB 1DP0A 4IM8A 5F7DB 5K59F 2IH1B 3J7HA 2BNQE 2F5BH 3I02A 1MAKA 1G6RL 3UO1H 3VXSD 3QDMB 3HPJA 3MO1A 4XRCB 3S37H 4EI6A 3VXRB 5I75B 4FA8A 4WEMB 4D0BB 1WWBX 2RQ8A 5I8KL 1NGYB 1XGPA 4G8EB 2R1XB 4LBEA 5CBAB 1RZGA 3ALPA 1UYWL 3O4LB 1NH6A 2Q8AL 2BMKA 4XVTH 4JFDA 4MLSA 3PL6C 4NUJB 4W6YB 3C8KB 4MA3B 4NJ9H 1CDUA 1N64H 5HHXH 3T0EE 1HI6B 5E5RB 5IGXH