1T6VN

Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lysozyme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
RVDQTPRSVTKETGESLTINCVLRDASYALGSTCWYRKKSGEGNEESISKGGRYVETVNSGSKSFSLRINDLTVEDGGTYRCGLGVAGGYCDYALCSSRYAECGDGTAVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Crystal structure of a shark single-domain antibody V region in complex with lysozyme.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Hydrolase/immune system
total genus 33
structure length 112
sequence length 112
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6vN00
2ADIB 3X13B 3PGFH 1XGPA 2IH3A 2WANA 3HE6D 2Q3ZA 5DI8B 2ESVB 1FFQA 5DJ8B 3HAEG 3D2UA 4GKNB 4WV1B 1HIML 4ONFH 2AJUH 4WUUA 2HMIC 5IHBA 3LV3B 3H0TB 4CMHC 4XVJH 1LE9B 3L1OL 3O2VH 2ED7A 1IGFH 3HI6H 1T2XA 5EOCH 1A4KA 1F4YH 1FYHB 3EYQD 2AK4A 4ELMF 2FEEL 4KKAD 4K71B 2I9TA 1ZS8A 2HN7B 1R6VA 3RVUD 1BIHA 2D0HA 1BX2A 1UXWB 3C5JB 2VXVH 3L1OH 1RJLA 2ZSVB 2J8UF 3MV11 1BMGA 4WHCA 1T7WA 1I9EA 3RI5F 3S4SB 1EFQA 4LLWB 5IMOA 4O58L 3T0EA 5IJKC 1WQVT 4LPUA 3WUZA 3QH3B 3B6SB 4KK6C 4AK1A 1MIEH 2Q87A 5A2IH 2GJZA 2V9QA 3VFOB 3NH7H 4X6EB 2AERT 2A74A 1NEZB 3Q0HA 3HZVB 3IAGC 3WLWD 3AC0A 4MLIA 1SVZA 5DVOA 1UH4A 1CWVA 3HZMB 4O58H 4UINL 3BP7B 3V0AC 3KYNA 4D9QE 3PNWB 2Y7QB 3DHJA 5I75B 4PB9L 4N5EC 2HJKB 5SWSE 4JQVC 1FNAA 3UPAA 1QQDB 5HI4D 3ULUF 4QHNA 1GGTA 4HUMB 3X14B 2MKWA 1NCNA 4Q2ZA 5DRNA 3TJEL 5HPOA 3V8OA 4UINH 1LWRA 1WFNA 3MROA 4U7KA 2C3VB 5E8NA 4DK3A 4J12A 4OZGB 1X5FA 2Q8AL 1LO3L 4PB9H 2J6EA 3VXNB 1DUZA 1N0XL 1X6NA 5EU6B 3RL2A 3QQ9C 4NZDA 4KI5F 3PWUA 2GTWA 4NQDE 4NPYA 5GS1A 5I1AA 4UOW1 3TJEH 2XY1A 2E27L 2EDOA 5F1SA 3MLYH 2OLDA 4UUJA 2Q8AH 1LO3H 1OAUL 3G5VB 5DQ9A 5K9KB 4OFKA 1N0XH 5CMAA 1S9YB 5C0JA 2F53A 1DN0A 3BAEH 4OQTA 1T1ZA 1EVTC 3GI9L 1JF1B 1ZLUK 1NQBA 5CBAA 1K4CB 2ATPA 2VLKA 2E27H 4Z78B 4QRTB 5SX5H 3KJ4B 1PKQE 2CLRA 1F4HA 4MQTB 3VGGA 1MJ7L 2BXYA 4P4RB 1U8QA 1OAUH 3OZ9L 1XH3B 5IFJA 1X5HA 1Q1JH 1KC5L 3NABL 3UYOD 3UPRA 1U8LB 1RHFA 3PL6B 3GI9H 1A1MB 3TBTA 1JGLH 1A6AA 4JM2A 3FZUD 3EOAB 3HZKA 1P6AB 1QSFA 5C86A 1KNOA 3LKQB 4ORGB 1T6WA 1LO2L 4HV8A 3OZ9H 4HC1L 3W0WE 3MRRA 2G5BA 3MV7B 1MNUL 1KC5H 2J8HA 3T4YB 3P0YL 2JF1A 4MAYD 2EIZB 1N59A 1AR1D 4AIZA 5GRYA 1KCUL 2B8OT 4P5KA 5ID0A 3ULUD 1ZMYA 5A3ID 1ZANL 1S7XB 4WW2B 3LEXB 5ISZA 4CN1A 1PVHA 2C1PA 3MMEA 1LO2H 4HC1H 3W2DL 4WI4A 5MEND 1MNUH 1MFBL 3P0YH 3F6LA 4RGOL 1Q9KA 2IAMB 1F6LL 2IPUK 4PGBB 1P84J 4N5UA 3P9WB 3ARFC 4QHMB 5ESVB 3U46A 4KI5D 3I2CL 4S10A 3VI3F 1ZANH 5D1XB 2UY7A 2BVYA 3WFHB 1XGQA 3WIHA 1MHCB 5KSBE 4JKMA 5DGQA 1HHKA 4KDTC 1NJ9B 3EYSH 2VDPH 1BFVL 3W2DH 1E27B 5I1GL 2PETA 1MFBH 1TMCB 2VN4A 3QFDB 1OAYH 1RULL 2W92A 2HVKA 3NPZB 4PJBA 4Z5RA 3LRHA 3T09A 3ULVC 5MHSE 4RAVB 2FX9L 4MJ6A 5FECA 3VCLA 2GEEA 2NY7H 3HNVL 3V6OC 5DJYA 5BVJA 4H1LG 5I18L 1BFVH 4GBXB 5IVOA 1Z9OA 4JAMB 3IFOA 3QIBB 2X4OA 1A6ZA 4Z6AT 4Y4HC 5I1GH 3T0XA 1RULH 5DUBA 3RJQB 4JCMA 3NIDF 4GMSL 2FX9H 4QRPE 4M5ZL 2HG5A 1KENL 3SKNB 4ZAKA 4U05A 3HNVH 4YC2B 1VEOA 2ZUVA 4K2UL 4YDVB 2OJEA 4TSCL 5I18H 5E9DB 4NZRL 4P2OA 5EORL 4LBEA 3ZDYF 3SBWC 3PHQA 1HH6B 3C8KB 4KK9D 2BSSB 2X4SB 1EHAA 1KJ2A 4ZPVA 4POYA 3MFFB 1B88A 4GMSH 4O02L 3P0GB 4PJGA 2IADA 4RIRB 3ZE2F 5E4EC 4M5ZH 4PRIE 4U3HA 1KENH 4X4XB 3OXRB 5IJVB 1HEZA 1UFUA 4XXCC 1ND0B 4GRLA 1K4DB 2DICA 4GUPB 4TSCH 4QT5A 3W11C 5KSUB 5IW6A 4GXUM 3GMOB 5EORH 4NZRH 1BFSA 1IKFL 1R3HA 3EO0A 1D7FA 4MD5A 2B5IB 3AB0C 3V4PL 5A16B 3OL2A 3T0BA 1YMME 2FH8A 3TBSA 5JO5B 3G6AB 1SEQL 4RNRB 5DJDA 1JZ7A 2EYTB 3SE3A 4OCLC 2DL2A 1G7MA 1H3XA 2X9XA 1Q72L 3ILPB 2DBLL 1IKFH 3RKDC 4GRMA 1GH7A 3GSOA 3V4PH 4MMZC 3GMNA 2VQ1B 1KJVA 5IV2A 4EOWL 3NZHL 4P4KC 5CSBA 2W9EL 2FDBP 5JZ7C 4KRNA 3WN5B 2YPLE 1G9NL 1Y0LA 2BHUA 3IU4H 4GKZA 1I7UA 3U6RB 2WAHA 4WU7B 2DBLH 1I8MA 4AQ1B 2D7TH 4MDJB 3TPKA 3IFLH 4KPHL 1ZHKA 5E70A 1RZGA 5GGVL 5IMMB 4M43L 1HSAB 4OUUA 1S9VA 2FO4B 3H9SA 3NZHH 4CMHB 2WK2A 5DZLA 2W9EH 3AM8A 4K3GA 1DEEB 3WFBH 3R8QA 1XF4A 4C4KO 1G9NH 1KB5A 3VXPB 4OZIB 2JB6B 4RBPK 3WHE0 1R5WB 4WU5B 3VFGL 4RGND 1H3PH 1TJIL 1XIWA 3MV8B 5CJ8A 5FO8B 5LGKA 5J1SC 1DLHA 5CIPA 2HJFA 3QDGE 4KPHH 5GGVH 4M43H 3O8XA 1CD9B 4Y19D 5K93A 4MNHB 2XACC 1J1XH 5C0CB 4BSWB 2GJ6D 2UY6A 1S7RB 5C07E 5FKAA 2QQLL 5I76A 3FOMB 1NGXB 3VFGH 2K1MA 4E9LA 2UWEB 2PYFA 1TJIH 5ALBL 4MQSB 3VXSA 4MD4A 3RWJA 4HUUB 5IVXB 3M1BA 5INCA 2X4PA 1Z6JT 4PJIE 4P2QA 3VJ6A 2WBJD 1QKZL 1LP9A 2QQLH 3THML 3RZCA 2QSVA 5GHWL 5I74C 1MAML 1RUPH 3ARTA 5ALBH 1JWMB 1AGFA 4N9OB 2VR9A 3BZ4B 3GHBL 1H5BB 1ZV5A 2DIAA 2RB8A 3TJHC 3Q6FA 1UG9A 1J0YA 3P4NB 4HJGB 4CMMA 3CXHK 4PYGA 1QKZH 5B4MD 1U95A 2AK4D 3THMH 1T03L 5GHWH 1MAMH 1HDMB 4RDQF 4HULB 3U83A 2A73B 4CW1A 4F9PA 1TQCC 4G9FA 3GHBH 2R9HD 2Z93A 3RAJH 3FQXB 2DWEA 5IBUB 1JNHA 4ZO9A 5EIIB 4HK3J 3U36A 5H35A 5ADPL 2VZ1A 4G5ZL 4DKDC 1T03H 4FQXC 2A9ML 4F7TA 3X3FL 3BDBA 5IP4A 2AXJA 1U8JB 1VFMA 3IFPA 1LVEA 3WFCL 2P8MB 4PBXA 1PY9A 1OP3K 4P59L 3MRQA 3SDAB 5GRZA 4Z7VB 1YY8B 1V3LA 5FM8A 1F00I 2CO6B 5DURD 4JR9L 5IWLA 4BQBA 4G5ZH 4EI6B 1UJ3A 3KXFE 4JFPA 3BE1L 2X4QA 3I6LD 2JKXA 3X3FH 1ZK9A 1FJ1A 3CX2A 4HKZA 2E3VA 3JWNC 5C0AB 3IU3A 1XCQA 4P59H 3NBNA 1NAML 4HSQA 1JV5B 3VGFA 2EC8A 1VDGA 5DD5L 3ARGD 5EIQA 4LCWE 2AXFB 1W0VA 3VD7A 3MRBB 4NFCA 2J3SA 1B0RA 3ZHDA 4YK4B 4NN6C 2ZOKB 4R4BB 3QZWB 3BE1H 3L95B 2W1NA 3MRDA 5IQ9A 2NY1D 4MA3A 3STZB 5DRZA 3ARXA 4NO5B 4HW6A 3SJVA 4GKSB 1P7HL 4AEEA 3DV6B 3OKYA 1JPST 2G75B 4FFZL 5D8JL 5D6DC 1CGXA 3L7FA 2FL5B 4PJ9C 4UIMA 1X5ZA 3TVMB 5DO2D 4Y2DA 5F1OB 2APWA 1FNLA 4PJBF 2F53D 2HTKD 5DMJB 2XWTA 2GK2A 3QQ4A 1MRFL 2UZYB 4FFZH 5HDLA 3KPTA 1FVEB 3D3VB 4KROC 4LPXA 4ZXBC 5JORB 2OS7A 1QFWL 2JJWA 1NLDL 5IB1B 3RNQA 1UB6B 2X4UA 5J0BA 4LNRA 1QR1A 1NC2D 1U8MB 4M8QA 1F6AA 3VD3A 1VERA 1MI5B 2Z8VC 3BMWA 4P3DA 5M94B 3TIDA 1BLNB 2R0LL 4HGWB 2JCCF 3CSYB 3QNZA 4X6CF 4G6AD 1QFWH 1NLDH 1MHHB 4JGUA 5EBLB 2FO1A 3O6LL 5HVHC 4YHOL 3IDJB 4D0CB 3RUGB 2F74A 1CYGA 3W9DA 4QXWA 2W07A 2F8OA 1KBGL 4XNQB 1RU9L 1DUYB 2PXYC 2R0LH 1CFNA 4I2XA 4LVOC 3LN5A 4R3SB 2EDJA 4UMGA 3QJFB 3UJTL 2X4RA 3HPJA 2BCKB 4HKXA 3O6LH 1YEEL 4YHOH 1KYOK 4G80B 5SWSA 3U2SB 1IILE 3ARQA 1H9VA 3DSFL 5B3NA 1UVQA 5DYOA 3S36H 1F6FB 3N1PC 3T04D 1KBGH 4UOW0 4OF5A 4Y4KB 1J8HB 1WCQA 3MO1A 4K7PX 3OV6A 2ZG3A 4IIQA 1R3JA 1T83A 3QXWA 4R8WL 5E4EB 5E2TH 1K8IA 3UJTH 2GTZB 1FH5L 4LDLB 4EN3D 3PE9A 4WI5A 2QTEA 2XTJD 4XP6H 3DSFH 1IARB 3IDXH 1D5MB 4GRWH 4NQDA 4JB9H 4MQ7B 4NHCL 5IKCA 1WCBB 3HZYA 1FVDB 4I4WB 1JWUB 2KDGA 1BQHB 3BH9B 4HWNA 3NFNA 3MRIB 3WS3A 4XVSL 1FC1A 3X3GH 1PSKL 4P0DA 3QIWB 3IETB 3UBXB 3DYMA 3UEZA 3ISWA 2P42B 3V5KA 2O5ZL 3JTSA 4DKEL 3BWUC 1GOHA 5E7BA 4P5TC 4K55A 4NHCH 5TGBA 1T7XA 4NRYB 3FFDB 1PKQA 4D3CL 1Q9WA 1S5IL 4U1SB 2CDGB 4XVSH 2W0FB 4JFFB 1C8PA 4TUOB 2IPKB 3V7AE 4MCZA 3CZJA 4TNVK 1I7RA 1Y6NR 2O5ZH 1FO0L 1HNFA 4HCRH 4OLXH 4DKEH 2BHZA 3OKEA 4NC1C 4KKCD 5ICYB 5EUKB 1BVKB 3V5DB 4OKDA 1BBJB 2I9LB 5F1NB 5EA0L 3IXTB 3WE6A 3L3KA 1OGAB 5I1LB 1NBZA 1WTLA 4D3CH 3MZGB 3MRJB 4GRLD 3D0LA 5HPMB 1S5IH 5FB8A 1UCTA 4IDJL 4QY8A 5JDJA 3W0WA 4LFHG 3ZTJG 3EHBC 1TQBC 1U93A 4Y7MA 2E7LC 4Z8FL 3STLB 2EE9A 5DD3L 1FO0H 3FO9B 1RK0B 3IJSA 4MNQD 3OKNA 1LP9F 1EAJA 5EA0H 1KXQE 5IMKA 3GMMB 2Z92B 4UDTA 4PJ5A 3VXTB 3DARA 4U49A 5HHVL 1FSKB 1MWAB 2PKDA 4IDJH 4CVZB 2X9YA 2QHRL 3EDKA 3BP5B 4N90D 1YN7B 2BSRB 2LU3A 4Z8FH 4I5BB 5DD3H 1F42A 2F58L 4UZGA 4I9WE 2OR7A 1TZIB 4LRIC 5DT1H 4XTRD 4ZG1A 1BJMA 3CUPB 2FX7L 4D0DA 2BFVL 2PW2A 4XPGL 3TNNA 5KSBA 1GOFA 4HLZG 1E4WL 1KLUB 1CI5A 5I74B 2QHRH 2K7PA 5D2NE 5EU7C 3C8DA 3H7BB 5D96C 5JW4R 4IS6A 2AKRB 4ZOBA 1LD9B 2A6DA 3I6GB 5FUOH 1TJGL 2DYPB 4X5XB 4HMCA 3ZT7A 4PJDE 1IKNA 4FXLA 4ZD3L 5IT2L 2VXUL 3RWGA 1DVFA 3SDXE 2KH2B 5E8EA 2ZSWA 4G8EA 5CEYB 2FX7H 5T3ZE 2BFVH 4NQEA 4XPGH 3PIQB 1I85A 2VLRB 4HIIB 3DX9B 1E4WH 5D7LE 1A3RH 4FQ1L 3PWLA 1NGZA 3KNBA 1KTLB 3UTOA 8FABB 3ULSA 1TQCB 4PTUA 4OM1L 3AREA 2CUHA 4JREC 4WRLA 1TJGH 5FYKL 4WJ5A 1KLFA 1MCCA 3RWFA 2BOCB 5IT2H 1U92B 4ZD3H 5B8CB 4P49A 4PD4J 1U58B 5F7EL 4MCYB 3VD4A 3RI5K 4GW1A 1C5BL 1PY4A 2DKUA 4FQXB 5HHOD 1T7ZA 4FQ1H 5BZWA 3FO2B 2J8OA 3DTXA 5I6XB 3HNTL 3U82B 5EC2B 4NZTL 3VFMB 4PRIA 2FR4A 2XN9D 4X6DB 5ECJE 4YHIB 4ZPTA 5F7EH 1ETZA 2UWEE 1C5BH 5TDNA 3SKOB 1CD1A 4DQOL 4JFYA 4PS4H 1G7HB 1ZA3A 4U7MA 4X8JB 5T1KB 5C0FB 3HNTH 1YMMA 2X70A 1NCDH 3Q1SL 1JF5A 2Y1VA 4GLRI 5ERWA 4NNXA 1FE8H 2XXMB 2R1XB 1WISA 2IFFH 3IYLW 2C4FT 3Q3GA 1WVZA 3B8SA 3LHPL 2CIIB 3QNYA 5IEHA 4XGZB 4DQOH 3L3IA 3ZT6A 1X5KA 3D39D 2Q7NA 3MUGA 3OKKB 4J3SA 4R7DA 4CVUA 1MWAH 5L6YH 3PP4L 5E95B 3BEWA 3Q1SH 4HK0A 1T20A 2YPLA 2YD2A 5IOPA 4X0KA 4GO6B 3FQTA 5ID1B 2F5AL 5H2BB 4PR5B 3LHPH 1JPFA 2NZIA 3S98A 1QBLH 2YSSA 2VJXA 4X6BA 2J88L 2DOCA 3IGAB 2VDOL 2KL6A 2Y23A 2RJMA 1MVUB 2YUZA 3PP4H 5ENWB 4FHBD 5HVWA 4NSKA 2FSEA 1HCVA 5BW7C 1NFDE 3U9UB 2F5AH 5DS8B 5IBTL 5L2KB 1NFIB 4KROB 1GC1L 4MNGE 4NQSA 5KTEL 3OF6A 4ZXBB 1DE4A 1YYLL 3WO3B 3IXAA 2LTQC 2P46B 1QD0A 3QDGA 3GUTA 2J88H 5I66B 2ZG2A 2VDOH 5KVGL 4WNQB 3OSKA 4LHUA 4Z7VE 1JK8B 5FF6A 3WNLA 5C07A 3T77A 4PV8B 1X4YA 3PWJB 5IBTH 3MLPA 3GJEA 2GUOB 5KTEH 1RJCA 1XMWA 3TA3C 1QRNE 4APQA 2WMPA 5GGUB 4XBPB 4L4VE 4KK8C 4AEFA 2I5YH 1HOCB 2JLLA 4PJIA 5KVGH 3KPMB 2FJGB 1BOGA 1HHHB 4FRWA 1BQSA 1YNKL 2PW1B 2GI7A 3L9RB 4OCXL 2F54D 1FV1B 2PXYB 2X44D 3BO8A 4LVOB 5HHXL 1NDMA 4PRAB 1AXIB 2M1KA 2O26U 1MHPL 1U8PA 1K8DA 3KPSD 2NTSP 1VESA 1P6FA 2DB8A 3VFRA 2EXYD 5D1QD 3F12B 3K3QA 1YNKH 3E3QE 4OCXH 4Z77A 2D7MA 5HDQL 3SDDC 5CKGA 5HHXH 4MSWA 1C5CL 5D6CA 1MHPH 4IJ3C 4JANB 3LV3A 4KJPD 2FECI 3N85L 1JUFA 3TNMA 2R1WB 5HYSB 3D87B 4QHLB 2AP2A 4P23D 3AU1B 3D3VE 1X5AA 1YPZE 4NCC2 1ZLUH 4YLQT 4NNYB 5HY9A 4JJ5B 1KTKE 4OZ4B 2HN7A 2RHEA 3B9DA 4LSVL 2YK1L 2P48B 3OB0H 1C5CH 2UVFA 5E1AB 5HYJE 4S2SB 2YZ8A 1UXWA 1HI6B 3C5JA 4HT1H 4MB3A 3HE7C 1OW0C 3N85H 1ES0A 4XBEL 1ZA6B 3X12A 1OB1A 3MA9L 1PFCA 1RUML 4J3OC 3S4SA 3KXFA 3QUYA 3ULVE 3NA4A 4MHHG 1ZOXA 2JTDA 2X1PA 1KF9B 4LSVH 4MD0A 4POZD 2HVJB 1F4YL 4JRYB 3V6OE 1PX4A 4QRSB 2O61B 3VFOA 4LCWA 4AT6B 4ZFOA 3MA9H 5CD5D 5H8DA 3HZVA 3HE6C 1RUMH 2VZOA 5JPNB 1FZMB 1OTTD 2VRAA 1ZWIB 1IL1B 4KDVA 3BP7A 4P46B 5DWUL 5IB5B 1QEWB 3B9EA 2HJKA 2X1XR 5GIRB 3Q48A 3RDTB 1J0KA 3GK8L 3H42L 1U8KA 3WLBB 5LGJB 3EYQC 1TQBB 3TBWB 5L9DH 1AKJB 1MRDL 1RY7B 4KKAC 3D18B 3RVUC 4KJYB 4XNYL 5B39G 3EW3B 2WNGA 3WKML 3JWOL 3J7HA 4G6FD 5DWUH 2NLJB 2LU7A 1JIBA 4DW2L 4BQ8A 3BPNC 4JFDD 1DBAL 3HNSL 3VXNA 1TVHB 3MLUL 3GK8H 3H42H 1K5NB 4JFEE 1Q0YL 1JVKA 1EUUA 5DQJA 3UJIH 4XCYB 3GMQA 3GKWL 2CIKB 5L8KB 4XNYH 1D5XB 4JRXD 3WKMH 1LGVA 3BDXA 1M05B 4K3EL 4DW2H 1DBAH 3HNSH 5D93C 2FIKA 1S9YA 2YPKB 3QWOA 3WLWC 1TITA 3OR7A 2P5WD 1Q0YH 4QTHA 5IHZB 1Z3GL 2EDYA 3IDNB 5D96B 4LGPB 3GKWH 1IZKA 4LCYB 3L3DB 2DLTA 4U2ZA 4HLJA 3ET9F 4K3EH 4S1DD 5JXED 5E5UB 4CU7A 1XZ0B 5HI4C 3AMLA 3CSPA 5IF0B 4XP5L 5D9SB 2Q3AA 3FB8B 3PL6A 3C60B 3WNKA 3QDAA 1Z3GH 1MFAL 3CDCA 4TUJB 1C1EL 1AGBB 3EOAA 3SDYH 5AUMB 1OP9A 2VSDA 4ORGA 5HDOA 3OKDB 4GMTL 3MJ9H 2GT9B 3MV7A 1N6UA 4O5LH 4DVRH 1A64A 3FCTB 3T4YA 3KLHD 4NO0D 4TQEL 4Z0BL 1D5BB 2DQHL 4I0PD 4KGJA 4J4PA 1C1EH 2GQHA 4Z76B 2QL1A 5SWZD 4F37F 1MEXL 2OTUB 2B4CC 1U3HD 1U42A 1QP1A 1R5IB 2N7BA 1HXYA 3HR5B 3LEXA 3WS6A 1CICD 5K9OB 4AM0B 4GMTH 4ETQA 3BD5A 3MV01 4Z0BH 1VGKB 4DZBA 1IM3B 2P4AB 4PGBA 1RHHB 4OF0A 1KIPA 5ESVA 4LCIL 5IGXL 4Z7UB 2IAND 2NTFA 1MEXH 3JVGA 2CKNA 4TNWF 2PTTA 3W82A 2DQDL 3GIZL 3SO3C 1YEGL 2IH1A 4KRLB 2Q6WB 4HG4K 5C2BH 3NN8A 1D9KC 1NJ9A 1BEYH 4P3WA 1T5XA 3FZUC 3QUZA 2P44B 1XF5B 3P0VL 3LQAC 4QRPD 4LCIH 1QBBA 4RAVA 1AY1L 3MREB 1VGEL 4PG9B 2VKXA 5C0BD 5T5FL 1YEGH 4RBPH 1KPVA 4MHHI 4S1QL 3JV6A 4GBXA 4YFDB 5L0QC 1AR1C 1GGBL 4JZJA 3ULUC 1IQDB 4DUVA 5AZEL 3TT3H 3P0VH 4X4ME 5IB3B 3B9VA 4O2CA 4J3TA 3BOVA 1T5WB 1MCWM 1AY1H 4UT6L 3RBSA 3VDCA 3SKNA 3WFEL 1VGEH 3ELAT 4DK6A 4PGJA 1IEHA 3OGCA 4UT7L 4OIBA 1F4XH 1CXKA 3BUYB 4QHKI 4BUHA 4YBQD 3ARBD 2AJZB 4M1CD 4S1QH 1ZLVK 3D85D 4PJIF 2ICCA 1JZ8A 1GGBH 4KQ3L 3C8KA 2Q7YA 4ODWB 2BSSA 2X4SA 4KI5C 1INQB 3MFFA 5AZEH 3F7YB 1A9EB 1MUJB 5JPMA 2MMXA 4RIRA 2UUDK 2K9UA 4FMFA 4HS3B 4UT6H 1UJTA 5DUPL 3WFEH 2BNQB 4F15B 1SJHB 4XNUL 3LMJL 2UV3A 4UT7H 5MEOA 4E41B 2P24A 1ACZA 1K4DA 4GUPA 1HYSD 3FFCD 1FL5B 3TA3B 4OCWH 3KPQB 3UTSB 3VXUE 4KWUA 3NCYS 1VPOH 2D3VA 5LG1A 5A16A 1ZSDB 4MLSA 3G6AA 5TQ0L 1P5VA 5DUPH 3LMJH 4MJIE 1FG9C 3G04B 2A6IB 5I1JL 4HWUA 4EI5A 3HMWL 5JOEA 4UTAL 4J8RB 3JBG7 2X4NB 1J1OL 5D2NA 2P43B 5JHDB 2F5BL 2ED8A 3S37L 2VQ1A 4Y16A 4J1UA 3ZKXC 5TQ0H 1MCWW 5EBWB 3WN5A 4PJDA 1OY3B 4F9LC 1XR9B 4NIKB 3S36X 4LFHD 3CMOL 4GW4B 4XCEB 2E6QA 5I1JH 3BD3A 4KK9C 4PRDB 4F80A 3U6RA 1FYTB 3HMWH 4UTAH 5D7LA 5FA4B 4U6XA 4MDJA 4HPOL 3SDDB 1J1OH 4S11A 4NUGL 2F5BH 4IJ3B 2NNAA 3M17B 2VLJE 1MOEA 2AQ2A 3QG6B 4P2RD 1JI1A 1QFPA 5J13C 1A47A 1XR8B 1DEEA 5C07D 2X2YA 3O3BB 4L9LC 2JB6A 1QTYT 3HRPA 5BXFA 5EU5B 1BM3L 5MEPA 3RWHB 1WAAE 4XNXL 4GAFB 4NBXB 5DD0L 3KYOA 2ZZUT 4HPOH 1LEIA 3DMMC 4BSVA 1EEZB 1MJJB 2D7PA 3FOLB 4NUGH 1WZ1L 3BGMB 4JRWA 3HE7B 2VN7A 5C0CA 4CAGA 3ZKND 3FB6A 4XI5D 3VXMD 2CH8A 1S7RA 4BH7B 5JMOC 1CDGA 4MX7A 3TN0D 3TH3T 1SJEB 1NGXA 4DJMA 2CK2A 1Q0XH 2UWEA 4L4TB 4CKVX 1EHLL 3LKSB 1JYNA 2YD4A 2FZ3B 4ZQKA 4XNXH 5IJKA 5DD0H 4HUUA 1F3RB 3TZVD 1CBVL 4RMUA 3RGHA 1WBZA 3RWCB 4NNPL 2AABL 3QDJD 4FTVD 3VGEA 4JVUA 1WZ1H 3Q5OA 3O3EB 5I1KL 2XY2A 4KUCF 1V7NL 4XP1L 3ZE1E 1R3LB 1CK0H 1EXUB 2EDEA 3LS5L 3GMPB 1JGDB 4PJAB 2CDFB 1IMHC 4YGAB 3BKYL 1KT2A 5I19H 4H5SA 2CPCA 1JWMA 4WI8A 3SCMA 5DFWH 1LEKB 3QWRD 5GGQL 1CBVH 4QLRA 4NNPH 2AABH 1H3UA 4RX4D 5KS9E 1C5DA 3H2WA 2APFA 4JQVA 1V7NH 4XP1H 5I8EA 4NOBA 5DHVH 4RGNC 2Q76A 4K8RD 1EHXA 1WWCA 2P8PA 4OV5B 3BKYH 4Y1AE 1ZGLB 1TNMA 1PDKA 3EOBA 4HWZB 4PBWD 3NGBC 4UV4L 4BH8B 4HBQA 5GGQH 3GSQA 5BS0E 5EZJB 5JOPD 3OB8A 3FQXA 3BPNB 1XT5A 4X99B 5GS0D 2CJUL 2ICES 4FQCL 3TFKD 3VXRD 3G08B 1WSST 4PB0L 2OJZH 2X9WA 1NFDA 4ODXA 5KW9H 2WWKO 4MNGA 2YEZB 4UV4H 3DO3A 1U8JA 5F6HI 4IOSD 2KZWA 2P8MA 3BUTA 2EECA 4KMQA 4YXLL 5KJRH 2R23B 2ATKB 3VG9B 2H1PH 5D93B 4NQVB 2CJUH 4K9EC 1YY8A 4Z7VA 4LCWD 1T21B 4FQCH 2HKFH 4PB0H 3UCRA 2BVPA 5F97E 4CDHA 1UXSA 3NFSL 3S6CA 3FTGA 2MWCA 4HUXB 3CAFA 1QRNA 4X7EC 1R24B 1IEAB 2YD3A 3O3UN 5H37H 3UTTE 1WICA 1FFNA 5E8OB 4LLUB 4KDWA 3INUL 3QISA 4TPRL 5B4MC 5ESQB 2BRRL 5E6IB 4I48A 2OQJB 4F7MB 2AXFA 3EYVA 2CR3A 4A6YL 3VXQB 3IDIA 3C6LD 4KUCD 1YNTA 2QSQA 3NFSH 5CEZE 5DJ2B 1UZ8B 3QZWA 3RRQA 1E28A 2R9HC 3JTTB 4NO5A 2OSLA 1BVLB 4AMKL 3DV6A 3INUH 2BOBA 5BRZE 5LAXB 1KYOJ 4TPRH 3WSQL 3DVNA 2BRRH 2D03H 5IBLD 2G75A 5MEQB 4OD1L 4A6YH 5EU3B 1WBYB 5FUZL 2X05A 4ELMB 2W60A 1P4BL 5FGBA 4NKDB 5C70A 2V7NB 5EZIL 4PJHE 4AMKH 3EDDA 2I07A 3WSQH 3VWJD 5B38B 3ESVF 5IB4B 1YJDC 3OG6B 2J8UB 4WFFE 3DXAD 1YYML 4OD1H 3O6FB 2FJHB 5FO7B 1FVEA 1AI1L 3D3VA 1YPZA 4ONOA 2EYSB 5FUZH 3MBEA 3ARFA 3B5TA 4XRCB 3QXDB 1S7VA 3VH8B 1P4BH 4JO1H 5D2LE 1HH9B 5EZIH 5HYJA 1YMHA 1S7TA 3SO3B 3ARGC 4NUJA 3QUKB 3TYGL 1D9KB 4KDTA 1G7IB 1NC4B 3LRGA 2DQJH 2BNRD 4WHYG 2MKLC 1YYMH 3GM0A 5EU7E 1QNZL 2NY1C 3O4LB 4H0HB 1VADB 2YBRB 1I4FB 6FABH 3QDMB 4PP1D 3MNWA 5JNYA 2XA3A 3V6OA 4WWKD 1DLFL 5CJQL 4M61B 3O11B 3ABZA 5GS1C 2R0WL 3W81A 1FC2D 4Y4HA 4LSSL 2FH6A 4JPIA 5DO2C 1QNZH 3MNVA 1M1SA 1NBQA 5HHME 4OM0L 2EH8L 4M48L 1SY6L 4LP4A 1QVOA 3P30L 3U0TB 3MUHL 4JKKA 2BCKA 1TCRA 4NQUA 4X7TB 5J3HD 2HTKC 4ZUSA 5JW5A 1IC7H 1DLFH 1T0MA 1UM4L 5CJQH 5GISL 1MFCH 3WKNA 1E4KC 2R0WH 1XF3A 2L0DA 4L5FL 5DJXB 4LSSH 4BZ1L 4XXDA 1A6VL 3MR9B 3VDBA 4OM0H 2EH8H 1SY6H 3IVKB 3P30H 4F33A 1EVUA 3C6SB 2H9GB 4N0UB 5K9JL 4XXCA 4ZUVB 3EYOB 2IBGA 1UM4H 4RCAA 5GISH 5E2JA 1NEUA 4JFEA 4HUVB 3V4VH 4L5FH 1D5MA 4PREB 4BZ1H 4PJDF 3PWVB 3SDXF 3VE0A 3V6BR 1NCBL 4MQ7A 4ZUWB 1I8LA 1IAII 3WHXB 3CVHA 4I4WA 1BQHA 1AD9B 5T1LD 5K9JH 3V0WL 2H2PD 1S7UA 1CGSL 5DTFA 3UBXA 4DCQB 4H20H 5FYJD 2IMNA 3HMXL 3QCUH 3T0AA 4XMPL 3H9YA 1F5WA 3TIEA 2VXQL 4P9HL 1NCBH 5AZ2L 5EFIA 2NXZD 3FFDA 4OLUL 3QUML 4P4KA 1MCEA 3ZKXB 3LSOA 2NY2D 4GAGL 3PHOB 3SQOL 3V0WH 4OAWA 1HXMA 5IR1B 1CGSH 3H3BC 3W9EA 5EO1A 4EIGB 4OJFH 1N5AA 35C8L 4U1MB 4UAOC 3HMXH 3G5YA 4B41A 4XMLH 4XMPH 1X7QB 4IRJA 2F9BT 5E6ZA 1BVKA 4GLRH 2VXQH 4P9HH 5F1NA 4X9IA 5AZ2H 4EN3C 4OLUH 3QUMH 2DS4A 3S5LA 2XTJC 4R97C 3JV0A 3MRJA 4GAGH 1BQUA 5CZVL 5L2JB 3SQOH 3TCLB 1WWBX 4L9LB 1NMBL 3DECA 5FCUL 4MJ5B 3VRIB 5C8JB 3EFFA 35C8H 4F2MB 4XCNA 2A1WH 3DMMB 4I9WD 4ERSL 3F7VA 1EAPB 3O2DA 3PABA 1UB5A 2MHAA 3GMMA 1P7QD 4FXKB 1G7LB 1UQSA 2RFXA 1KCSL 5CZVH 1JFQL 4FABL 3RY5A 2LVEA 3PDOB 1NMBH 5FCUH 5C08D 3UDWC 1WZLA 4CVZA 5HHNB 1FDLL 1KPUB 4CVXA 1TPXB 2VOTA 1NGYB 3BP5A 3Q5TA 4X6FB 3UTSE 4Q58C 4I5BA 5DC0A 1AQDA 1ZHBA 4ERSH 2HFEB 3I6KA 2HLAA 4PRHD 1MLCA 5L8JB 4HKBA 1JFQH 2YD5A 5TQ2L 4AIOA 5KSAD 1FDLH 4KKCC 5EUOE 4OFIA 3HS0A 1XAUA 4KGLA 5JHDE 4ODSL 1NFDF 1LD9A 4KV5F 5D7SL 4GRLC 3WEXB 2DYPA 2I27N 1UM5L 3QAZC 4HIHA 4RGNB 2AV7B 2GIYA 3PIQA 2VLRA 4IOIB 1FFPB 5TQ2H 3DX9A 1FYTE 2VWEE 3NGBB 4Y19B 4ODSH 8FABA 2P5EE 4X4MA 2VTFA 4NKMB 5C0GA 3U30B 2GJ6B 5D7SH 4JDZA 4PRNB 3V2AR 1UM5H 2J4WL 5DMIL 4NBZB 2DLIA 3P2TA 1U58A 4MXWL 1RVFL 4FQXA 4RAUA 1CVRA 3QHFL 3PDDA 3CDGA 5FYLE 3ARZA 5HVFB 2FECL 3CFDB 3QA3A 3S97C 3IDMB 4V1DE 4XTRC 5EC2A 4QRQA 2GYSA 3VFMA 4C54A 1EEYA 2J4WH 4HX1B 4X6DA 2CR6A 5DMIH 3JXAA 5CJ5A 4IRZL 3MCKB 4MXWH 4L29B 1J05A 1RVFH 4WUUB 5AAWA 3HB3D 4ZTOH 3VI4E 3VXUA 4LF3A 5C0FA 1YUHB 5ANMB 1ZLWK 2AK4B 1FL3B 2FGZA 3FN9A 3K8LA 1CE6B 4PY8J 2I9TB 4GG8B 1EFXA 2CIIA 3K8MA 3WCYA 1BX2B 5F21B 4XGZA 1JYXA 1RURL 3VWKD 5F7KC 2ZWLT 4G43A 5D1ZA 1PQZA 4K07A 1YPZF 1T1WB 5BJTB 1E4XH 1C08A 5IMOB 3P11L 5ID1A 4BQCA 5D6DA 2AI0L 3E2HC 4PJ9A 4WVRA 3M8OL 3MRNA 5T1MB 1RUKL 3LZFL 2R15A 1RURH 2GJZB 3QI9D 3IGAA 2QSCL 1YEFL 1MVUA 5DURB 4BK5A 4V2CB 2VLJA 1BBDH 5CINH 5ENWA 3SKJH 3T0WA 4F7EA 3FKUS 3ULVF 5JOFA 3UTPD 4Q9CA 5C0ND 4Q9RL 1A1NA 5DS8A 5L2KA 2V17L 3KYNB 3M8OH 4ZXBA 1WAAA 2E7BA 2VDLL 1RZJL 5DC9B 4L4VD 2ITDA 1G6RA 2QADD 3MUZ1 5I66A 4FS0A 4WNQA 1T4KA 2BSTA 3QO0A 2PCPA 4Q2ZB 5DRNB 2P45B 1RSFA 4Q9RH 4LGRB 3MROB 3PWJA 4N8VB 5E56A 2NY1B 4JPVL 4S1SH 1NCCL 2GUOA 3WBDA 2EDXA 2V17H 5I1DB 1AGDA 3V6FA 2MSPA 4RMTA 2VDLH 1RZJH 5GZND 2D7QA 4HWBL 3ARRA 1PZUB 1HOCA 2CDEB 2D4DA 3LKPB 1JNJA 1O5DT 3KPMA 3PWUB 5LQBL 1OARL 4ZUTB 2DLHA 2GTWB 2VR5A 4NPYB 3OKOA 5GS1B 2YWZA 3PJSA 1MCOL 2BP3A 1JGUL 3F62A 3L9RA 4JPVH 1CVSC 1NCCH 2PXYA 3S4SG 2V5RA 4UUJB 3RIAF 5JIPA 1I3RA 5HYQB 3DRTB 4F37K 5CMAB 5C0JB 5JW3L 2F53B 4WUKL 2IQAA 3RIFF 1T1ZB 4Y4FD 5LQBH 1OARH 3GI8L 2RGSA 2DM2A 5CBAB 5I1HL 2VLKB 3DETD 1NEZG 1MCOH 4X4ZA 3WUWB 1JGUH 3MBED 4JHZA 1INEL 4PJFF 1U8QB 2NX5D 2CSPA 4YHNA 4RMVA 5IFJB 4TNWK 1F3JA 5BS0A 1RZ8A 3S96B 1CZ8L 3BKML 5JW3H 3QNXB 4WUKH 2CUIA 4GT7A 3GI8H 2GITA 5KG9A 2ZNXA 1A6AB 5C0EA 5I1HH 2CKBB 3HZKB 1QSFB 3D0VB 4I0CC 2X40A 3AU1A 3B3IB 2EC9T 1JPGB 1UWEL 4C56D 1INEH 3NCYP 1DQLL 1LEGA 4KHTL 4OZ4A 4CU8A 4Z7WE 1E6OL 3GSNA 4HV8B 3MRRB 4YHYC 5E1AA 2G5BB 1CGWA 1HI6A 2ZUYA 2H6PA 1CZ8H 1IRAY 2ZJSH 2DMKA 3OJ2C 4KZEL 3B9KD 3OAUL 3T08A 1H3VA 4M3KB 4AIZB 1HWHB 5ID0B 2UZIL 4HIJB 1UWEH 4JQIL 5ISZB 4P5TA 2JIXD 2NYYD 3G5ZB 2C1PB 4KHTH 3MMEB 1E6OH 1DCLA 3UTTA 2HVJA 5I0ZA 3S8WA 2EXYC 5D1QC 4QRSA 2VC2L 1Q9KB 3RY6C 4KZEH 2O61A 3OAUH 1YEHL 3U48A 3REVB 2J6EL 1A6WL 3U4EB 3U46B 4AT6A 4UAOB 3LN4B 9CGTA 4W6WB 5JPNA 2FD6L 1XCTB 4JQIH 4NC2B 1IL1A 3KYMB 1XGQB 4NO2A 4KJPC 2XTJB 4R97B 1QEWA 2A6JA 5MENE 5GIRA 5BRZA 5BZDB 4JFED 3QIUD 3WLBA 2HVKB 2QLVB 4P23C 4PJBB 4Z5RB 2ZUXA 3HRZA 2J6EH 1A6WH 1G0XA 4G8IB 4WTZA 1KCRL 4XHJD 4MJ6B 3TBWA 5FECB 2E7LA 3K4DA 4KI5E 3D18A 3VCLB 2VYRE 3SDCD 3RX5A 4IOFD 2FD6H 4OQTL 5DJYB 5J9PA 5BVJB 3CSBA 1B0GA 2NLJA 1J18A 1PBYA 4PJHA 2Z31A 4QRUA 5DUBB 1LILA 1D5ZB 1KCRH 1B4RA 4U1IA 2BY2A 4TSAL 1F3DH 3GSUA 5E94B 4OQTH 4POZC 1CDUA 1EDQA 4LRIA 1JPSL 2JCCB 1RIHL 2OJEB 4R2GD 4X6CB 5CD3A 5D2LA 1WBXA 4P2OB 3OG4B 4JEGB 3PHQB 4I18A 4HG4J 4MB4A 3MPCA 5CD5C 1Q9OB 2YPKA 4ZPVB 3EZ8A 3IDNA 3C87A 4ODTL 1E6JL 1ZT1B 4TSAH 1HEZB 1F3DJ 4GRLB 4M00A 2FHCA 1JPSH 1RIHH 5C2UB 1FAKT 3BXNA 4HS6A 5IW6B 1ZXQA 1R3HB 2D0FA 3HG1D 3EO0B 1XZ0A 3BGFC 5IF0A 1NMCB 1P84K 1ZLVH 2PYED 3DO7B 1N4XL 3TBSB 4MNQB 4JG0L 3KHOA 5FO9A 1K6QL 4ODTH 4TUJA 1E6JH 5FYKU 5J1AA 2WQRA 4HQQL 4KRMB 1M6OA 3N06B 2UUDH 3MLVH 5A2LH 1QSED 2FYYA 1G7MB 1MSPA 3LS4L 3CFEA 3OKDA 3PQYE 4OCMC 2GT9A 4OTXH 3GSOB 3BP6A 3FCTA 3GMNB 3WIHL 3MOQA 1KJVB 3NCJH 4JG0H 2HAZA 5HI5D 1K6QH 4HXBL 3PF2A 4HQQH 4KTDH 2OTUA 1ULVA 5F9DC 4GKZB 4H25A 4HFWA 3C09C 4RFNC 2X89A 1BD2D 4AM0A 4HMEA 5I0DA 1WC7A 1ZHKB 1RZGB 4UT9L 4ODVL 3WIHH 4ONHA 4OUUB 3DIFA 1IM3A 3ARDD 1XGTA 1O0VA 4HXBH 3CC5A 3VXOB 5CILL 1BFTA 4XVUD 2Y5TA 4U1GC 4ODUA 4S1DC 5JXEC 4KJQD 2A0LD 5ESAA 5DD1H 5SV3A 2Q6WA 3CPLA 5CIPB 4OLVL 4P9ML 4UT9H 4G8FA 3O8XB 4ODVH 5F72S 4NO3A 4YR6A 3RWDB 1J12A 1XF5A 2ADGA 1KIQA 1JN6B 4EDWL 5CILH 2Y72A 5FKAB 1KJ2L 4PG9A 3H7LA 1I8KB 1WAAF 2YXMA 4RWYL 3VXSB 4N0RA 3K1DA 3KLHC 5HHOB 4MD4B 3RWJB 4OUOA 3M1BB 3E2HB 4P9MH 3VD9A 4LAQL 3HFML 2X4PB 3HI1A 4ONGH 4P2QB 3V0VA 1IQDA 3VJ6B 4XAWH 1CTNA 1U3HC 4LKCA 4EDWH 1L0XA 2XN9B 3OGOE 1T5WA 2VUOA 1LP9B 5I1IL 1KJ2H 1CICC 1KEGL 3O9WD 4LEXL 4RWYH 1AGFB 5C3LD 1EZVX 3TO2B 5FYKE 4LAQH 4YDIL 3HFMH 2GW5A 1CGTA 3VXUD 4HGKC 3ZE1F 3VFVA 3Q6FB 3RQ3A 4QOKE 4CMMB 1U95B 2DKSA 4HS3A 3CFKA 4I1NB 4U1NA 5I1IH 2BNQA 4MJID 1KEGH 1M7IB 4E41A 2NW2A 1T66D 3BX7C 1O7VA 4G7VL 1CIDA 4C83A 1KOAA 4CW1B 4YGVB 1S9WA 2O93L 5KS9F 3O2WL 3PP3H 2Z93B 3QXTA 3RP1A 1OAZL 3TA3A 2DWEB 3UTSA 2BSED 5E5RB 1JNHB 3MRMA 1NCAL 4HHAB 1ACYL 2N56A 1A4JA 5ANME 3NFPB 3U36B 1ZSDA 4L8DA 2RR3A 3GSRB 2J1KA 2GK0A 1QBAA 1A7OL 2ZUQC 1V5JA 1KB5L 4TVPL 3QG7H 3O2WH 5EUOA 5GJTL 4J8RA 3L3HA 1OAZH 2YD7A 5CLTA 2DJUA 2X4NA 4Q0XL 3MRQB 1ZT7A 4OSUL 4U0RC 5JHDA 1NCAH 3T3PE 5F7WC 5HGGS 1F11B 2X7LA 3NCEB 1G84A 3BPLC 4L8SC 4YBQC 4JFPB 2WUCL 4N1HB 2X4QB 2R69L 4KK5D 1FJ1B 5IW1A 4HKZB 1A7OH 1FYTA 4TVPH 4X4YA 1KB5H 4H26B 1UADC 1VFOA 5GJTH 1XCQB 5GPRA 3SDDA 4Q0XH 1QFUL 4OSUH 4W70A 1RZFH 3NTCL 4X5WB 2GSIA 1XGUA 3OKMB 1DSFL 1UKQA 2DM7A 5CIPH 1NUGA 5L7XL 1HYSC 1XR8A 5LWYL 4B7LA 1RI8A 2WUCH 2JJUA 3MRDB 1JYWA 4NWUL 4MA3B 3I6LE 3JWDL 2Y07L 3KHQA 4PGCA 5DRZB 3CD4A 5FXCH 1PW3A 5EU5A 3SJVB 3A67L 1FFOA 3RWHA 3DUSB 1CFTA 1QFUH 4S0SD 4YHYB 2DWDA 4GFTB 3BGMA 5GGSA 1DSFH 3HE7A 5IBUG 3H3PL 1OW0A 4UIMB 5L7XH 4LSQL 2NY4B 4XBGB 3QDHA 3SN6N 1MELA 2C3WA 4NWUH 3AXLA 3JWDH 2Y07H 4H8WC 3SPVB 4L4TA 3LKSA 3CMGA 3A67H 3VMPA 2FZ3A 4NWTL 1YEKL 2A77L 3RWCA 3ECBA 2XWTB 1TVBA 3QQ4B 3O3EA 4P99A 4ZO7A 3BMVA 3H3PH 4J3WA 3GMPA 1EXUA 1PKOA 1YZZA 4LSQH 4PJAA 1T7VA 4Y1AD 3HE6A 1ZE3C 4PJHF 4LNRB 3K1KC 1GZPB 4NWTH 2A77H 4M8QB 4MS8D 1LEKA 3T1FA 1I9IL 4BSJA 1DQJA 3TIDB 2HTLD 4YXKH 4JHAL 4P23B 4MA8L 1EO5A 3QNZB 3QFJD 5D2LF 2HA1A 1KIUA 4QO1A 2XZAH 2VNCA 4QCIA 3QZWG 3HI5L 4BH8A 4LHQB 1KIRA 3IRZA 2F74B 5EZJA 2HT2D 3W9DB 3ZKNC 1I9IH 4DEPC 1INDL 4KTEL 1LQSR 2E8YA 3TN0C 3HUJE 1CFNB 3Q2CA 3OPZL 4JHAH 4MA8H 4X80L 3BFOA 3MYJA 3I3EA 4P3CH 4HKXB 5E03A 3TZVC 2YEZA 1WFOA 3HI5H 5SWSB 3UTTD 1IEBB 1WZMA 1CLYH 2OK0L 4JHWL 5DYOB 2R23A 3UYPA 2ATKA 1INDH 4KTEH 5F9JA 3MO1B 1T21A 3CXDL 1AGEA 3OPZH 3VGHA 1IAIL 4IIQB 1R3JB 3ZO0A 4OF8A 5TF0A 4UU9B 1GSMA 1R24A 2VISA 3MNZB 4Q74A 5BV7C 2X41A 5BRZD 2OK0H 2NXYD 2V2XA 4K8RC 5B22A 1SEBB 3BGFB 4NQDB 1I1AA 3CXDH 3CZFA 1MIML 5IKCB 3FONA 5I71B 3HZYB 3KG5A 1IAIH 3G6JF 5E8DL 4ZDHB 1NAMA 4O2EA 4G6FB 1QHPA 3NFNB 3JTTA 2AAVA 3PDGA 5GS0C 2XTJE 5HHQB 1A7RL 2X10A 4YQXH 3TFKC 1MJ8L 5DJ0A 2RCSL 2Z31D 3V5KB 5E6YA 1H3TA 3CX5K 5EOTA 4WFFD 1B90A 1MIMH 1TFHA 5MEQA 4GS7B 2DQGL 3BVNA 3JUYA 5EU3A 5E8DH 1PKQB 1G1YA 2ESVD 2IGFL 4Z0XA 2EKSA 1N0LA 2V7NA 4J3VA 4Z7OE 1A7RH 3C09B 1WIOA 1MJ8H 2E8ZA 4MCZB 4RFNB 2RCSH 2P5WB 1I7RB 1SMOA 5ICXA 1WIUA 3BW9A 4X5LA 4YBLB 5C92A 3OKEB 1QRKA 5F1IA 2Y25A 5IB4A 3DGGA 3X11A 5B38A 2J8UA 3GMLA 4U6VL 5L88L 3WE6B 5FO7A 3L3KB 2DQGH 4EJ1C 4ODBD 1NBZB 5CAYB 3QULA 2E9JA 2AJVH 4DTGL 3WD5L 3D6GA 2ICWB 4WDIA 3D0LB 2IGFH 4XRCA 2H2SD 2R4RL 5FB8B 4Z7WA 4QY8B 3QXVA 2D4FA 1HH9A 1N7MH 1VACA 1U93B 4D8PA 1BOYA 5HI3D 2PR4H 3BIBX 3ZYZA 4ZFFB 1P7KB 3QUKA 1DBBL 3T65B 1G7IA 1E0OB 3E8UH 5D70L 1TZHB 4U6VH 5GRUL 5IMKB 4UDTB 1W0WB 1TCMA 1KPRA 3QPQD 4LLDA 1I4FA 3WD5H 4EIZC 2R4RH 1OAKL 5IBLC 3RNKA 4NO0B 1EPFA 1DBBH 2DF3A 5F7LB 4MAYA 5D70H 2DIBA 1QO3A 1CDJA 5GRUH 1QZ1A 1KTDB 3WDHA 1EZVY 3AS3A 1U3HB 4D0DB 3BIKB 4OD3L 2PW2B 3TNNB 3U7AA 2B1AL 4XC1L 1CICB 1FNFA 2DIJA 3WIIL 5F96L 2MFNA 3VWJC 3A6CL 5MENA 5AD0B 1U3ZA 1F2QA 3L5WA 4N90E 4IS6B 1PG7W 1IAKA 1OSZB 2A6DB 2WLYA 2D7NA 4EUPA 4EQ2A 1A6TA 3IF1A 4WHYH 1DVFB 2LV4A 5E8EB 2ZSWB 4G8EB 3IVKA 1WJ3A 4LSTL 4OD3H 4JVWA 4XC1H 5EPMA 5EUOF 5F96H 3A6CH 1DP0A 3T3ME 1N3NA 4ZUVA 3MLTB 1NGZB 3KNBB 3PWLB 5EU6D 4WI9A 2C3XA 4HUVA 3AREB 1Z9MA 1WZKA 3U7YL 4PREA 4QRPB 3PWVA 4PP1C 3RWFB 3NIGE 3BQUD 3BH8A 3WHXA 4LSTH 1HQ4B 4WWKC 5E8PA 4GW1B 3HLAB 3TBYB 4QHUA 4B5EA 1CXLA 3DTXB 4DCQA 1NCTA 4G7YH 3U7YH 1R3KB 4PRIB 4U0RB 2DTSA 1J87A 1Y6MR 5E99L 3GSXA 5J3HC 2LQRA 3DUHA 3FB7A 3REWA 3CLEL 4L8SB 4ZPTB 1ETZB 3T2NL 3WHE1 2CMRL 4QTIL 3KDMA 4F9LA 3MRKA 3QT2A 1FLRL 1IC5H 4JFYB 5IR1A 3QXUA 1EBPA 1ZA3B 5DSCA 2CGRL 2DQUL 2X70B 4IDLA 1X7QA 4KQ4L 4U2YA 2ITCA 4N8PA 3ALPA 4NQXA 5E99H 4KH2A 4BZ2L 2PNDA 1CFQA 3CLEH 5JW4Q 3Q3GB 1RPQA 3QNYB 2CMRH 5L2JA 3PQYA 2KUTA 4Y8DC 3VI4F 3L3IB 1FLRH 4D9LH 4LLYB 3MUGB 2IJ0C 2CGRH 2ICWJ 4YPJA 4R7DB 2DQUH 1FBIL 1EEQA 5ACMA 1FRGH 3BEWB 4KQ4H 4HK0B 3GBLA 3PG2A 4M6OL 4XPBL 1T20B 2YPLB 4DGYL 5IOPB 4X0KB 2KPNA 3C9NB 4BZ2H 1ZLWH 2H2PC 4HS8L 4FXKA 4R90L 1G7LA 1CT8A 4JZJC 2J7LA 2YSSB 5FM5M 3PDOA 2HWZH 5GRVK 4X6BB 1P9MC 3D39E 3X17A 3MQIA 4KY1L 2IAMD 3RIAK 4IHOA 4X6FA 1FBIH 2NXZC 1P53A 3L3GA 4NSKB 4PD4K 4M6OH 4XPBH 4YUEL 4DGYH 2AW2A 2HFEA 3DYPA 4KZDL 3RIFK 4HS8H 4NQSB 3DSNA 1DE4B 1RIUL 3IXAB 4M7LT 1RIVH 3TGXA 2Y06H 4KY1H 4BK4A 2P5ED 4LHUB 3LVEA 2XXCB 5ADOL 2OXHA 5FF6B 4JPKL 4YUEH 3WEXA 3O6ML 5C07B 3T77B 5EZOL 4KZDH 2YUXA 4KKBD 5A43C 5J4MA 3QEUA 2EDTA 2GJJA 3MV9D 3IFNL 1RIUH 2Z4QB 4IOIA 5TPWH 1FFPA 2GKIA 1ZT4B 4FZEL 2L4OA 4PJIB 1CXIA 4Y19A 3TYFA 2G2RA 2WW8A 1BOGB 4V1DD 5ETUA 4JPKH 2GJ6A 3O6MH 1G9ML 4DEPB 5BQ7A 3UBXI 4DGVL 1OTUD 3BT2L 3FQNB 3IFNH 5D2NC 2Z35A 5E9DD 3RVVD 3QUXD 3BD4A 1U8PB 2UZXB 5E4IA 1QR4A 2WBJA 4QOKA 3IDMA 4X8XA 5IESH 4OB5L 5CLWA 1A6UL 4DGVH 4HX1A 3BT2H 2F54E 4Z77B 1KCLA 5KSAC 1MH5B 4JN2B 3MCKA 4MSWB 4L29A 5CZKA 3GJFA 3UAJD 1UM6L 5D6CB 3CJJA 1VA9A 4M5YH 1W72A 5CS7A 2J12B 1DQQA 12E8L 2VXVL 4JY4A 3KPSE 1CFSA 2YKLL 1JUFB 1YUHA 5ANMA 3TNMB 3SOBL 1AO7E 1VCAA 3TF7C 5JTWA 1CIUA 4OB5H 2HJLB 3ARUA 1HHGA 1B4JL 1FL3A 3F5WA 1A6UH 2C5DC 4L3ED 5HY9B 1IFHL 1CE6A 4I3RL 4GG8A 5C9JA 4K23L 4JDTL 4UQ2B 1UM6H 1BECA 1L4IA 1MIEL 2WBWB 4I13B 1DEDA 3KWWA 12E8H 2R8SL 3NH7L 2YKLH 1ES0B 4IEFB 3SOBH 2IPUG 1OB1B 1T6VN 3X12B 5E5MB 5IM7B 1T1WA 4W4NA 5BJTA 1B4JH 1L9NA 3KXFB 3CK0L 3QUYB 1IFHH 2FNBA 3GEWB 4Z7WF 4QRRE 4K3HA 1NPUA 4I3RH 3T2QA 5KBNC 2D2OA 4K23H 4MD0B 3C2AL 4JDTH 5T1MA 4LLVB 2R8SH 1JE6A 2KKQA 1TZGL 5DD6A 4LCWB 4ZFOB 3P3YA 4OI8A 3FAWA 3S3PA 3CK0H 1MFEH 4N9GA 2PTVA 3SCMC 3MV8D 1RMFL 4PLKD 5D7IE 3RPKA 3C2AH 4ZNCD 2VLLA 3PGDA 4QF1A 1U8KB 4KHXL 2N7AA 1TZGH 3ARGA 3JUZA 3U79A 1I1AD 3IDGA 1MQ8A 4XWOC 1EO7A 5HYSG 4N8VA 3MLYL 1RMFH 3WNPA 3VWKC 4BYHA 5I1DA 1XGRB 2QEJA 3O3DB 3QHTC 2CDEA 4KHXH 2QQQA 2WINA 3BAEL 3LKPA 5DQJB 1VFBA 4I77L 4ZUTA 3GMQB 4PGEA 1KUMA 3WO4C 5I15H 4GRWF 3QI9C 4Y0GA 1SYSB 5HYQA 3LQZA 3DRTA 4JFDE 2FIKB 4MMXC 5TFSH 1Q1JL 3QWOB 4YAQB 3OR7B 2MCG1 4NN7C 5T5NF 3MYZA 4QTHB 5EDXA 3MJ7B 2WV3A 2R0ZL 4I77H 5C0NC 1JGLL 3QBTB 1E4KA 2Y6SC 5D4QA 1SHMA 2WSKA 3WUWA 4JRXE 4A2MA 4HZAA 4UDUB 3DURA 2QADC 2IFGA 2JJVA 4ZO6A 3DLQR 3ORJA 1NC2A 2AJSL 3T2OA 3G9AB 5LBSL 4EEEA 2VQTA 3R1GL 4DVBA 3S96A 3QNXA 4AL8H 2R1YA 2P5WE 4C58B 2BNRB 4LSDA 4B0MM 1Z0NA 2R0ZH 3UROR 3QQ9D 4OGXL 5F6IC 5EBGA 3QRFM 2CKBA 2BVTA 3WNNA 1ORQB 4NGHL 1WUNT 3D0VA 5GS0H 5GZNC 3B3IA 1J10A 3MXWL 2NW3A 1JPGA 1ONQB 4LSPL 4XNMA 3VGDA 1YC7A 2AJSH 2RQ8A 5LBSH 1S3KH 1PZ5B 3R1GH 3SDAD 2W65A 2P8LB 3E3QC 4OGXH 2YMXL 4QXGL 2G60L 3HAEA 4NGHH 5FGBC 3C5ZD 4HIJA 3EFDL 3MXWH 4U1LB 3CFJA 1HXYB 4FQQA 4LSPH 3G5ZA 5I73C 5C0AD 3EYSL 4ETQB 2VDPL 4TRPL 4Y4FC 4YH6A 3C5SB 3BDYL 4RFEB 5GS2H 3JV4B 1T3FA 4DZBB 4PUBL 1OAYL 4WFEE 3REVA 3MBEC 5HSFA 1KIPB 3U4EA 2YMXH 4QXGH 3LN4A 2G60H 2NTFB 2IC2A 4Q9BA 5SWZE 3EFDH 1IQWL 2PTTB 2NY7L 3BI9X 1XCTA 3KYMA 2XG5A 2IH1B 4R9HA 4EN3A 4K94L 3NN8B 5IFHL 4TRPH 5KAQF 3BDYH 1T5XB 5F7NC 5BZDA 4LCUB 3QUZB 4PUBH 3V6ZA 3AAZA 3B2VH 1LO4L 5I1CH 4X9BA 4G8IA 3VDAA 4D0BA 2IANE 3TVMD 3VG0L 1IQWH 1E4JA 4FFYL 4XC3H 5T1LB 3V8CA 4K94H 1KPVB 1EJ6A 1QSZA 5DEFB 5IFHH 3JV6B 1NUDA 3B9KC 4KJWD 5T33L 3LH2H 1JMZA 2QQKH 1BJ1J 4JZJB 3BZEB 2ADFL 4HJJL 3UDWA 1LO4H 1D5ZA 5FV1L 4O2CB 1YN6A 2NXZB 3OGCB 3VG0H 5F7UA 4FFYH 5E94A 3BIAX 1QLRB 4KFZC 3CFCL 2JCCA 4XP9L 1H3GA 5C0BE 1WEJL 4X6CA 4GH7B 5T33H 4XPTL 2Q7YB 2ADFH 4HJJH 1BAFH 4PJ7E 1Q9OA 3FQUA 2FRGP 5JPMB 1F45A 3DBXA 4Y5YC 1ZT1A 5MEOB 2FHBA 2P24B 1MF2L 3CFCH 4AZ8A 4XP9H 2WZPD 3ZHKA 4F57L 2R2HA 1WEJH 3PQYD 4EZMA 3QIUC 5BO1L 1K9TA 4XPTH 5F7YC 3NPSC 4XHJC 1CL7I 2APBA 1I8LC 3DO7A 3SDCC 4MNQA 4IOFC 4DKFL 1AIFA 2M2DA 3VFUA 1P7QB 5IB2A 3IU4L 4IM8A 4KRPB 1MF2H 1BREA 4B53A 4F57H 4EI5B 5I16B 1I1CA 3FFCE 5EB9A 3AS0A 3WJJC 5BO1H 3IJYA 2D7TL 5D2NB 3IFLL 1YQ2A 2ZG1A 3TWCL 4Y16B 4Y4KD 1J8HD 4QEGA 1EGJA 4J1UB 1T89A 4R2GC 4DKFH 2R4SH 3WFBL 5J12B 4PJDB 3RVTD 1MAKA 5E00A 3SDXB 5DFTA 2B39A 1H3PL 4NBYB 5FGRA 1A7NH 1VEPA 4PRBA 3MA7B 5D7LB 5AG8A 3T3PF 3FN3A 4U6XB 4IRJC 3TWCH 7FABL 4PJXE 2CK0L 2NNAB 2IQ9H 1J1XL 1ADQA 5EBMA 4XH2A 3VXOA 3T4AA 3DVFA 4CADA 1L6XA 5BXFB 4U6TA 1N8ZB 1KELL 5MEPB 2NZ9D 1V8HA 3KYOB 3QIWD 4U1JB 1LEIB 5FGCB 4BSVB 1X5XA 7FABH 5F7MC 3RWDA 2CK0H 1NH6A 2EDFA 4P2RE 3FB6B 2G9HA 1BZQK 1JN6A 4ZFZA 1OM3L 3MRLB 1GGYA 1HHJA 1JHKL 4IMLA 4MX7B 1I8KA 2XRAL 1RUPL 4RA3A 3TPUB 1U8IB 5HJ3B 1KELH 4ZQKB 4JFFD 4RMRA 4Y5XC 3KS0J 5HHOA 5FYKD 4YHZL 4OCNC 2OMNA 5HI5C 1WBZB 3D1MC 4MJ2A 3LB6D 3AS2A 4W4OC 3RVWC 1CGYA 1MPAL 4QOKD 1TVDA 3VXME 1OGAD 2XN9A 3E6FB 1OM3H 3MCG1 1F2XK 4DN3L 5CJXA 1JHKH 1RZKL 1A2YB 3UTZA 1KT2B 3TBVA 2VKWA 2XRAH 4H5SB 1KCVL 1Y6KR 4HJ0D 3EO1A 5E1HB 3H8NA 2IG2L 3SCMB 4YHZH 4ZS7H 3TO2A 3ARDC 3RAJL 2YRPA 3QDJE 2OR9L 4FTVE 4JZNB 1C5DB 3BSZH 4XVUC 1MPAH 4AG4L 5I8EB 3DROA 2J2ZA 1T0NA 2A0LC 2DD8L 2Q76B 4KJQC 4DN3H 2P8PB 2NY5C 1RZKH 4H1LA 5FCSH 2A83A 4QWWD 5JLZA 1M7IA 4X7CC 5H37G 1KCVH 3EOBB 2MQ0A 4TN9A 2IG2H 4S0TD 4YGVA 2AXHA 3GSQB 4V2BA 3VWKB 5T3ZL 3D39A 5J89A 4O4YL 2XQYK 4UIKH 1W0YT 2RIKA 2OR9H 2XKSA 4HHAA 4AG4H 1DN2A 3NFPA 2DD8H 2YRLA 1NFDB 3GSRA 3RPIA 5F7HA 4ODXB 3MRHB 1DBKL 1QG3A 4MNGB 2OL3B 3GBNL 2VABA 3H3KA 4WTXA 5AYUL 5JMRA 4WI6A 1A1OB 5T3ZH 4O4YH 4RFOL 4LVEA 5JOPE 5F44A 5JW4N 1K3IA 3OMZA 3HUJF 3IDYC 5IIEA 4FQ2L 1F11A 1VB9A 2AEPL 2C7UA 4HXAL 3VXRE 4NN7B 4GG6F 3O9WC 2BVPB 1KACB 1UXSB 3FTGB 1DBKH 1QRNB 4M4PA 3GBNH 4HEPG 5AYUH 4L4VB 3KPRD 1FFNB 2QADB 4H26A 1QPXA 1GL4B 3FHQA 4RFOH 3QEQE 1P5UA 4FQ2H 1WITA 4X5WA 2AEPH 3OKMA 4HXAH 4I48B 3HC0A 3O41A 4ELKA 3EYVB 3IDIB 1T66C 1YNTB 5F6IB 2IEPA 4G3YH 1E28B 2B0SL 2R2BA 5JQHC 2OSLB 3DUSA 5D1ZC 2BOBB 4FA8A 5IROC 4J6RL 3FB5A 3DVNB 5DVMA 2PO6A 3DHMA 5TF1L 3LPFA 4NC0B 1AQKL 1W8NA 2EIEA 2F54A 4XBGA 3I3DA 3SE8L 3PHSA 1AE6L 4UI2A 4JCLA 2W60B 3PWNB 3SPVA 2B0SH 4OZFB 2DMCA 2D31B 1UGNA 2XPGA 2I07B 5T1KD 3UMTA 3N1MC 4PJ8D 4XMKL 5DMKA 2JJTA 3KPSA 4J6RH 4Y4FB 5CZXD 4GAJL 2R56L 1XEDA 4HZLA 5TF1H 5D1QA 1PGRB 3ARSA 4OFDA 3RY6A 4KK5C 1AQKH 1YPZB 3MBEB 3ARFB 3NZ8A 3SE8H 2LVCA 4R0LC 1AE6H 1C16A 2BVUA 1S7VB 2E9IA 4Z7OF 1NL0L 1S7SA 4MVBD 4MYWB 4P5MA 4YJZL 5HYJB 1YMHB 1S7TB 4U1HB 1GZPA 2BXZA 4NUJB 4ZS6D 5HYEA 2XTLA 4XMKH 4JDVA 4GAJH 1NUFA 2R56H 4PG2C 2YA2A 4M62L 3DXAE 3CX5J 4OFVA 2XQBL 4P23A 4M93C 3ZMRA 2VZ3A 4JO3L 2OTPA 3D48R 4QRRA 3VMNA 5FYJU 4BUGA 2XOTA 1NL0H 5HGBB 3MNWB 3NCFB 5JNYB 5F9WC 5GJSL 1IM9D 3P9MB 2C4XA 3B9KB 4RMWA 1BF2A 3S36L 4NKIH 4Y4HB 2BNRE 2CRMA 4B50A 1RV6X 4M62H 4JPIB 4GQPH 2GAZB 3MNVB 5DUML 2XQBH 4FFVC 4JO3H 3G9VA 3ZLQC 1QVOB 5E2TL 1M7DA 2Y4SA 5GRWA 5D7IA 2HKHL 1TCRB 4ZUSB 5JW5B 3ARPA 1T0MB 4XP6L 5GJSH 1IEBA 3ZDZE 1XF3B 2QR0B 3IDXL 1SBBA 2EEBA 4XXDB 5DUMH 3WDIA 4JB9L 2FBJL 5EN2B 4HFUL 1VHPA 4F33B 1H8NA 4X7DC 2HKHH 4MS8C 4UU9A 4NRZB 3MNZA 5IK3A 3X3GL 3VH8G 3DJ9A 2HTLC 4JFEB 2VERN 5I1EH 4FOMA 5LKNA 3SKMA 1SEBA 3DI3B 4TSBL 3AB0B 3VE0B 1HSBA 2F8XC 2FBJH 3ROLB 2FBOJ 3P4OA 4KXZH 4HFUH 3CVHB 4ZDHA 5MI0C 3IKCA 3T3MF 1CGUA 2LFGA 2HT2C 1S7UB 4PJFB 3TP4A 1X3DA 4JFDA 5DTFB 5HHQA 3MRFA 3FRUA 4J2XA 4M7KL 4OLXL 4HCRL 4CRPA 3NIGF 1EEUA 4TSBH 4KI1A 3TIEB 2V2WB 4HGMA 5EFIB 2GY5A 4P4KB 4JRXA 1U0QA 3WJLC 2CLZA 3KPNA 3LSOB 4R2GB 3OWEA 2VH5L 1X5LA 5I2IA 4O51A 1IGTB 4M9PA 4AEHL 4OAWB 1HXMB 3W9EB 5EO1B 3ULVL 5GSRB 4PJCE 1G9EA 1N5AB 1RFDL 3FQWB 5FYJE 32C2B 3LKNB 3D69A 3CFIC 2P5WA 3G5YB 4FNLL 4M7KH 4IRJB 2ZNWA 3AUVA 3CFBA 3OAYK 3S5LB 4CGTA 2VH5H 3MZTA 2ICWA 5F9OL 1KG0A 3ARVA 1CLZL 4DN4L 4LKXB 5IMLB 2NXYC 4AEHH 5JXEA 3HG1B 2ZCKL 3ULVH 1TJHL 3EFFB 1RFDH 4ZFFA 1P7KA 2VAJA 4XCNB 3T65A 4FNLH 3F7VB 3GB7A 3PABB 1TZHA 3U0PA 5HYFA 1UB5B 5DT1L 2MHAB 1W0WA 5CJOL 2WIIA 3IT8D 1UQSB 1OF2A 2RFXB 5F9OH 1TTGA 1CLZH 4H0GA 3S34L 4DN4H 2Z31C 2ZCKH 3CNKA 1TJHH 1LMKA 3RZWA 4CVXB 5ITFA 2R2CA 4NO0A 2F8VA 5GRVL 1AQDB 1ZHBB 4I0PA 5FUOL 3I6KB 2HLAB 2DJSA 4OD2A 4X7SL 3ETBF 1T1XA 1KTDA 5SWZA 4WV1C 1U3HA 1MLCB 5CJOH 3GRWA 5FAAA 3DVIA 3BIKA 4MXQD 4P46D 4HKBB 4I18C 1KEML 3MXVL 3S34H 1CICA 1BD2B 2EEDA 1A3RL 4PRPE 5C08E 3RDTD 3ZKMD 3DVGA 3CVHL 3IAPA 5AD0A 1SJXA 5EIVA 3HS0B 5SX4I 1TLKA 3ARDB 4XAKE 3VFWA 1OSZA 1AKJD 5CHNB 3LEYL 5TE4L 4X7SH 4MJ4A 3RX7A 3PV6A 2BNUA 2H2SC 2IANA 4HIHB 5DGRA 2ZP0T 4PRHE 1QBML 2YA1A 5H94B 5HI3C 1KEMH 3MXVH 3AROA 5C0RL 1NANH 1CG9A 1IGCH 1JF6A 4WY7L 3CVHH 3MLTA 3P77B 1RZIA 2IWGA 4OZHE 4NQCE 5C0GB 4R4ND 1FORH 3LEYH 4JDZB 4QRPA 5TE4H 4JY5H 4BQ9A 5CGYD 1QBMH 1GAFL 1HQ4A 3I9GL 5C0BA 4RRPA 1FIGL 5C09D 1BP3B 5C0RH 3HLAA 1AGCA 3MRPB 4RAUB 3TBYA 5LJYH 3CDGB 4WY7H 5FK9B 4PS4L 3N0PB 5FGCE 1BHGA 4PJ7A 3QA3B 2AEWA 1NCDL 5C6PB 4QRQB 1D6VH 1JHLH 1R3KA 1EEYB 3LKOA 1FE8L 1GAFH 2IFFL 4NRXA 3I9GH 3O9WB 4L8SA 1FIGH 4Q6IC 5CP3A 3O2DL 3RTQD 1J05B 3ARBA 1FAIL 4MXVF 2I24N 2YN5A 1F8TH 3D85A 1J11A 2AVGA 2LU4A 3UZQA 3VXUB 2NPLX 3C8HA 4LF3B 3C60D 1MWAL 1RK1B 5L6YL 2E5EA 4MJIB 4J23A 4KTYA 1V7ML 1OTSD 2XWBB 5L8LB 1EFXB 3O2DH 5D7JD 1SYVA 1M4KA 2E6PA 3FFCA 4NN6B 5D5MF 1FAIH 1QBLL 4K3DL 4JG1L 4MA7L 3AFLA 4LLYA 2ARJQ 4G43B 1X5YA 2YS4A 3BQUC 1JPTH 1PQZB 5D1ZB 3QQ3B 1C08B 1MCHA 2XZQL 1ZGLP 3C9NA 2KQNA 1V7MH 1JGEA 2WUBL 4PJ9B 3MRNB 5EU4A 3GO1L 3FAXA 5CFHA 4K3DH 4MA7H 4JG1H 4WW1A 1OQOA 4O9HL 4OF3A 3RL1B 1RZ7L 1OL0A 3TM6A 5FM4A 3SE4C 2OR8A 1BZ9A 3S35H 4HUWA 4E42A 3KJ4C 2VLJB 4QGTA 3U4AA 5F3BB 4F7EB 2ENSA 2DQFA 4OFYD 4LLAA 4MDIA 1BQLL 2XZQH 5JOFB 4KV5E 1A1NB 2WUBH 3NCMA 5BOZG 3I75B 2EH7L 3GO1H 3SY0B 1IJ9A 2D0GA 4R0LB 1KGCE 4GXUN 2ITDB 5KANI 4O9HH 2I5YL 1G6RB 3IS1X 5ILTL 1RZ7H 2NY0C 5EO0A 4K3JL 1EUTA 1T4KB 2NY5H 2BSTB 3QO0B 4JHBA 2PCPB 1I7ZA 3K2UL 4P2RA 3TO4D 1CDYA 1OD9A 4XB8A 1BQLH 1MQKL 1IBGL 3EYFA 3UTPE 5D7IF 2VDNH 4FQJL 5JR1H 5HYIA 5GRXG 1AGDB 2EH7H 3V6FB 5F7DB 2Z4QA 1N26A 3BISA 5ILTH 2FGWH 5INDB 1GPOL 5HVHB 1IAIM 4K3JH 1ZT4A 1Q94A 3BN9D 5F9WB 4WW2C 2PO6D 3K2UH 3OKOB 3VXMA 1MQKH 1IBGH 1NLBL 3KAAA 3PJSB 3LRSB 4NQTA 2UYLA 3U9PL 3WNMA 4RWHA 4FQJH 4YHLL 1DANU 3TN0A 5IVZB 2WWKT 3FQNA 1I3RB 1U8HB 2IAMC 3TZVA 1JNNL 1GPOH 4OCRL 5KS9B 3QDJA 2IQAB 4FTVA 3PWPE 5GQBA 1HHIB 2EDDA 4YHPA 1AO7D 1U8OA 1X5IA 4AYFA 1NLBH 3O0RH 1OP5K 3U9PH 4YHLH 2VWEC 4Y1AB 4PY8I 4KU1A 1G9NC 4L3CB 2W0KA 1MH5A 4JN2A 4YHNB 1FG2B 4UOJA 5D7KE 1F3JB 4HT1L 2V5TA 2CLVB 1JNNH 1RZ8B 3QWRA 5BS0B 4OCRH 4KK8D 4LAJH 4RX4A 4YE4L 1PD6A 1S78D 3P73A 2GITB 4FZ8H 4KKBC 5KG9B 3HPLB 5C0EB 2Z8WC 1JTOA 2HJLA 4R96A 1AXSB 4HIEA 4QRRD 2F19L 1LEGB 2NX5E 3GSNB 3O45B 4JN1H 4LEOB 4UQ2A 3T0VA 5I30L 2VLMD 2H6PB 4YE4H 2Q86A 3FHAA 4PTTA 4CNIA 1OTUC 1KFAH 2VZUA 1G7JA 3VXRA 4G6KL 4NCDA 4JE4B 5E5MA 1G6RL 5IM7A 2GCYA 3GNMH 1E4XI 3RVVC 3WFZA 1TENA 1L7TL 3BRDA 1WV7T 1ZTXH 2J5LC 4P5TB 3QUXC 4TNVF 4C56E 2ID5A 2F19H 1YQVL 4PFEA 3HCVA 3UTTB 5DEZA 1MFDH 5I30H 3I02A 5JDSA 4LLVA 1FZOA 1SQ2N 3QEQA 4RDQG 1S5HB 3C2SA 2FIRT 1PEZA 4JY6A 4G6KH 5L9DL 1G6RH 2FJFA 3OR6A 3N1QC 1L7TH 5CKAA 3UAJC 2Z8RA 4XCCH 4BZYA 1YQVH 3HC4L 2B5IC 4NO2B 1V3JA 2A6JB 1FNGA 5EH1A 3U0WL 5BRZB 4HBCL 1NBVL 2Z9TA 3HRZB 5KN5A 1LDSA 2A38A 1ORSA 3UJIL 1F58H 3C6LA 3P9LB 5KZCB 4BJLA 4JFHD 2DI7A 4CN6A 2Z8SA 2FCBA 3L6FA 5J9PB 3ZTNL 3HC4H 2Z91B 1B0GB 3MUY1 1XGRA 4PJHB 4MA1C 3U0WH 4HBCH 4M9OA 4B7IA 2Z31B 3O3DA 3GJFK 4QRUB 3ILQD 1NAKL 1NBVH 1CQYA 4RZCA 5J6GA 4U1IB 4HWBA 1A8JH 3GSUB 1DFBL 1NKRA 1P4LA 3MJ8A 2HRPL 1I1RA 3ZTNH 5CD3B 2YXFA 5D2LB 1AD0B 1WBXB 2BHYA 3DUUA 1SYSA 2E7CA 4PJFE 4I18B 4YAQA 1CL7L 4RMQA 1NAKH 4WFGD 3VWJA 3GSNL 3MJ7A 3L7EB 3DXAA 3NA9L 4M03A 4U6HA 5DK2B 4PLKC 2C9AA 1DFBH 2FHFA 3B8YA 5EWIL 5JIIA 2HRPH 3SDYL 1XF2A 3BXNB 4OCSL 4HS6B 4UDUA 1SVCP 1HIMH 1OWWA 4PJ7F 3MJ9L 5EULV 4NOFA 1LNUA 1I1AC 4O5LL 4DVRL 1CL7H 3K46A 3Q6GL 4WI3A 5DJCB 5EOCJ 2BNRA 3GSNH 5FO9B 3NA9H 1HYRC 5HHMB 5J1AB 5DK0A 1M6OB 1ORQA 5EWIH 4JREB 4OGAD 1V3KA 2FYYB 2V7HA 4HUNB 4OCSH 1ONQA 5ITBL 4PV9B 3CFEB 1T7YA 1CDBA 3BWAA 2MQCA 4WWKA 5CEZL 3HG1E 1MCKA 3BP6B 3KPLA 1PZ5A 5HDBE 4N0YL 4MWFB 2PYEE 3Q6GH 4PGDB 3ZSTA 4WFED 3QEHA 2P8LA 3SO5A 4I2XE 4U6YA 4ZSOB 2XZZA 4WGVB 3L3JB 4XX1G 5JIHA 2EDWA 3G6JB 4Z7NE 4U1LA 4H25B 5KVEL 1QSEE 4HFWB 1MHEB 5ITBH 5C2BL 1H5BC 4G8GD 1EK3A 1BEYL 4Q6IB 5CEZH 4K7FA 5C7XL 1L9MA 1WC7B 3C5SA 4I3SL 4RFEA 1OOAA 5MP6L 2AEQL 3JV4A 4N0YH 4ONHB 5E6ID 3DIFB 3UXFA 25C8L 1TTUA 1NFKA 1TXKA 1XGTB 2PTUA 3CC5B 3OXSA 2FLBT 2Y5TB 4ODUB 5DRWA 1YEIL 1MREL 1G7PB 5ESAB 1ED3A 5KVEH 3LEVL 3CPLB 4ENED 4AQOA 1S9XB 1BD2E 5C7XH 5CJBA 4I3SH 4PJXF 5MP6H 2AEQH 4G8FB 2H26B 4HK3N 4NO3B 4LCUA 4YR6B 1U36A 5DR5L 2ADGB 1KIQB 25C8H 3TT3L 5HGHA 1OCWL 5HBBA 3S88L 1H0DA 3BQUB 3GSWA 5F7FA 1YEIH 1MREH 3E1F1 1QLFB 1F4XL 5T1LA 4I0KA 3T0DA 3SDAC 3LEVH 5DEFA 4MAYC 2IBBA 4PJCA 1IAOA 3BZEA 5DA4A 3HI1B 4XT1C 5DR5H 3V0VB 3C5ZC 4MGXA 1P9MA 5A3IC 3FQRA 2WQ8A 4LKCB 3O6FD 1OCWH 5GGRB 3S88H 1P4IL 4WWID 3OB0K 1UENA 5TDOA 3OQ3B 4XB7A 1QLRA 1GVIA 4FQHA 4DGIL 5A2JH 1AC6A 2HLFD 1KXTB 4CDGC 1D9KD 2E9WA 4OCWL 5C0DB 1NC4D 5AG9A 1N2RB 2LTQB 3PGCB 1VPOL 4LSUL 4YK4C 3VFVB 5B39A 2YWYA 2NY0B 1JCKA 3O4LD 3AY4C 4G42B 1P4IH 3CFKB 4U1NB 5CBEB 2VL4A 3B5HA 3RGVD 1MJ7H 3QDMD 2NW2B 43C9A 5FIEA 1I7TA 2NY3D 4DGIH 4CL7A 4C83B 2HT4D 1MRCL 1S9WB 3GDBA 3NABH 2YD1A 2EZ0D 2BVQA 3MRMB 1KLGA 4LSUH 1A4JB 3TVMC 4L8DB 3DV4A 2GFBA 2GK0B 3BPCA 1OGTB 2ZUUA 4PJ5E 1VENA 1P7QA 4KJWC 4NT6A 2ZOLB 1LE5B 1LO0L 3CU7A 5KVDL 3DGCR 1MRCH 3WMSA 5I16A 3UTQA 3EJJX 4PRPA 5C08A 4GJTB 5EUOB 3L3HB 4GQ9L 1LK2A 1ZT7B 1WT5C 4F3FB 2X7LB 1KCUH 3O4OC 4L8CB 1U6AL 4PRHA 3SDXA 5TJWK 1AR2A 2DAVA 2E7HA 1LO0H 5KVDH 5IW1B 4GW5A 1BZ7B 4X4YB 3MA7A 5GSVA 4GQ9H 5KSAA 4RGOH 3MUJA 5IG7B 5A1AA 2P5EB 4OZHA 1FNEB 4NQCA 2GSIB 1XGUB 4BFBD 1OP3H 1U6AH 3I2CH 5E08L 4R7NA 3CH8A 2FWOB 3QO1A 4PBVC 2EICA 1J0ZA 4NJ9L 5T3XL 4NQEE 2W0PA 4PGCB 3MV9B 2V2TA 2YPVL 1Q0XL 1N8ZA 2Z0BA 1FFOB 7CGTA 4WO4A 1CFTB 4U1JA 3IKKA 3KPOA 1EERB 2YHGA 1T2QL 4EQ3A 4V1DB 2DWDB 5GGSB 5E08H 1CK0L 1K2DA 3VMOA 3MRLA 4M1GL 4NJ9H 4X7FC 5T3XH 3AXLB 2YPVH 5I19L 3TPUA 2DQCL 1U8IA 5HJ3A 2J5LB 3QUXB 4HWEL 4Y4KC 1FZKA 5IUSA 3ECBB 1T2QH 1EO8L 1TVBB 3RVTC 1NCWL 1MCRA 1J9CT 5CP7B 1KXVC 5M95B 3E6FA 4M1GH 4K2UH 5F88B 3HE6B 1A2YA 3ZL4L 4ETYA 3TCXA 2DQCH 4E5XB 1TIUA 2XNAA 4WI2A 3L5JA 4HWEH 1IGYB 1CD0A 4YDJA 3T1FB 3ZKQD 1EO8H 4HDIB 4O02H 3CGTA 3DMMD 1T22B 4JZNA 1DQJB 2LABA 1NCWH 1FP5A 5DEGA 2EO1A 4N0CD 1HWGB 2OJZL 4U1KB 4L3EB 2NZ9C 2EXWD 3QIWC 3ZL4H 5KW9L 2DQTL 4QCIB 4RMSA 4NP4L 5F8QC 3DX8A 3EJYD 1KIRB 3VWKA 2VSCA 1EBAA 5KJRL 4MA1B 1J0IA 2H1PL 1A9BB 4LARL 1SEQH 2HKFL 3CLFL 2VL5B 1HILA 1URLA 2AXGB 3MYJB 4Y88A 2EYRB 3QFJE 3P4MA 3MRHA 3DX7A 2DQTH 1Q72H 2OL3A 5FM5O 5ACZA 3LB6C 1GGUA 1U2CA 4NP4H 4Q7DA 2WBJC 1A1OA 1ZVHA 3QI9A 2Q20A 3QEQD 5E2VL 4EOWH 5HTSA 4NHUA 5MERA 1VEMA 4LARH 5F9JB 1PJ9A 1S7WB 1AGEB 3CLFH 3V95A 3UYRL 4HJ0C 2XFXB 5FYLL 1GYAA 2V5YA 3MOAL 1CGVA 1D6EA 3SGEI 3ZDZF 2VISB 1MCDA 1FGNL 4L4VA 5IQ7L 4IMKA 1JZ4A 1H3WM 2XG4A 1BIIA 3J8F7 2V2XB 3GM8A 5E2VH 1P1ZB 3I84A 1FFRA 4M7LL 3QR2A 1I1AB 2D03L 4QWWC 3CZFB 1AJ7L 3DX6B 3FONB 4HUKB 5DJZB 3UYRH 4OQ1A 1FSKC 2HP4A 5FYLH 5CGTA 1NAMB 1GZQA 2B7DT 4O2EB 3MOAH 4PP2B 1C12B 2B20A 4YNYB 1FGNH 5IQ7H 2VZVA 5I8CA 5DJ0B 1HKFA 3PWPA 4LIQL 1MVFA 4XPHL 2W59A 4M7LH 5EOTB 1MY7A 1AJ7H 1CD8A 4Q9QL 3BVNB 4FG6D 5HVGB 4E0RB 2SEBA 4Z0XB 2JK5A 2EKSB 3FMGL 3GBML 1MCIA 3D2UD 3PWNA 4JO1L 4WUUD 4OZFA 3K4ZA 2D31A 1ZKAA 1F4WL 5ICXB 1A7QL 4LIQH 3BW9B 4Y4FA 4XPHH 5F1IB 2DQJL 1Q38A 3EGSB 3DGGB 4PJEE 3X11B 1N64L 2N1KA 3U1SL 3GMLB 2ARJA 3VRJA 4Q9QH 3EOYG 3QULB 2ENYA 4JFQA 1JHTA 6FABL 5CGMA 4WDIB 1CFVL 1IGJB 3S3SA 3EDJA 2ESVE 4LHJB 3FMGH 3GBMH 2NX5A 4Z7WB 2FATL 2JELL 3IDUA 1VACB 3OKLB 4PJCF 5GXBB 5IEKA 4D8PB 1GC1C 4U1HA 5FA3B 1I9RL 3K2MC 1FZJA 1F4WH 1OT1A 3WIFA 1A7QH 5J6HB 4HH9A 5B8CC 1N64H 3U1SH 2CXGA 1Y18B 4ALAL 4PYHA 1KJMA 1KPRB 2XWJB 4LLDB 3T0ED 4YEFA 1CLOL 4C56A 1CFVH 5CEXB 4NKOB 4UTBL 3ZYJA 3OAYH 3SE9L 5HGBA 2FATH 2JELH 5I6XC 1NKOA 3D25B 2L7UA 1IC7L 1I9RH 3RNKB 1MFCL 4LOUD 1S7QA 1ZVSA 4JM2F 3P9MA <