1T6VN

Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lysozyme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
RVDQTPRSVTKETGESLTINCVLRDASYALGSTCWYRKKSGEGNEESISKGGRYVETVNSGSKSFSLRINDLTVEDGGTYRCGLGVAGGYCDYALCSSRYAECGDGTAVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a shark single-domain antibody V region in complex with lysozyme.
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Hydrolase/immune system
molecule keywords Lysozyme C
total genus 33
structure length 112
sequence length 112
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6vN00
2FR4A 2OJZL 3T0DA 2HMID 4OI9A 3FB6A 1T1ZB 5GS2H 2QADB 1BBDL 1MRDH 2D9QB 5EU5A 4G7VL 4UIMB 1ZSDA 3HR5B 4D0DB 4MNHA 3ARPA 4K7PX 4QNPF 4BZ1L 4ZNEA 3O9WB 3KLHD 1A1MA 3PJSB 1G7LA 3UTZA 4F33A 3EIFA 1NCCL 3OAUH 1CF8H 3GO1H 3T77A 1WIPA 4OLUL 5HHXL 5DXWA 3O3AA 4AIZB 1J0IA 4FTVB 4I18A 2JB5L 3D69B 3WS3B 5EC2A 4HK3J 3T4YA 2VXQH 4CVUA 1L0YA 4MWFB 4ODBD 3TVMD 3CU7A 2E8YA 4ZXBD 1M05A 3QEGL 4UB0H 2FB4L 4L4VB 4RA0C 5AYUH 3VXTB 2M26A 3QEQD 1ORQB 3N0PB 4RGNC 3PP4H 3ULVC 5EZOL 2GCYB 3PGFL 1FZMB 1BAFL 1YEIH 2NNAB 4JFEE 2NX5D 4ZDHB 5B3JF 5IMLB 2QSVA 1VGKA 3D39D 5DMKA 2J4WL 1MVUB 5FM4A 3I9GH 2CDFB 2EO1A 1A3LL 1V7NH 4OCXL 5I71C 1X4YA 1UXSA 3VD7A 5GRWA 3K1DA 4WTWA 1BEYL 2DLHA 3MBEA 5E4EB 4O58H 2IFGA 4AH2B 4ZUVB 4MQ7B 1D5ZB 1KV3A 2MQCA 1EUTA 1R5VA 3B43A 1F90H 4M93B 1X7QB 3BQUB 4OM0H 4MA1B 4RGMB 1N5YH 1FN4A 2DM4A 1F6AA 4H0IA 4R0LB 4F9PC 1YZZA 3L3JB 5I15H 1T5WA 4FQXA 4KXZH 5C0AE 1FNAA 3IU3A 4E41B 4WI6A 2ZOKB 1RIVH 1LE5B 3WXWL 4UV7H 3HC0B 3CVHA 5BQ7B 3CLFL 1FNEB 3WJJC 1G6RL 2WWKT 5EO0B 3MJ9H 8FABB 4XZUB 5DJ0B 2VIRB 1FC1A 4U1JA 1UA6L 1X4XA 4DUVA 5F8QC 2VR9A 1GH7A 4M3KB 1N64L 3PV7A 1DANT 4Y2DB 3I02B 3HAEG 4TOYH 5E8DL 5I6XB 2AS5M 1QUNA 3EOYG 4LIQH 4V1DE 4WI4A 3TBWB 6FABH 3AS2A 4L5FL 2R23B 3RWIA 1NCAL 1S9YA 1MFNA 3OX8A 3OF6D 1AO7B 5M94B 3BRFA 2QKIA 3CVIH 3KPMB 1IGTB 3ZDXE 3OF6A 4KHXL 3QCTL 1LDPL 2K9UA 4X4ME 4LNRB 4R4NC 4BUGA 3HPLB 1FH5H 4OCWL 2DQTL 5CMAB 5I1IH 4RGOL 4OSUH 1X44A 4ODXB 3RNQB 2IBBA 3D5OF 3EJJX 3KDMA 1DP0A 3DJ9A 5BW7C 1DLFH 3VXUA 3QQ3B 1YN6B 4LF3B 3O4OB 3L5JA 1RIHH 1PKOA 5EUOE 4F3FB 1J86A 3OB8A 1HH9A 3OMZA 3RPIB 4R4FH 1FE8L 3TBYB 7FABL 5DUPL 1RIVL 3DUHA 2FGWH 1IBGH 4NHCL 1YYLL 4PJIF 5EZIH 4XC1L 2LVEA 2CIIB 1VFMA 3DUUA 4CDHA 1UM5L 5TE6L 2VDMH 1A0QH 2PCPA 1VFBA 4HUVA 1QR4A 2ORBL 2NZ9C 2FJFB 4S1QH 3VGHA 1EA9C 2I26N 2XXMB 3G5VA 4U6XA 4M8VA 3DI3B 1YEEL 3B2UD 3MLZL 3MOAH 3BUYA 4KMTH 2AI0H 4X9GA 1XFPA 2XXCB 4IIQA 5E2VH 2ZG2A 1LO4H 4LQ1A 1OTSD 3TBTB 4D3CL 4FP8H 4HGMA 3LQAC 2YEZA 1NFKA 3ROLA 4NYLB 5EC1A 2EH8H 1XGQB 43CAA 1C7SA 5IOPA 1CFVL 4GG6F 4GRWE 1UWGH 1AR2A 2DQIH 5K9JL 1MCJA 4JO3L 1ITCA 3PDDA 3BZFB 2EECA 4V1DD 4EBQL 4XAWL 4M00A 4U31A 4ZAKD 5LGHL 3V5DB 5JORB 3VXUD 4XMLH 1BD2A 1MCFA 3GSXB 4NQDE 2FZ3A 3QEGH 2W0KA 3AB0C 3TYGL 5I71B 3TF7C 3SY0B 4MHHG 5FDWB 1EXUB 3VG9B 4MJIB 5JHDA 1M6OA 1QHOA 2APVA 4NZJA 1G7JB 5C0AB 3SEPA 4GG8A 3QCTH 3T2QA 4FQHB 1DL7L 2V2XB 4CMMB 1OAKL 3V9FA 5KSAB 4NGHL 5KVGL 5MEPB 2ZSVA 3LKPA 2COQA 4L5FH 5CUSL 5JXAH 2YZ1A 4U4BA 1BBDH 1F02I 4QY8B 3VH8G 4YDIH 5DF0A 4JY6A 5JW5B 4X5XB 1N64H 3SGDH 1J8HD 2PXYC 3TNNA 5FGBA 2OYPA 1R5WA 2B0SL 5I1GL 1CXIA 1I9IL 3TNMA 4R96B 5J6GA 5E8NB 4A6YL 5FYKU 1AD9B 1HQ4B 3BPCB 4XNYL 5BQ7A 3T65A 3IU4L 3CSYB 2W9DH 5KSBA 3E6FB 2VLKB 2EH8L 3S3JA 5IB3B 3C60C 3ZDZE 3PWPE 5ALCL 4CMHC 4BSVA 1T83A 5EN2B 4I9WD 2YRPA 4KMTL 4JZOB 4DZ8A 4PJFB 1MFAL 5FYLL 4LOUD 4AJ0A 5JW4Q 5LQBL 1DBJL 1N5AB 5T1LD 1CFTB 2DL2A 1KGCD 5GS1A 5KS9F 3BDXA 3ROOB 1BZ7A 1D5IL 3B3IA 1MCDA 2PR4L 3VWJA 2EDXA 1L7TH 1RJYB 1T2XA 2HLFC 4X6DF 4MD0A 2H2SC 3G6JA 3ARGD 1OGAD 3MREB 5IMLA 4I77L 3O4LD 4X8JB 2EDLA 1T5XA 3FKUS 4MSWA 4XTRC 4S1RL 4JFQA 1P7KA 5GGTA 3WFCH 5BV7B 3QUMA 5F6HJ 3D85B 4LSVL 3VFMA 3F7YB 4J3XA 4X7EC 2WLZA 1U8KA 2IPKB 3RWEA 4HS3A 2XTJB 1S7XA 2DQCH 2EXWC 4NRYA 4R9HA 2FB4H 3JWOH 4ZS7H 2AABH 5I8EB 2A6KB 2DIBA 4R4BA 1ZHLB 1EVUA 4KWUA 3ZKMD 1NFIB 1JZ6A 1UKQA 3IRZA 4PJXF 5F21B 3ARVA 4XAKD 4XPHH 4Z77A 5IT2L 1AY1L 3ZZ1A 5H8DA 4R8WH 2VDPH 4ZMAT 3CDCA 5DJAB 3RKPA 1FO0L 4NKDA 2Y5EA 4DKFH 4GRWB 4L8SA 4WFGE 2PKDA 5HPMA 1B6DA 1NCAH 3IFOA 4B41A 3ZT6A 2IC2A 1KB5H 4K3DH 4WHYG 5IESH 4Y1AD 4JDVA 2O5XL 2VUOA 3K0WA 2LV4A 3OZ9L 3PGCB 4NO2A 4TUKH 5MEOA 1JZ8A 3MXVH 2R0LL 5C6PB 5FM5O 1SYVA 2W0LA 4MA1C 2MFNA 5MI0B 4DUWA 5E8EB 4HWEH 2X4UB 3T0AA 4I18C 2JCCB 1GYAA 4LRIC 4LSTH 3MJ9L 4RGNE 4A2LA 1NPUA 4R7DB 3EFDL 5I74B 3GDBA 1GHFH 1DUYB 2F54D 3PHQB 2P48B 4BUHA 1WV7T 1ROWA 5ICXA 3KPRA 2PW2B 1CFQB 2H2SD 4MAUL 1JMXA 2BOBB 1AR1D 5I6XC 2C3WA 4PJHB 4QXUL 4J6RL 3K8MA 4F37F 1AGDB 4PV9A 3DBXA 5CD5C 3O8XC 1X5ZA 3O4LE 4M7KH 2OJEA 1IGYA 3BMWA 2C1PB 3MLVL 2VJXA 4MJ2A 2XQBH 5TE4L 1R3JA 1HHJB 1KJMB 5CJ5A 1HQRB 3ZKNC 4W6YB 5DJYB 2XZQL 4H20H 1MF2L 1DQDH 3GSQB 2FATH 2HH0L 1RJZA 3OR7A 3U7YL 3MJ9A 3L3IA 3LKNA 1RIUH 2JELH 1DQQB 3EJYD 5E1HB 5CEXA 1FC2D 4NT6B 4MS8D 4G6FD 3BKYH 1MUJA 3C5JA 3LN4A 4NNPL 3ULSA 4MA7L 5DI8B 3BW9A 2Q7YB 4QRRB 1EEZA 3QUXC 1QRNE 5D70L 2R4SL 4JG1L 5EA0H 4P2OA 5BXFA 1JGDA 2AXFA 1D5XB 1EAPA 1KN2L 3BXNB 4HIEA 1U9KA 1MCRA 2NQCA 3KYOA 4MXVE 2DD8L 3TZVA 4FFWC 4IRSD 2P1YA 3GSRB 4UT7H 4YHOH 2PO6D 4AENB 4OD1H 5D7IF 2EDHA 2ZSWA 4F15B 5MHSD 3BWAB 2R0KL 4FFZH 1S5HA 4X0KA 5CIPA 4ODTL 2BY3A 1SY6H 3CX5J 1C5CH 1EK3A 1A4JA 2R1XA 5L6YH 2DM7A 1U8KB 2IPKA 1YY9D 2DI8A 1KB9K 4TSCH 4JY5L 1D5BA 4NQXA 2EICA 2PW1A 1CU4H 1OP5K 3WUZA 5GZOD 5CWSB 3TIDA 3QIWB 4AEFA 4W4NA 1RPQA 3PWPA 3TT3L 3TO4B 5C2UB 3O41B 3GBLA 2GTWA 4YDKH 3BMVA 2NY0D 3RQ3A 3DVIA 3DVNA 5C0BE 1SY6A 3QPXL 4JCMA 3GKZA 5CCKL 3SOBL 1I1AB 5HYJE 4GQ9L 5C0CD 1L4IA 3HRPA 3BOVA 1MCBA 1TZIA 4PRPD 5KAQG 1NAKH 2P5EB 1I1RA 3ISWA 4Z7NF 4HJ0D 4Y5XA 3H42L 4ISVB 5JIPA 4OZFG 4C57C 4POUB 2JIXD 2UZIL 3H6JA 4R2GD 2P45B 4IDJL 3MCKA 1FYTE 4LHUA 1LO0H 3QP3A 1HHIA 4JLRB 2NZ9D 3QUKA 3MV7A 5D1QA 3T2NL 3MRCB 1QD0A 1MVFA 3VWJC 2D2OA 4JG0L 3IDMA 4LBEA 2CR6A 3MNWB 3OAYH 4JQXA 1F3JB 1C8PA 3O3DA 3HRZB 4L9LC 1GOGA 4MLSA 4XP9H 4F7TA 3GZKA 1RSFA 4ZPTA 1DANU 5HD8D 2GSIB 3IF1A 4L3AA 5JA8B 3ARBD 1JHLH 1I8KB 4C56E 1MIMH 1GGYA 3QG7L 3SGJC 4OZ4A 3R8QA 4OV5A 5JHDE 4A2MA 1S7TA 1RURL 43C9A 2WIMA 1FNGB 1R3IH 1S5IL 1ZMYA 5IHZA 4R7DA 2FIKA 3O4LB 4DN3L 3ZO0A 1BQHB 1QA9A 3T2PA 1GXEA 2X9YA 2VLJD 5T3XE 3QI9A 3TA3C 5D2LE 5KVFL 1I85A 4LAQH 1PDKA 4R4ND 1QLEH 4HPYL 5E6IC 2FX8H 1SHMA 5B8CB 1F3DH 2IALA 1P9MC 5TFSL 1DSFL 1ZK9A 2MCG1 1LP9F 4G7YH 4N8VG 1WBXB 3O6LL 2EDEA 5H2BB 5FDWA 1XF2A 4ONHA 4AIOA 3ULUF 4L8SB 4C59B 3E3QE 4LLDB 5HDBE 1YEGL 3L5WA 3QUZA 4Z0XB 5HI3C 5JIKA 3RP1A 1LK2A 1QRNB 3V5DA 2XPGA 3DRTA 2VLKD 2G5BA 2P8PA 5EB9A 2EO9A 3DSFL 3IJYB 2W0FA 5FO9B 1IM3A 3EJZC 4YHIA 1NFIA 5FDYA 5L9DH 2HKFH 4YFLI 5DD0H 3VXMA 4JAMA 1YPZF 2F58H 3S36L 1HEZB 2AJYL 5GJSH 5TH2B 1G9NH 3Q3GA 3U1SL 3VU2A 3GSWA 4BQ9A 3BDYL 2YBRA 4G8GD 2Y07L 4P46D 3WNKA 1KJ2L 4P59L 1FSKB 1J18A 3FN9A 3MMEB 2D7QA 4P3WA 3T1FB 4NSKA 5CEZD 1GOHA 3AREC 4HK0A 4PRHB 3SKOB 3UTTA 1H0DA 4OFPA 1IZJA 4Z7WA 1RZ8A 5DD5H 4YQXH 1CQYA 1XGYL 1U8QA 2MPAL 2ZJSL 2J88L 2NLJB 1LEIA 1NGZB 4XBGA 3RGHA 1BZ7B 3B3IB 1X3DA 1IQWH 4KKCC 1KUMA 2EEDA 4EN3D 3DGCR 3LQZA 3GUTB 2E9JA 5IFHH 2NXYC 4JKWA 2AK4A 4U1KA 4JKPH 4TQEH 1RURH 5EU7E 1RK1A 5EU3A 2QSCH 4IRJB 3VXUB 3G08A 1Q9KB 4P23D 2P5EE 3S34L 1I3VA 3CVHH 1A8JH 3QQNA 5JQ6L 4XP9L 3H7BA 4PJ7B 5EU7C 5SWSA 3LQZB 3ZKXC 1NGQL 2ZUWA 5BOZG 1RZKH 5FCUH 1JIBA 2B5IC 1VFOA 2HP4A 2R4RL 4EN3A 1CDYA 4PPTA 2NY4D 3V4PL 4OV6F 3IDNB 3TNMB 2ADFL 1HXMB 2XWJA 2ZG3A 3L3OB 4QXTB 1K5NA 2WBJD 2FSEB 1IRAY 3OKDA 2C1OB 4TSBH 3VXSB 3X12A 1A22B 2WSKA 4YHYB 1Z9OA 5IB5B 5ETUB 4RMSA 3SN6N 2CRZA 4HIHB 1UQSB 3HC4H 4BZYA 1U8HA 4JKLA 4HWBL 2CQVA 1KTLB 4PJDF 3I6GA 2ARJB 4LIQE 4XCCL 4YX2L 2ICES 3SKMA 1BQLH 3MLSH 2PO6B 1NLDL 3MUZ1 4PJBB 1U8LB 4ZUUA 4MQXC 3IDXH 2PETA 4ZPTB 1HNGA 2CJUH 4M6ML 2P4AB 4U0QB 5FYLE 4WEBL 5C9JB 1J8KA 4LQFH 2KQMA 4JCLA 4LCUB 5HDLA 5D2NC 2D03L 1DLHB 4OAWB 3MLRH 3O2WH 1JVKA 1U95A 3QFDA 4U1IA 2QHRH 4R0LA 2B4CH 3T0EC 5I1DB 4Z5RA 4XPFH 5AZEL 2OMNA 4HGKC 2C9AA 2IWGA 3VCLB 1U8NB 2EXYD 1JWSB 1RJLA 5TFSH 4FQQB 3JWDH 4RMTA 4KRPC 4J4PC 1QBML 4Y5XB 1NMCC 3IYLW 5ADPL 2Z92A 1ETZA 5ESVB 4OT1L 2YWZA 4NQDA 5D7IE 3MRRB 4LLAA 5KVFH 5C0GB 4NUGL 1NGZA 4U2ZA 2M1KA 1M7DB 1AKJB 2DMKA 3NN8A 4OZFB 4P2OD 1NUDA 2DLFL 4KRLB 3O41A 43C9B 4HEPG 2DB8A 3QHZH 4NQVB 5KG9B 1HK6A 3KVQA 4WI5A 5DT1H 2A77H 2FWOB 5HTSA 4FQIH 4ETQB 1HSAB 1LK3L 3KPQA 5EOCL 2P42B 4NQXB 3QFJA 3BEVB 4L9DA 1SEBB 4PRHE 1T03H 1IGIL 4DEPC 2BSRB 1DQDL 1FG9C 2F8VA 3NTCH 4U1HA 1BZ9A 4BELD 1KLGA 4I18B 3MRIB 3TCLA 1FBIH 2WLYA 4X7TA 3TBVB 4FXGB 1AQKL 2CXKA 3RWGA 1KC5L 2DIJA 2P8PB 1HIMH 3LEYL 4ONFL 1H9VA 5ITBL 4YHKH 3VXQB 3WD5H 3MRGA 3OGOE 4OCRH 2W9EL 1A02N 4EI5B 1PY4A 5CGTA 3FAWA 5F7EH 4JM2B 1NAKL 3K74B 5E00A 3EFFB 3HG1A 3SKJL 3VDAA 4KUCD 4JR9L 4XPGH 4MX7A 1JP5A 1KF9B 3VXOB 2IPTL 3L7EB 4PJ7E 3Q6FB 5HI5C 2JF1A 4YE4L 5BS0A 1MIEH 4UUJB 1FVDA 2R1YA 4YZFF 3Q1SL 4FABL 2Z31B 4NNYA 5HY9A 5HVWA 1ZLWH 3R4DA 2H3NA 3BKMH 4UILL 2NY0B 5E94B 1CVSC 4E42A 1WLHA 1IT9L 3GMMA 1UB5B 2YUWA 1CTNA 2DQUH 3MFFB 4J7RA 3TA3B 4N8PA 4FFZL 5AD0A 4Y2OA 1HH6B 3TPUB 5D2LA 3NIFF 5A43C 3MV9A 2AERT 4M4PA 3LMJL 4UT7L 4PGEA 3TJEL 4KVCH 1ZA3B 2VDPL 1MCLA 2P7TB 2CLVA 4E42B 2XI9A 3LH2L 2AV1B 4AEIL 3E2HC 4U7KA 1KN2H 4LCWE 4RAVB 3QDME 4K55A 5CGYC 3N50A 4NJAH 2B1AL 1DVFC 4MXQD 1C7TA 1UVQA 4ODWA 1KPVB 3GI9L 5FUZL 1JWMB 2D7MA 1UKSA 4HJGB 1KN4L 4JO2H 3EDJA 3KJ6L 5A40E 3Q6FA 4UT6L 2ATKA 1OGAA 3QNXB 4QOKB 5FB8A 1MVUA 2NY6C 2BVTA 2ZUXA 4ELME 4GRLC 3IFLH 4PJ5D 1U3HD 2RQ8A 4Y4FC 5EBLA 3V8CA 1D5IH 2DQHH 5HHMD 4YC2B 2HTLD 5J9PA 3PWVB 3C6SA 3OXRA 4G6AC 5GS0C 1MCQA 3IGAB 4HX1A 3OTTA 2VXVL 3R0MA 3H3PL 5MEQB 4M6OL 1DE4B 2VXSH 5AAMA 1WCBA 3FT4A 4JB9L 2F15A 1FSKC 5C07E 2NY3C 4NOBA 1PFCA 1A6VH 4FTVA 5I1EH 3J7HA 2V9RA 3P9LA 4X6EB 4HFUL 4DVRH 4XGZB 5IW6A 3C8HA 3HS0A 4GMSL 2ARWA 4ZFOB 5TDNB 3JTSA 3LS4H 1GIGH 3F7YA 4DKEL 3QIBA 3FN3A 4JPKL 1C12A 5CSBA 5HVFB 4LSTL 4XBEL 1YY8A 2VLLB 5I1CH 4XP4L 3MA9H 5GSRB 1NUNB 3OKNA 2WV3A 1T0NB 3P0VL 3QWQB 1J8HA 1JL8A 3VXOA 3HMXA 5BZDB 1CT8A 1R3LB 4XCFL 2FR4B 2YZ8A 3VWJB 5KS9A 5E2UH 3ME0A 5IBTH 1MLBB 4JPWH 1MHPL 4MB3A 1GGBL 3BKJH 2O61B 1A7OH 4F2MB 5CEXB 3QDGA 3V6ZA 4X4YB 4DZ8B 3LB6D 1A1NB 1YNLL 1EHLL 1INQB 3V5KB 4XGZA 3V0WH 4Z77B 1RHFA 2N7BA 4GUPB 3VGAC 4U1IB 4U6HB 2IMNA 5IT2H 4X6CA 1VGEH 1BHGA 1DE4A 2R2EA 2GITB 1G7QA 1UACH 2N7AA 5C9JA 2YPLE 4YXKH 2Q8BH 4CGTA 5TQ0H 3OXRB 3G9VA 3RIAF 1WWAX 4JFQB 4FQCL 4I0PD 1KPUA 1QLFA 4EBQH 4NZUL 4RFNB 2UUDH 5I18L 5IGXH 1S7QA 1FIGL 1ONQA 1F58H 3FQWB 1A6ZA 4PRPE 3KYKH 2PW2A 1UGNA 2DQIL 3VG0L 5K9JH 5JW5A 1P69B 4BH8A 2NY0C 4BSJA 4ZUSB 1NFDB 3MV8E 3UTPD 3VXSD 2ESVD 1B4RA 2DTSA 1U42A 2F9BT 2Z92B 5ESVA 2EDDA 2EYTB 4H88L 2G9HB 1JWMA 5BS0B 2W60B 2RAMA 1JGLH 1P84K 1E28A 3VRJB 4TVPE 4JPVL 3QDMB 2MWCA 4QXTA 4MCYB 1QG3A 1OQOA 1HXMA 2XWJB 1Z9MA 1MFAH 5FYLH 3R06B 4G9DB 3QIWC 5D7LB 3U4EB 3C08L 1CIDA 4EI5A 1HYRC 3BD5A 1ZGLM 1K85A 1YYLH 3N1PC 2O5ZH 3U7WL 4WV1C 4YHZH 2W9LA 3RWHB 3H9SD 3IETA 2ADGA 3SGEH 3PQYA 5IGXL 12E8H 2VLRE 5C6WH 1NDGB 1KIQA 1U6AH 3IRPX 4AM0B 4BFEA 2I5YL 3ZMRA 4OGAD 5I19L 2HN7A 3G5YB 3JV6A 4Y2DC 5CZVL 1WQVT 2HYMA 4YIQA 5FECA 5GRJH 1FCCA 4JFDE 5K9OA 3QO0B 4FQJL 5GGSY 3TIEA 4N0FB 1CGTA 5JXAL 1P7KB 4JFDA 2HRLA 3WO4C 1LDPH 5KTEH 4LSRH 2WWMD 1FV1A 5F93C 4OZFA 1DDHA 4PJAF 3W5MA 2UZXB 4E0RB 4ODHL 1CDJA 3BKJL 5K9KA 5E1AA 4MJIA 5DQDL 4GKSB 2FX9L 3Q6GL 4TULL 5DTFA 2R1YB 5E8DH 5F7WC 4QTHB 5E2UL 1FGVL 4PD4K 4Q0XH 2AK1H 4NCC1 5ANME 4YAQA 2I24N 3RPIA 4JHAL 1GL4B 3BQUD 4GBXB 1A6WH 2I5YH 4TTDC 1U92B 3RZCA 4Y88A 2IAMC 1C5BL 4XP4H 3X3GL 2EE2A 4ZAKA 1MAMH 2C26A 3DX7B 1MHEA 4H1LB 4JPKH 3MRBB 3E6FA 3HC3L 3RY5A 3CLFH 3RY6A 2X5PA 5I8OH 3SPVB 4D3CH 2UWEB 5LWYL 5E8NA 1DDHB 1U8QB 3GMLA 3OJVC 4KK6C 1YEFL 2AI0L 3HLAA 3G5VB 4G3YH 2Y36L 1KSRA 3EOAA 5JNYA 2YA1A 5JR1L 2YPLB 3AS0A 1AXTL 1RFDH 4LLVB 4MAYA 3STLB 3HNVL 4IHOA 5FO8B 4LMQI 3O4OC 1NC4D 4GAYB 5MEND 1PGRB 3JWNC 1BEYH 2EE3A 2X4TA 5EZIL 3VXSA 4QRPE 3UPRA 3LKQA 5FOBB 5F9AC 1T7ZA 4OBRA 3HLAB 5T3XD 1NFDE 3WFEH 3KJ6H 4LCIH 5B38B 5FUOL 1FIGH 4WHTB 5DD6B 1M6OB 4BFBD 4OLXH 4MA8L 3GI9H 3CMGA 4RNRA 3KDMB 1DBBL 3DOSA 3PL6D 3WNPA 2BERA 3CCHA 1RZGA 2BJMH 1VACA 3QZWG 3I3DA 5IVOA 4NQTA 5GISH 1LE5A 1EAJA 3EOTH 4R3SA 4OKDA 4G6AD 3MRCA 2DQJL 1IAIM 1FYHB 3B9VA 4AEIH 1LD9A 4M62L 3VFSA 1LEGA 1XGTA 4LHUB 4I1NB 3MCKB 3MNVA 5D7LE 2DLTA 4WRLA 4Y19E 4ZUUB 4P57B 3N1FC 3QFDB 1P4LB 3L3GA 1CF8L 4FXLA 2YPKA 5KOMC 5J7CC 3L3DA 5SWQB 1WZKA 4YAQB 4X83A 1C1EL 1BGXL 4BZ1H 1I1AD 4KRNA 2VQUA 5TJWK 1XGPA 1BF2A 5AZ2H 5A2FA 3PWUA 3FQNA 4GAYA 4LIQL 4UZGA 5DA0B 1MSPA 3STLA 2B1HH 5B39A 2NXZD 5T3XH 1S7TB 4OQTL 1OSPL 4EIZC 3S6CA 3LPWA 3TIDB 4LCYB 4DTGL 4JFDB 8FABA 4HIHA 3BP5A 4Y5VA 5DEFA 1OARL 5H37G 3O2VH 3L3HB 5EPMB 3L95A 1IM9D 3S37H 1KCVL 2X1WL 1A4JB 3EOAB 2CK0L 4X6CB 3VXMB 3MXWL 1GC1H 4YHIB 4M5YL 4MD5A 1YEJL 3HUJE 3L5HA 1MCWW 4XHQA 1ZEAL 3EDFA 5GGTL 2G5BB 2HVJA 1PQZB 1R5IB 3TZVB 3MPCA 4OM0L 1A1MB 3PJSA 4S11A 4U3CA 4QXWA 3V6OC 1QP1A 4HWBA 3ZTNH 4E9LA 4JREC 5IMKB 3EKCA 2VZ1A 5CSZB 1FBIL 5H2BA 3VFGH 5HGBB 4B0MM 2BNRB 3UTQB 3A0OA 3SE8L 3BFOA 1T7WA 1WWCA 2ICWI 4KUZH 1A3LH 1RZ8B 3VRJA 5L0QC 3JVGC 3TO4A 4GSDL 4P5TC 1FZMA 1AJ7L 1T7YA 3FQUB 3U6RA 1LK3H 2X09A 4WO4A 5EOCH 4F8TA 3PGFH 2VDNL 1XGUA 1T2JA 4HWNA 1JNLL 2ICEB 3VWKD 1NGYB 5CSGA 5D6DA 4XCYB 1FL3A 2B1AH 2Y7QB 3FT2A 1ODAA 3UJTH 4L3EA 1H0DB 3PL6C 4L9LB 3EO0B 4OZGA 3ZE0E 1RZFH 1S7WB 5C71A 3CUPB 3M17A 1INDL 4GKZA 3RTQB 5KN5B 1KLUB 4OF5A 4WWID 4EOWH 2YD6A 2ADGB 1TZGL 1IE5A 4PJHA 4CVXB 3NMEA 4HKXB 4U49A 4G6MH 4EUPA 4MNHB 4ZFFA 5TDPB 4OLVH 1J05B 4D0BB 5E2TH 1CFSA 2Z93B 3LN5B 1XGTB 5IJVB 1KCLA 2FJHB 3VI4F 1A6UL 1QRNA 4MXVF 1A4KB 3C5ZA 3QDGB 2D7OA 2ESVB 3T2OA 4TNWK 2YD7A 1GAFH 4LRNL 4F7MB 1NCBH 3PXHA 3LEVH 1BQHA 1QA9B 1NLDH 3TBSB 2OXGA 2IALB 3LN5A 1KELH 2QQLL 1CGSL 3STZA 1CFSB 5EG6C 3KPLA 1I9JL 5JW4M 2VAJA 4Y16C 2Q3ZA 5E7FA 3WS6C 1J1PL 4LHQB 2W9EH 3IDGB 4JRWA 4OCRL 5C8JA 4WFHE 3O3DB 2WBJA 4OB5H 3HMXH 1EFXD 2HLAB 1RUQH 5DRXA 1WTGT 3A67L 3MA7A 4ORZC 5LXGL 3MLWL 4GMTH 3FL7A 3LZFL 1KBGH 2Z91A 4KKLD 4J4PD 3AM8C 3RWEB 3CD4A 2F5AL 1AXIB 3QISA 1YNKL 1T03L 3GHEH 4NJ9L 3C6SB 3LIZH 2GIYA 4OFYD 4ODVH 3T0ED 1JHKL 3EO1A 1MCHA 4OLWH 3VGAB 2IANE 3K2UL 4MD0B 3SE4C 5JOPD 1VHPA 2YHGA 2DLFH 2ATKB 1J8HB 1HINH 3EYVA 3V6ZB 1K8DA 3BN9D 3IFOB 4CVZB 3S4SG 5IWLC 1EO7A 2NY4C 4ZSOA 3UZQA 2BNRE 1MLBA 2F5BL 1KPVA 4GLRI 4W6XB 1RMFH 1RHHB 3OR6A 1D9KC 3H7LA 2ADJB 1TJGL 3BVNB 4JRYD 2FBJH 1ZA6B 5HGHA 5IBLC 3RA7H 1T0NA 4H8WL 4OI7A 4QRSA 4D0CA 4RSVA 4LLWA 1FL5A 4X7CC 4M43L 1OAUH 2AKRA 3CMOH 5DRXB 1BZ9B 5JXEC 3V6FA 5HGDA 3TIEB 1T89A 1FRGL 1FFNB 2BSSB 1M7IB 1J88A 2O5YL 2D03H 1J11A 3DBXB 3L3HA 1PG7H 1P5VA 4KJWC 5IM7B 3IDGA 2HKFL 5L9DL 5FKPB 3ARFB 3MFFA 4K07A 1JZ7A 3S88H 4K8RC 1S5HB 3BXNA 4HIEB 1BX2A 1FL5B 4F80A 3WN5A 4NQCD 4H0HB 5FYJD 4OLYH 5GRUH 4JY6B 4YX2H 1MCCA 3IGAA 4HX1B 1CR9H 3MOQA 3CXDL 4XCCH 4KZDL 2VQ1B 3OPZH 5B21A 4RMVA 2A6JB 4RDQF 3LQAL 5EWIH 3PE9A 3VD9A 3O9WC 4LSSH 3CPLA 3WKNA 5GS1B 3QDJD 1JGUH 1MJUH 2X9XA 1BOGA 5ESQB 2AXFB 1EX0A 1WZLA 4OM1H 3O45A 4N0YL 5J89A 5BCAA 4XXDB 4KTDL 3LRGA 1YPZE 1RY7B 4OCSH 1MUJB 4JM2A 2QJDA 5ISZD 4PRAB 3LHPH 4GQPH 1FP5A 3CPLB 5LCVH 1NGXA 2AP2A 4PGEB 1NGQH 2A6JA 4N8CL 3GSQA 1UCBH 4J3TA 2ZPKL 4PJ9A 1QFWH 2FJHA 4G9FA 1OSZB 2XQYG 4R96A 5IW3A 1MCKA 3IFNL 4MLIA 3ESUF 1MEXH 4YHNA 1J5OL 1KPUB 1ZA3A 5DC4B 4X5XA 4ZUWA 1L0XA 4GBXC 1I1AC 4Z7WE 1T20B 4WI2A 4NRYB 1UJ3B 4S0SD 4DGVH 1PW3A 1A64A 1NGYA 4I3RH 1RUPL 3QCVH 4U0RB 5DFVC 5ETUA 2QQNH 2ZSVB 3LKPB 1GVIA 5EBMB 2ZNWA 3EYOA 4MXWL 3U6RB 4GKZB 5HHME 5DURB 5FYLD 2FJGB 4U6HA 2HFGH 5IQ7L 2OSLA 1WC7A 1IAOB 1XGYH 4BJLA 3RU8H 5J11C 1MRCH 3A6OA 2BVPA 4NO2B 4OGAC 3NN8B 2XNAB 4D8PA 5J1AB 1G7MB 3N1QC 3MNZB 3NA9L 3NPSC 4X4YA 1R0AL 1CICA 3OV6A 1T7VA 4ZSOB 3ILPB 5FHBL 4DFIA 1BJ1H 5FYKE 4UQ3B 3WV0A 4I2XA 4G8GA 3TZVC 4FFWD 2FRGP 3H7BB 3MRHB 4IRSC 5I8CB 4KZDH 3UBXA 4WFFE 3EYVB 2CKBL 3L5XH 4Q9RL 4NKDB 4KAQL 5A2LH 3X17A 5JUEL 3KPNB 3GBNH 1TNMA 3WDJA 4X7TB 1RK1B 3TBVA 1MCEA 1UENA 4C4KO 3MUGA 1ZHBA 2NY1B 2HVKA 1J1OL 4XWOC 4CAGA 2VL4A 1I3UA 4NYLA 2VLKA 5EC1B 3I85A 3QIBB 3L5XL 1WICA 3D1MC 1R5IA 1NANI 4FZEH 1HSBB 4UINH 3LVEA 2Z91B 3N85H 3HS0B 1JHTB 2P8LA 1UEMA 4PYHA 3FQXB 4LFHG 2R9HC 2Y4SA 5KN5A 2QKIB 3TNNB 3RIFF 5CGYD 2FO1A 3HE6B 1FL3B 3C5ZC 4N5ED 1UT9A 5A2JH 4LPTA 4HPYH 4NCC2 1BWWA 2P5WD 4GS7C 1CE1H 4GT7A 2V7NB 4GAJL 3QO0A 3D18B 4IBLT 1JZ4A 1HSAA 3KPQB 1CWVA 3MRRA 4GAGL 4K8RD 3MRNA 3V4UH 1S78D 2G2RA 5KSUB 3UMTA 5HYSA 1YY9C 4HW6A 3MLXL 2NXYB 1U41A 1R3IL 5E5MB 4JZOA 1TPXC 4XZUA 4PJ8B 4URTB 2XKSA 4NNPH 5C0AA 5EN2A 4X4XB 2BVOA 2WP3O 4LVHC 4B53A 2XACC 2JELL 4JQVA 4P4KA 2XPGB 4YXHH 1HHKB 1UWXH 1CFTA 4XCNA 4I5BB 4UMGA 4I2XE 1P4LA 2BMKA 2QQKL 2CLRB 4OGXL 5D1QD 3A67H 5F7DA 5ISZA 4KPHH 2J6EH 1LD9B 4X4XA 3MBXH 5J1TC 4S2SA 1EFXA 1RUAH 1PY9A 1MFEH 1E4WL 2W60A 1LGVA 4XCNB 4P2YA 5DJZA 3L95B 4LVEA 2BHZA 4WWKA 3TBWA 2YSSA 1TTFA 1A7RL 3CFCL 2V17L 5C08E 2EKJA 2ZG1A 3NCJL 4LSSL 1NFDA 1WUNT 1ZT1B 1U8PA 4JM4H 4KV5E 3D0VA 4Z7VF 3UYPA 3CUPA 1VB9A 3M17B 1MJ7H 1NBYB 4EJ1C 5E99L 4P2CG 4NM8H 4Z7WB 3I6GB 4RQQA 5HYSB 5B39B 2AXHA 4Y8DC 5CKGA 1G7JA 3MLYL 4PGZA 2LQRA 5DR5L 2Z31A 5K33A 3WIFA 3ZDYE 4GG6E 5HHMB 4F9LA 1RQ5A 3MYZA 4ZFGH 5E6IA 4K71B 3SY0A 3IDMB 4LBEB 1YN7B 2J8UF 5L6YL 4PTUB 2DYPA 4JFYA 3T4YB 4JKMA 3I50L 2X4RA 1U3HB 5IW1A 4ONGL 3S3PA 3CMOL 3ZL4L 3GIZL 3S96B 2H26B 4M6AA 3VFSB 2IGFH 2R0KH 3UTZB 2AQ3A 1PSKH 5F9DC 1FIEA 2PF6A 2CLZA 4YFLF 4YHOL 5C86A 3QUZB 4O51B 2VDQH 2BXYA 4X6FB 4PB9L 2QR0B 1N0XH 3MUGB 1LE9A 1VSCA 1CDUA 5I75C 5DD6A 4PJIE 1YEKH 4WHTA 2HFEA 5J57B 1T1ZA 1RZFL 3WIHL 3VXNA 2BVPB 3JWOL 1NJ9A 2R4SH 5FGSA 2YC1B 4A6YA 3SE3C 4G8GB 2NMSA 1P84J 3LKQB 4NZTL 1T1XB 4D9RE 5SWZD 1VFBB 4QRRD 5CWSA 4B5EA 5FHAL 5GIRB 1INEH 3S97C 5K9OB 5CILL 3CXHK 1G7MA 2CGRL 3O4LA 4ZFOA 2R1XB 1UZ8A 1HILA 3F62A 3W2DH 4POZC 2FATL 2HH0H 4M1GL 1Q9OB 1FNGA 2HJFA 3HTLX 5C7XH 3KYMB 4NQVA 4YWGH 3UTTB 2X89D 4K2UL 4AM0A 1NBYA 3NACH 1NL0L 5EZLB 4POYA 4I4WA 3O3AB 4XMPL 3IF1B 3RGVC 3K1KC 4PLKC 5IHLB 5FECB 1F00I 3WKMH 1NMCB 4F33B 2YBRB 4K7FA 1FNEA 3UEZA 3KYOB 3P0GB 3T04D 1N2RA 4FQXB 5EBLB 3TFKD 5F9OL 3QUKB 3LOWA 4JRXB 4AYFA 3CLEL 1GC1L 2E5EA 2EE6A 1TZHA 4Y4FB 4JRXD 4RFOH 3K80A 1MCOH 1WK0A 1RV6X 1BM3H 3IU4H 3MACL 4OAWA 1DCLA 1NGXB 4I2XB 4MQ7A 2DKUA 4HMDA 4M6NH 1DQQA 1JPSL 4F8QA 4MJ6A 2Y6SC 4KZEL 1YEHH 3NZHH 4J8RB 4JVWA 3K8KA 1D6VL 1JWUA 3HMWH 1TENA 5I1LA 1WISA 1E28B 2DRUA 3RWIB 3ULUC 1S7QB 2HTLC 1KB5L 4K3DL 4NCDA 5J12B 5KVGH 3RHWF 4BZ2L 1FZJB 1BZQK 1H3UA 1YYML 7CGTA 1JN6B 4NBXB 4HKJB 3U82B 5ILTH 2YPLA 5F70A 2VAAB 3INUH 1OTSC 1CIUA 3HE6A 3UJIH 4OV5B 3BPNB 1TZGH 2VIRA 1IAIL 2AJUL 1QLFB 5FA4B 4GG6B 4HAFA 5C2BL 4NO5A 1INDH 1JHTA 3LDBC 1NAMH 4RWHA 2HTKD 3UJTL 3AS1A 4WEMB 2JCCA 1LVEA 4N0RA 1JNLH 4XAWH 4HC1A 3GRWH 4LFHD 1KEML 1MHEB 5F8RC 1FFQA 1SYVB 4QXGL 2G60H 3FFCB 2EH7L 3FB6B 3TO4D 4JQIH 1X7QA 1T6WA 5DMKB 3VJ6A 3PF2A 3T4AB 3ULSB 4Y1AE 1LO4L 4ZOAA 1QYGL 2CKBB 2EYTA 1ZLSH 2AW2A 3VFTB 5ACZA 2VZUA 3LKOA 1JNNL 3RWFA 4EQ2A 1FNSH 3O6ML 2RJMA 1D5BB 3AY4A 5JR1H 5DK2A 3MRLA 3U4AA 4JPIA 1PKQA 4G8GE 1S7RB 5E08L 4WWKC 1CDBA 2D9CA 1UM5H 5TE6H 3ZHDA 1QSED 3MRIA 5A2IH 1E4XH 2VLLA 1K3IA 4IDLA 4JO4L 4TPRH 1YMME 5I8EA 1IKNC 3ULVE 5DC0A 4Y5VC 5EBMA 4AIZA 4WI9A 4QHUB 4QHUA 2DJ4A 5HHOD 4HXBL 4XVSH 1HHHB 2GJ6E 5EORH 4OFIA 3VFMB 4KHTH 2RB8A 3MYJA 2WZPD 5BVPH 5K9QI 4MA3B 3ZDXF 1BJ8A 5DMIH 3KPRB 1FAIL 3HE7B 4JO1L 4AENA 3HB3D 2AK1L 2CMRH 1P4IL 3UBXB 3SDAB 5DI8A 4PJFF 1YEDA 5CHNB 1FHGA 1U8OB 1KFAH 1W72H 1CICB 2R69L 5BRZD 1LDSA 1WBXA 1BGXH 3VJ6B 3OR7B 1FL6B 4LDOB 5D7SH 3VCLA 4ZG1A 2LE9A 4ODSL 5BZDA 3MLUH 2UY6A 2VQTA 3O45B 5A16B 4X6DB 5DJYA 1NGPL 3ARSA 1MHCA 4HJGA 3GGWA 3V52H 2EIBA 2G9HA 5FYJL 1CE6B 4U0RC 9CGTA 4M1DL 3A6BH 1JPST 2Z4QB 3B2UC 1MLCA 4C83B 2YRLA 3TYGH 3O8XA 3RX7A 3QUMH 3FCTA 4P2RE 3OKLA 4RRPA 1JZ2A 3P9LB 3QFJE 2GHWB 4X6EA 5LGHH 2IAMA 3FTGB 3P11H 1J05A 4D0BA 4MA8H 1ONQB 1T2QH 3MYJB 3UXFA 4HXBH 4XVSL 1G0DA 4LDEB 2A6KA 5ICXB 1SQ2N 3FT2B 5ECJE 2JB6B 2HT2C 5GPRA 1M7IA 5IB5A 1E4XL 3NZ8B 5MEPA 4WO4B 4GXVH 4GRWF 5E94A 1KPRA 1G7IB 2YMXL 1YEEH 3SDCB 1OGAB 3VFPA 1ZGLB 4M5ZH 2ORBH 1IVLA 2ADJA 1M7XA 3H2WA 1KOAA 3QIUB 1SEQH 3NIDF 5HGBA 1LO3L 1RK0B 4UQ2B 1J5OH 3IAGC 4J23A 3N1MC 1X5YA 3VFTA 5ACZB 2ESVA 3HZMA 1AO7D 3VXRA 1BD2B 2WUBH 5E4IA 3O81A 2D0GA 3D39A 1NUFA 2VQ1A 5IJVA 3G08B 5J3HC 2AJZB 3FFCA 4K94H 4DGYL 2VYRE 5EZOH 4LSQL 1QFWM 2CLVB 2CRYA 3WNOA 3QA3B 4KI5D 1YY8B 5AYUL 1BFVL 3CAFA 5ICZB 1JYWA 4NPYA 4Y2DD 5L8JB 4HKXA 1NAML 5HYQA 5B4MC 3JTSB 4K7FB 3TVMA 1PQZA 3BGMA 15C8L 4IIQB 3BPCA 3RWGB 1NMAH 1OPGL 3WLWD 1FH5L 5J6GB 1T22B 4OIIH 1MI5E 1TTGA 4NKMB 3GO1L 3V7AG 1I3GH 1TFHA 1N7MH 1YYMH 4ZTOH 2CKNA 2PUQT 4R90H 5FYJU 1BP3B 4XNUL 5HHQA 3AM8A 1QPPA 2P47B 1V3LA 5DK2B 2VKWA 4Z7QF 3BD4A 4Y5VB 4ETQA 5TF1L 5IBTL 4MB4A 1M4KA 5IP4A 4WV1B 5TH2A 5E24E 1ETZB 2CKBA 4OIBA 5INCA 3ZDZF 1FFPB 1D6VH 2X4OB 1VERA 3U0PA 3RZCC 5I19H 2GY5A 5K59F 3QNXA 3TVMC 5FB8B 1H15A 3THML 3V7MA 1U6AL 3R0NA 3SDXF 4RFEA 5F1NA 2ZCKL 3FQNB 4QCIB 2OTUB 1XGPB 3LKRA 2QR0A 5F7HA 4P0DA 4DAGH 3HNSL 1AHWC 2C3XA 1XF1A 3VXRE 4HFUH 2FHCA 3Q5TA 4X6DE 1I1FB 4TPRL 1N4XH 4RMUA 3BGFB 1HQRA 4MD5B 2VSDA 3TO2B 4OCNC 2HG5A 3B83A 2R9HD 1MY5A 1MWAH 5TDPA 5FV1L 43CAB 4P46C 2VC2H 4K8RH 1SEBA 4P2RB 4ZXBC 1F2XK 1Q1JH 2BDNH 1JGLL 2ITCA 1EGJA 3QFJB 4YK4B 2H6PA 3TA3A 4XWOD 2MTPA 4FG6C 4Z9KB 1OD9A 1J0YA 2NY7L 4MZ3A 4OCXH 3HUJF 3FO0H 5JNYB 4JQIL 2AEPH 2J4WH 3LDBB 2FJFA 5CIPH 3PHQA 1U8PB 5F9WB 4J8RA 3UP1A 4XP1L 4XMKH 5D1XA 3QUZC 4NZUH 3ET9F 3LPGA 4AG4H 3H3KA 3GMOA 3QEQA 2JJVA 4UUJA 2C1OA 2V2XA 4CMMA 2W0PA 5DGRA 1A47A 3L3DB 5SWQA 4UB0L 2CUHA 1OGAE 3GJFK 4IM8A 2BVUA 3CFDB 4MNQD 4NM4L 5CEZH 1NJ9B 3JUYA 5C2BH 4HH9A 4F3FA 1IGMH 1O0VA 4K3JH 1VA9A 1J1XL 1N59A 3ZTJH 2JTDA 4CU8A 1DFBL 1IAIH 2CLRA 1OT1A 1XH3B 1TMCB 3TC9A 1U95B 1JPGB 2OL3B 1F4YH 4WW1B 3SJVA 2YPLD 4R3SB 3SDYH 3LAFA 4R6UA 4ZFFB 4KH2A 4BFGA 4ODXA 3RNQA 2YEZB 2LVCA 2XZCH 2BRRL 1TZIB 1B0WA 5HGAA 5E1AB 2EDRA 1U58B 1DBKH 4I4WB 1CDIA 5HD8C 4NN5C 5TQ2H 5INCB 4DW2H 3P0VH 3QIWA 2R56L 2X4TB 4TVPH 1U8HB 1HILB 3I2CL 4KDWA 3DYOA 3T1FA 5IKCB 1WWWX 3BEVA 5JO5B 5K9KB 1FDLL 3KGRA 3VXTA 4QOKD 2WQRA 5JO5A 4ORGA 1GOFA 1AD0B 1B0GA 5E2WH 4DKEH 3NAAL 1SM3H 3RY6C 2IPTH 3SDDC 3VFOA 3MV8D 1BIIA 3G6JB 2FX7H 5CFHA 3KHQA 3QG6B 3SKJH 4YUEL 1Z2KA 5F9OH 3S5LB 2BCKA 2UWEA 2BNRA 2OK0H 3QQ3A 1Z9LA 3GSRA 3BIKA 3GSWB 2VXSL 4XNXL 3BP4B 3BSZH 2AQ1A 5ITBH 5DJZB 5EOQL 3QEQE 5MERA 3B9DA 3CJJA 5D2NE 5ICZA 2CLZB 2KPNA 3RL1B 1S9VA 2ZNXA 5C70A 5KZCB 3VG9C 2GJ6A 1B6UA 4ZO7A 2AGJL 1FN4B 1MNUL 2YUVA 1U3HA 3DRTB 5IW1B 1G1CA 2J12B 3V2AR 4S10A 4NDMA 3NBNA 3VXRB 1YN7A 3ZKQD 3DTXA 3RVUC 4RBPH 4QTHA 5E7BA 2PTVA 2WBKA 4NBYB 1INEL 1EEYB 5IVXA 3C2AL 5DT1L 2NY3D 1I9EA 5FUZH 5JXEA 2FIKB 4BA8A 4X5LA 4ERSL 3ARZA 1WGOA 4FNLH 4WY7L 2CO7B 2N56A 1QSFB 4ZAKC 5HHOE 1KPRB 5DJ6A 1EO5A 1IKFH 3WIIH 4KKBD 3WYRA 1KTLA 5KVDH 3LH2H 1X6NA 1CGWA 2X4NA 4P9HC 3QI9C 3WIHA 4OF0A 5HDQL 2OJEB 4GXUN 1CE1L 4LLMB 5EO0A 4OT1H 3ZKMC 1KJ3H 3QO1A 2VR5A 5SV3A 4ZUSA 3U46B 3ORJA 1B3JA 4CW1A 3QDMD 5FYKH 2ZOKA 1IAMA 2OBGA 5AZEH 4OUOA 25C8L 4OF3A 2APFA 3GIZH 1UM4H 4S2SB 5GHWL 4HKBB 3MNVB 4XTRD 2F19H 1CD8A 3SGEI 1F6AB 3SDDD 4OF8A 3RWHA 2HT3C 3HAEB 2J5LB 5I8KH 1X4ZA 2NYYD 4C83A 5MENE 2D7TL 1ACYL 5GS2D 4WEBH 5F1KC 5D7JC 5DHVB 2OCFD 5I1AB 1DR9A 5AWNL 3ZKND 1V7ML 5TPWL 5FFLA 2H8PA 5A16A 2H2PD 3BZFA 3V5KA 1CBVH 3CDFA 2BHUA 5E99H 4MCYA 4QWWD 1MJ7L 4HG4K 5GRVL 3U0PB 4P49A 3ARTA 3HG1E 4F2MA 1KEGH 3BT2H 3G9AB 1G9EA 3PDGA 3SGJA 3DGGB 3MNZA 1FGNH 2XRAH 5L2KA 1R3LA 1MFCL 4C58B 1FV1B 3MRKA 5ICYA 5IQ7H 1UH2A 4OZ4B 4ZODA 4NSKB 3V4PH 3GK8H 2BNQD 2Y6SD 4FN0A 4PJBF 1JPFB 5JW3H 2FEDC 4L4TE 4XPTH 5C0DB 4P5KA 2E6JA 5D71H 2GITA 5HI4C 4AIXA 4I0PB 1MEXL 4JDTL 3G6JE 5TF0A 4P4KD 2KH2B 3RVVC 3QDAA 2IBZY 4YHNB 4UIMA 3PWLB 4F58H 1WT5C 4JDTH 5GGRY 2DM3A 1ZHBB 3K46A 5C0AD 5E6ZA 2IG2L 4JZJA 2H32A 1X5JA 3PQYB 1JNJA 1E4KC 1U92A 3RZCB 3BVNA 3MLXH 1ZXQA 4GBXA 3ZTJG 3BPLC 5LCVL 1XCQA 3V4UL 5GGVL 2P5EA 1H5BB 3OXSB 2DJUA 5MI0C 1KB9J 4I9WE 3P4MA 3BZ4B 4UTBL 1KT2A 3V4VL 4KK5C 1QBMH 4EIGB 4PFEA 1DTUA 1KCUL 2Y5TB 3T08A 5B8CA 5D72H 3BKCL 1MQ8A 2YA0A 4Z0BL 4P5MA 3KPOB 3HI5L 1KEGL 1OAXL 1NKOA 4NT6A 4Z6AT 1OP5H 3AS3A 2XZAL 4N0FA 3OPZL 4FQPA 2E9WA 3C6LC 4P9ML 1CLOH 1OCWL 4Y4HB 2F58L 3F65A 5CP3A 5EO1A 3E0GA 1F8TL 2YD9A 4NO5B 2AV1A 4AZ8A 4MYWB 4DZBB 1KIQB 3FQWA 1BX2B 1EJ6A 1F8TH 4WVRA 1QNZH 2E9BA 1CDGA 1B90A 1CN4A 2H3NB 2R29L 4RIRA 3VXPB 5C8JB 4L3EE 2JE8A 4OZGE 1AGDA 4PV9B 1BVLA 1XR8A 3JV0A 4GOSA 2LAAA 4PG9A 4M43H 5C6TL 5KSAA 1T5WB 1D5XA 1CFQA 5D7LA 3U4EA 2I9TA 1MHCB 3DURB 4JM2F 1DVFA 5F7MC 2FX8L 5HVHB 1ZA6A 1SBSL 5HGHB 1KJ3L 1A6AB 1RMFL 1RJCA 5MENB 1JYVA 5IVNA 4DQOH 1RHHA 5HYFA 4M48H 4JFOA 3SQBA 1EXUA 1OLZA 3QRGL 3KPPB 3WXVL 2H41A 1HINL 1MAKA 1UVQB 4PJCA 1MJ8H 2W59A 1S5IH 3UZVB 5SWSD 3KG5A 1TZHB 4Y4FA 2Z93A 1VGKB 3HG1B 4LDLB 4BH8B 2YD2A 1A6ZB 3LIZL 3QNZA 1CG9B 2C1PA 4X99B 1ND0B 5D71L 3QAZB 3X13A 3O3BB 1KBGL 4RWYL 5IFHL 2X4PA 4Z7OE 5JMOC 3WHE1 4JM2C 5C0DA 2OZ4A 1A7BA 1M05B 3WXVH 4FXGA 3T2NH 2EIDA 5I76B 3LD8C 2P24B 4JM2D 3V6FB 1BQSA 1B88A 1ZHLA 3MA7B 4OB5L 4PY8J 5KG9A 4CKVX 1MRFL 3KYMA 3MO1A 5J8OA 4KUCF 1BJMA 4OM1L 5KANI 2PCPB 3QB7C 1W72B 4HUVB 1MPAH 3F8UB 1A9EB 2AEQL 5J9PB 2BC4A 4PB0L 2GUOA 3BT2L 1VKXB 3ARDC 5C6TH 3LKOB 1FLRL 4D0DA 4MSWB 4U1NB 3GB7A 1EAPB 3KPSD 3QPXH 5MHSE 1AXSA 4KKNA 1CD1B 4OCYH 4TNWF 5KS9B 2YC1A 2AJYH 3QEHA 1GSMA 3BIBX 5I1HL 4FHBD 1RJYA 4YHLL 2RCSL 2NXYD 2CH8A 4FTVE 4ZO6A 4ZFZA 1URLA 2L7UA 5GGSB 3TBSA 5I1DA 4HWZA 1QLRB 5GSRA 3HNTL 3IXAB 4ALAL 5FGCB 1QRND 4FQQA 1C12B 4Y4HD 3DX9B 4N5EC 2HT4C 1MI5A 5CMAA 1P6FA 5DJAA 3DXAA 5LBSL 2E6PA 3MFGB 3BUTA 2H26A 4MMZC 1UM4L 4EDWH 3KYNB 1OAXH 3BJ91 1MCPL 5F9WC 1O7VA 4R4BB 4I3SH 4H8WH 1R5WB 3U0TA 1JF6A 2PO6A 4JGUA 4YDLC 1OQXA 3SJVD 1KCUH 3FT4B 3QNYA 1TJGH 2WINA 5BJTB 3OX8B 3FRPA 2DWEA 4GXUM 4EOWL 5GRYA 2EDWA 4PP1D 1UQSA 2WP3T 3WIFB 1KNOB 3I02A 1UWXK 1U8LA 2X4NB 3X12B 2ZKHL 2E7MA 1WFNA 4JG1H 1S7WA 3SKMB 4QTIH 1MWAA 4OFKA 4U1JB 5LGKA 4L3EB 4L9LA 4OZGB 3AXLA 2J6EA 2IG2H 4Z7NE 3IT8D 2VDNH 5HI3D 2P44B 4ZTPL 1KTRL 4P3DA 1OB1B 4E41E 5HI4D 2IBGA 5D7KD 4KJPC 1REIA 2E3VA 2DLEA 1E4KA 4PRBB 4OLZL 4ODWB 1A4KA 2YPKB 3C5ZB 4OZIB 3DMMD 3HFML 3SE8H 2XZQH 4JG0H 5ESAB 2JCCF 5JORA 3L3JA 4KGLA 1PLGH 5LXGH 5ISZB 1IEAA 2BNQA 4KTEL 3ABZA 2BDNL 1EEQA 5E0QA 1WAAA 5DC9B 1L7IH 5FA3B 1PVHA 3BDBA 3FRUB 4KTYA 1N2RB 5TDOB 5L2KD 1J1PH 1R24A 1V3JA 1HCFX 3GKWL 4RNRB 1Q9KA 5AD0B 3BP7A 4NQEB 4P4KC 3RVVD 4CADA 4MS8C 4DK6A 5IFAL 1AO7E 4Y89A 2JK5A 5F7UA 5CCKH 3NAAH 4PJGF 3FMGH 4Z8FH 3EFDH 1CBVL 2P5WB 4CVWA 4HS3B 4NQSA 3QQ9C 2ICEA 3DPBA 4NNYB 5HY9B 2CIIA 2NLJA 3QIWD 4XAKE 3BUYB 3UX9B 1LEIB 4OQTH 3CFKB 4LL9A 2FWOA 4AEHL 4NC0B 3SKOA 4FRWA 4JAMB 4EKXA 5HGGS 3GMLB 1JYXA 4YEEA 5EH1A 5AZ2L 3WLBA 4NO0D 3RI5K 4EN3B 4WCYH 3G6DH 1OP3K 4AT6B 1N7ML 4OD1L 3QXTA 3SDYL 1N8ZB 3TBYA 5KS9E 1FFOB 1FO0H 5FGRA 4PGDB 2L4OA 3C9NA 4OIIL 3QT2A 4L29B 3L3GB 3ULUD 1NMAL 1HN1A 3HAEH 2QTEA 4RAUB 4RMWA 4MAYC 1AH1A 3FQTB 5D6DC 3BRGC 1IGTA 4L3ED 2FH8A 4K7PH 4JRYE 4FNLL 1BFVH 3CDGB 3PWNB 2EDBA 3GUTA 3VRIB 1RZJH 2OQJA 3QULA 4KXZI 2R0ZH 1VACB 3IDYC 2YN3A 3FFCD 1CK0L 4XP1H 4XVJL 1ADQL 1ZKAA 2A0LD 5KOVC 1RIUL 3HZVB 4N0UE 2VDLH 3JTTA 4TUOB 4X7SL 5C0BD 1AO7A 1MFDH 4RQQB 1MF2H 1SVZA 1RI8A 2FJGA 3LCYA 3VE0B 3RTQC 3KLHC 3V8OA 4MB5A 1M7DA 3VFGL 1ZT1A 1EV2E 1LP9E 1UADC 2DWDA 3OG6B 4PJAB 4WW2B 3ZTNL 5DJCA 1F5WA 3KPSB 4NQDB 3Q3GB 3IVKA 5LQBH 2Y36H 4G3YL 4LLVA 4MAYB 1AC6A 2A0LC 2C4FU 3MRPB 3RNKA 4OTXL 4MJIE 3KAAA 2DQEH 1D5MA 4ZOEA 4M7LL 1N3NB 1W0VA 4GG8B 2BFVH 3BZEB 1YEJH 1N4XL 3BP6B 1AGEA 2R2HB 2VMFA 2GSIA 4JFFE 4OGYL 5L0QB 2UVFA 4PV8A 5A3IC 4Z78B 4LPXA 3SDCC 4U33A 3HC3H 4HCRA 1RVFL 3HC0A 1R5VB 5I30H 4ZOCA 1IM9A 1YQ2A 5SWZB 2QSQA 4OZIE 1I7ZB 3L5WB 4NKIL 4KDTA 4LLDA 4XNYH 3QIUC 3DYMA 3QQ4A 5E8PA 4LVNB 3BN3B 1MAML 1RZGB 3WO4B 3I6KB 3LKRB 5IJKA 4JLRA 4W6WB 2KKQA 4UOJA 2PYED 3QUML 5F1NB 1OSPH 5IEKB 4X80L 1W8NA 3TT1H 5GQBA 2Q7NA 1S8DB 3UZEA 4TUKL 2DBLH 2H2PC 4E5XB 3CFEA 2FX9H 3Q6GH 4UOW0 1FPTH 1IMHC 5E9DE 5HHNA 4NQEE 5C3TA 3I3BA 3MRNB 3MLUL 1I1AA 2OL3H 3T0XA 3CSBA 1DQML 4DKAA 1DL7H 2V7NA 2OTPA 1EMTH 2VLKE 3AGVA 1W72L 1F3RB 2R69H 5BRZA 3SDCD 1II4E 2IEPA 1IC4L 2P5WE 2LTQC 3PWPB 2FSEA 4HK0B 4PRHA 4JFDD 3BI9X 5CJBA 3OB0H 1X5AA 2BVQA 3SGKC 1J1XH 3D69A 4GRWH 5DMJB 4K3JL 5GGRA 3WS3A 1CLYL 2YK1H 3WFZA 5FKPA 1MREH 1FLTX 2QQQA 3KXFE 4PJFE 3TM6A 4APQB 2HKHL 3ZKXB 5IM7A 4GLRH 4PTTA 1QBAA 1G7LB 4ZS7L 3MNWA 3G04B 1CICC 5SWSB 5C1MB 4TNVF 2ED7A 3ARRA 3MRBA 3SE9H 3MRFB 5FUOH 1MOEA 4KKBC 4M3JA 3HHRB 3TLRA 4IRJA 2DM2A 4I77H 2FH6A 2B4CC 3DI2B 5GRXG 5H37H 2EYSA 2EIZA 3V6BR 4FP8L 4HLJA 4JO4H 2KDGA 3BW9B 2ICWA 1G9MH 3IDIB 2BVYA 1MQKH 5DRZA 1ZLUK 4PY7B 3MBEB 2IPUK 5FV2A 3DMMC 2XTJE 1JGDB 4YHYC 4OLEA 4U1MA 1J7VR 3R06A 3C5SA 1HWGB 3VFPB 3V6OA 5FM5M 1QQDA 4GXVL 4NN6B 2R23A 3VH8B 5ALCH 3DVGA 4JQXC 3DETC 3IAPA 3L3IB 2XOTA 3LKNB 3F12A 1C5DB 5FYKD 1JV5A 4N0UB 4MDIA 4QRUA 1KIPA 4UT9H 4R4FL 2HFTA 2W07A 4G80B 4ZD3H 1F58L 4JJ5B 1H3XA 1G6VK 1HEZA 3KLAB 2D7PA 4XP6H 1J0ZA 3ESVF 2ZUQC 5HHPA 5DVOA 2ZSWB 5AAWA 2ICCA 4PJAE 2Q8BL 4YXKL 3KPSE 5MEQA 4JHAH 4UOW1 2D31A 1IL1A 5IIEB 1AI1L 4OSUL 4NWUL 3HUJA 3PWVA 1G7QB 3OAZH 5FYJH 4OD2A 2WAHA 1H3VA 4O02H 5TF1H 5CUSH 1I1YA 3QXAA 5D1QB 2Q87A 4RGNB 5EU5B 3U36B 3U0WL 5ELIA 4BQ8A 2NTSP 4XCEA 1OAKH 2GSGB 5DDHA 4LKXA 4DCQA 2X44D 4KVNH 5JA9A 3Q5OA 5SWZE 3QDGD 1A1NA 2Q7YA 3OAYK 4CUCA 2XA3A 4W4OA 1KFAL 4JPWL 3D0LB 3FFDB 3NFSH 4DN4H 4PJHE 4RGMC 3U9PL 3HMWL 4NWUH 4XCFH 5E8OB 4C55A 2P46B 2ZCLH 4HJJH 2K7PA 1P9MA 4HUMB 1KGCE 4M93C 5DMIL 32C2B 4P2OC 5B39G 3UTOA 5IVXE 5E9DB 2EKSB 4V1DA 2P7TA 3V95A 4L1DA 3ZYOA 3LS4L 1BM3L 4H8WC 1NCWH 3SDXA 4R26L 3ARFA 4WHYH 4YHZL 2PYFB 4UV7L 2VITA 3C8KA 1HHGB 4WJ5B 3GMPA 2Y25A 2XYCA 1JZ3A 5EU6E 3QXDA 1N6QH 3RX8A 4NC2B 3L1OL 4NO3B 3OKMB 4QRRE 5CIPB 1U3ZA 2DTMH 1N5YL 3KXFB 1HHIB 3EO0A 1UM6L 2MJWA 3MREA 4CN6A 1TXKA 1AE6H 1S7XB 4BH7B 2IADB 1TLKA 4PUBH 3MRLB 1T66C 4FQLL 5IQ9A 3ULUE 1K9TA 2VDML 2XFXB 1QYGH 2VE6A 1NLBL 4JVUA 5ACMA 5CJOL 4MQXD 4CVZA 3U9UA 2VDLL 4PJFA 3RUGE 1FE8H 1AIFA 4YH6A 2EDJA 4MX7B 4XVJH 3SKNB 3N06B 4QRRA 3UTQA 1OW0A 1OVZA 4D9QD 3GRWL 3CH1B 1ZWIA 3ROOA 4TSAL 3U7AA 4K3GA 3AAZB 4G8EB 4PGBA 1DLFL 2X4QA 2HFFB 2C3VA 1N5AA 4NJAL 1ZVSB 5KANG 3WIHH 5KSBE 1K4DA 3NABH 4HBQA 3QUYD 4M1DH 5C07D 2ARJQ 1UH3A 2DQTH 3HZKB 4NKQB 1MH5A 1ZT7B 1T89C 3CSGA 3V0WL 2FO4A 4WU7A 1KYOK 2HLAA 3IDUA 2BSED 3CVIL 2Y06H 1Q9LB 4WCYL 3AREB 1HH6A 3TPUA 5C0CB 1JK8B 5DEFB 1GGBH 3QUMB 3R8BB 1ZTXL 4CL7A 4RGND 1XGRA 4WTXA 3DX8B 2BOBA 4D94A 4NQCB 1ZT4B 3GFUA 1RULH 3VFUB 3MCLL 4BM7A 1P7QA 2WUCL 2SEBB 2X05A 4ZFGL 1GJIA 1FYTB 1IGFL 2I07B 1D7FA 1I3RA 2GQHA 2VLJB 4PGCB 5DR5H 3NGBB 5I1CL 3LD8B 4M6NL 4ELMF 2X4UA 3C5JB 4PP2A 5BS0D 3GJFA 1RZ7L 3L6FB 1FVDB 1DBAL 3C6LD 4NWTL 5KJRH 2V5RA 1V8HA 4BSWA 3DYPA 4RFOL 1Q94B 4KK8C 3FOMA 2V17H 4C56B 4J3SA 3ULVD 5JHDB 1PG7W 4M7LH 3W0WA 2WK2A 3LSOB 4F15C 5D6CA 2PXYA 4YHKL 2PYEE 1UG9A 3ROLB 2K3TA 3AB0B 3VXQA 3FQRA 2VOTA 3SO3B 4JN2B 5D2LB 2DQHL 5IB4B 1IC7L 4IOFD 3MBED 1Q0XL 1RZIB 3KWWA 4UBDD 3UAJC 4X7SH 3OL2A 5CJ8A 3BH8B 5FOBA 2G60L 2NY4B 1UZ8B 5EIVA 1KN4H 4JFZL 1B4JL 1KEMH 2A77L 3MLPA 3CZFA 5GIRA 1X5FA 1S9XA 3QHZL 4M4RA 3QRFM 1OAQL 4PRNB 5DRNB 3O11A 4QGTA 3OKOB 4LPUA 3L3OA 4RX4A 3WHXB 3ZLQC 4Z7UF 3WFHB 5C0GA 2JB5H 1K6QL 1FVEA 5LAXA 3INUL 3P73A 5FKAB 3LMJH 4NRXB 4Q58C 2FZ3B 5IMKA 4HF5H 3FB8B 3RUGB 1G7HB 2MQ0A 5HYJD 1U8NA 1JI2A 4EDWL 5CBAA 4FXKB 3HPLA 4UINL 1IC5H 2LU3A 4OZFH 3GMRA 4LNRA 3UYRL 3EHBD 5D93B 1EO8L 3MLRL 2HTKC 2EZ0C 2X4RB 2L0DA 1W8OA 4QHKJ 3X3FH 3O0RL 3UTSD 2C4XA 4U1HB 5KSBB 2XT1B 5J1SC 1A7NH 3REVA 4F9PA 2XG5A 4DGIH 3O6KH 2I60H 3T1WA 1W0YT 4PJEB 3GBNL 3MUY1 5DK0A 1E6JL 3BP5B 1Q9WB 3UDWC 2CKBH 3FOLB 4JDZB 4B7LA 4Q9RH 1G9MC 3GSUB 1L6ZA 3QIBC 3SCMB 4XPGL 5BVJB 2A6IB 4UIKL 4WUUD 3VXUE 4ZS6C 5C0CE 2ITDA 3NA9H 1R0AH 5DYOA 2UUDK 3ZE2F 4JHWL 5F7EL 2EDKA 3DUUB 2VISA 1A7RH 1QBLL 3PWUB 1MY7A 4NQCE 1ZHNA 1L6XA 2QADC 4YHMH 3G5YA 3JV6B 3CVHB 1R6VA 1DQTA 3PABB 4N8VB 4KQ4H 5I66A 5IFJA 1JWSA 1K5NB 3E1F1 2R0WL 1BECA 3HR6A 1EFXB 4CNIB 4P57A 1FORH 3RVUD 5F6IB 4OGXH 2R1WB 4LP5A 2QQKH 3IJYA 3IDNA 4BSVB 4F57L 2R8SH 1RZKL 3RWJB 1LEGB 2CDEA 3WDIA 5CD3B 1JGEB 2BMKB 2HWZL 3SDDB 3UROR 4PJXA 5JQ6H 3VXSE 1KIRA 5IR1A 1DLHA 1BQUA 4XVUD 4LCUA 4YXHL 1JTPA 1RD6A 1D5ZA 2XTLA 1CZ8H 3DX6B 5T3ZE 1T83C 1IGCH 1AD9A 5IVXF 5J11B 2LTQB 4JEGB 2ZPKH 4PJ9D 5A2KH 1UCBL 4D9LH 3DO3A 5L2KE 4PJBA 4HIXL 4QTIL 2PYEB 4ZO8A 4PJBE 1MCWM 3KS0J 5F7FA 1TIUA 4PYGA 2IQ9L 4QKXB 3JWOC 4K23H 3RPKA 4UV4H 3WFBH 3T3PF 2A2QT 2J88H 4KTDH 1S7UB 4XBGB 3FO1B 5GSVA 4AL8L 4AMKH 4QO1A 4QT5B 1VPOH 2IAND 4L8DA 4U6XB 1X5LA 5E2JA 5KSAD 5HVGB 2IGFL 1MCPH 2J8UE 4RCAA 3FO2B 3RRQA 4L3CB 2V9QA 5SX4H 1FNHA 3O3EB 4LGSB 5IMOA 2Y07H 4HZAA 4P46A 1TVHB 2C7UA 2X10A 3DXAD 5GJTL 1AC0A 3SPVA 2R29H 5E6YA 3BEWA 3IXTA 5FUCE 4QRPA 4IMKC 4GH7B 2WW8A 3I75A 3VGDA 5GS0L 3MV7B 3LS5H 1IM3B 2W0FB 1VFAB 4QF1A 4WFEE 4ZAKB 1CFNA 4PREA 3M07A 2NYYC 1GZQB 1QVOA 3UC0L 3QDHA 1H3TA 1OAUL 4HXAH 2ZCHH 4UQ3A 3TJHD 5F88A 3VMOA 3DWTA 3S37X 1XF2B 4YPJA 1HXYB 4N68A 3ZYJA 2E9IA 1R3HB 3FO9A 4BYHA 4WNQA 2J5LC 5J1AA 4D8PB 2MSPA 3P0YH 2GTWB 4UV4L 3WFBL 4F37K 2AQ2A 3FJTA 4Z7VB 5D1QC 2NNAA 1IAOA 4UU9A 1D6EB 4Z7WF 1U3JA 3EO9L 4PJEE 4E41D 4UTAH 4XX1G 1AGCA 1YMHB 4XH2A 3IS1X 2AJVL 5IJKC 1GRWA 1EBAA 2XN9B 4MDJA 4ZQKA 3ULUL 1HYSD 1CXFA 1HZHH 1UJ3A 1YA5A 5IHZB 1OTTC 4YNYA 1JHKH 3FB7A 1T80A 1A3RL 4WHDA 4CJ0A 5EIQA 5BO1H 3PP3K 4ELMA 3HI1A 5IBUG 5FO9A 4EZMA 4XH2B 4GRLA 3ECBA 4CDGC 3HRZA 5AG9A 35C8H 3C8DA 1F3JA 1WZMA 2Q6WB 3O2DL 3E3QC 4YHPA 4GAGH 4M48L 4X7FC 4LHUD 4MQTB 4ZYKA 3IFPA 3B5GA 1A14H 3EYQC 2X1XR 2BNUA 3HCVA 3UTSB 2UWEF 1MJJA 3H42H 4OZHA 2I27N 2OP4H 1HDMA 3D3VB 4HS6A 3W39B 3UO1L 3H9SE 4UNVA 5ESQA 1LEKA 2ZCHL 5T1DH 3GBML 4XBPB 3RWDA 4Z7OF 5KVMC 1I8IA 4N0CD 3LQAH 3F7VB 1FO0A 3ZE0F 5I16A 4QF1B 4HQQL 1G9NL 3U1SH 1J12A 5GJSL 3V79C 4LEOA 1ZVHA 3DVNB 4RAVA 3H0TA 1YNTB 5AWNH 3P30L 4BFIA 1GCFA 1K8IB 4DGIL 4HT1L 5E56A 3P9MB 1FJ1B 4LCWB 1WZ1L 4TTDD 1OM3L 4HGWA 3IKCA 1PJ9A 1I8KA 3VA6A 3PXJA 4OCLC 4TSCL 1HWHB 1A6UH 1UEYA 3GMQB 2O5YH 3TPKA 1A3QA 2VLMD 1H5BC 1T4KB 5GJTH 4JFEA 1EDQA 2YWYA 1KXQE 4FFYL 4MWFA 5HGDB 3OGCA 2GJJA 1KYOJ 2AKRB 4HF5L 5D72L 3EGSA 2GI7A 4LLWB 4GUPA 1LMKA 3QH3B 4QOKE 4YDJB 2UYLA 5JW4N 1DUYA 5T33L 2FL5A 3QCUL 4PJ5B 4ZUTA 5DJ2B 3B2VL 3FONB 3UJJL 5M95B 4KJYA 4HDIB 4HUWB 4QHLB 2J8UA 4YBHA 1H8SA 5ENWB 2CDGA 2YKLL 3L7EA 2PTTB 2VL5A 4QRTA 4L8SC 5DHXB 3C2AH 3VRLF 4JJHA 2MHAB 3HPJB 4P23B 4JDVB 1EEZB 2GT9B 2OTWA 3NFPB 3QXWA 4JFZH 4NHUA 4AQOA 4F58L 4IOIA 2HJLB 3ARBA 4ODVL 5GRZA 4ZDHA 4NRZA 1EUUA 1VADA 1QFUL 2ADIB 3P3YA 4L4TA 2YD1A 3MRGB 3RVXC 3GMNA 3S35X 2VWEC 4XPTL 4H20L 4DJMA 1CGUA 1F42A 2GTZB 2AJVH 2AJXH 2APBA 5TE4H 1JNHA 4KGJA 2XQBL 3NIGE 4N8VA 3T0EB 1U2CA 4LRIA 1TVBA 3ZSTA 5ID1A 3RGVA 4OCSL 4X0KB 3EZ8A 4X6CF 1Z5LA 5CEYB 2FIRT 3H9ZA 3WCYA 3BWAA 2BSRA 4GJTB 4BK4A 1BVKA 5FEBA 5I0ZA 4K94C 3DIFB 2BNRD 4XI5C 2FCBA 5IK3B 4O2EA 1I9JH 1DQJB 2FX7L 1XCTA 4P23C 1ZE3C 4PRIB 4Q97A 3ZYIA 3F58H 2F54E 4PBVC 1C08B 3UC0H 5IB2B 5JOPE 3NIDE 3KPLB 4KK8D 1SM3L 4X98B 4KMQA 5KJRL 4G43B 4NNXB 1IAKA 5DEGA 4QOKA 5TPWH 3TH2T 1V7MH 3S4SA 3QR2A 3S88L 3GSNB 3FN0L 1IGFH 1LO5A 3PDOB 4S1DC 4XXCC 4JY5H 1E4XI 1ZANH 1SYSB 2V7HA 3CU1A 3MCLH 4HHAB 1UYWL 2WNGA 1RJLB 3UTSE 4XPAH 4JFHD 1FRGH 1X5HA 4LPYA 4W81A 1WT5A 1ZTXH 4O2FA 1IC5L 3D3VE 2ATPB 3GJEB 3FB8A 4OLVL 3RUGA 5JIHA 4PRPB 1HHJA 1KJMA 2DQGH 1C1EH 3QJFA 2JJTA 3T3PE 3P4OB 3RA7L 1I9RL 1T3FA 4YDLB 2FBJL 5TGBB 3ZE1E 2EDNA 3DV4A 3ULVH 4YR6A 1VPOL 3TZVD 2J8HA 4AMKL 1HQ4A 3U2SA 5DGQA 2X40A 1CS6A 1I8MB 3QUYA 2A74A 4JFPA 5KVDL 3L7FB 4NQED 3V5HB 4LLYB 5L2JB 3QEUB 5GISL 1OAQH 4M61A 4Y19A 2F53A 4XRCB 3BH9B 3ILQC 1NC2B 5D5MB 2FYYA 4HK3N 2Q86B 4OLXL 4XCYA 5E5UB 5F96H 1NC2A 3B4NA 3GNMH 4XMKL 2JJUA 2GFBA 3REWB 1F2QA 2BX5A 5E8EA 5FK9B 1A9BB 1OGTB 4GSDH 3FQUA 2EDTA 5IEHA 4L1HA 2CK2A 1F13A 5D4QA 2XWTB 2VN7A 3LZFH 2PR4H 3NCBB 5FAAA 1IC7H 5F1SA 3PGCA 5F9JA 3EFFA 4YLQT 4LLUA 4X6BB 5CSZA 2CR3A 3GHBH 3IJHB 2Y23A 1VCAA 4PJ7A 5C92A 2W92A 5LGJB 2AK4E 3N1GC 3W0WD 1P1ZB 3MROA 4Q9CA 2VLRD 4NP4H 2OK0L 3OJMB 1QBLH 1N6QL 5I9QB 1Q94A 4YUEH 1MHHB 1YC8A 2E6QA 3MXWH 4UIKH 3TCLB 1XT5A 1NEUA 4KKLC 1XGQA 5IOPB 4NN5B 2HRPH 2F54A 4QYOB 1GZPA 3MRJA 3VFRA 3TBTA 2MCPH 4HUXB 4MNGB 2DDQL 4Y4KA 3ARDA 1VFUA 1BFOB 1NGWA 1ZVYA 5ANMB 5TQ2L 1P7QD 1T5XB 2OI9C 3MXVL 3X11B 1EFQA 2B1HL 4X8JA 3U9PH 2KZ1B 2F8OA 1DBKL 1FCGA 1JK8A 1IAII 3QHFH 2O5XH 2UZYB 1S7SB 4K7PY 5DZOA 4EI6A 5F97E 5K59E 2ZUSA 4CU6A 4MCZA 1DUZA 1IEBB 2K1MA 2VABB 4PRIE 4XNUH 1SJEA 1S9KC 2C3GA 2F54B 4KVNL 1BVZA 4UI2A 4YPGA 4PRDB 1J10A 3M1BB 4DKFL 4HBCH 2OM5A 4LK4A 2YUXA 3JV4B 5HBBA 3HZKA 4WTZA 2UWEE 1K6QH 3DETD 4U6YA 4YC2C 5ADOL 1VEOA 4QHNA 3SHSA 4HZLB 4YDVB 1ZVSA 5CP7A 4RX4D 4Z5RB 1NCNA 4KJQC 1A2YA 3RWCA 1FVCB 3UCRA 5CEZL 4MNQA 5F1IB 5L8LB 5GXBB 5J13C 3CZJA 3MC0A 1LK2B 5A3ID 4K9EL 3FT3A 4LSQH 4ONHB 4XP6L 5C0NC 3T65B 3NCCB 3KNBB 2VL5B 3PQYD 1BBJB 4QRTB 5IV2A 1B4JH 2EEAA 4P5TD 4LCIL 2BSTA 1N6VA 1LHZA 2GJZB 2A73B 1OTTD 2CPCA 4MJ5A 5B38A 2XWBB 3OHXA 5I73C 1NLBH 2Z31C 1I7RA 1NBQA 5L88H 3ULVF 5IQ9B 3CK0H 4LSUH 1MFBH 1TJIH 1ORSB 4QRQA 1CYGA 5DMGD 2IPUG 4ZUTB 3B6SB 4QY8A 4NUJB 2AAVA 3QI9B 2YRZA 5JTWA 3NOIA 1AE6L 1OAZH 2EYRA 4LASH 3S8WA 5IVZA 4LLYA 4Y5YA 2Q20A 3OKDB 1XF5B 3EYUH 5CJQL 5HJ3A 4XNZB 5DO2D 4LNVA 5T1KA 5F3HA 3VI4E 2AXJA 1WTLA 2NY2D 1BREA 2FGWL 3QJHA 4QLRA 3SDXB 2VZTA 1S3KH 2DIAA 4HMEA 4HGWB 5GRVK 1EVTC 2X4SA 5F71A 3CX2A 1DBAH 3C6LA 1T2QL 2IFFH 5H94A 2VSCA 32C2A 1RIHL 2GKIA 4A6YH 4ZNCD 3NFNB 3DX7A 4P4RB 4IS6A 3MJ8A 4P9HH 2B0SH 1KTKE 3BQUA 4PLOB 5EFIB 5I0DA 3F7VA 1F45A 1PX4A 3PDOA 4H26B 5DMYA 2AK4B 4U1KB 1AGBA 1WFTA 4PR5A 4OUUA 5C08D 3SGDI 3RDTC 5HHVL 3MLTA 3TV3L 1FZOA 3SDAD 4ODHH 1NGPH 5DTFB 4N9GA 4BKLA 3NIGF 3MRMB 1UXSB 1U8IB 4NGHH 3ARYA 1QFWI 4Z76A 4WU5A 5D7SL 3S7GA 3KXFD 2FLRT 3VXME 3X14B 2I25N 4J3WA 4WUUB 2VXUL 4IOSD 4L8CA 3AMLA 5DHYB 2EC8A 3VI3E 1TCRB 5HHVH 4OQ1A 3HUJB 3C60A 3TV3H 3WO3B 2A6DA 4MNGE 2GCYA 1T1YB 2DBLL 1MCNA 1BFSA 3MMEA 4F7CB 1EZVX 1JRHI 3PHSA 4PG2A 2D4DA 3GSOB 2DQJH 4EVNB 4P3CL 3FB5A 2MNUA 5CEYA 4P9HL 4U1GB 4XMLL 4NN7B 5B38G 3K3QA 2A1WH 3PL6A 4PLKD 4JJ5A 5DQ9A 5LG1A 4KHTL 5DJ0A 12E8L 2Z35A 5J56B 1G6RH 2GTZA 4NKIH 3MR9A 1AQDB 4ZD3L 3RDTB 3WEXA 2YPVH 1SJHB 3T77B 4GMSH 3ZYZA 1S3KL 3WXWH 4QHMB 4LCCC 5C0FA 3O9WA 3BX7C 1A6VL 4FQXD 5C0IB 4HMCA 5E2VL 4D9QE 4Q2ZB 1SEQL 4WI7A 5EO9B 4N1HB 3HNVH 4P2OB 3T0BA 5BXFB 3DHJA 1F90L 3GSVB 1PYWB 5F6HI 1UM6H 1FNSL 2QADD 3MLTB 4YFEA 3PIQB 1YEFH 3G5ZB 1MCIA 2Z8SA 3LN4B 1A0QL 3P4NB 5CLTA 5CZXD 3WFDH 1SMOA 4ZUVA 4PJ5A 5CJXC 5EIIA 1CDHA 3WJLA 2H9GA 4IRZH 3MJ8B 1QZ1A 4HKZA 7FABH 3MR9B 1NEZG 3EGSB 3ARFD 4RBPK 3BHBA 3OQ3B 3SCMD 4QHKI 2RFXA 4M7JH 3GM8A 4YGAB 5F7NC 5B22A 2IAMD 5JPMB 1YPZA 4GKOA 5TQ0L 3RZCD 3RL2B 3QJHB 1ORQA 4XVTL 3OKEA 4F7TB 2EZ0D 2NW2A 3RVTD 2DQFA 3MGOA 3DMMB 1QSZA 1B0RB 1V3KA 2AJUH 3AC0A 5DQDH 4PRHD 2VXUH 4RFNC 3GIVA 3OAZK 3SDXE 2APTA 3MV9D 1EMTL 1J0JA 1J0HA 1MAJA 3K4DA 4BZ2H 1INQA 5HVHC 1FO0B 2DAVA 2DQUL 5EU4B 3U0WH 2CUMA 5DD1L 1FPTL 3OHXB 4FMFA 1IT9H 2DICA 3QHFL 2O61A 5B4MD 2X2YA 2CMRL 1EHAA 5EUKB 1IEHA 3J8F7 3NZHL 4JO1H 3IFPB 5IMMB 1FAIH 1CT8B 1UA6H 3ARDD 3VGGA 5BVPL 4LPCA 4QGYA 5D7JB 4Q74A 3VGFA 1Z0MA 2IFFL 3MACH 2VERN 4LAJH 3H9SA 5HHOA 5JIIA 3ECBB 1RVFH 1OL0A 4LP4A 2PW1B 1UFUA 5F3HB 4OCMC 5GGQL 4H25B 3CGTA 5TDNA 3UAJD 4OGYH 3ES6B 2NX5E 4WUUE 5F3BA 3C08H 2NTFA 3CFJB 2EE9A 4JB9H 2QHLA 2RBLA 5IF0A 5E08H 4GKNA 1F4WL 5FF6B 4O4YH 2DWDB 4PJAA 2VXVH 4RMQA 4LASL 1WBZA 4YO0A 5DRWA 1J8HE 1OAZL 5ACLA 4JPVH 2L7JA 2J8OA 4XMPH 2A6IA 3PGDA 4NKOB 3D85A 5EUOB 4L8CB 3CK0L 4LSUL 1IKNA 1PD6A 4KRPB 2KL6A 1E0OB 1F11B 5C0BA 4M1GH 4KRMB 3W11C 4APQC 5JLZB 5I74C 4G8FB 1U91B 5BV7L 4ZPVA 2DQDH 5T5NF 2WIIA 5CILH 4FQIL 2Y72A 5T1MA 2QBWA 3ZSSA 4F7PB 4QYOA 3PP4L 2DL9A 4NZTH 4WDIA 3T8XB 2OX5A 3TH3T 1PX3A 1TQCC 2F53D 3B5HA 3LEXB 1A2YB 3RWCB 1EGJH 1MHHA 3WBDA 1FZKB 5DS8A 4ZXBA 3S35H 4PLJD 4NZRH 5CBEA 3TEUA 2ZOLB 4IRJC 1CD9B 1QKZH 5JMRA 4DEPB 3HN3A 3HE6D 5IB3A 5HHXH 4NBZB 1IC4H 1FVEB 1IFHL 4HBCL 1IGYB 2GAZA 4MCZB 1JF1A 3CSYA 2DQGL 2D3VA 3KJ4B 5D7IA 5DSCA 2OL3L 2JLLA 2B4CL 4NO0A 1JUFB 1MHPH 4O5LL 1IQDB 2JJWA 3O2WL 2H1PH 2VNCA 1S9WA 1ZLVK 1ERNA 3GMMB 2HT4D 2J3SA 2Q76A 3IDJA 2WWMC 4QT5A 3VA2C 2OZ4H 3HZYB 3O6FA 3OJDA 3B9KB 2VUYA 2R2BA 1JPSH 4DKDC 3IDXL 2DDQH 4O9HH 4Y4KD 3WSQL 4XRCA 4YHLH 4U1LA 4KQ3H 3U79A 3ALXA 3MLSL 5J3HD 4P5TB 5JDSB 2HRPL 4G42B 1MCOL 4R2GB 5DJXB 4IEFB 1XMWA 1XIWD 3F58L 5DJDA 1FLRH 2E8ZA 4GRMB 1IGJB 1YJDC 3CFCH 5IB1B 1MPAL 1ZHKB 4LARL 5E00B 2OI9B 2ILLA 1MFEL 1MRFH 4M6OH 3H3PH 3HB3C 4WFED 1XAUA 4KDTC 5FOJA 4IIQC 3C87A 2BY2A 2F74A 4EDXA 3JV4A 1DEEA 5FCUL 4Z18A 5DFVD 2ED8A 3NTCL 3IFLL 5C7XL 4OLZH 1KLGB 3I6LE 1SJEB 4P3DB 4XC3L 5BMFH 4UT6H 4PGCA 2NX5B 3E2HB 4YJZL 4ZSOE 1LNUB 1P7QB 3D9AH 4OJFL 4U05A 5JPNA 5SX4I