1T6VN

Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lysozyme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
RVDQTPRSVTKETGESLTINCVLRDASYALGSTCWYRKKSGEGNEESISKGGRYVETVNSGSKSFSLRINDLTVEDGGTYRCGLGVAGGYCDYALCSSRYAECGDGTAVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a shark single-domain antibody V region in complex with lysozyme.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Hydrolase/immune system
molecule keywords Lysozyme C
total genus 33
structure length 112
sequence length 112
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6vN00
4UIKL 4Z7WF 1U2CA 4PRIB 4RMVA 1FZOA 4L4JA 3M45A 1JN6A 2NMSA 4PJ9C 4JHAH 2A73A 3OR7A 1NGXB 3GSRB 1NANI 3P4NB 4KPHH 2VXSL 1PFCA 1OB1A 1KULA 1F6FB 2HT4C 1CQKA 2IMNA 4ZUVB 1R5WA 4M6MH 5C0AE 5JORA 4V1DD 3C8KA 3IJHA 2F54E 5JW3H 5IIEB 3EBAA 4OFYD 2YUZA 2IANE 4Z7VF 4JFZH 2AQ1A 5DJ8B 3BPOB 1KUMA 5D5MA 5CBEA 1GXEA 5IEKB 2XKNA 4JRXE 5AWNL 2HT3C 3R0NA 1NAKH 5C09B 1BJ8A 5FM5M 4WFED 4BQ8A 2R0KH 1LEGA 3BP7B 3RWDA 1FVCB 4HAGA 5HYEA 4MCZB 4MX7A 1TJIL 4MA1C 1IM9A 4NNYB 3OKNA 2IFFH 3Q6FA 5BMFL 3LQAC 4HZLA 2W1NA 3HI1B 1TZGL 2ICEA 4N0CD 1VPOL 1H8OA 3NBNA 1WZLA 4EKXA 5IEHA 3ARDD 3M17B 4BZYA 1GC1H 1FPTH 3HAEG 5I16B 3PWVA 3T3PF 3O6FB 1ORSA 3LKPB 3CXHJ 1CGSL 4NIKB 4F7PA 2B8OT 4XXCC 4FQLH 4BH8A 5KVFL 1FLRH 1WTGT 1BIHA 3HMXL 3QIUA 1IGIH 2DLGA 1BF2A 4MCYB 5IK3A 3KPQB 5BVJA 4XPBL 1MUJB 5D7IF 3KYKL 3RUGA 1VGEL 4KUCD 3C8KB 1I9IH 3WIHL 2ZJSL 1D3CA 4HSQA 3EO1A 3DUSB 3S4SB 4OZHF 3B5HA 1F3JB 3QXVA 1ED3A 3LHPL 4DKEL 4JVPA 4HZAA 4K94H 1BFTA 1ZLUK 5DS8B 3ALXA 3C09C 2IBZY 2NZ9C 3OKNB 4PJ8D 4NO2A 4M7JL 3AAZB 5GGQL 3PXHA 1OM3H 1YUHA 1AQKH 4GW1A 1IARB 1KEMH 3UPCA 2EEAA 3U7WH 3HUJB 4UI2A 4L8SA 4D0BA 3BKYH 4PJ5B 2X70A 2GQHA 3CFKA 5LQBH 2XWTA 5IGXH 3QUMB 1RPQA 5HVHB 3T77B 1G1CA 3IDUA 4KKAD 1FNGA 4AJ0A 3MRRA 3L3IA 3IT8D 4JFXA 3LN5A 1FLRL 3LEVL 1ITCA 5B38A 1DSFH 2BZDA 3O6KH 5EZJB 3KJ6H 2UY6A 5ERWA 5D6DA 1UYWH 2QLVB 5ALCH 5DO2D 4ODXA 4KHXL 4Y4FB 3REWA 4U4BA 1F6AA 1KFAL 2QQLL 1OGAA 2YXMA 5E2JA 2A6IB 3ZT7A 3LEYL 5D72H 3ULVL 4MHHG 5DYOA 1DQML 1JF1B 2D9CA 1GOHA 5CP3H 2DICA 4O2CA 3FQNA 1HSBA 2Z31C 2FHCA 1X6LA 3RKDC 1AKJD 4G8GA 1A1MB 5C92A 4XHJD 1BMGA 3MLTA 5CUSH 3GMLA 2VDPH 3GSUA 1CDHA 3PGCB 5TE4L 3VMOA 25C8L 4YXHL 2W60A 2NY6D 5F8RC 4R26L 1U0QA 1QP1A 4F3FA 5JW4R 1ZE3C 1QQDB 2YRLA 4P9MH 4HF5H 3B9EA 4W81A 3RTQC 1GGUA 3HUJA 4E41D 1NGWB 1KCLA 2FEEL 4ONOA 4MVBC 1ZSDA 4F7CA 1MCNA 4L3EE 1CLCA 3P4MA 1AHWA 4O9HH 2ADJA 1HKFA 5D93B 5DJYA 4UT7H 4YR6A 1NFKA 2FD6L 4WWKA 4LCWB 4YGVB 1U8OB 3MV8D 1MRDL 3GK8H 5HHVH 3ALPA 3KJ6L 1QLEH 2Y5EA 1S7VA 4M6OL 4ZUWB 3U4AA 1T2QH 1BBDL 3L3HA 1CG9A 3B9AA 1YEKH 4PB9L 4M61A 2E27H 5D72L 3ULVH 2W9DH 4GG8A 3LN4A 1ZHLA 2CLVB 4Q9QH 4KRPD 2DWDB 5JDSB 1IE5A 1GYAA 5TQ2L 3S9DB 1LP9B 5TQ0H 1ND0A 4JJHA 5BRZA 2B20A 3T4YB 2EYSA 5I8KL 3KYOB 1QNZL 2YUXA 2JF1A 4GMSH 4PIRF 1GGCL 3MLTB 4XBEH 4U1IA 3NCFB 1WCBB 2CR3A 4XPFH 1EJOL 5ESVA 1MWAB 4Y19A 2R1XB 1AI1L 1G7JB 1EJ6A 1IAII 5EC2A 3VXPB 3K0WA 3MJ9L 2A74B 2BMKB 4P23C 4R8WH 5F7KC 1KGCD 3WFZA 4OCRH 3IU3B 3QQ9C 1A5FL 2ATKB 4HUKB 2FH8A 3QUZC 3HI1A 5I9QB 3PJSB 4KI5C 3IXAB 1TZIB 4FQQA 5D71L 4ZG1A 4TRPL 1VERA 1KACB 1QLEL 2M2DA 3D87B 3VFRB 5ACMA 5FYKE 2KQNA 1EEQA 3BPLC 4KKLD 4FFYH 4ZFOA 2FL5B 3VI4E 2G75A 1KJMB 3DGGB 3TYFB 2NTFB 4W68A 2AQ3A 2GJ6A 3JTTB 3LS5H 4RZCA 5DZOA 4B53A 1QFWH 2VDRH 5BV7C 3UROR 5D1XA 2VDOH 3SO3C 2Z92B 5EU5A 3ZDYE 1HE7A 4D9RE 1XF2B 5I74C 1NMCB 1NL0L 2JELH 1OGAE 5FOBB 4QYOA 1QSFA 3EO1B 2F58L 3IU4L 4M1CD 2VXTL 4UTBL 4XCCL 4ALAH 4QGTA 3Q5YA 4G42A 5A2FA 2JCCA 3HNTH 3Q6GH 1WLHA 5FCUH 3IXTB 4WIQA 4C56A 1FRGL 4HCRH 3MLPA 2P4AB 4F80A 1N8ZA 2PYEA 3LH2L 2CDGA 5CJ5A 3HC4L 1IC7H 3NPZB 3HZKB 2P5WD 3QJFB 4UINH 4APQC 5ADPH 4DUWA 2FEEI 4JM2D 2BVQA 2R2CA 2A6JB 4I18B 1V05A 4FQQB 3WIFA 2OM5A 4PJ5A 4PJGB 2HH0H 4PJAE 1BQHA 4P2QB 5KSAD 4JO4L 1E4XH 3QIBD 1RK0B 3BEWB 5D7IB 1AGCB 3R06B 2OSLB 2GT9B 2VUYA 3FB5A 2KH2B 5IMMB 3SJVB 4UMGA 1KNOB 1A21A 5D7KE 1T2XA 3C8HA 1DBBH 5CEZH 2AXFB 4LQ1A 4XZUB 4HJ0D 4LFHD 5DK3A 1HIMH 3MRBB 3IS0X 1KTDA 4BQ9A 5K33A 2VKXA 2P47B 2QTEA 1HHKA 4K7PL 4LRNL 1UB6B 1KXQE 4LARH 1J1XH 5EFIB 3HRZA 2P48B 4OB5H 3WIHA 5FYLH 5C08A 3TVMC 2R9HD 2QL1A 4KV5F 3SBWA 2HFFA 5DRWB 5FKPB 4HEPG 4Y5VA 3FJTA 1AO7A 3GEWB 3DYOA 1T3FA 3ARGC 3T2PA 1I85A 1RIHL 5I71B 5C0AB 4Q0XL 3UTZA 5DQJB 3CX2A 2GJ6E 3TT1H 2HLAA 3QIWC 4FFWC 5ESAA 2H26B 3DSFL 4DOHE 3UCRA 1D6EA 1A8JH 4G6MH 5JPNB 3IDXH 3BP5B 4TSAL 2VDML 4L8SC 4P59L 1JHTB 2IAMC 4G8EA 4G80A 1BEYH 5E8OA 1DQDL 3WUWA 4F7PB 3DTXA 5T1DH 1NCWL 1ZSDB 4KZEH 5J3HD 2UWEA 4NQUA 5C0DA 4E42B 1YY9D 1B9ZA 1RK0A 5D7IA 5CZXD 3IDMB 4XHJC 5J6GB 4QT5A 3RKDD 3ZDZE 4PREA 5IB1A 1JNHA 1D5MA 4JRXA 2DQJH 3DMMB 3I3EA 4W6YB 3DYPA 4ZAKA 5FYLE 4GO6B 3VG0H 1G9NL 2YSSA 3QBTB 4Y1AD 3EZ8A 3KYNA 3BPLB 4QWWC 3OX8A 5BCAA 2CRIA 4JPKL 4UT6H 5CJOL 5JIIA 2EH7L 4LLWB 2YPLE 3UYOD 3W9DA 5EBLA 1KJ2L 4Z76B 1ZA3B 5IQ9A 3JV4A 5MENA 2GFBB 4KGLA 3P4NA 4XNMA 1C7SA 4PRAB 4ORZC 1P6AB 4JHBA 3STZA 2GEEA 3RWCB 3GIZH 12E8L 1EFXD 5F6HJ 1J11A 5IM7A 1G7QA 3IJSB 2V2TB 4JY6B 1RZ8A 4Z7VA 4K3DL 3VXSE 2DQIL 2X09A 5CEXB 4LF3B 1NC4B 5F9JB 2HFGL 3PJSA 5DGQA 5H37H 4HXBL 5J6GA 4F9PA 2NY5L 5IHZA 3T0EB 4FOMA 4ZTOL 2WIIA 4GG6E 2I60H 1MJ8H 2I9TB 4GAGL 4I1NB 4NM4H 3AS2A 1I8KB 5IBUG 3RWIA 3W9EB 2DQHH 2DQJL 5JA8B 3TO4C 4TOYH 4EQ2A 3GRWH 1EUTA 1LEIA 3HNVH 2OR9L 2J1KA 4PRPD 3O0RH 3PDOB 4F57L 4JAMB 4PJ7E 1J10A 1KCRH 4MD0A 5JHDA 5FYJH 3T2OA 3RL2A 2A0LD 4MAYA 4IIQA 4KUCF 1UXWA 5C7XL 1UEYA 1T1WA 1F00I 1UWEH 3NFPB 3MCKB 3QNZA 2AVGA 1UXSB 5KS9E 4Z0XA 3QA3A 5F89B 3KG5A 3QWRD 4M3JA 2QHRL 2CLVA 1D5ZB 1KIQA 2V17H 5L2KA 4EN3B 2AK4A 3O8XD 2CO6B 3UC0H 1JGEA 1LO5B 2X1QA 5T3XE 1GC1C 3OG4B 4LLYB 2X05A 2W0LA 4LLQA 5CILL 3LKOA 1AXSB 2ZCLL 1Q9WB 1TPXC 4LEOA 4CVXA 2XZQL 5D7KD 2FJHA 4ELME 5D2NA 1X5IA 1N6QL 3IAGC 5DWUH 5DRZA 2W65B 4OLUH 4WWKB 1CIUA 1H3PH 3W2DL 2PTUA 4NO0D 1CDYA 1KPRB 3R8BB 3CU7A 4JDTL 2IG2L 4ZQKB 2BSSA 2M1KA 1I8IB 4OZ4A 3SDDD 1QR1A 4MNHA 3DXAA 3C08L 3AM8C 3FQXB 4ZDHB 1GHFH 4D0DA 4F33B 3MFFA 3CMOH 2P5EB 3I75A 2WANA 4LSDA 5AD0B 5E94A 3I50L 3AMKA 5DJ0A 3DX7B 3IDYB 4WU7B 5DRNA 3EO9L 1GL4B 1C08B 3FQWA 1I85C 4OIIL 4JFDA 1S7TB 4MWFA 5EU6E 3QQ4B 4PJ9B 2ZOLB 1EFXB 3ZYOA 2ERJB 5KSVB 3U9UB 2NY3D 3BHBB 4IRZL 1OAKH 2KL6A 1I8LA 3KXFD 3TBTB 4KK5D 1YN7B 5T3XL 3TN0C 5GGSB 1BF8A 5MENE 3RUGE 1OF2B 1ZGLB 4PJBF 1CXIA 4LAQH 5BV7H 4QTIL 1BD2B 2NR6C 3O6ML 1N6QH 4KAQH 4PUBH 2NY7L 1E4KC 2X1OA 1JE6A 2DQFB 1LQSR 1MI5D 3TVMB 4LBEB 3SQBA 1K2DA 1QO3A 3QDMD 4OF3A 2A1WL 3GSQA 3VXUD 1A3RL 3S4SA 2HP4A 4MYWB 1BFOA 5J11C 3ARSA 4GOSA 3SKOA 3RIFK 4HX1A 1U92A 2P8PB 4LPUA 3CLFL 4U6HB 4D9LL 1SY6L 3AAZA 3LS4H 4LCWD 2FGZA 3GGWA 3MACL 3RVUD 3WN5C 5IB1B 3MBEB 3FB6B 3CUPA 4M8QB 4Y2OA 1QBLL 3MUGB 5F7WC 1DEEA 1AKJA 4GKSB 2GT9A 5IWLA 4OI8A 2X9WA 1GOGA 3PP4L 4TNVK 4Y8DC 3T77A 3UMTA 2QBWA 4OF5A 5H2BB 1AFVH 2EIDA 3MRLA 4M93C 5JOFB 4PJGE 3EDKA 3X3FL 1KPUB 3UBXG 1YPZE 2IH1B 3HI6H 4I0KA 4DTGH 4H0GA 5JW4M 4A6YH 4UV7H 1YJDL 2AJUL 2MMXA 1SVCP 1J0ZA 3OXSB 1DN0B 3LRSA 1EPFA 5EFIA 4B0MM 3SDXA 4F7MB 2DWDA 5JDSA 5IVXF 2FJGA 4NO3A 2MWCA 4QHKI 1C1EL 1PQZA 3QR2A 1AR2A 3SY0A 3TO2B 1JGVH 1MCIA 3QCTH 2FHFA 5KS9B 2WMPA 3D85B 2J2ZA 3ZYJA 2MSPA 5MP6H 1TITA 1CBVL 1J1OH 3QUYA 4GBXB 1OB1B 1MSPA 2F19H 3NA4A 5KS9F 3FB5B 1X5GA 4JFEE 1G0DA 1J0IA 1S78D 1DVFB 3FB8B 2EKSA 4WU5A 5D7SH 3MOBH 4KKCC 4PJIE 1RULL 4U1NA 2DWEB 4X9GA 1EXUB 3VFUB 3MO1B 4IOIB 1GZPB 5AUMA 2ZNXA 2H32B 3INUL 4MQSB 4LMQI 4WW1A 4LCUA 1RUPH 4IS6A 3U0PA 4MJ5B 2Y72A 4WUUA 3B9KD 3OZ9L 3LVEA 3PP4H 4O5LH 5HD8D 3RVTC 3VRIB 4MCZA 4JG1H 4YDVB 4MZ2A 2J6EL 4MXQC 1UCTA 4G6JH 4NQDD 1ZMYA 3RZWA 1MF2L 1CFBA 4XPTL 4K23L 5FOJA 2D0FA 3M17A 4P48A 4ZUUA 4K7PX 5EU6A 2YR3A 1SHMA 5EA0H 4L1DA 4QLRA 4ZFZA 4PB9H 4X6DE 5F88A 5J6HA 1FIGL 4IMLA 1GGYA 3GI9H 4PP2B 1BJ1J 3ZE1E 1A2YA 4WFEE 3MLYL 4N9OB 1N59A 3BIKB 3VGAB 3TNMA 3TLRA 4Y16C 1HH9A 3O11B 1NFDB 3BRFA 4YHOH 1T1ZB 1MLCA 1E6JH 2RCSH 3NCYS 3STZB 2BDNL 1XCTB 4WHCA 4YXKL 3GSRA 3WD5L 4J1UB 2A2QT 5BRZD 5DJCA 4ALAL 5ISZE 2XYCA 5LGJA 3UPAA 5DDHA 4GRWH 3C2AL 2A9NL 5E03A 1YECH 4LK4A 5HHNB 2MFNA 3WIHH 3BGFB 3ECBB 4XP5L 2R1XA 5F96L 1XR8B 3OKOA 4QHKJ 2WNGA 4JFED 1EGJA 1NJ9A 1B2WH 4Z7UB 4YFLF 4QF1A 1NDGA 1YUHB 1JPFB 3QUYD 4WU7A 4AY0A 5SX5H 4MNQA 4P2OB 4OZHE 1INQA 2P7TB 2YD3A 2Q8AH 2X70B 1FFOA 4K23H 3GJEB 4PJ5E 3F7VB 1ACYH 3P9WB 2F53D 1P9MC 5HSFA 4L8BB 4NRYB 2J4WH 4BSVB 5MI0B 3WUWG 1GGTA 4KK6C 5E5RB 4MAYB 1V3LA 1DLFL 5BQ7A 3P0VL 3QUZB 5L6YL 1A6PA 1P7HL 5C9KA 3S37X 3QWQB 2MKLC 1S7WB 5FYLL 1DFBH 3V6ZB 5I17A 4HQQL 4HIXH 4OTXL 4NBYB 2BDNH 1DQJB 4ZD3H 3MR9A 1KCKA 3GSOA 5D6CB 3GJFH 1F97A 2F58H 4X6DB 3L95B 3T3PE 3WSQL 4DAGL 2XA8L 3Q3GA 5B4MC 1IM9B 5C0CD 4M5YL 3LPGA 1MI5B 3DSFH 4O58H 4OM0H 3UJTH 3VXSB 2HFEA 4X8XA 1RZIA 3MCLL 2QADC 4JKPH 5T1KD 1YNLL 1T83A 4Y8AA 1GH7A 1UXWB 3WNNA 1ZLVH 4XHQA 1SBSL 1IC7L 2Z35B 1ZLWH 4JFHD 4GAFB 5FO9A 5F89A 15C8L 4ODUA 3HN3A 4WI7A 4NOBA 3SGJC 4JRXD 5GS0H 3QZWA 3QFJD 3HE6D 2ADIB 2WZPD 1U95A 1BVKB 3P4MB 3RGVB 2Z0BA 1AGCA 1DBJL 1FNSH 4IMKC 1WVZA 2O5ZL 2DKMA 5IB5B 1OCWH 5FFLA 1OSPH 5ICZB 4KV5E 1BIIA 5D1QD 1A4JB 1U8LA 1UM5H 4TUOB 4FXGB 3VWKB 4APQB 5EBMB 5HYFA 4MA8H 3SE8H 1S3KH 5CD5C 1I4FA 1J8HA 5T3ZH 2FYYB 1F8TL 4QOKD 4XXCA 2Z8VC 3QDGD 4HDIA 1I7RB 4JFDD 3BQUC 2CKBH 4NZUL 4Y5VC 4NRXA 2PF6A 4M6AA 2GAZA 3MRCA 2ZKHH 3EJJX 2D03H 4JHAL 3KXFB 4M7KH 1P5VA 4O58L 2B39A 1VGKA 4HGWA 3UZVB 1MCCA 1UWGL 1T0PB 2E7BA 5I66B 4JFFE 2D4FA 5FUOL 4HG4K 2Y36L 3CH8A 1WWAX 3V4UL 3VI4F 5F6IB 3TO4A 5I1GH 3NTCH 1KIPA 5HGBA 1G7IA 4LVOB 5E08H 3EKCA 1MFDH 1VHPA 3KS0J 1JZ4A 1P7QB 1FNEA 3QI9B 5DJ2A 2WUBL 4NM4L 2KBGA 3C8DA 3PWPB 4X5WB 1NLDH 3TBVA 2X4NB 2E3VA 4AH2A 4GG6A 3HE6C 5HYJD 4LSTL 1IEAA 4OCWH 3BMWA 3G08A 5B39B 1MH5A 2DL2A 1N0LA 2BNRB 3BH9B 3ARFA 2AXHA 4ISVB 5KVEL 3CPLA 5LG1A 3SDDA 5BS0B 4LLAA 4GG6F 3VFRA 4BM7A 3QRFM 4QRSB 4QXGH 1VDGA 5E99H 4UUJA 4ELKB 4JPKH 5KSUB 5F7EL 5KAQG 4MAYD 4PRBB 1YEEL 5C2UB 1D5ZA 1KIQB 2Q7NA 3GMPA 4WHTB 1D5XA 1DVFD 5D96C 2Q3AA 1IFHL 5HHQB 4XVSL 3IFPB 2FX9L 2ZCKL 2AV1A 4HKBB 4PGJA 4LRIC 3P77B 3QDGE 4P49A 4PRPA 5CIPH 3S5LA 1QSFD 4ZO7A 1U91B 3QEHB 2A9ML 4NHUB 1HHHB 5E6IB 4J23A 4Z95L 1AKJB 1OP5K 4TUJB 4HUXB 5ID0A 5CJXC 5F1NB 4UOJA 2GUOB 5I1GL 1CDBA 1S9YA 2LU7A 4XPAL 2HVKA 3RUGB 5GRJL 2L7JA 3CDCA 5JOFA 1ZHKB 4NWTH 1KT2A 3FHAA 1NAML 1S7VB 3TCLB 2UV3A 3VFOB 1EHNA 1T4KB 3BDXA 2HJFA 3F7VA 4M43L 1S7RA 2NXYC 4NYLB 2X89A 5JHDE 3PNWB 3WIIH 2MQ0A 3TBYA 1LEIB 3MJ8A 3OKLB 4ONGH 3GBMH 1OP3K 5I1AB 3WNOA 4PJCF 3L5XL 3R06A 4R90H 3L6FB 1NFIA 3FRUA 1VENA 4PLKD 3ULUE 3AB0B 4V1DB 5JW5B 1M7XA 5FM8A 2DJUA 1T5XB 3EYOA 1WWCA 3TBTA 4D3CL 4QRUB 4M7ZC 2J12B 3NH7H 5DHYA 3QFJE 4Y19B 4CU8A 1UJ3B 1OP5H 4GQ9L 1T2JA 2H32H 3PIQA 4CU7A 1YMMA 3AY4C 5I2IA 2D7TH 4JREC 1FSKC 1F6AB 3FCTA 4JREB 4G7VH 2QQLH 5CILH 2XXCB 4XP4H 1U3HB 4D0CB 4JM2C 3JWNC 1DQMH 2YWZA 1G7HB 2VQ1A 4OGZA 3CC5B 1NGQH 4JRWA 4PLJD 3BN3B 4JPWL 1G7PA 5FM5O 4HJGB 5KG9B 3MV7B 5FO9B 4RFNC 1HHGB 2XN9B 1YEFL 4HIHA 4K8RC 3GB7A 5F93C 4TSAH 4ZQKA 4ZFOB 4P4RA 2ITCB 2UVFA 2DM2A 2ADIA 2YBRB 4X4XA 3VGAC 5C0DB 3CVHL 1C5CL 1KBGL 3ARXA 1CE6A 5E8EA 5IFHL 5E8DL 1OQXA 5D7LA 1MCQA 1WBZB 1RURL 3S96A 2ARJA 2IAMD 3DNKA 3P0YL 1F11A 1BWMA 5I6XB 3U7AA 3QT2A 3FRUB 4PJAF 3JWOC 2PCPA 3WHXB 2IBBA 5EBMA 1JNHB 4K55A 4LCCA 2OL3A 1IQWH 4KJWD 5F70A 3VRJB 5I8OL 1T0NA 3E3QC 1T20B 2O5YL 2FEDD 4PS4L 3ILPB 1CFNB 4JFHE 1ZHNA 2BNUB 3ARGD 1CFSA 3CXHK 3BGAA 4PPTA 2VNCA 1FYTA 4HT1H 4U1MA 1GGIL 1UZ6E 3V5DB 1F2XK 1CLYL 4K3GA 1D5BB 4QOKB 1YEHL 4FQPA 2NY7H 3MRNB 3N0PB 5FYJD 5F8QC 4PRPE 4P2OA 5HHXH 5FHBL 1WWBX 5FHAH 2HVJA 4TVPH 1CXEA 1FO0L 4P2CG 5DEGB 1KJ2A 3KWWB 5C0AA 3MOQA 1P4BH 4YDJB 4F58L 3JSSA 4NRYA 3BEWA 1A6ZA 2EH8L 4L8CB 3BD3A 4V1DE 4XP1L 1DN2A 3WFDL 4F37F 2VTFA 2HLFC 1CGTA 1HEZB 3INUH 4KQ3L 5AEAA 4AM0B 4PYGA 3P0YH 3ESUF 1IC5L 3T0EA 4MQ7B 4IOSD 1QBLH 5GISH 1M71B 1Q1JL 1WICA 3VH8A 2R0KL 2XZCL 4LCWE 3DO7A 1EGJH 3J8F7 2ESVE 3V0VA 1HOCB 5JXAH 3CXDH 2DBLH 3L5WB 4J3UA 1T1WB 1T7YA 3MCKA 4P9HH 4KMTH 4NCDA 1ZTXH 3KPNB 4OZGA 1Z0MA 2PR4L 2YMXH 4LGRB 3OAUL 4IRJD 1BJMA 5C9JA 1L9NA 4U3CA 2NYYD 4YHIA 3TM6A 1E28A 2OI9B 3ROLB 2IQAB 2RR3A 4KJPD 3T0BA 1G84A 4RX4D 2V2XB 3TA3B 3OR6B 5GRUL 2O61A 5EU5B 5T5FL 1XF2A 3DIFB 2GJ6B 4ZS6D 2V17L 1XAUA 5EU3A 1JNNL 2QSCL 3O2VL 1A22B 2DDQH 1QSEE 3HMXH 5DD3H 3X3GL 1AO7E 2CPCA 3GI8H 3ROOA 1TNNA 5JUEH 1P4BL 4HKZB 2RB8A 2OTWA 2VLKD 1MRCH 2A77L 3IDMA 1EHLH 1ZLSH 3MGAA 3TH3T 3PL6B 4CN1A 3BX7C 2ED7A 3KYKH 4AEEA 1WZKA 3N1PC 5HD8C 4KRPB 4AIZB 2DWEA 5F6HI 5DURB 1W8NA 1B0GB 5CAYB 3OTTA 3GJFA 2VH5L 3HR6A 3MLVL 4G8FA 4PJXB 3U46A 2X1PA 1KJVB 4WW1B 1RUPL 1F3JA 2F15A 1H8NA 3CU1A 2X2YA 4UIMB 5J56B 1BJ1H 1CXKA 3QHZH 4PJCA 1CT8B 3CPLB 1BREA 5CHNA 2OQJA 2EDLA 5JOPE 1R3LB 1MLBB 5TGBB 4S11A 4I3SL 2D7QA 3NIFF 5IGXL 3MGTB 3SDCC 1N5AB 4G8IB 1S7WA 3PDDA 4WV1A 1JV5B 4CN4A 3IFPA 1RIVH 4UB0L 3WN5B 5C1MB 2PW2A 4Q74A 5MEOA 3W39B 5D5MF 3I6KA 1XIWB 3THML 5DMGD 1UB6A 1EAPA 4KHXH 1U58B 2VXVL 5EOCH 4AH2B 1BHGA 1BQHG 4WWID 5EU6D 4YHZL 4PJ7B 2WAHA 5IV2B 4MDIA 3H2WA 4DN4H 1GAFL 3MCLH 1IQDA 4RMRA 5BS0A 4EEEA 3WV0A 1OARL 3L5HA 2D0GA 4D8PA 3D69A 3FAWA 1D9KD 1U92B 3NCJH 5JMOC 3RWEB 1QVOA 4UAOB 1SEQL 4EUPB 3DARA 1YPZB 4QRRE 5EOTA 3X14A 1ONQB 4X4ZA 4JZOB 2ARJB 2MHAA 3ZKMD 3DHJA 1Q72H 2GSIB 2R39A 1J5OH 4ZSOB 1OAXL 4CADB 4XNQB 2YD9A 4U1HA 2PCPB 2YD1A 4OKDA 4KTYA 4NRZB 1ZLUH 4W6XB 5DQDL 3T0WA 2VISA 1DEEB 4CMHC 3BH8B 5KTEH 3SGEI 2JKXA 4J3VA 3CAFA 4WFHD 4XXDA 1NGYB 1AHWB 2EIBA 4JFDB 3IJHB 3W0WD 4RWYL 4UT7L 1YYLH 1V7NL 1XCQA 3LZFH 4HD9A 5DGRA 4PV8B 1RJYB 1WC7A 4Z78A 4Y1AA 3V2AR 3KYAA 1CVRA 4FQCL 5C09A 3EJYD 3V52H 1NUGA 3WXVL 2FRGP 1QUNA 3THMH 3DI2B 4LSRL 1B4JH 5DO2C 5EOCL 2ZKHL 5HJ3B 4HUUA 6CGTA 4HUWB 4ZO9A 4KRMB 2CRZA 4GAJH 2PETA 5LXGL 1PG7X 4NQDE 5E8PA 5EBLB 1NANH 4D0DB 4EI5A 4HKXB 1FVEB 1JI2A 4P5KB 4OM0L 3DBXA 3EGSB 3GIZL 4P46D 3BP4A 3D39E 1A6TB 4XTRD 5BZWA 2A73B 1T5WB 4XCFH 1C08A 3NA9H 2NPLX 3V5KB 1MEXH 1W0WB 1YY8A 1S7TA 1E4JA 3UXFA 3ULVD 2HT4D 3CSGA 3C5ZB 4GLRI 3MA9L 4X7EC 4BKLA 1MCJA 4D94A 4K8RH 3BE1H 3WCYA 4U1HB 3VFUA 2OL3L 4HXBH 3DX8B 5I76B 3OB0K 2QSQA 4P5TB 1NLDL 4GXUN 4MD4B 4XH2B 2QQNH 4LIQE 4OBSA 3GM8A 1OF2A 1XF5A 1F4AA 5DQ9B 4C56D 3MJ9A 3VXOA 1JYNA 3QEQB 4CJ0A 3M1BB 1A02N 1TVDA 5KANI 1G9ML 4OLXH 4X4MA 1LP9F 5FA3A 4Q6YA 5E99L 2NXYB 3ILPA 5CMAA 1RZJH 2W07A 3S35H 2X4OB 4NFDA 4HBCL 1CFSB 2G2RB 3WXVH 3REVA 2XACC 4NQXB 1WF5A 5ABDE 2JK5A 3F7YA 1UXSA 1I1YA 4E5XB 1JRHL 3DX9B 2DQTH 1EO7A 2P44B 4NZUH 3QUXA 1JPTH 2X40A 3QIBA 1BAFL 2VDRL 3G6DH 3SY0B 1NBQA 4N0FB 1FC1A 2UZIH 2BRQA 1WBYB 1JNLH 4Z95H 5ID0B 4NT6B 5EWIH 2PO6C 4Y4HB 3WNLA 3MUGA 5LGJB 1U8IA 1U8NA 3JWOL 1UA6H 5SWZE 3U0TA 1YMME 4PJXA 3S3SA 1CL7L 4FQ2H 4HUVA 4WFGE 1MPAH 3STLB 2EDOA 4M62H 1VFAA 2UY7A 1U3HC 3GSXA 5H2BA 4UDTB 4HKJB 5IR1A 2LTQB 4NN5C 4KC3B 2BVPA 4GRMB 4YXLL 1QSED 1XGRB 4IDJL 1P7KB 5EN2A 1TLKA 1WZMA 2IH1A 4HIEB 1ZLVK 5IROA 2M26A 4YC2B 2FB4L 1CT8A 3LH2H 3HC3L 1GHFL 3NIDE 1I3VA 2XTJE 3GJEA 5DJ6B 4IMKA 2P7TA 3W81A 1DQQB 4R97B 2YWYA 3DRTB 4OV6F 1X4YA 4CVZA 5HGAB 4YIQA 5J89A 2DYPA 5GGUB 3RDTB 4LSQH 4HK0A 5E4EB 4V2BA 2BERA 2R0LL 1FH5L 3NCEB 4JFOA 4Y5YC 1T1YA 4D0BB 1OAKL 3SE4A 3S5LG 3S36L 4O4YH 5FO8B 3V6FA 4GQ9H 3FRPA 1LK2A 2X4RB 5I2IB 3MRKA 5T3XD 5HYSA 2J5LB 3DIFA 5GHWH 3IDJB 1CS6A 1UT9A 2YD8A 3WO4C 1ZXQA 5INCA 4WTWA 1NGWA 2Q6WB 5GIRA 4LVOC 5A2JH 4LLMA 1NGPL 4PGEB 2ZG2A 2VDKL 4ODXB 1FYTE 3AU1A 1EV2E 2OMBA 1HXMB 2A6KA 2MTPA 3HE7D 4KK9D 2OZ4A 5EB9A 3QUYC 2WBWB 4HKJA 5IR1B 4MB3A 1MFEL 1LILA 3QFDA 3O3AB 1H15B 4BJLA 3TT1L 3FN0L 3MJ7A 3X11B 1QEWA 3EJZD 4I0CC 4M6NL 3CVHH 3MLWL 1Z3GL 4I2XA 5GPRA 1MFBH 1DZBA 7FABH 2DJ4A 3C5SA 1A4KB 2N7AA 1T4KA 4O51B 5DVNA 3QHFH 4L4TE 1NGZB 2V2XA 4HS8H 1A2YB 4ZPVB 2UWEB 4PYHA 5A16B 2BC4B 1BIIB 5D96B 3L5XH 4U1IB 4NM8H 2C1OA 3KPLA 3FO9A 1T7WA 1UKQA 4APQA 4MJ6A 2MKWA 4NBZB 3ARDB 4GKSA 1WUNT 4NQSB 3ULVE 5C09E 2YOCA 3CNKA 1J1PL 1S9VB 4PJDF 5C2BL 4NNXB 4YAQB 3ZHKA 3OMZA 4HS3B 2EO9A 4TULL 5I30L 2CIKB 4ZSOE 4TTDC 3HI5H 4U6YB 2YS4A 3U1SH 1F3RB 1YPZF 4WI4A 5MEPB 2WP3T 4ELMB 5ELIA 1NC2A 1QSEB 2AJSL 3ULUH 3H9HB 4M1GL 4PJFB 4IIQC 4ZUWA 3PP3K 5CJOH 5HHXL 1CG9B 1M6OA 4ZO6A 2VABB 3SKUD 5AAWA 4KMLB 2Z4QB 2EKJA 5KS9A 2H6PA 4NNYA 5D6CA 3TO2A 3LN4B 4LQFL 3QDME 3S3PA 3SGKA 2VDNL 1O7SA 5F9DC 2CLZA 5BRZE 1XIWD 3MJ6A 3VXSA 4OUUB 1G6RL 3JUYA 5SWQB 1CR9L 5F1IA 3MLZL 4OD2B 4RA3A 3R0MA 4KQ4L 5FUCC 2XY1A 3QO0B 1MRFL 3QWOB 3UTSD 4JGJA 1F11B 3FO9B 2N4IA 3RZCC 4O5LL 3Q5OA 3KNBA 5HHOD 3QQNA 2XN9E 3C5JA 2IAMA 2ZCHL 4FQHB 4H0IA 1ERNA 1T21B 2OLDA 2W9EH 3RVXD 2ADGB 2OR9H 4ISVA 3QUXC 4GW5B 3HZVA 3QIWA 4X99A 3C9NA 1U8LB 4FMFA 3IB4A 1NAMB 2FECI 1ROWA 4G9FE 4MMXC 4U6XB 5FCSH 4KDTC 3TJEH 3VFMB 5HHOA 1GVIA 3P9LA 4CU6A 1RSFA 3ZKMC 1F3DJ 4FTVA 4N1CA 5DVMA 2WUCL 1J8HB 4U0RC 3QG6B 4IRJA 1JNNH 4BH7B 3T4AB 2ENYA 1TZHA 3O3DA 2ICWI 3ISWA 4BZ1H 4RMQA 3PGFL 3I2CH 2EDFA 3HMWH 5CJQH 2RCSL 1BFSA 2EEDA 5BVPL 3WFHA 4P46C 4OGAD 4R3SA 1ORQB 2E7MA 3NGBB 4L4VA 4D2NA 4L9LA 3BP4B 3GSXB 5GSVB 3EOTL 3E3QE 5D2NC 1YC7A 3VXUA 3K2UL 3QB7C 4HK3N 5HDQH 4XP1H 3WJLA 4NFCA 2FX7L 3L3IB 4NZRL 1SBBA 2C26A 4U31A 4PV8A 4KQ3H 1DSFL 5ILTH 3WXWL 3IF1A 4XCYA 3VGEA 4AENB 5LGHH 5ERWB 1IGJA 4MA1B 1IKFH 1IC5H 4I4WB 3L1OL 1UQSB 3L3GB 1I8IA 1KN4H 2DMBA 5FF6B 1QR1B 3MRFB 2WBJB 3WIIL 1Z9OA 3QHZL 3TBYB 5CLTA 2R8SH 3MFFB 5DQJA 4X6CE 1MNUL 1HOCA 1MJUH 4QRRA 4U3HA 2C1PA 2CXKA 5HGGS 3RPIB 3EYOB 5IJKC 3MYJA 1JIBA 1AC0A 5DJXB 1DBAH 3QXWA 3RDTD 2DIBA 2RIKA 4RGNB 5T1LA 1HYRC 4XC3L 4D3CH 1R6VA 3MA7B 3LCYA 1IKNC 4JM2A 4Z7UE 3SDXF 5L0QB 4KXZI 4DCQB 4YJZL 4N8VA 4JFQB 4PJIF 5KSBF 4NN7B 1FG2A 3GI8L 4PB0L 3MROB 5JR1H 1VGEH 4JDVA 5CZVL 5E2UH 4QTIH 5DQ9A 3GSVB 4E41B 5D1ZA 3QEQA 1WQVT 2Z93A 1IAMA 4UNTA 3K8LA 4XNYH 4KI1A 3TIEB 4OFYA 5IT2L 1IGJB 1HN1A 3OKKB 2EDNA 5F7FA 4X5XB 5CSBA 2AJXH 3O2DL 2Y6SD 4B50A 4RGNE 5FGCB 1H3TA 1XR9B 3VFNB 1BLNB 4PJCE 3CIQA 3OG6B 4JRYE 2XTJC 3AS3A 2NY2C 1HHJA 1SEBA 4D9LH 2BSTB 1A3QA 1I3RB 4PJAA 4QRRB 3Q0HA 2NY6B 5KVMC 1BVLB 4I48A 3ZT6A 5I8KH 5E2TL 2MOVA 1J87A 1PKQA 1I7ZA 1LEKA 4GMTH 4M93B 2HT3D 3K2MC 3T2NH 4EUPG 1R5IB 2VXSH 3MLXH 2O5YH 3BO8A 4PLJC 4YZFF 4Q97A 2EDEA 3GKWH 2GHWB 3HE7B 4LVHB 4U1KB 4WEBH 1JFQH 3MJ9H 3MRKB 2XKNB 5JW3L 1D5IH 5J1SC 3DETC 1MCOH 5SWSB 4U0RB 5MHSD 1I7UA 3I3DA 4HEME 4PJEF 3FCTB 1EZVY 1HSBB 4QO1A 2Y9RT 4XMLH 3BZ4A 2YKLL 1QFUL 4ZS7L 1ADQA 4HH9A 2A6KB 4MNGE 2V5SA 4I0PA 2BOBB 4KK5C 4PJEB 3MJ8B 3OKLA 3DRTA 3PABA 2D0HA 2NY3C 1CDCA 1J1OL 3H0TA 3RRQA 3RDTA 4FG6C 3RKPA 3UJJH 4R26H 3CDFA 3SJVE 5I73B 1QRKA 2JJWA 2NTFA 1JF6A 4GXUM 3UJIH 4NNPL 1RULH 1CZ8H 5E6IC 4YO0B 3FONA 3MO1A 2J8UA 4KU1A 4X7SH 5CP7B 3RNKA 5KVFH 4X6CA 1BZ9B 3BH8A 5EUKB 4EJ1C 4IS6B 1XZ0B 2IFGA 4YPGB 4NJAH 4I77H 1UVQB 1QSZA 1T7ZA 3JUZA 3VWKC 3O6FC 2C9AA 4QRQB 4F7TA 1RZKL 2JLLA 5CWSA 5HYQB 1CFNA 2COQA 2UWEF 3I85A 5JA9A 1KXTB 2ARWA 1A6UH 4GS7B 1NUNB 1URLA 1PG7H 4MQXD 2Y1VA 2OP4H 3H3PH 3RL2B 3KR3L 1QA9B 4L5FH 3HC4H 5TQ0L 5BRZB 5C0EA 3P4OA 3RX5A 4UINL 5ADPL 2YKLH 2ZSWB 4L4VE 3PV6A 4GKNB 4JB9H 5BXFB 3A0OA 5DS8A 1GGCH 1X5HA 2OK0L 3H42L 2BC4A 4QHUA 3TIDA 4F37K 5HYJA 3ARDC 4TUJA 4U1GC 2VITA 5K9JH 2CDFB 1YY9C 3UTSB 5DEZA 4LKCB 1HHHA 1F3DH 4Z7NE 1RZFH 4PJFF 1GZQB 1X5XA 1FNFA 5GJTH 2AJYL 1IRAY 5HGDB 2XWJA 4I4WA 3NAAL 3QWRA 1MIEL 2PXYA 3NZ8B 4LDOB 1NAMH 4PGBA 3LEVH 2R2BB 4K7PH 4XP9H 5DJAA 4DFIA 1AO7D 1WZ1L 4L4TD 4XH2A 2DQEL 3BP7A 4ZNEA 2X44D 4YEEA 5ID1B 5A2KH 1FZOB 3UPRA 4OBRA 2AP2A 2R56H 1G9MH 4JLRA 4HC1A 4KJQD 3LB6D 4PJCB 3N06B 4Y19E 4HIJA 5I1KH 1FBIL 1CK0H 2ZUQC 3F62A 4LSQL 4BSWB 3QG7H 2BNQB 2E7LC 1UEMA 1N5YL 4F9PC 2O26U 1SMOA 2VIRA 4LU5H 2F5BL 3GBLA 4O4YL 3VFTB 4O02L 5B8CA 1A1MA 5E8NA 2DOCA 1BOGB 2IANB 4OLVH 5AYUH 4M4PA 4PJ9A 1AD0B 3AXLB 1MCKA 3RY6C 4KDWA 3QIUD 1UJ3A 1A1NA 3QO0A 3V6OC 1IM9D 3H42H 2FATL 3HPLB 1HKLL 4JY5L 2RAMA 1H9VA 2VE6B 4L29B 1SYSB 5C0NC 2IADA 1ORQA 2YN3A 1NCCL 1U42A 2W92A 3DI3B 2KUTA 1BQLH 5BS0D 4CJ1A 3UDWC 4DAGH 3BDYH 3MNVA 5DHXB 3BN9C 4R96B 4GRWE 4OJFL 4UDTA 3NZ8A 3V0VB 2EO1A 4ZOCA 3L3KA 4JFPA 3PHSA 4TNVF 4KTDL 4NKMB 3P9LB 2Z31B 2YPKB 4JANB 4XVJH 1X5ZA 3HC3H 5IFJA 3PE9A 4PTTB 4FZ8H 1TTFA 2W38A 4CADA 1E4XL 3MRGA 5I1JL 3O3DB 4OF0A 3HFML 4ZOAA 4Z7WE 5C07A 5MERA 1B3JA 4QXTA 3OF6D 3CZFB 3NOIA 5EOQH 2F5BH 1I1FB 5CFHA 3BZDA 5GZND 4UV4H 2CK2A 1CGWA 1CVSC 1T0NB 1OSPL 1HIML 4PGCA 4F15C 1KELH 3MRRB 5TGBA 4R4BA 1MHEB 3KGRA 3TT3H 1G7JA 1EXUA 1A1NB 1K8DA 3ETBF 4ELMA 4WNQA 3E6FA 3RU8L 4LCUB 4Y5VB 5J11B 1P1ZB 1PZ5B 2YZ1A 4YHLH 1CU4L 2WIIB 4ONFL 5MEOB 4YZFE 3ZT5A 1IEHA 2OR7A 5C0BB 4Q0XH 5FHBH 4DVBB 5T5NF 3ZYZA 4XNUL 2R4SH 2HVJB 4Q9RH 1AGBB 5DMYA 2GY7B 2B7DT 1P9MA 4F57H 3DUHA 4UQ3A 3RAJL 1J05B 4Y19D 2GSGA 5IV2A 1VEPA 1PW3A 2VC2L 2E7LA 2KDGA 4CDHA 3FN0H 3FT2B 5K9KA 4K7FA 1YJDC 1N0XH 3ALWA 4TSCL 2ICWA 4P23D 5DJXA 3PGCA 3QJHA 4RGMB 2BOCA 4GBXA 4FXLA 2DYPD 4KK8C 2IAND 4GKZB 4E0RB 5TH2A 1XH3B 4K8RL 3DURA 3VXQB 3EYSL 4YQXH 5ICXB 1XF3A 4LSPH 2CDEA 1RUAL 4RX4A 1NCBL 3WHE0 1FZJA 2C4FU 4IRSA 4B5EA 2DJSA 1IGIL 3BFOA 3CDGA 1XF5B 3D6GA 4UV4L 2C1OB 3KPLB 5D1QC 3WS3B 4G6FB 2KZWA 4CL7A 2H8PB 1SMAA 3H3KA 4O2CB 4WGVB 1U8OA 2BVEA 5B39A 3OAYH 5DWUL 1A64A 3TJEL 3B43A 4OZHB 5F21B 4RA0C 1MFNA 4WWKD 2DQCL 1YNTB 2O5XH 1JGLL 4Y1AB 1UZ6F 2DLFH 2IQAA 3IDIB 2BK8A 1QHPA 5EH1A 4Z5RA 1DTUA 4YBLB 2XTJD 1BLNA 2Q86B 4BZ1L 4XNUH 2BVQB 2G60L 5LGKA 4POYA 4F3FB 1MREL 5DD3L 4AQ1B 4RGOL 3WFHB 4GXVL 4HLZG 4NO2B 2ZUQB 1FDLL 12E8H 4PRHA 2BOBA 2VN7A 3HAEB 3IJSA 4WW2F 5DJZA 2BSRA 1PLGH 4LLVA 4MB5A 1OP9A 4HKZA 4ODHH 4H8WL 4MWFB 1WT5A 3CFKB 4NN7C 3MGOB 4KKLC 3G5ZA 5J06A 5EN2B 4YHMH 4ZFGH 3SDYH 4PLNC 1PX4A 4TVSa 3TGXA 3L1OH 3BIBX 3GSWA 4ZTOH 3SCMD 5FIEA 1H0DA 3CDYA 1TJGL 2JJVA 1HNFA 3OXRB 3F6LA 5EUOF 5FEBA 5B39G 4DZ8A 4QRPB 3GSOB 1NC4D 4N0YH 3HNVL 1NCDH 2UWEE 3HPJB 1AO7B 2DLEA 2EDXA 1RIUL 1U8PA 5JPMA 1S9WB 4CVZB 3UTTB 2BNQA 2YC1B 4KK6D 2BVYA 1LO2H 5HGAA 3IETA 1DBAL 5DFVD 2R4RL 2HJKB 4JY4A 2V2WA 2V5TA 1UM6H 5AG9A 2MQ3A 2B2XL 5E70A 4P23B 4Y1AE 4CKVX 3I02A 1IAKB 5IVZB 4BSVA 2VDPL 4OLYH 3WFCH 3DROB 4P5MA 5HPOA 1OL0A 3CLFH 1CLOH 4RGOH 3B8SA 4P59H 2YK1L 4HWBA 3WMSA 2D7OA 3UDWA 2W0PA 4FHBD 2QADD 2ATKA 4P9ML 4UOW1 3ZSSA 4X6CB 4P0DA 1P53A 3R4DA 5E00B 3MNVB 3WKMH 1XIWA 2XV6B 5ISZA 1ETZB 5EO1A 1QACA 2W0FB 3NMEA 2J88L 1RZ7L 2ESVB 2NZ9D 4PJ8C 1N2RA 5I8EA 1XGYL 4LRIA 4JRYB 4TTDD 3K7UA 2WWMC 4I2XB 3WLWC 1G7PB 2OTUA 4FRWA 4FABL 5GS0C 4UV7L 3K1KC 4S1RH 3C6LB 1CYGA 2CKBA 4K94L 3VXRA 1A4KA 2P45B 1C5BH 5FF6A 1UADC 2X4TB 3RHWF 4Q58C 3AS1A 2LQRA 4HS8L 4XB7A 3BWAB 5I1DB 3RI5F 1I1FA 3TH4T 3WKNA 2GFBA 4FQ1H 3MBXH 4E41E 3ULSA 1LE5B 2F74A 4GW4B 1T6WA 5KTEL 1G6RB 2GYSA 3LKQA 1LO0H 2NY5C 5HPMB 1ZT1A 2EDWA 5JDJA 1V8HA 2HKFH 4J4PC 2DTMH 5D93C 2Y25A 3LDBC 1J1PH 5E8NB 5CGYC 4Z9KB 2VLKA 3D3VD 1QD0A 5HI4D 3VFVA 1T1YB 3V8CA 3MPCA 4UNUA 1ZGLA 5FDWB 1LK3H 4K3DH 5BV7L 3HE7C 4Z78B 4PJEE 1G7MA 4ZTPL 1XGQB 2C5DC 4OCRL 5JR1L 3FT4A 1U3ZA 32C2A 1XFPA 5IEKA 3MLRH 5IHZB 1SJVA 1DL7H 2IGFL 3JVGA 2OS7A 1NAKL 3QAZB 3SDAC 2Y7QA 2GITA 3B9VA 1TZIA 5GZOC 3MFGB 4FFVC 3H3BC 2DMKA 1BZQK 1FO0B 4RMWA 2IFFL 3ARPA 4NQTA 4XCFL 1RVFL 3C60D 4LKXA 1L6XA 3D2UB 5KANG 4N90E 1EEZB 4OD2A 4RFOH 4Y5YB 3ZE1F 3LPWA 3VFNA 2P8MB 4EOWL 2HFTA 3PXJA 3CDGB 5HY9A 4XPGL 3VFSA 2ZUTA 3FOMA 1MWAL 4UBDD 3VXTB 4Y2DD 3FFCE 1X5KA 5FAAA 5GISL 5FKPA 1T21A 5DHVA 2XICA 1B90A 3C5JB 1PG7W 1SJHA 3JTSA 1JGDB 5T1LD 1NAMA 3N1QC 3NFSL 3BW9A 4KKBD 4RDQF 2AKRA 5FDWA 3SGJA 1HXYB 5KVDH 1CICB 4C83B 1YYMH 3BH9A 4KMTL 4J3SA 4NSKB 4G9DA 2YMXL 5FCUL 3WDIA 3QRGH 3QEGH 2PYFA 4H1LB 1K8IA 4PBWD 1QSEA 3GMMA 2YA1A 4OIAA 3UYRH 1BAFH 1X9QA 5FA4B 5FYKL 5HDOA 2VQUA 3H7LA 4C4KO 1TFHA 4E42A 4NQEB 3C08H 4JJ5A 3X17A 4WHTA 1JNLL 5D4QA 5FKAA 4TTGA 5E1HB 5H35B 4FN0A 4JPIB 4XBEL 3GBNH 4ZPVA 1RVFH 4YHKL 1GZQA 2FZ3B 3BIAX 2E6PA 1EJOH 1KXVC 5D7SL 5C6TL 4L4TB 3R1GH 4GJTB 4X7TA 4ZAKC 5HI3D 3HG1B 4U1NB 3KLHC 3RTQA 4DZBA 2UUDH 4N0UA 4Z7NF 1MWAH 2E7HA 3RHWK 3VXTA 1UH3A 3TN0D 2J8UB 5CP7A 2CIKA 1NPUA 5ICYA 3BP6B 4HIXL 4OTXH 5LAXB 3KS0H 1EZVX 1XZ0A 4G6AD 4QXUH 2VQ1B 3PWNB 5HHMD 2XPGB 2YD5A 5JIKA 1IEBB 3RPIA 5DVKA 3TF7C 5F1SA 4PRAA 3STBA 1RZKH 2YD4A 3V6BR 4BFEA 4NWUH 4MLSA 4RNRA 5FUZL 2AK4D 3V6OA 3CFBB 5F97E 3ESVF 2R2EA 5FGRA 1PVHA 3UTOA 1JWUB 2YBRA 3SE3C 4X4YB 1HSAA 4XWOC 4B41A 3KR3H 4S2SB 3WJJA 1NBYA 2LTQC 4NN5B 4LSVH 2APFA 3AB0C 4P9HC 3HPLA 4EDXB 15C8H 4J8RB 3RJQB 3P30L 3GGWB 2HN7B 4CMMA 4UQ2B 3QZWB 4M7ZB 1KSRA 1R24B 2FGWL 1VESA 1L0XA 1BQLL 4MD5B 5DDHB 3QEQD 1XF1A 3SDAD 1VEMA 2AERT 5IMLB 2EIZB 3FB6A 4WFFE 2NY0B 1KJ3H 1IAOA 3IDGB 1IAIL 5IVNA 1WEJH 3B6SA 1ZANH 3KPSD 4TUOA 4OGYH 4O9HL 1OAYL 3BKML 4GW5A 1EMTL 2GCYB 3B4NA 3QIWB 5FGBC 1X5JA 1VEOA 1TCMA 2FX8H 4BFBD 5I1DA 4JQXA 3HZMB 5E6YA 5DD1L 1E6OL 1HHJB 1SEBB 4I8DA 4OGXH 4OZ4B 2HA1A 4MSWB 2BFVL 1ZS8A 4GSDL 3G5YA 4I9WD 5I1JH 4R4FH 2CKBL 1AJ7H 2APWA 2VLRE 1SY6A 1I7ZB 2KPNA 4XNQA 5DEGA 3WL9B 3N85H 4HG4J 1ZHLB 3WHE1 3MV9A 3X12A 2I07A 1GIGH 5FGSA 4DJMA 4L8CA 3OJMB 1R3HA 3KPQA 5BVJB 4WFHE 1IJ9A 5MP6L 1H3UA 1Y0LB 4M5ZL 3EOBB 4PR5B 4G9FA 1FIEA 1J0KA 4U1GB 5SV4A 2HTLC 5I0DA 5D1QB 3SDAA 3VGGA 1UJ3C 4JRYD 5CGTA 4U6YA 2BNUA 4FQXA 3UBXB 1DANT 1EX0A 5B38G 1ED3B 1U41A 5M7QA 2P24A 1RHHA 2ZG1A 5TF0A 4MJ2A 2X4NA 1NCCH 3DLQR 4ERSH 1IT9H 1A6VH 3JXAA 2YD2A 1ZANL 1KB5B 5D7JC 3MRNA 3J7HA 1PZUB 3LQAL 3SDDB 3PDOA 4BQBA 2AK4E 3B2UD 4HWNA 4PFEA 1UZ8B 4XPTH 3OAZH 4OIBA 3QYCA 5TPWL 3G5VB 2YPKA 1N6VA 1TTGA 4HX1B 5KSAC 4EZMA 1YEEH 3ARED 3EYVB 4KZEL 3LMJL 1ZA6A 3VCLA 5JQ6H 4NQCD 3EFFA 3MV8A 4HFUL 1NGXA 1NFDA 4S1DD 5C0BE 2O5ZH 4QWWD 1EDQA 5DMKB 4HGMA 4YBQD 4U49A 5F7HA 1VFUA 3FB7B 2DLTA 1AXIB 4NJAL 4F7CB 4U1JA 4X9IA 1A47A 1KIRA 3NPSB 1NL0H 2JELL 3E6HB 3RL1A 4TNWF 4MS8D 4TUKL 3BGMA 5J1AA 2F54B 4R4ND 4OM1L 1MHPH 1WJ3A 5B22A 4EVNA 4XCCH 2IALB 3PV7A 4KJYA 1MCHA 2W0KA 4Z7UA 5IBLC 5J8OA 2JK5B 3F7YB 4J3TA 3RQ3A 1JPFA 3ZTNH 1TNMA 3NZHL 3UTPD 5IMOA 3RX8A 5MENB 4MNHB 2X4TA 3VRLE 3V95A 4PRIE 5CS7A 5SX4I 2Q3ZA 4LVNC 5EDXA 2VITB 2WM0A 1PLGL 1DBMH 5DD5H 2DIJA 3EYQD 4NC0B 5E2VL 1OPGL 3QUKA 4C57C 4YX2H 4KUZH 4J6RL 3VWJC 1M7IA 3OJVC 5K9JL 3BSZH 4LPWA 4QRPD 1EAJA 3WLWD 4ODWB 4JHZA 1MCPL 4HUVB 1AGDA 4P2RD 1MPAL 3VFPB 4LNRB 1I9RH 1RY7B 4YBHA 1XF3B 5J0BA 2R2BA 2OX5A 2YXFA 3QCUH 3LV3B 3T0EE 3U0WH 1RUMH 4JZNA 1DFBL 2NY2D 3CFJA 1KCVL 4XVUD 2FJGB 2B0SH 4NBXB 4LSSH 1FFQA 32C2B 1PY4A 5DVLA 4UT9L 4W70A 2X1WL 3L95A 1A7NL 1TETH 2YD6A 4Q9CA 1U8MB 1MNUH 1Q9OA 1IQDB 3CX5J 1DR9A 1ND0B 4WTXA 4TSBH 1RV6X 5B4MD 4EVNB 2A83A 1WFUA 4U7KA 2X1XR 4AEIH 1I1CA 5EBWB 4EXPX 4KRNA 5CZXC 1UENA 1J8HE 4DKEH 2Q8BL 1NFDE 1WAAF 3K74B 1RZIB 1S78C 2ZWLT 4M7JH 5ESAB 1OW0C 5T1LB 2QHRH 3S36H 3W5NA 3EYFA 4QHMA 5EO0A 4G8EB 1CFTA 4PB0H 2FATH 1HCVA 3PV6B 3FFCD 4HUXA 2VLKE 2AEPL 4CVXB 2E6JA 3FONB 3FT3A 1NCWH 5CSZA 4X9FA 1UWXH 2FZ3A 1NUDA 1CDJA 5C0AD 2Y23A 3SQOH 5DZNA 4MXWL 1H5BC 3FO2A 1ZHKA 3HZMA 1LP9E 4H5SA 2E9IA 4W6WB 1ZHNB 5E9DB 4DKFH 4MSWA 1YNKH 1H15A 3I6LD 1Z2KA 2AJXL 2CRYA 2EYTA 1Y6MR 1T0MA 2RFXA 4A6YL 3WL9A 1N8ZB 4ACPA 3D69B 4UT9H 3WJLC 1K8IB 3TBSA 4FZ8L 5FUCE 1YEHH 3BESR 2JIXA 2ICCA 1PQZB 4XVUC 4XAWL 3VXMD 4EDWH 1PKQB 3B5GA 5DD0H 2DQGL 1XGUA 4PTUB 8FABA 2DTML 3MLSL 4PJBB 1IC1A 2BHUA 5DUPL 3V5KA 4M8VA 2P1YA 2R29L 4IRZH 4PJHE 4RAUB 5ESQA 2Z31D 1HSAB 3LAFA 1CDIA 3O2WH 3WFDH 4S2SA 1F5WA 1QQDA 1JHLH 5I76A 5DFTA 1OD7A 4HS3A 5D6DC 2J8HA 1S7SB 3WLBB 43C9A 1DQTA 3BN9D 1F58L 1H3VA 1HHIB 1NH6A 2CDGB 2HFGH 4XCEA 1X44A 1YDPA 4MJ5A 5ITBH 1OAUH 3WIFB 1BWWA 1SM3H 3QDAA 4JG1L 3BI9X 3SCMC 3CFCL 4LL9A 4HHAA 4OFVA 1YMHA 4M6OH 5L7XL 2A1WH 4BZ2L 2LAGB 1ZGLM 1KTKE 3N1GC 2VLJA 4KMQA 3MV8E 5EA0L 4QXGL 4FFZL 1I9JL 3MV7D 5GS3A 3ARFC 3VFTA 4G80B 3I6LE 2JIXB 5TQ2H 3MRHB 5T5FH 5EU3B 3AXLA 4UTAL 1OQOA 3TA3D 2HRPH 4H20H 2ZUYA 4UQ2A 3ULSB 1LE5A 5D7IE 3E6HA 1MRFH 4JPVL 1A6WL 1PEWA 2ZCKH 3GSNA 5IB2B 4I77L 3OJDB 3H9SB 5IQ7H 4PRPB 1Y6NR 4FZEH 3WS3A 3QO1A 5F1NA 1AD9B 2Q76B 5E2WL 1U93A 3O2WL 1S9XB 1EBPA 5EPMA 4XPAH 3BYTA 2ED9A 2DQCH 3QRGL 1CGXA 1K8DB 1UH2A 2MNUA 2W65A 1HQRA 1WV7T 2Z91A 1I7TA 2UZXB 4XAKD 1DBKL 5DR5H 3E2HC 1QRNB 3ULUF 3X13B 1R3IH 5JZ7C 1PZ5A 4S10A 5IHLB 1OAUL 3T0AA 3D85A 5IFJB 3CFCH 4YPJA 2HG5B 5MEND 1A1OA 1KOAA 3S8WA 1FV1A 1QYGL 5H37G 3FQXA 4EI5D 1FL5A 3ULUC 3QIBB 4WFFD 5IJVB 4P99A 3A6BH 3E0GA 2C3WA 3CSBA 4QCIA 1IGYB 3O4LD 4UDUB 1RZFL 4H8WH 5HYJB 5BOPA 1N64L 4Q2ZB 5FB8B 1LDSA 2EDKA 1LD9A 4LLUB 1JZ8A 4I3RH 5JQHC 4MMZC 1KB9K 1TJHL 3AM8A 1H0DB 4JHWL 1WZ1H 1CD1A 5IQ7L 3RWFB 4HQQH 3VWKD 3IU4H 4UOW0 4D9RD 2P5ED 1U8HA 4LLWA 1S9WA 3TO4D 4LPYA 1DE4B 1FGNL 4K3EL 1WFNA 1W8OA 2V2WB 5BW7C 3EYQC 2VLME 3QFDB 2Z8RA 3Q6GL 4HGWB 1VGKB 4ZUUB 4PUBL 2YUWA 4HJGA 5F9WB 5C9JB 3HS0A 3O4LE 2FWOA 4JDZA 4O02H 4XBPA 4XB8A 3NCJL 5DMIL 4PJHA 3C6LC 4MA3B 1PKQE 4B7LA 1U9KA 2VZSA 1N4XL 3PWUB 1FGVL 1QO3B 4UU9A 3P30H 1ONQA 1IL1A 1LO4H 1VA9A 3X3GH 1CXFA 1RU9L 2I5YH 1Q72L 2CKNA 2RQ8A 5I6XC 5AZEH 1C5CH 1KBGH 1S7UB 5BJTA 2A77H 4RQQB 1WWWX 4KFZC 1KEML 4U1LA 2PTTA 1IAOB 1U95B 2UVEA 1LE9B 1WEJL 5CZVH 4NPYB 4H8WC 3B6SB 2ZOKB 3LQZB 4OD3L 4KDVA 5I8CA 4U0QB 2GUOA 4JZJA 4JKLA 5DD6A 5FB8A 3EDDA 5IB5A 5EZIL 3LDBB 3P9MB 4MJ4A 3D3VE 1B0RB 2BXZA 4GRWB 3SDCA 5I8OH 3IGAB 5B38B 4S1DC 3SO5A 4YDKL 3HE6A 1NC2B 4OZHA 1FFNA 2BFVH 2QQQA 4AL8H 4MA8L 3RWFA 2E7CA 4Z6AT 4N9GB 1IM3B 4XVJL 3F58H 3VFOA 5DZLA 2GKIA 3SDDC 3X3FH 5LJYH 5K93A 4OZFH 1Q8MA 1XR9A 1JL8A 4L1HA 4MLIA 3MZGB 4PTUA 3PGDA 3MRIB 5CBAA 5DYOB 4X6BA 3HFMH 3LKQB 2XG5A 3ARZA 3O2DA 4M02A 1N3NB 4N1HB 3KPRD 4WENB 2P5EE 5I1AA 2CLZB 4RNRB 5I19L 5HHPA 5E2TH 1D6EB 5JPNA 1FO0H 1U3HD 1OY3B 3MXWL 3DVGB 1LEKB 2VDMH 1L4IA 1AGFB 2FJHB 2B1AH 5F7DB 4X9HA 5IP4A 2XG4A 1M7DA 1RU9H 3ARTA 4LHUD 3D0LA 2B1HH 3T1FA 2AXGA 1MAMH 1LK3L 2LFGA 4FQXB 4M9PA 1EHAA 5LCVL 2P24B 1VFBA 4HV8B 1JK8A 2VAJA 1CU4H 2BNRE 2GJJA 2QQNL 1WIPA 4YWGL 2XQYK 3OKYA 1F6LL 4JQIL 3RY6A 2DS4A 5FXCH 1IMHC 4G5ZL 4LSTH 4OCWL 4ZPTA 3A6CL 4KHTL 4DK3A 1EIBA 4OGYL 4YDKH 4H5SB 1T1XB 1KCUH 4LBEA 1CF8L 4ZXBC 1FFNB 3LQMA 4XAKE 4J3XA 5DTFB 5FYLD 1T2QL 3RI5K 4ZYKB 1O0VA 3LOWA 1CXHA 3BPNB 1P4LA 1ZTXL 4LHUA 3V5HB 1I1YB 2F8XC 2P8MA 3QIUB 3OAUH 3G5YB 4KI5E 4DKAA 2K3TA 4XPGH 5IOPA 4N68A 3VJ6B 5FK9B 3GI9L 2W91A 3ZZ1A 1KN2L 3MRPA 3UX9B 4NQDB 3LN9A 3JV5A 4MQXC 2XRAL 4JY6A 3GHEH 1VACB 3FN3A 3VXUB 4OQTH 3RNQA 3LZFL 1UVQA 3KPRE 2OTWB 4M6ML 4RAVA 1IC4H 4U1SB 1MY7A 4FTVD 1FYHB 5F9JA 3ARWA 2LV4A 2VB5A 1B4JL 1CTNA 3C2AH 1B0GA 3FMGH 2R2HB 4ONHA 4UILL 2H9GB 1S7SA 1MJ8L 5KJRH 4HDIB 1A6UL 5GZOD 5F96H 4OCMC 5I1CH 2QADB 2ZPKH 1FL3B 5IFAH 5T33L 2IEPA 2G60H 4LAJH 5HXMA 1JWMB 3LIZH 3MSPA 1CCZA 3A6CH 3KJ4C 4WW2C 4KUZL 4JB9L 2CJUH 1UH4A 3IFNL 4L4TA 1KJ2B 3KWWA 3BPNC 3MNWA 3BISA 4PJ9D 1S7XA 3MRDB 1G9EA 3R1GL 3MRQA 4HK0B 4OT1L 3FTGB 2G9HB 2NW3A 2JJTC 3NCYP 2DRUA 5JQ6L 4NKDA 3BJ91 2VMFA 3QXDA 4PJIA 3ZYIA 1DLFH 1JGEB 1LO5A 4EQ3A 3VFVB 2MPAL 4LCCC 2PN5A 4F15B 3MROA 2X4QA 3C5ZD 3WLBA 3GNMH 1BOYA 5FDYA 3G04A 5HDBF 3U0PB 1S5IH 4E41A 3TH2T 3BRGC 4WHYH 3DO7B 4G6KH 3VH8G 4M3KB 3SPVB 4PG2C 4ORGA 3VD4A 3BQUB 3AMLA 4JDZB 1AGEA 4HJJL 3CVIH 2NLJB 4M48L 1S8DA 1SJHB 3JTSB 1TIUA 3CFBA 1JPGB 3RDTC 5I1EL 3SKNA 1UM6L 1HXYA 3D5OF 4WUUD 3BAEH 4CNIA 5GRXG 4NQCA 4M6NH 4OCLC 5T33H 4OLZH 1I8MA 4JQVA 2NX5B 2YK1H 2ZSVB 1IGCH 3QHFL 3X13A 4AM0A 2MHAB 4NT6A 3RGVC 5E9DD 4AT6B 1A1OB 3RWJA 1OGAD 5IJVA 4X8JB 5EO1B 5CEYA 2J88H 2EZ0D 5EG6C 5E00A 4ESKA 2IBZX 1YN6A 1VB9A 3MODL 1TVBA 5CSGA 3VXSD 4NQSA 2G9HA 2DI9A 1QLFA 5I1LB 1P2CA 2BVPB 5C2BH 3OKEB 1PSKH 35C8H 5LWYH 3BKMH 1KTDB 3GJFB 3MOAL 3QCUL 1WAAA 5C86A 2EDTA 3RY4A 4FQJH 4OGAC 1DCLA 2OXGA 1N3NA 4QF1B 5I18H 5EU4B 3V52L 3KPOA 4K2UH 4UIMA 4PJ7F 1HYSD 2PYFB 2EE9A 4H1LA 4PTTA 3GO1L 3C60C 5SX5K 2ZUVA 5ALBL 3K3QA 1QBAA 3O3UN 1NCAH 3PABB 1NMCC 1EA9C 5TE6H 3G6JE 3LRHA 3MV9B 5E8PB 2RBLA 4CVWA 4X80L 3HB3D 4HKXA 5IW1B 1BFOB 2WIMA 4M1CC 1BQSA 3L5JA 1Y6KR 3BZFA 4OLZL 1I8MB 1BD2E 1UJTA 4MXQD 1INDH 5I66A 1EBAA 5GHWL 1TQBB 2BJML 2Q87A 4Z7WB 4O2FA 3VGDA 5JNYB 1KLUA 3NIFE 5GIRB 3IFOA 3VMPA 1KIPB 3BKJH 4DKDC 3HE7A 2GK2A 4U1KA 1BP3B 2NXZC 2AEPH 4JO2H 1T89C 5FYJU 1NDGB 3FOLA 3CK0L 4P2OC 3DUUA 2X6MA 4J4PD 4ONFH 5IBTH 2I26N 1G7HA 5C6PB 4N8CL 4S1SH 5DJDB 4HC1L 1I7UB 5T5NG 3VH8B 1W0YT 5D7JA 4JPWH 4Q9RL 4YFDB 4NUGH 3HG1D 2VLJB 1BX2A 4OLXL 5ITFB 3KYNB 5KVGH 4P3DA 1FPTL 1PX3A 1MCEA 1BBDH 2Q20A 4P9HL 3ME0A 2ITCA 2DF3A 5J12B 3QNXA 2DM3A 4ODVL 1FFPA 4GKZA 5JHLL 1II4E 3MRPB 4XNXH 3VWJD 2YPLD 3QNYA 4RMUA 1ZA3A 5D7JD 2B4CC 1F45A 1I1AC 1QRND 4EDXA 4BSJA 1L7TH 1QFWI 4GMSL 2RJMA 1FSKB 1CDGA 5GS2D 5ANMB 1K5NB 1IILE 4XPFL 1I9IL 4KVNL 2J8OA 3K2UH 1PYWB 3T09A 3V0AC 5AUMB 2I24N 3QH3A 4NQCE 1QRNA 1RJLB 2VN4A 4EN3C 4WUUB 4XMPH 3X14B 4WY7L 3BT2H 3L7FB 3VWJA 5AG8A 3K80A 4F7EA 4WHYG 1YA5A 4RRPG 4LSUL 2JE8A 1ZS8B 1WBXA 4KKCD 4NUGL 1EEYA 4L3AA 2OJEB 5FKAB 1I8LC 3QQ3A 1FQ9C 1AQDA 4JJ5B 5L7XH 1PDKA 1FHGA 1A6ZB 4G7YH 4WCYH 3F65A 1C16A 2AJ3A 3AREC 3HG1A 1ZVSB 3UTQA 4ODHL 4LNRA 3S88L 4TN9A 2X4QB 3TO4B 3WEXA 1IBGL 1M7DB 1I9RL 3B2UC 3WO4B 2XZZA 2VDOL 5K9OB 1QBBA 2F5AL 1FNAA 5DUML 3CFJB 2X4PA 3MQIA 3TPUA 4WV1B 2Y5TB 3KLAA 5D1XB 4NC2B 2PXYD 3OXRA 2WBJC 4LSSL 4N0YL 5E1AA 1MQKL 2VXQH 4PGEA 1NDMB 2NW2B 4R4NC 1U8PB 2VLRD 4U6VL 2VXVH 4ETQA 4NWUL 3C2SA 4X9BA 4Z7OE 1T04A 4JN1L 1REIA 3DWTA 4NFBA 1GRWA 4LCYB 1N4XH 3BVNA 2R2HA 4PGZA 3BT2L 3ROLA 3T4AA 1ZT7B 5KSUA 3O2DH 2I25N 2IG2H 1T03H 3PQYD 1GGBL 4ODTL 1BECA 5EULV 4P46B 3WFCL 4PJGA 3OAZK 4WWKC 4U1LB 3KVQA 2BNRD 3IFLL 1KLFA 5JO5B 4OZIE 1YEGH 4BYHA 1FE8L 4KKAC 4WI3A 2BVUA 4H0HB 1EUUA 4LHQB 1JNJA 1SYSA 3R8QA 4NM8L 3D18A 4PLKC 4WUKH 3BD5A 1KIRB 3GK8L 4DKFL 3EZJB 3GKWL 4I3RL 1ZWIB 4HWUA 5F3HA 1R3KA 2RFXB 2F54A 1RJYA 1WC7B 5IB3A 4FQCH 3O8XC 5FO7B 4S1RL 2Q7YB 3U1SL 3ZDXF 4LCIH 1MQKH 2ARJQ 3S37L 4OSUL 3BEVA 3TWCL 4ZXBB 1HZHL 4HT1L 5C0BA 2EXYD 1S7RB 4NYLA 2XQYG 3V4PL 1JN6B 4X83A 3VXME 4FMKA 3VD9A 2LAAA 3KYOA 4PJBA 3QZWG 2F74B 1EFQA 4N5EC 3E1F1 2F54D 1RHFA 3ZL4L 4Z7WA 1A7OH 4DEPC 1C7TA 4U05A 5C3LD 3P3YA 4FTVE 2L4OA 4DCQA 5GSRA 1BEYL 4TYUA 3U36B 3KXFE 3VXPA 4EI6A 5GS0L 5T1DL 1KYOJ 1OLLA 4XX1G 5IVOA 1A5FH 4BFIB 5DUBB 5DFWH 3M8OL 4ZUTA 4JG0H 3ZKSD 4Y4KD 4ERSL 3VXNB 1Q0XH 3WNKA 1T6VN 1LGVA 3ZDZF 3Q6FB 4MGXA 5IHUL 4EI5C 2NX5D 3QCVL 4Y2DC 4DN3L 3CSYA 3LQAH 4LDLB 2VQTA 3IDNB 2XZCH 4BZ2H 1NLBH 1WCQA 3KPMA 1TZGH 3MNZB 4Y89A 1KPUA 5HYQA 3LRGA 1FFPB 5CP3A 4Z0XB 3QDHA 3B83A 2A83B 1F8TH 5FO7A 1OTTC 4FFZH 5C08D 3T04D 4DK6A 3L3HB 4OFIA 2OP4L 3U30B 1CQYA 1QA9A 4XMKL 5EZOH 2XKUA 1P5UA 3O6LL 2K7PA 4Q6IA 1K5NA 4HWBL 1CE1H 5A2LH 5A16A 3HAEA 3OKDA 4EUPH 1X5FA 4JQXC 1YMMB 5C0CA 3GSNB 3V4VL 5D2NB 3V4UH 5KSBE 4HS6A 5IM7B 5BVPH 4MNGB 2VXTH 1D6VH 3ARDA 3RWCA 4S0TD 2YA2A 3U83A 3GIVB 1H3WM 3ARBB 3UAJC 4OM1H 3MOBL 3GSWB 1P7QA 5SWSA 3ARFD 4O2FB 2FX7H 1I1RA 3IF1B 4N1EA 4NQED 2C4XA 5L2KD 3S3JA 1KENL 3W82A 4IOIA 4OKVA 5CEXA 3PWPA 3ZTNL 1NMBL 3SO3B 3OB0H 4HUWA 1F4WL 2EXYC 4P4RB 1JMXA 4JM4H 5CZKA 3I75B 1A7PH 3TCXA 1MCFA 4JKMA 2AEIT 5E9DE 1P7QD 3WJJC 4YUEL 4JAMA 5DD5L 5JHDD 3KLHD 3H0TB 1NLBL 3T8XA 3KJ4B 3WFBH 3DOSA 1S7XB 1HINL 1CF8H 4L3EB 4AQOA 3JV0A 2AEQH 3UJJL 3U7WL 3NA9L 4OT1H 3O41A 4NQVA 4G8GE 1WFTA 4PJDE 1RUKL 4WUUE 4QHNA 3TPUB 3OJ2C 2BSRB 4PP2A 4C4KT 1CZ8L 2ZNWA 5I9QC 1IKNA 4RAUA 5ESQB 4NUJA 4K07A 2QR0B 1CE1L 1NDMA 2NW2A 4MNQE 2P43B 3H9HA 4AZ8A 4LLQB 4XWOD 5CKAA 1E6JL 4K71C 4YBLC 1DE4A 4OQTL 2HVKB 3MYZA 2Z93B 3VE0B 3QFJB 3UTZB 1RZJL 2FO4A 4PJGF 1X3DA 3GSVA 5JOEA 2VZ1A 1S9XA 2CGRL 1KENH 2DI8A 3TFKC 3ULUD 3TIEA 3NCBB 4Y4KA 3BP5A 5DMIH 4JFDE 1F4WH 2HJKA 3DECA 5SWQA 1JRHI 5GS2H 3DUSA 5BXFA 5KSBA 3RWEA 2Z8SA 4P23A 25C8H 1OOAA 5AZEL 2B5IC 3E8UL 3GSNL 5C3TA 5MHSE 5I1HH 3O3BA 2P5WE 4HF5L 2VZTA 4QXTB 2VLMD 4ZSOA 4ZAKD 5HI3C 3O41B 4NQVB 3QIWD 4OD3H 4R2GD 1TMCB 3U0TB 1JPSH 4DW2L 2VDQL 4MA7L 1U6AL 4P2RE 1A7QH 3SJVA 1BD2D 3FO2B 4GKOA 3FO0L 4M9OA 4PJIB 5T3XH 4G8GD 2LVEA 4LHUG 4WNQB 1WGOA 3GHBH 1QR4A 5E9DA 2BX5A 1U2HA 4NGHL 5EPMB 4G8FB 3HUJE 1CDUA 4NO3B 3TA3C 1NCUA 1YN7A 4LAQL 2BY2A 3I6GB 2AJZB 5K9QG 4OCXL 1S5IL 4YNYA 5HDBE 4FG6D 3K81A 2W9DL 1AJ7L 3H9YA 2WV3A 4PG2A 3V8OA 3IVKB 5KG9A 3ARGA 3VU2A 1AGFA 1TQCB 1FVDB 3KYMB 3TJHC 4L9LC 4L4VB 4Y7MA 2FIKB 4OI7A 5EO9B 3ZKXB 4YHNB 3HS0B 4HBQA 3FQRB 5H94A 3HHRB 3WUZA 4PJ8B 4KVCL 5JIHA 5KSBB 2DQIH 1JHLL 2EE6A 5INDA 1QFPA 1T5WA 1UB5B 5IIEA 1I9EA 1MAML 2V6HA 4P46A 4UU9B 3EYSH 5GRWA 3H8NA 5DJ8A 3A6OA 1JBJA 5AWNH 1FZJB 3MA9H 4J3OC 1PY9A 4GAGH 4X7SL 4KROB 4DUXA 5D7JB 3RA7L 4JFYA 4WW2A 3QEUB 1U6AH 1TJIH 3MODH 3VMNA 2F53E 4LNVA 4FFVD 3B8YA 4YDLB 2IAMB 5KVGL 5I1LA 1L9MA 2ZCHH 3D0VB 3M07A 3PG2A 5LWYL 3Q1SL 4KY1H 3QAZC 1P4LB 4LHUB 1R5VA 2P42B 3C9NB 4RGMC 2X5PA 4X98B 2BVOA 3V5HA 2P5WA 3HNSH 3LKRB 2XXMB 1MHHA 4PY7A 3OKDB 5EOTB 1KJMA 3KLSA 3LS5L 4TVPL 4FP8H 2NZIA 4E5XA 4ZS6C 3CVHB 1TZHB 1FG2B 4JPVH 1VACA 4I48B 1LO3H 3OGOE 3F5WB 3F8UB 5E0QA 4ODSL 2ADFL 1UKSA 3GHEL 5E2WH 1AXTH 5BO1H 5FOBA 3K4AA 3LY6A 5A43C 2NXYD 4WEUD 1R5IA 4HIIB 1DVFA 3RVVC 5E5UB 3QUMH 3VXRD 4OV5A 4GBXC 4K3HA 4BK4A 3C87A 1K3ZA 1KPRA 4KI5D 1DP0A 4CW1B 4JDTH 4M1GH 4Z7UF 3SDXE 1K4CB 5IESH 2I9LB 3V79C 1IKFL 2XTLA 2AK1H 2NY6C 5DK0B 3AY4A 1C5DB 2QHLA 2X4SA 5DJAB 3U7YH 2NY1C 5GS0D 4GRLD 5EOCJ 4M7LT 3MV11 4G6JL 5IWLC 2DQHL 4I18A 4JKKA 5CINH 5E94B 1RMFL 5ETUB 3FT2A 3EO9H 1BQHB 1IGYA 2ESVD 2FJFB 3BKCH 4QRSA 5JLZB 5SWZB 5A40E 5BS0E 1MY5A 5GS1C 3HNSL 1CGVA 2AXFA 5GS1B 1IBGH 5IMMA 4Q2ZA 5F7MC 1FIGH 3HG1E 4RFEA 1W0WA 1YY8B 3SKJH 1GJIA 4XVTH 2OTPA 5I17B 1MCPH 3KPTA 1TJHH 3IRZA 5D1ZD 4ELMF 5IKCB 4XNXL 2MCPH 3O6KL 3ARBD 3DRQB 1UCBL 2GJZB 2WLYA 5K9QI 4MD5A 1MRCL 5B8CC 1RZKC 5DA4A 2G5BB 2OZ4L 4DGVL 4LEOB 2GJ6D 5GGVL 3VXOB 4WRLA 4JR9L 1XCTA 3SN6N 1YC8A 1HI6B 1L6ZA 2NLJA 4N0RA 5DJCB 4LLMB 3P73B 4GH7B 3FQNB 2VDKH 4P5KA 4XNYL 2VJXA 1J8HD 1A3RH 3T2QA 3VXMA 3O9WC 2JCCB 4XPHH 4D9QD 1XR8A 3OKOB 5IESL 3IYLW 5IT2H 5C08E 2VZUA 3GMLB 2EDJA 2YPLA 5I15L 4ONHB 2JIXD 4BH7A 4ZOEA 1JHKH 1DDHB 5K59F 3EW3B 5CJBA 3IXTA 1SY6H 4YXHH 3VA6A 1BBJA 1FL3A 1IL1B 3I2CL 4QTHA 4PRHB 4YO0A 2DQUL 3LB6C 5L8KB 2LABA 4PJDB 5KZCD 5DJZB 2EDDA 4XBGA 1KV3A 4TQEL 4I3SH 2J4WL 1C16B 1LO0L 4WUKL 4ZAKB 3K4DA 4FQXC 4JO1L 2EIZA 3FQUB 3UAJD 3A67H 1PSKL 3IDGA 4N8VG 2IPKA 1CFQA 5DVOA 4DTGL 2AJZA 5T1KB 5IVXB 4YBQC 2MJWA 1KCSL 1E4XI 1JZ5A 5BV7B 2E6QA 1R0AH 3OX8B 4LCIL 1OTUD 3V9FA 2OMNA 2KKQA 3NGBC 4RBPH 3MMEB 3G9AB 2AGJL 1JGVL 4YHLL 3WSQH 4GKNA 4QOKE 3MREA 2PKDA 4NZTL 4WGWB 1NFDF 2R4RH 3BXNA 4UIKH 5KSAA 4M5YH 3QFJA 1M6OB 2BY1A 1QFUH 4ZS7H 1OARH 4G6AC 1QNZH 5GZNC 3Q3GB 1MI5E 1SEQH 4H1LG 4MDJA 5DUPH 4ZFFB 4Y4KB 4JZOA 2VC2H 3MA7A 4JM2B 4CNIB 5FGBA 1MCDA 1UWXK 4X6EB 5L2KE 3DX6A 4A2MA 5EIIA 4PR5A 1I75A 2X7LB 5LCVH 2VR5A 4JG0L 4HV8A 1J7VR 4YHYC 4GRMA 3IFLH 5ICXA 2F53A 5E2UL 1YQVH 1NCTA 3KAAA 1DBJH 4M1DH 2BVTA 5M94B 2CDEB 3DXAD 1RZ7H 1ZHBB 1JK8B 4I5BA 5ADOL 5I1IL 3RFZC 4N8CH 1AP2A 3VFWA 2F8VA 3WHXA 1LEGB 3N1MC 4LHJB 5GJSH 1JGDA 3AROA 4ZODA 3PDGA 3BQUA 1S9KC 3CFEA 3D39D 1AE6H 1R3KB 1MVFA 4O2EB 3O3AA 3EAKA 4LOUD 5GGTH 1KCRL 4HWEH 1JPGA 4XX1E 1IZJA 3C6SB 3MJ7B 5DRXA 3X11A 4BUGA 1P4IH 4AG4L 3QNYB 3CVHA 5IROC 1HK6A 3LRSB 2K7QA 2VDLL 2NY1B 3O6FA 3MBXL 5L2KB 2DLFL 4NRXB 3W5MA 3MREB 4KKBC 4WJ5B 1NGZA 5AZ2H 1G7LB 1U91A 2EIEA 3NVQA 4M7KL 4P2QD 5KSAB 2Z8WC 1JVKA 1U8KA 4E9LA 4ZUSA 2VYRE 5INCB 5ISZD 1A6TA 5C07D 1NC2D 2EC8A 4C56E 4YDIH 5C0CE 3WS6C 1CBVH 2D7MA 4LP5A 1PYWA 2IPTH 1RZGA 4NC1C 3DETD 3AU1B 2AJVL 3K8MA 4HH8A 1MHEA 4L3ED 4XP5H 4HXAH 4PRDA 2D2OA 4MJIE 3DX8A 2ILLA 1QSVA 2BHZA 2CUMA 1UB5A 5TDPB 1CFVH 3MUJA 3UO1L 4LPVA 1FORH 5I1CL 1RJZA 5HVWA 2XI9A 1F42A 2PYEB 5DR5L 5LAXA 2DIAA 2DB8A 4A6YA 3LIZL 3ZKQD 2Y7QB 1MIMH 5JLZA 4KZDH 4ZDHA 3H7BA 4P2QE 4G43A 5HHMB 4JO4H 5E6ID 5GGTL 5MEQB 2GY5A 4Z7QF 5DC9B 3DX7A 3D1MC 3DV6A 5HYJE 2ICWB 2EXWD 4QRUA 3EDEA 4NO0B 5EO9A 5F7EH 3FZUC 3P0VH 3KPPB 1EFXA 4NUJB 4LU5L 1FZKB 4OFKA 4YHIB 4E0RA 4FQIH 4NNPH 2B2XH 1OHQA 1G7LA 2IANA 4X7FC 4DUVA 4PD4J 4LLUA 3TPKA 2F5AH 2FX9H 5SX4H 5L2JB 1ZAGA 4HPYL 4FXKB 5IUSA 1Z9SA 3W11C 2MQCA 4LGSB 4ZD3L 4XWGH 1LDPL 2WP3O 1CD1B 4P2YA 4J12A 1VADA 3ZDYF 5DEFA 2IPTL 2VXQL 3KNBB 5EU7C 4LOUC 1CL7H 1F02I 2CK0H 2XT1B 3CVIL 4JFFD 4TVPD 4Y88A 4KAQL 2EECA 4OLWL 1A0QL 1JGUH 3LEYH 3PHOA 2YUVA 4JEGB 1YECL 4QRTA 4QY8A 2HFEB 3SE9H 3HZVB 5E56A 1EMTH 3SOBH 4LPXA 4CW1A 3FFCA 3IDXL 4RSVA 1JUFB 1K4CA 4NQEA 5TH2B 1E0OB 5IF0B 1A7PL 2QV2A 3F7RA 3NIGF 2CKBB 1CD8A 1A9EB 3P11H 2QKIA 1XMWA 4OZIB 2VLRB 5TE4H 3EDJA 4AEHH 4L8DA 2YPVH 4WI9A 5DMJB 1T66C 4PP1C 3WFBL 3ES6A 2OR8A 4AT6A 5C07B 5MERB 3X12B 1DUZB 5C0FB 2ATPA 3KPPA 2W9LA 3MRLB 4Y2DB 2P49B 2PYEE 1JTOA 4FQIL 3EOBA 1YQ2A 2R0WH 1YN6B 4OQ1A 3K4ZA 3VXRE 1F4YH 1KELL 1AFVL 2JB6B 1QKZH 5L6YH 2PNDA 4P4KA 3I9GH 3T0ED 3SDXB 4XC1L 4G7VL 4QXUL 1YJDH 2AJUH 3FT4B 2XA3A 3HRPA 5JZ7D 4GS7C 4NDMA 4PV9B 1KPVA 3B3IA 3E2HB 1D5IL 1HILA 2A38A 2WBJA 4YE4L 4KGJA 4MB4A 1ZLWK 1ZT4A 3PHOB 1FVDA 3KYMA 4UZGA 5I1KL 1KB5L 2GITB 4DGIH 3IETB 4KTEH 5A2IH 1JWUA 1EHXA 1FAIL 3UJTL 4PJ8A 4L9LB 3KDMA 4I0PB 4PJEA 5JXEA 1XGUB 1G7QB 5I73C 5IVZA 2FLBT 4X4XB 1QBMH 1G0XA 4J8RA 4Z7VB 1KGCE 4ENED 4RFOL 4MAUL 5C6WH 5E6ZA 5JNYA 3TBWA 1R24A 4LF3A 4BA8A 3TESA 4R7DB 3GSNH 5D7LB 3U4BH 3VGBA 3OGCB 4OD1L 1J8KA