1T6VN

Crystal structure analysis of the nurse shark new antigen receptor (nar) variable domain in complex with lysozyme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
112
structure length
112
Chain Sequence
RVDQTPRSVTKETGESLTINCVLRDASYALGSTCWYRKKSGEGNEESISKGGRYVETVNSGSKSFSLRINDLTVEDGGTYRCGLGVAGGYCDYALCSSRYAECGDGTAVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Lysozyme C
publication title Crystal structure of a shark single-domain antibody V region in complex with lysozyme.
pubmed doi rcsb
source organism Ginglymostoma cirratum
total genus 33
structure length 112
sequence length 112
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6vN00
1Y0LA 3HLAA 1VGKB 3O2DH 5FYLD 3T3MF 2VOTA 5IJVB 4PJ5E 4XZUA 1MAKA 1I9IL 4P9MH 5JNYA 3DX9A 4UV7H 2MKWA 1AKJD 3Q6FA 1TZGL 1UGNA 1C5DB 5F6IC 1IGML 4WUKL 4XBEH 5FO9B 1HH9A 1EAJA 3MRCB 3EDKA 1X4YA 2B4CC 2NX5D 5FXCH 1CXIA 1U93A 1EO8L 3MLTB 4PRHE 3D39A 4U1SA 3HPLA 5ISZD 2ICWA 2F19L 4MB4A 5C8JA 2NY6C 3PQYE 4M7ZB 3KHQA 3BRDA 1EFQA 1I7UB 2GCYB 1TENA 4YBLC 2H26B 4Z7NF 2DD8L 4MZ2A 4Y4FC 3TJHD 1E4KC 4RFNB 2X4OA 3QJFB 2DQFA 3E6FA 4NSKB 4MNQE 4BSWA 1RULL 4NZTL 1MF2L 2I07A 2ADGA 4HH9A 3NA9H 4NZJA 3SEPA 3VE0B 1AC6A 5SV3A 1P7KA 4MNQB 3HC0B 4WDIA 1XF4A 3WXVL 4G8IB 3R0NA 3I3BA 4TUJB 1KCVH 2A2QT 3WO4C 4MCYA 4JREB 3RVWC 1TVBB 1S7SA 4IEFB 4X9BA 5L7XH 1KPVA 5KSBB 5EFIB 3SJVE 1RJYA 4F58H 3DROA 1G0DA 2YUXA 1OAZH 3I6GA 1OF2A 2P7TB 4HXBL 5L88H 3OXSB 2IAMB 2HKHH 3GSRB 25C8L 4N9GA 3NH7L 5D6CA 1AXSB 3MX0A 5IVXF 4AG4H 3CLEH 2VNCA 2HWZH 2JCCE 3BXNB 5L8JB 1BIIB 2CR3A 4CBPA 1G9NC 1KN4L 4NZRL 4UIMA 3PV6A 1CS6A 4LCYB 4U1LA 5FB8B 1F6AA 4ZTOH 5GXBB 5IW1A 2HFTA 3O6FB 3VRIB 2YBRA 5IB4A 2GEEA 4Z7WE 1ORQB 4A6YA 2VDLH 4KDTC 5FFLA 2D7TL 2DIJA 3UPAA 1BD2B 1BBDH 3MNVB 2YRZA 1IAII 2PR4L 4UTBH 5E94B 12E8H 5KW9H 4ZPTA 1I8MA 2IQAB 2YPVL 2HJLA 4M7KL 2BVOA 1WC7B 2CRZA 5T33L 4KKLD 4GQ9H 4F33A 3NBNA 3K2UH 1JGUL 3A6CL 3DRQA 2GKIA 5FM8A 3BMVA 4R7DA 3IXAA 1DQJB 1NMBL 4IMLA 3EYQC 5AZEH 4QRUB 3T0AA 1XZ0A 5KG9B 1OP5K 1A9EA 3GSVA 4M7ZC 4HGWA 1NCWH 3UTSD 2HT2D 3BZ4A 4I0PB 4NFBA 2R56H 3B6SA 3IAQA 1UH4A 2CDEA 3TIDA 4OZHF 1WAAA 2JELH 3RDTD 2W0PA 1ED3A 1J5OL 5IROC 4HMCA 4JANA 1I85A 4RFNC 2HT3D 3L1OH 1IJ9A 4E5XB 1OY3B 4Z78B 4MGXA 3K3QA 2D31A 3HPJB 2HH0L 4JFYB 1KSRA 3OKEB 3GUTB 2RR3A 4YDVB 4YEEA 1ZA6A 3MRPB 2VDOH 1S9YB 1QVOA 4PLKC 1IC7H 1FFOB 5DJDB 3Q3GB 1U95A 2NR6D 4JREC 3K7UA 3L7FA 2ADFH 4JO2H 5F88A 2QBWA 4K2UL 3U0WL 3T2OA 3VWKB 4YDLB 4R4ND 1J88A 1OLLA 4BELD 4XB8A 4POUB 1CXEA 4XNXL 4R4FH 2XWJA 1A6VL 1IM3B 3LD8B 5HVFB 4XVJL 3RL2A 1W2KT 3DO3A 2WBWB 3EYFB 4WO4D 5FA4A 1JTPA 2IAMC 4FXGA 4KI5F 2YA1A 2ILLA 3N9GH 4LCUA 3TBWB 1CR9H 4I9WE 1R3LB 1KJ3L 5HHPA 3WXWL 1M7IA 4OLZH 4PJHB 2JB5H 2MPAH 4XTRC 2HTKC 3QIUB 1J1OL 3I3DA 4U6HA 4XPTL 1I1YB 4H5SB 3VI3E 3C9NB 4NO3A 2OL3H 3MXVH 4HWZA 3CDCA 3O6FC 2CO7B 3UDWA 4NQSB 3SDYH 4ODSL 4U1GB 4Z7VA 1SVZA 5HHOB 2HJFA 4X9GA 5DO2D 1Q9KB 3LMJL 3MLZH 2XFXA 2PW2B 3WFBH 3T0EB 4MSWA 2IH3B 3O0RH 5IGXL 4Q6IB 5IT2H 3QJHA 4TUOB 1LP9E 4PJ9A 2H32H 1UC6A 1A3QA 1OAQH 1R3HB 3MROA 5EO9A 4LAJH 1PY4A 3BO8B 4ZSOB 5EUKB 3MRMA 3HE6D 5IEKA 1MCOL 5JQHC 4JB9H 5GGSA 2FEEI 3S4SG 4I0PC 4Z0BH 4N5UA 3HI1B 3BHBB 3FQRB 1I3GL 2W91A 1N0XH 5CP3H 2XXCB 3NZ8A 4DWHA 5J6GB 1OTTD 3L5WA 4G8EA 4JFOB 4DOHB 4XPHH 1UQSB 4BK4A 4YNYB 3K1DA 3VWJD 2DF3A 1RHHA 5CD5C 1Q0XL 3NCEB 4H1LG 2R29H 2YEZB 5ALCH 2ARWA 5I18H 5E1AA 2R1WA 5LG1A 3ZT6A 1LHZA 3BN9C 1S7XB 3TNMA 2XPGA 4CMMB 3EJZC 2DTML 5F44A 2Q8AL 1FNEA 4Y4HD 4F37K 2DWDA 2GHWB 2AJXH 4JFPA 3X12A 3ILQD 1T2QH 1WLHA 4MDJA 3CAFA 4TSAH 3VWKC 4YDLC 5IQ9B 1PBYA 4OQTL 1MHPH 3HA0A 1KTKE 4IRJA 1CU4L 4D0DB 2ATKB 2DQDH 4ZO9A 1AP2A 4JRXD 3AUVA 1N5AA 3PXHA 3HTLX 4IRZH 1EAPA 2M8XA 1FYTB 2OBGA 4LOUD 4ODXA 5I0ZA 3GIVA 5EU7C 1R6VA 3UJJH 4HAFA 1QLEH 1XH3B 4RGMB 3QIUC 1VFMA 3KYKH 2Z91A 4RFOH 4PY8I 1QOKA 3PDOB 3IETA 4OAWA 5JDJA 2WUCH 5CIPA 3RWEB 3QO0A 5DJ6B 5C07D 1K4CB 3MFFA 1DQMH 5J0BA 1N5YH 1T3FB 4MA3B 4U1GC 3UTTA 3LQAC 4ETQA 3RVXD 1MLCB 4X4XA 3L7EA 1QBAA 3VGAB 1MIEH 3JVGA 2R0ZL 4M5ZH 3IS1X 3RBGA 4FZEH 3T0EC 3RWFA 2AJYH 4GH7B 4Q6IC 1H8SA 1GZQA 3VFTA 4FQLH 1F45A 1QLFA 1AGDB 3EKCA 3BD3A 1UXSA 4HG4K 5AAWA 5HHXH 3KNBA 3C6SB 5GSVA 1NGZB 2DQJL 4XNZB 3RY6C 3T2QA 3DX6A 1AO7E 1RU9H 1CLOH 2VXUH 1MREL 2MSPA 3WFDL 3X3GL 1KLUA 3FHAA 5B39A 4X6CE 3NZHL 1P9MC 4UILL 4YHIB 1YNKH 2FZ3B 4ONGH 4QCIA 4OBSA 1GAFL 4U2YA 3E6HB 3JTTB 4N9OB 3K4ZA 3BPLB 3EJYC 4XGZB 4HUVA 2I9TB 5IKCB 4UTAH 1I8LC 4KK5C 1DE4B 2VUOA 5INCB 1T1WB 4OZFH 3BEVA 3CGTA 3KPRE 8FABB 3WFHA 5F9DC 4RWYH 4FQQB 2VAAB 4K9EL 4EDXB 3B3IB 4JGUA 3D2UD 5E4EB 1YJDH 1B4JH 3BP5A 5F9JA 1BVKA 4OCLC 5IFJB 1WEJL 3B9DA 4GAYA 4WI9A 3FKUS 3VFMA 3QCUL 5DVOA 4MWFB 2D03L 2XY1A 3DX8A 2JJSA 4QT5B 4HHAB 1X5IA 2ICWJ 3U7AA 3UXFA 5EBWA 2I27N 3A6BH 3QZWB 3GKWL 1CZ8H 4O58L 3S3JA 2OS7A 2EXWC 4JFDB 1MWAB 5AUMA 4U7MA 1BJ1H 1N3NA 1GGCL 1BHGA 5D4QA 5C0CA 2SEBB 3H8NA 1Z9SA 2DI8A 2ICWI 3PHOA 4JN2B 2HVKB 4X98A 1JTTA 2J2ZA 4XNMA 4J12A 2BXZA 5HYEA 1BOGA 1F13A 1DUZB 3VW3H 1FE8L 1T1YB 1KTLA 4RGMC 2NY5H 4PP1C 3SOBH 2WK2A 5JHDD 5A3IC 1SMOA 4R0LA 1LO4H 3DV4B 3IAGC 1TNMA 3MV9B 1FVEA 3JXAA 4O4YH 2AXGB 1CL7L 4LCCC 3E1F1 1S7QB 4OCYH 1UKTA 3MRDB 4H26A 5HSFA 1G9ML 3CSGA 1OAKH 3O11B 3O9WD 3RWHA 4YIQB 4HC1A 1XF5A 4LP5A 4MCZB 1FL3A 3KPNB 3VMPA 3GSNA 5SWSA 1NFIB 4XNZC 4WI4A 5DJ2A 1CGTA 4JLRA 3LB6D 4LAQL 2AEQH 3BKYL 4NQCA 3I6KB 1UXWA 5HJ3B 3DYPA 4YBQD 3Q5OA 4Y5VB 1KNOB 1DVFD 2ICEA 4L4TE 5BMFL 3SDCD 4KTYA 3UO1H 3MLSH 4JQIL 3GJEB 3BPLC 4K71B 1BWWA 2AJ3B 4ELMB 4Q74A 1MCKA 5F7HA 1N4XL 1UJ3B 4NHCL 2VR4A 4M03A 5BS0D 2EH7L 5TDOB 2J6EH 2PTUA 1VADB 2FGWL 1PYWB 2BVYA 3IS0X 4LEXL 4PTTA 5HGHB 1I9RH 4X9HA 5MENA 1A6ZB 5E4EC 3VXRD 2GT9A 3QDJA 1B3JA 5FOBA 2A0LD 2DDQL 4BUGA 3QXVA 4WEBH 3PWPD 4PJIA 3T08A 4AH2B 2PNDA 1KXVC 5GRWA 2VDKH 3BZDA 3EDFA 3H9SB 4LLAA 5D6DA 5IB3A 1NCCH 5HHQB 3BZFA 2R0LL 1BJMA 3VXUD 5EG6C 2D9CA 1I3VA 1SYVA 1MCLA 1FZMA 1M7DB 2D2OA 3KPSD 4K3JH 1ERNA 3IDNB 5JR1H 3DX7A 4NBXB 1XGYH 2V2WB 1RK0A 5KS9E 5MEPB 3IT8D 3BMWA 3NIFE 5BXFB 4YDJB 1L9MA 1YDPB 3TFKC 4EZMA 2Y6SC 5ACZB 1NFDE 2ADJA 4P2QD 4NDMA 1KULA 5DC4B 5T3XD 1QSEE 3FCTA 4XPGL 1V3LA 1JF5A 5F7KC 3FFCA 1MFAL 4U6XA 4PRIE 1ES0A 4ZFFB 3MOBL 3QFJD 3MV7A 5CKGA 3SKUD 2YPLB 4MXQD 2VDML 5BW7A 1LE9A 4L29A 2R1YB 1XFPA 2B5IB 2NY4D 3HE7B 2XZAL 1I9IH 5I15L 1NBZB 4Y5VC 4QXTA 5CZVL 3KWWB 2OYPA 5LGHL 1KEML 1ZHKA 4G9FD 3QNZB 3D87B 4K71C 4PD4K 3TA3B 1IGJA 3JWNC 1IGMH 1UJ3C 4PIRF 3MNWA 4MD0B 4ZUUB 4NC2B 1QRND 5IEHA 4WY7H 5D7JA 4L9LB 5EZOL 1EO8H 5CAYB 4B0MM 2P8MA 4YPGA 3QDMB 5C3LD 1CVRA 3VI4F 2F54D 3JV4A 1HYSD 5EBLA 2VITA 2EXYC 4PJDF 2MHAB 5D7LE 4EUPA 4O2EB 4X4YA 3WNKA 1X3DA 2WBJA 1II4E 1U8JA 4QXGL 1T6WA 2H9GB 2Y23A 3GFUA 4NZTH 5ANMB 1OP3K 1P6FA 5KSVB 1WF5A 5D7LB 5JW5B 4S1SL 3FRUB 5DJXB 5MEQA 3BP6B 1IGCL 4FFWC 1P4BL 2BNRB 4F9LC 1RZ7L 5CD3B 2X7LB 4LLDA 3EO0B 2VL4A 5EOCL 5J06A 3TBSA 4G6FD 4HKXA 3RIFK 4PJAA 3BIKB 4UMGA 1MOEA 1BX2A 3WKMH 2PTTB 5FDYA 4RSVA 3O8XB 1CD9B 1DBAH 3VFWB 2OTPA 4PJBB 4HXBH 2X4QB 3ALWA 5F7LB 5DRZA 2OXGA 25C8H 2OMNA 3ET9F 3NH7H 4LBEA 5TFSH 5C0IB 5K59F 2NZIA 3FO1B 5BQ7A 2P5WA 3IFOB 4HPOH 1EO5A 3IFLL 4OM1L 1KN4H 5HY9A 4NZRH 1JFQH 3BGFB 3GRWH 2WIIA 3RTQD 5J9PA 3VH8B 2CKNA 4WUUE 1XCQB 1IEAA 4F7CA 1ZGLP 1FNAA 3ARGD 3ARFA 2DQCL 1KBGH 1NMAL 2J5LB 4OLEA 1D9KB 2B5IC 5DRNB 1YMMB 4OIIH 2A6KB 1UA6H 2D7TH 3MBEA 4LHUB 5DEGA 1EZVY 1CFSB 3BIAX 1JGDB 3HE7C 5JXED 3OAYK 3D0LB 5EBMB 4PTUB 4NT6B 2ATPA 1INDH 5FOJA 2DBLL 4KRPD 3STBA 1R5IB 1QZ1A 4NOFA 3DMMB 5T33H 2OTUA 3GHBH 1AI1H 1U8MA 4HWBH 3W11C 1F3DH 3KXFA 4U1NB 1JGUH 2Y36L 1MFBH 4X7CC 5JIKA 4QRTA 2JIXD 3TA3C 5KVEH 2YD3A 2DI9A 1YPZE 2PXYB 1J8HD 1CBVL 4WNQA 2BDNH 4GG6F 3P4NA 4L9LC 1EHAA 4N1HB 4N0CD 1RUKL 2W9DL 4PLJC 1A9BB 4MQSB 1UB6B 1FVDA 5TF1L 1G9MC 4DTGL 5FYLL 3FB6A 1F4AA 3D85A 1RY7B 4XHJD 1AR1D 5KN5A 2N1KA 5E99H 3I50L 2C3WA 1DTUA 1IKNC 4GLRH 2YA0A 3MRLB 4M6NH 1AXIB 2FWOA 1EZVX 1H8OA 1IQDA 1QNZL 5I1CL 1G0XA 1YYLL 4MAYD 3FQNA 4HW6A 1DLHA 3ARVA 2PYEE 3FHQA 4DK6A 1A7OL 2ITDA 2UWEF 2PW1B 2VLJD 5IFHL 4X4ME 4IHOA 1V3JA 3W2DL 2PYEB 4KXZH 4Z0XA 3UTZB 1XMWA 1I9JH 2FSEA 2OMBA 4PJ8B 5BRZE 4C83A 3O8XC 2R23B 1H3PL 4Z95L 3L6FB 2UVFA 5D2LA 4OTXL 1YY9D 2A73A 1KJ3H 3BW9B 4N5EC 4UB0L 3WXWH 5I76B 4PRNA 5JW4M 5FKPA 4YFLI 1Z0MA 2BSRA 5DR5H 1P84J 3BGFC 1TZIA 4ZQKB 3RVVC 4JFFB 2F53B 4KZDL 2AXHA 3MGTA 2C7UB 5HI5C 2ZUUA 2J5LC 2FR4A 4I18A 1AGFA 5HD8C 1XF3A 1D9KC 3RUGB 3H3KA 5IK3A 4ODSH 3CFEB 3A67L 3BI9X 3QWRA 1UVQB 4NO2B 5C9KA 4LASL 1GC1C 2A9ML 3L3GA 3LMJH 3OAZK 1E28B 2UYLB 2F5AH 1EJOL 1X6NA 3MRJA 5T1MB 4MXVE 3DMMC 1VCAA 5IGXH 4W4OC 1QR1A 1JN6B 1E6JH 2PXYC 4LKXA 3CU7A 4V1DE 3OGOE 3SGDH 4XP5L 4MB3A 3VA6A 4PY7A 1YEGL 3RWJA 1MCOH 5HYQA 4GRWE 1YUHA 1YEFL 4K23H 2YUVA 2G2RA 1I3GH 3F7QA 3L5IA 1U3HB 1D5MA 3C2AH 4LSDA 4GRWB 2ZCLH 3WLWD 1J05A 4NKOB 2Y06H 5F3BA 1GGUA 5FHBH 2BRRL 5LGKA 2XOTA 3UBXA 1NL0L 3SKNA 4PD4J 2GK0A 1DFBL 1WT5A 3B5HA 5KBNC 4X9FA 4CJ0A 4Y5XA 3IFPA 3QYCA 2Y5TA 2CUHA 5FO7B 1KCSL 2B1HL 3OR7A 3P4MB 1OGAD 1INQB 2VE6B 4HPYH 3QUXB 4FA8A 1ND0B 3QXTA 1N6QL 2CH8A 2VLLA 2VZUA 3W0WD 4PJFE 5DMJB 1AD9A 5E4IA 2V2TB 5EU5A 1CFTA 4OQTH 1I8IB 4OKVB 4PJ8C 4K3EH 1DQLL 4URTB 2PETA 5FYLE 4CVZB 5KSUA 2BVQB 1JF1B 2XV6B 3JWDH 1MVFA 1X6LA 2H45A 2ZKHL 1HSAA 2FRGP 3RWDA 2X70A 5ADOL 3OBAA 4O5LH 3RZCA 4R97B 1Z5LA 4DUXA 1A47A 1AKJB 2FGZA 3I02B 1FO0L 2NX5E 4JJ5A 1VGEL 5IHUH 4LGRB 5ISZE 1BQLH 3CUPB 1HKFA 3C6LA 4PJEE 3WL9A 5AD0B 1G7MA 1R24B 1VFUA 2IPUG 3QIWD 1CLZH 4U0QB 1I7TB 5ISZB 3VFUB 1QFUH 1ZT7B 3OWEA 4DFIA 1UWXH 2NMSA 1EUUA 3PGFH 5GJSH 5LGJA 1AGEB 1F90L 1GGTA 1H5BA 4JY6B 4Y19D 2DQJH 2YK1H 5IIEB 1J0HA 3U48A 1TJIL 1P69B 1MREH 1N7ML 4XPFL 5I9QB 3WFDH 3X3GH 4RGNB 4QTHA 3OGCB 2ZSWB 2APBA 3LH2L 4Y16B 4UILH 1MHCB 1D5IL 4O2CB 4Y1AD 1FVCB 3M8OL 4OFYD 5IBUG 1U3HC 5EPMA 2IBZY 5I8EA 3HZVB 3CDYA 4ZUSA 4PB9L 3PWLA 1TVHB 3HRZA 3NFPA 1LEIB 3O2DA 4MNGB 1NJ9B 4G6AD 3U4AA 4XCCL 3OAUL 2IQ9H 4APQD 3G08B 4Z7QF 2HLFD 5TQ0L 1MEXH 4K9EH 2R0WH 4KVNH 4R2GD 5J57B 1NCDL 4NQVB 3QUXC 5B3JE 4U1IA 1L0QA 3AREA 3AMLA 2ED8A 4HKBB 1A7NL 1CDGA 1YEHL 5DYOB 3C09B 1JZ2A 2D03H 4EXPX 4NRXB 3T4YA 3BPOB 3NFSL 4O58H 3GKWH 3W9DA 3ZL4L 4ZO8A 1I1FB 2AP2A 5FDWA 1I1AA 3G9VA 3DVGA 4LQ1A 4PJCB 3SE4C 1GGCH 5ESAA 1YA5A 5F7MC 4I3GA 1EBPA 2IBZX 3P73A 4QRPD 3HCVA 5AWNL 4NKDA 4R97C 4BUHA 5CBEA 4Q9CA 4RRPG 5C0AA 5E2JA 4WHYG 3TCXA 1RMFH 3HNTL 3L95A 4QLRA 5DFTA 3M1BA 1XGRA 4XMKH 5LVEA 5DJAA 3H9YA 2AQ2A 2A6IA 4OUOA 5F9OL 5FGBA 4JZOA 3UTSE 1JYNA 1M6OB 1JPSL 1AC0A 2VXVH 4HF5L 1CL7H 4GRLB 1AH1A 3SDAD 1S9VB 2QHRL 1CT8A 4ODTL 4JO4H 1RZJL 4N8CL 3ZYIA 3MYZA 4CL7A 1P7QD 3UTQA 1JNHB 2W65B 3ZE2E 2LVCA 2GJ6D 3TZVD 4KQ4L 2NY7L 1AXTH 4GOSA 4M9OA 4HJJL 4FNLH 5I9QC 4LAQH 2EH8L 1EGJL 5A40E 1UACL 2DTSA 5HPOA 4Y16C 1FZJA 4F9PC 5I1LB 3MMEB 2P8LA 1FGVL 5E7FA 3QCVL 4L8SB 3PP4L 1MQKL 3IGAB 4ZTPH 3UJIL 4HIIA 1R5VB 1FO0B 5E2UL 1LO3H 1ZGLA 1MVUA 3QISA 4HZLB 1KFAH 3QUZB 4OZFB 4L8DB 3TEUA 4HKJB 5D1QA 5C0GA 2X89A 1CIUA 2M1KA 1HEZA 4PYHA 3PGCA 2J8UF 2EH7H 1AGBB 4LSRL 2FGWH 2QKIA 2AJVH 3SDXB 4LEXH 4JKMA 3L3OB 4TVSa 3ZKSD 1WV7T 2ZUTA 1UKQA 1KT2A 1FAKT 5C2BH 2I26N 4P23D 4PRBA 1XGTA 3C09C 1G7PA 3GHEL 1MFEL 5DJ8B 4PJGB 4YWGL 1JPTL 4G80A 4J4PD 2FO1A 3AMKA 2EIEA 2H2SD 3WJJA 1QYGH 3RX5A 3BIBX 1W8NA 4NUGH 4W81A 4GW4B 1JV5B 3BQUD 5LBSL 3MGOA 3GBLA 1FFPA 3U36A 3TT1H 3MLWH 5J4MA 4HAGA 5E24E 1T20A 3D25B 5ICXA 1QFWL 3L5JA 1QA9B 3QDHA 4IRSA 1C12A 1C7SA 1JCKA 1GVIA 3B2VL 4KMLB 1PG7L 4Y88A 4DAGL 3MRRB 4ONHB 5HHNA 1NGYA 3O2VL 1N26A 2XYCA 1ROWA 4GRLC 4MJ6A 5D5MA 2QSTA 2IANB 1LK2A 4YZFF 3HE6B 1DL7L 4NQXA 2Z31D 1MFAH 2YS4A 4XBPB 1HWGB 4ISVA 1NEZA 3O45B 1NC4A 4N0YL 2P45B 1HWHB 4MS8C 1UM6L 2HFGL 3IU3B 3NABH 3KPLA 1ZEAH 2CLRA 1RIUL 3TWCL 4M6ML 3U6RB 3V7MA 3REWB 2BY3A 4GKZA 1HXMA 4MHHG 1VACA 1SM3H 4ZFZA 5C08D 1FJ1A 1FFNA 2Y72A 2QR0A 4JM2F 4L8SC 5DUML 3REVB 1MI5A 4HUWA 3QUYB 2ZPKL 1QFHA 1WCQA 5JW4N 5I19H 4HT1H 3BZEA 3QUZC 4JRXE 4ZNCD 4PJXE 4NQDD 2A77L 2P47B 1XGQB 2Q6WB 3RGVA 1FCGA 1L6XA 3MLPA 3FONB 4PS4L 4GW1A 4HDIA 3ULUH 2JTDA 4MA8L 2ZUVA 5JIHA 3TGXA 1BBJA 2H32A 3U4EA 4N0UB 3DBXA 4HBCL 4QXGH 3C60D 5C07E 5F9WB 3WIIH 1A6WL 5JHLL 2R4SH 3CSYA 2GTWB 3SKOA 1M7XA 1I7RA 1Q9LB 2XQYG 3GNMH 4EIGB 1T89A 4CDGC 3G6JB 3V6ZA 1HKLL 1G7JA 5CP3A 3FT2B 2VXQL 1CDYA 4YHML 1SJVA 1OPGL 4JRYA 4EI6B 5DJYA 5HGGS 1ACYH 4ORGA 3THML 2V5YA 1U8IB 1OWWA 4D9LL 3C08H 3MXWH 3T3ME 3QNXB 3WFEH 3RRQA 4M00A 4UZGA 5T1LA 3T2NL 3LKNB 1CICA 3UBXI 1A8JH 3AU1A 2VR9A 3WUWG 1EO7A 4HK0A 2Y5EA 3PWNB 1R3KA 4LNRA 4JKKA 1T7VA 2VQUA 3HFML 3HE6C 4GXVH 2YD6A 4OM1H 1JYVA 2W07A 3HMXL 1OARL 2IBGA 4EVNA 1F3JA 4KK6C 3ULVC 3OJDA 1TCMA 1PVHA 1O5DT 2P5ED 4OB5H 1CYGA 4MQTB 4GG8B 3DHMA 3HUJA 3SQOL 3LKQA 2DM7A 4NN7B 3VFVA 1NFKA 1DUYA 3T65A 2KZ1B 4KHXL 4I0KA 2AK1H 2RJMA 4FTVD 3D2UB 2DBLH 1A3RL 1E4WL 3EFDH 4FHBD 5T3XL 4Y4HC 3QUYC 2NW3A 4AEHL 1Q9WA 1UADC 2Y36H 4EXKA 1DLFH 3MNZB 5E8NA 1CBVH 3CX5K 1U3JA 3CZFA 4M48L 2AEPL 1HCVA 1RUKH 1VA9A 2W9DH 1IGIL 3P0VL 5FUZL 5KVDL 5GRYA 5J3HD 4F7PB 5TF1H 4JZNB 4MJ5B 4BKLB 1RZJC 3K8KA 5TJWK 2XTJB 5CJQL 4LOUC 5F8QC 5DZLA 3VXNB 5FYLH 3RBSA 4TN9A 5IW6A 4KK8D 5JHDE 4EDWL 1KTDA 3PNWB 3QBTB 1HH6B 5C0BB 1ADQL 3L5XL 4G8FA 2GJZB 2AVGA 5F9WC 1LE5B 3RX8A 2AV7A 5IVXB 4P3DB 3MUY1 5C09D 3GSWA 2FO4B 4AQOA 4OM0L 4XAKD 5GRUL 1J0JA 2LQRA 4GBXA 2BFVL 5C7XH 1EJ6A 5LAXA 4F7MB 5JZ7D 2X2YA 3SCMA 4BZ2L 5IMMB 5I1EH 4NCC2 4K07A 1V3KA 5F21B 2DQTL 2IMNA 2DQIL 2WP3O 4X7DC 2BNQD 4UIKH 1HSBB 4WGVB 3SO3B 1H3PH 3HNVL 1BQHG 1OSPH 1KPUA 3CMGA 2XKNA 3ZKMC 4DKAA 5E2WH 3QUKB 4OD3L 5ERWA 2I25N 5DD1L 3KHOA 2G75A 5JA8B 1JMXA 3OPZL 4NKMA 4ZFOA 5L2KB 4KJPC 4V2BA 2K3TA 4ZD3H 4RA0C 1ZLWH 4P57A 5M7QA 5CEXA 2V5SA 4NN7C 4OZHE 4P9HH 3TBYA 4N8VA 1TXKA 3A67H 3V5DA 3VXPB 4E41D 1W72B 2L7UA 2H8PB 2VB5A 3NIGE 3VXRE 5BV7B 4TQEL 2ZOKB 4M93B 5HBBA 4OLUL 5DK0A 4C58B 1LDSA 3PWPE 1Z0NA 1CE6B 1A0QL 1D6EA 4PJ5A 3O6KL 5EBGA 1BEYH 3R06A 1K3IA 4OZIE 4QNPF 1FZKB 2FYYA 1P5VA 3LEVL 1EEQA 2FHCA 3AM8A 1T1ZB 1CF8L 2DMBA 1QHOA 3VXUE 4JG0H 4RA3A 2GY5A 1CDUA 3LKSA 5D2NB 5K33A 4PRHA 3KPSE 1DBJL 1VERA 1OP9A 2XTJC 1D5BA 3MTRA 5IB1A 4G7YL 4LCWD 3PQYA 1EEYB 1VENA 2CLVB 3OG6B 5E0QA 5FYJD 1JGVH 3W5NA 1S7TB 3SO5A 4F37F 3WSQL 2RCSH 3RWGB 3B9KA 1F4YL 4XWOD 2Q8BL 1X4ZA 2VIRA 1NL0H 4MNQA 5IG7B 3U4BL 4P2QE 4JQXA 2FDBP 1DFBH 5LXGH 4KC3B 2HMIC 3PIQB 3OTTA 4XXDA 5T3XE 1QBML 1QTYT 4X6DE 1KCSH 2B1HH 4N0FB 4RMRA 1TVBA 5KZCB 4X6FB 1VFAB 2RAMA 3QFJE 1N6QH 3IDGA 4NO0A 3NMEA 4L4VD 1DBML 3ARPA 4WFGE 2J6EA 2R69L 5H8DA 3GI8L 3L3KB 3SO3C 3B5GA 3SJVA 4UUJB 3P4OA 4ZPVB 5F96H 2F58L 1R0AH 3ARQA 2W0FB 5D9SA 2YC1B 4NNPH 1OCWL 4OJFH 4JFZL 2ZKHH 4R7NA 1AE6L 2EEDA 1IEBA 5CEYB 2NXYB 5SWZD 2QADB 4TTDD 2JCCA 4G9FE 4KROB 4WI3A 2I9LA 3BJ91 1YECL 1QRNE 3ARSA 4XCNA 3KYNB 5KSAB 3QPQD 3O6FA 3T3PF 2XICA 3MRBB 5I1HH 3TNNA 4WU7A 4Z7VF 5EC1A 4BM7A 2D0FA 1YEIL 1BM3L 1MHEB 2F54E 4DVRL 5K9OB 1A21A 3AS0A 1R3JB 5IFAL 1P1ZB 5BV7C 2A9NL 4Z7WA 4ODVH 1H3TA 5CSZB 4E42A 3TH3T 3ARED 4M93C 4PYGA 1JZ3A 1EEZB 1T7XA 1U8NA 1CFNA 1WBXB 3DIFB 4P0DA 4HIJA 2IG2H 4FQ2L 1BF8A 4JKLA 3OXRB 4TUKL 2C1PA 5FUOL 5GZND 3V4UH 4YDIL 1B90A 1CGSH 1ZS8A 4MA7L 1P4LA 1TJIH 1RUPL 3QXDA 3GMNB 1I1AD 1N7MH 4JDVB 4XPFH 3E3QC 1A22B 1KIPA 4LLWA 1EMTH 3QI9D 4P2CG 2P24B 4TPRL 4ZFGH 5D2NC 4LRIA 3CVIH 5E1HB 3LH2H 3LEXA 5DMIH 3P0YL 1B0GB 1N2RB 3L3DB 4WHTA 15C8L 3M8OH 2DYPD 4RFEA 1OL0A 3B8YA 4G6JL 2ESVD 1F3RB 5CZXD 1N8ZB 1Z2KA 4PB9H 4G6FB 3HPJA 4ZYKB 3MSPA 1X5JA 3BWAA 4LRNL 4G8GA 4KI5C 2A38A 4XCCH 4GXUM 3OAUH 1S9YA 1NLBH 4OV5B 5DJDA 4GSDL 2GYSA 4KJYA 5GSRA 1MCRA 4DW2L 2APTA 1MCQA 3QEHA 3EYSL 1A4JA 2GUOA 4WV1A 4OGYL 3D0VB 5EU6D 4E0RB 4DJMA 3V0VA 5HHMD 1CG9A 2NY0D 4ONFH 4IOIB 4RAUA 4HXAL 1G6RL 4OGAD 1UKSA 2EYRA 5F3HA 4Y0GA 2BMKB 5I1JH 3TVMA 4PRPB 4M1DL 2JLLA 2QADC 3NCYS 5AWNH 4P4RA 4YAQB 5E6IB 4KROC 5DEFB 4Q2ZB 3VJ6A 1JGLH 4K94H 1SJHB 1ZHNA 4Q9RH 1J8HE 1U8PA 4G9DA 4KY1H 5KSAC 1F8TL 1MRCL 3EHBC 2QQNH 1UCBH 3BSZL 4BQ9A 4J1UA 4LF3A 4LSVH 5D1XD 4HF5H 1NGXA 3WEXA 1KJ2L 4QXUL 1KJVA 2IPTL 1MJ7H 1RZGA 3C8KA 1T0PB 2AJUH 4N8CH 4I3RH 1TZHA 3OKLA 2LABA 3WS6C 3DWTA 4TUOA 2VDRH 1AFVH 1F4XL 1T7WA 3VFGH 4O02L 5KSBF 3RWIB 3T77A 3QIBB 2OJEB 2YZ8A 2WWMD 5T5NG 4KQ4H 4F7EB 3D18B 1LP9A 2NY7H 2YPKA 3DV6B 2EIZA 2NXZB 3DGGA 2G9HB 4XP9L 1BMGA 3OKMB 1JWSB 3N0PB 4HJJH 4UBDD 3OZ9H 2VH5H 3F8UB 1FIGL 2EH8H 2VLJE 1LK3H 1RZIB 5EO0B 4TULL 1UACH 1OM3H 3RIAF 5A1AA 3GRWA 5JORA 3ROOB 1BZ9B 3EAKA 1RFDL 4JFOA 2OK0H 3FO0H 4LLQA 1XEDA 2UUDH 4R3SA 2DOCA 1IAKA 4M1GH 5CEZL 4QHLA 3MLUH 1YN7B 1EV2E 4YQXH 1FNHA 2HN7A 4U4BA 2AEIT 2VKWA 4LSRH 4MXWL 1Q38A 4I4WB 1ULVA 4YFLF 1H0DB 4H88L 4NRYB 3I75A 5D70L 4PV8B 4HWBA 3UYRL 3MRHB 4I48B 3EOBA 3BP7B 2X9WA 5HYJB 2WINA 3X3FL 3VD9A 3ARBD 1S7UA 4UDTB 5EC2B 1CD1B 1U3YA 3GHEH 1JPGA 1MFEH 1JPTH 4G3YH 5HPMA 2VRAA 1F42A 2IADB 2ZSVA 3C5ZD 4CW1A 3GJFB 1CFQB 3HC3H 2COQA 3BN3B 4MD5B 2E7BA 2F8XC 3GMMB 5B4MC 5B38B 2DJ4A 5JXEC 2YSSB 2NYYD 5E6IC 4S2SB 3QG7L 5C6TL 4PJ7E 2NNAB 3B2VH 1PG7H 4EI5D 1K4CA 1P2CA 2HVJB 1W0WB 5B21A 4JZJB 4DAGH 3TYGL 5ILTL 1DANU 4QGYA 4O00A 4GAJL 5HHVL 1CGYA 1TJGH 3DTXA 1U8HB 1WUNT 3NN8B 3KYMA 1T22B 4IIQA 1MLCA 4TVPD 3RAJL 3U30B 4WW1B 1DL7H 3ZDZF 3ZYJA 1L4IA 4ZAKD 1FN4B 7FABL 5ITBH 4XMPL 4RNRA 2D9QB 4M9PA 3KPOB 5CLTA 2YWYA 4ZUWA 1YYMH 4N0YH 1G7QA 2CDGB 3QIBC 3RJDA 3S98A 3STLB 5D7IE 3GMRB 3GMLB 3P9MB 2NXZC 1DSFH 1RIUH 1G6RB 4FRWA 1OGAE 5I75B 2H6PB 3MJ7B 3HS0B 1AO7A 4AL8L 1RJZB 3IDJB 4DZ8A 3LOWA 1YEEL 3W0WE 1KC5H 2E9IA 3VDBA 1MY7A 4RZCB 4X6CA 3QG6B 1U91A 1IAOA 3BAEL 2ZPKH 3QEUA 4OI8A 1TJHL 3U82B 2Q7YA 4G7VH 1ZANH 2NTSP 1T1WA 3CFKB 2A77H 3HMWL 4DZBB 1W0VA 4UOJA 3GMOA 3EOTL 5CHNA 3UEZA 4DK3A 3IKCB 4PGZA 3V5KB 3QFDA 4BQBA 3DI3B 3RWCB 3KPRA 1NLDH 3RPIB 4P4KA 2VO5A 4S0TD 3HNSL 4PJIF 4L8BB 5IESH 3TO4B 3V6FA 3IDXH 4QT5A 3VFNA 1NANH 4HHAA 1C08A 4NJ9L 4FFZH 5H94B 3QA3A 3EOAA 5JHLH 3OB0H 4QOKB 1NC2B 3H42H 4LLUB 3HAEB 3MJGX 2Z8WC 4ONOA 4Q9QL 5DGRA 4QF1B 5K9QI 1S8DB 4MQ7B 2VXQH 3D3VD 3TJEL 2XNAB 1T1YA 3FAWA 3BP4A 4HKZB 4YHMH 4HUXB 4Y19E 5I1DA 1NDMA 3D6GA 3BPNB 4DGYH 1BLNA 1LO2H 5CGYC 5H35B 3LPFA 2XTLA 5HXMA 4H25B 1U41A 2NY6D 4JZJC 1MIML 2WWKO 2AABH 4LPXA 4OUUB 3DLQR 3GM8A 5GGQL 3H3PL 3QEQD 5GIRA 4JFQA 5L0QB 1PSKH 1FDLL 3OG4B 3EYOB 4Y1AE 3U30C 3HFMH 4Y4FD 5J1AB 4JHZA 1LEKB 5DUPH 5DHYB 3QXUA 4NNYB 4OQTA 5CP7B 1G1YA 4M8QA 5D8JH 5E6ZA 3E8UH 3RJQB 2X5PA 2RHEA 3VI4E 3WLWC 4K7FB 1JNJA 4PJDE 3H0TA 3TN0B 3ARDA 3I6KA 3I6LD 5I75C 3OKKB 3RVWD 1X5YA 4XMLL 2UVEA 1M71B 5FA3B 1A3RH 1BPVA 2NY3B 1CIDA 4L3EB 5GS1A 5T3XH 1GRWA 2W0KA 3U0PA 4OCSL 2ZCKH 2UZIL 2BY2A 4L4TA 2NW2B 5L9DH 4YHKL 2EDKA 4FQXB 4M48H 1PYWA 3CFIC 1GGIH 3FMGL 4KHTL 4QRPE 4X6EA 5EZJA 5HGHA 4POYA 4HCRL 4ZUTB 4JDTH 1FORL 2ARJA 2A6DB 3RNKB 2CGRL 5B8CC 3SGJA 2IFFL 1EK3A 1A6UL 1LILA 4Z76B 2APXA 2PO6D 1HN1A 3TO4C 1HHHB 2DL2A 3F12B 4G42B 3LPGA 5CILL 1OLZA 5L2JA 5K59E 2JJTA 2ITCB 1PDKA 3DUUA 3ARRA 5MI0B 2AJZA 5IHLB 4XRCA 4OM0H 1NGQH 1WICA 4UV4L 3RI5F 4Y5YA 3SDAB 2DBJA 1WISA 4WI8A 2APWA 1K4DB 3R4DA 3EYVA 4TTGA 1TETL 2GJ6E 4YHPA 3O3UN 2XWTB 1P7QB 3WHXA 3BPNC 1NAML 3ROLB 3UAJC 5EUOB 3EYQD 3VD5A 5I30L 4TOYL 1KOAA 1S7WB 4RAVA 4U6TA 3DVFA 1E4XL 5KS9A 1FIEA 2NLJB 3HNVH 5TGBA 4BFIB 5C86A 4A6YH 5L0QC 5F1IA 3T0WA 4GXUN 2X1WL 4UINH 5HYSB 5DQDL 4Y2DB 1NFDA 3OPZH 4GG6E 4U1HA 3U2SB 1QSEA 3GMQB 3VXTA 2BOBA 4PRIA 1N64H 5TH2B 4GG6B 1MLBB 2OX5A 4I5BA 3QO1B 4PLKD 1EPFA 2XACC 3IU4L 3TN0C 5FIEA 1INEL 3HE7A 4G6AC 1Q9OB 4Z7UE 5D71L 3VXMB 4U1MA 1U8QA 2NY3C 4WJ5B 2FBOJ 3O6KH 4ENEC 2IAMD 3B9VA 4K3DH 2P46B 1CI5A 3BGMA 4ODUB 5DJ0A 3KPPB 2NY2B 1RSFA 4FQXC 2W1NA 4I8DA 4GRMA 4GUPB 4P5TA 3QQ4A 2AJSL 2H1PL 4IDJH 4XTRD 2HTKD 2UWEB 3MYJB 4G7YH 6CGTA 4O2EA 3DYMA 4M4PA 2PUQT 2VDPL 4R96A 5HGDB 3NTCL 3ZKXB 4KKBC 1FGNH 4P2OB 1A2YB 4IOSD 4LLYA 5F7EH 4NQEB 4X7TA 3T8XB 4GJTB 5A2IH 1BD2D 5MI0C 3EDDA 2QL1A 1IM9A 4UI2A 3BP6A 1A6TB 1QRKA 1ZWIB 5SWQB 2HG5A 3SDAC 4NUJB 5FUCE 3ZSTA 4BFGA 2Z93B 2EC9T 3P77B 1AGCA 1J9CT 3VFWA 2DQUL 4UQ2A 2FIRT 2HFFA 3LSOB 1S78C 1JHTB 1ZXQA 5D2LF 2DLFH 1ETZB 4OGZA 3FT4B 3PP3K 2FJGB 4UT9L 5EIIA 1TTUA 5C08E 4I0PD 3RY4A 1BAFL 2F58H 3FO1A 5HDQL 3FRPA 3TIEA 4WU5B 3NCJL 3CFDB 1CVSC 3O3BA 5I66B 4JHAL 2W9LA 1Z3GL 4Y2DC 1HIML 4WWKA 3DXAD 5A2FA 2VLKB 5CD5D 2IF7A 3O3AA 5IOPB 3ZHLA 3U9UB 1U2HA 2BC4B 4NQDE 5CSGA 3CZJA 4PGDB 4WUUA 3M07A 3NPSB 3BN9D 1BM3H 2DQEL 4DVRH 3EJZD 4JO3L 1PZ5A 5IFAH 4TNVF 3FFDB 2A9NH 4ORZC 4PTUA 4HLZG 1YEJH 3QWQB 1RIVH 1W0YT 3VWKD 5T5FH 3UYOD 1HINL 4HS6B 4KAQL 5DI8B 3Q6GH 4OF8A 4FP8L 3MOAL 1I3RA 3GJFK 1MSPA 2A83B 4GLRI 3AXLB 2GIYA 4TUKH 1U8KA 1GGBH 4LKCB 2GQHA 4MA7H 3BH8B 2L4OA 4X5WA 2NY2C 2Y25A 2OJZH 5IQ7H 1RUAL 3HI6H 1YPZA 2K7QA 3KR3L 3ZE1E 1Q0YH 1PEZA 3K4AA 4KTEH 3CC5A 3MZGB 4ZDHB 3QIUD 5DQJB 5I8KH 4WW2A 1YN6B 1U92A 4IMKA 3G6AA 4KXZI 1PZUB 4QRSB 3TPKA 3ZKXC 2JJVA 4F15B 1QEWB 1ZAGA 4P2OC 2I60H 1IKFH 1MH5B 3LVEA 1KLGB 5HHOD 1WZMA 2EDQA 2PN5A 2G5BA 5I1IL 5BZWA 1I8KB 2EDXA 4H8WC 5F7FA 3VFSB 3VGDA 2PW1A 3T0ED 1IC4L 3TO2B 2IPKA 2P5EE 3HG1B 1SEQL 4PRDB 3HR5B 3LRGA 3S37L 4OGYH 1KIQB 3GBMH 5I1GH 4E9LA 4X4MA 5T1KA 3RKPA 2XN9E 3GSQA 1QFWM 4HFWA 4HXAH 1A64A 2QQQA 5BRZA 3CIQA 3H9HA 1EXUA 1DN0B 1ZTXH 2XN9B 4BSVA 1A7PL 3EW3B 4RMUA 4FTVE 3MV11 4YR6B 4X99A 1G7HA 1ZV5A 3KYOA 1AD0A 5IUSA 3G5VA 3QZWG 2W60B 3SHSA 4D2NA 3MCKA 4X5LA 1IZKA 3BH9B 4KK5D 3UPCA 1KG0B 1T21B 1S5HB 4R4BA 1S9XA 1UWEL 1NCAL 2KQMA 1XGUB 3SGDI 2AV1A 1OB1B 1X9QA 3S8WA 5AG9A 3PWUA 2ZJSL 2E9JA 4NO2A 5CJXC 3IVKB 1U58B 1SYSB 1IGYB 2VLRB 2IPTH 1FH5H 5E5MA 5F1NA 2YD2A 5JW3H 4ZO7A 5C71A 4BH7A 1EBAA 4OLWL 1D3CA 3LRSB 2X09A 4NC1C 3BT2L 3CK0L 1JE6A 1JN6A 1NPUA 4OCXL 1U8LA 2EXWD 5C09E 1BFOA 4X8XA 4L9DA 1REIA 2FEEL 1FYTD 2BJMH 5IBLC 1FIGH 3ZKNC 1FPTL 3LQZA 5I6XB 4V1DA 4HGMA 4MX7A 4P2RB 3WD5H 2JK5B 1BVLB 3PL6B 4LU5L 4NPYA 4HZAA 1A4KB 3WNMA 1RUML 4PP1D 4AIZA 3OKDB 5GHWL 3RHWF 2MQ0A 5A3ID 3MV8B 1AIFA 4LVOB 2BNQE 4F15C 4WFED 4XAWL 2X44D 5GGSY 3BVNB 2CRIA 3FOMB 4MXWH 5GJTH 1CXHA 3L3IB 4NGHH 1U42A 1INQA 2EO9A 4L3CA 3W39A 5A43C 1ND0A 3MZTA 4YBHA 2Z35A 1EVTC 2HJKB 5DJZA 4S0SD 3TM6A 1MJ8H 3LKOB 5EU4A 3RNQB 4F3FA 3C5SA 5LWYH 5EN2A 1ZHBB 3WE6B 4PJFA 3MV01 1JZ5A 1J1PL 2IALB 1RK1A 4E41E 3QXAB 4XVTL 3G6DL 1JF1A 2XKSA 4DN3H 4FMKA 5IVZB 4JPIB 5IHZB 1JNNL 2M26A 4DKFH 2VL5B 1VKXB 4OGXH 3WUWB 1A6AA 3VFRA 5H2BB 1AKJA 2O5XL 1HI6B 3MRNB 1UB5A 3VXSB 4AM0A 3QG7H 2VABA 1U8OA 5IHBA 2CLZA 1EHLL 1H3WM 2AGJH 3CUPA 1QSFB 5D72L 2EECA 1MJUL 2NX5A 2OTWA 2CRMA 4GAJH 5HHVH 5ISZA 1RZKH 4LCWE 4PG2C 2CKBH 4U1KA 4PJEA 3I9GL 5FYJE 2G5RA 5JQ6L 4J6RL 5E9DB 7FABH 3DVNB 4AZ8A 5CLWA 4DUVA 1PKQE 3CFBA 2J8UE 1AGEA 4HS8L 5DSCB 5BVPL 1BFVL 4MLSA 3EOYG 4JFDD 1TLKA 4RQQB 4BYHA 4PR5B 1PKQB 4IS6A 2J8UB 2OQJB 3SE3A 2FJFB 2X05A 3G5YA 2VXTL 4KUZH 5DJCA 3KAAA 5I6XC 1VFBA 3N85L 2CR6A 1S9KC 3CD4A 1KJMA 3MRKB 3PL6C 3PWVA 4OI7A 1OTUC 3L9RB 4XP1L 2CPCA 4L4VE 2Z92A 4IM8A 4MDIA 1SEBA 3BAEH 4CN4A 2X4RB 2H2PC 1RIHH 3SY0A 1H3UA 3GK8L 4DN4H 4ZUVA 3MV9D 1DANT 3OHXB 5CGTA 4U6VH 4W6XB 3TFKD 5IVNA 3VFPA 1RQ5A 1E27A 4P5MA 4QY8A 3QDGB 3H7LA 1F4WH 1T04B 1LO5A 2ICCA 2IPUK 5DRXA 4LPTA 3MC0A 5SWZE 3P2TA 3ZE0E 2D7PA 3RA7L 2EKSA 3MBXL 2HKFL 3NPZB 5DWUL 2FH8A 2V7NB 2C3VB 4CMHB 4HIEA 1RJLA 2EDDA 3S36H 4K55A 4DEPB 5DYOA 4ZNEA 3VFOB 4NRXA 1UEMA 4NJ9H 4YHZH 1BZ7B 5TE6L 1K85A 1B0WA 1OGTA 4X9IA 5FAAA 5CJOL 1CL7I 4FZ8H 4LLVA 5IB5B 4Q9QH 5I1AB 4LPUA 3U0TB 3CFJB 3WIFB 3TJEH 4QRRB 3B2UC 3ARUA 3N1MC 3KPTA 5IB2B 5J6HA 4ZS6C 1V7NL 3O41A 5F93C 5TE7H 5I73B 2GJJA 1D5XA 1MAML 3AAZA 5D1ZB 3P11H 4OFPA 2DQGL 1M6OA 4PRAA 5D5MF 2EIDA 1UM5L 5HI3C 2DKSA 4R8WL 2EXYD 2CJUH 1T0NB 5EZLB 4Q9BA 4NHUB 3UTSA 2R2EA 4JM2B 3IJHB 3GSOB 5I8CB 3DRTB 1JNHA 2ESVE 3VD4A 3RDTA 3K2MC 3TBVA 5L6YL 3H9SD 1HDMB 1J1XL 4X5XA 2EE2A 3TCLA 1XIWD 5FYKU 1ZSDB 1PQZB 3JTSA 1T0MA 3WIHL 1OW0A 1K2DB 2X41A 4FQCL 2FX8H 2ZNWA 4FFWD 4DGVH 3VH8G 2CK0H 3CLFL 5DLMH 5DMKB 1GH7A 4XMLH 1WBYB 4XNQB 5CMAA 5EU6E 4YUEH 4K8RC 4HZLA 5J56B 3JV6B 4XCEB 2Q86A 4MJIB 2UZIH 4M8VA 3FZUC 5MHSE 4ZS7L 3P9LB 4XPAH 4WO4A 3SPVB 3UZEA 3B9EA 2J4WL 1WIPA 3FMGH 3QRGL 4KHTH 4X4ZA 3QHZL 5DD0L 4HCRH 1DCLA 2FH6A 3U83A 1A1NA 1FORH 1FG2B 5TPWL 4GKOA 4CMHC 3VRJA 2IFFH 2QQLL 5JUEL 1A6UH 4DEPC 1HHJA 5JLZB 2YPLD 1MCCA 3SGKA 5CILH 1UH2A 1WBZB 4U7SA 5TE4L 4O51A 1MY5A 1UZ6F 4XC1L 2MJWA 1H15B 4XVUD 4WENB 2Z4QB 4ALAL 3ARTA 4JFEB 2G60L 3MRIB 4OSUH 4UV4H 4YHNB 4S1QL 5F1KC 3GO1H 2VDNH 3TA3D 3L3HB 1NBVL 1J18A 5BOPA 1MCBA 1NAMH 2R39A 2XRAH 3MLVL 5I73C 2EDEA 4JVWA 1XGPA 5D1ZC 1S9WB 4TOYH 2ZUSA 4PLJD 1NKRA 1Y0LB 3QDMD 3HLAB 2N7AA 1B9ZA 3F7YA 1E4XH 2O5YL 1A02N 4XZUB 5K9KA 3HE6A 5JNYB 3DX9B 3VGGA 4FXKA 2QHLA 2IGFL 5E8EA 1MNUH 5F1OB 4JM2C 2WMPA 1C5CL 4XBPA 5DQDH 2VQ1A 3DYOA 3HUJF 1HH9B 1BVZA 2RGSA 5D7LD 1XF2A 2QTEA 3NIDE 3NCCB 1U93B 4BSJA 4U1SB 3D39B 1AJ7L 5IMOA 3HPLB 2I5YH 2FD6L 2ICWB 4D0BA 5C8JB 3PABA 5ETUA 3JWOH 3IXTA 1INEH 2BSTA 2BNRD 4XX1G 2EYTA 1P4IL 5D71H 4RGOH 1Y6MR 2VXSL 4XWGL 2ZUYA 2X4OB 5E8PB 2DQFB 4Y4HA 3E6FB 4BSWB 2I07B 2ADGB 4HH9B 3O8XD 1LQSR 1G1CA 3MA9H 1C16A 5FHAH 5KVFL 1JPFA 1U9KA 4RIRA 4WDIB 4JVUA 4KMTL 2C4FU 1XF4B 4JRXA 2Q6WA 4DVBB 4S1DC 4LSTL 4N5ED 3C5ZB 4MCYB 4RDQG 4PJXA 4GMSH 1S7SB 2AJSH 5DC9B 3RVVD 4FQ1L 2YD4A 4K7PX 5HI5D 2CXGA 1RJYB 3MRGA 1BQSA 1JWMA 3DROB 1N0LA 5JO5A 3I6GB 5HD8D 5B22A 3BDYL 5D6CB 3ULSA 1D9KD 4N9GB 3F58H 1YMMD 4HFUL 1JHKL 2VDQH 4LHUD 5C07A 2V9TA 1PX3A 4NYLA 2LVEA 4UIMB 4G6KL 5C0FA 4UAOB 3PV6B 3DMMD 4RMTA 4U1LB 5IR1A 1KB5H 2GK2A 4NM4L 5SX5K 4I3SL 4KV5E 1CE1H 5IW1B 2PXYD 3H7BA 2YBRB 5IB4B 5BJTA 1CK0L 2VISA 3PV7A 3I84A 4UT9H 3UROR 1I8MB 3ES6A 4ZPTB 4KUCF 3NCJH 2BVOB 2BX5A 4LHJB 2UV3A 1FSKB 4AMKL 4F33B 1M4KA 5SX4H 3X14B 4QNPE 3DRQB 5IW3A 4D9QD 4PREA 4R7DB 1J8KA 3IXAB 5JPMA 4IMLB 4NP4H 1XZ0B 3KLHC 1T7YA 1A9EB 2UY7A 3GSVB 5C0EA 4BH8A 3EIFA 4HGWB 5LQBH 3BZ4B 2YMXL 4HQQL 4U33A 2E3VA 1J0ZA 3B6SB 2CDEB 2DIBA 3ZYOA 3TIDB 4UNTA 3RZWA 1ED3B 1QLRA 2Y07L 3D2UA 4JANB 2PYED 2QSQA 1HINH 5FGRA 4KAQH 2MCPH 3O6LH 4FP8H 3S4SA 4G5ZL 4PJ8D 5E00A 5DA4A 3ZTNH 2EE3A 1A7QL 5CJ5A 2D31B 1BJ8A 3RVTC 1YMHA 2LTQB 2EZ0C 3WDJA 1ZA6B 2Q76A 2V6HA 4JRWA 2X4UA 1GPOL 4CU8A 1HHIA 2D7NA 3C5ZC 4NRZA 3KR3H 3D3VE 4H1LA 1U95B 3ZDYE 1LVEA 3L7FB 5F88B 2YXFA 5BZDA 4JFFD 2F53D 2XG5A 4XNYL 3MGAA 3ULVF 3BE1L 3KYAA 3D3VB 1F4HA 2XWJB 3N1QC 4U6YA 2EDFA 3RL2B 2YOCA 3WKNA 5FA4B 4FXGB 5JHDA 3QEQE 1NCBL 2RQ8A 4LCUB 2WIMA 4HV8A 1FL6A 3QAZC 5I1IH 1BZQK 3SKMA 3F7PC 3CVHL 3QH3A 5HHPB 3FN3A 1M7IB 1RZFL 2DRUA 4UAOC 3UYPA 1IC4H 1OTSC 3VMOA 4NKIL 4UNUA 3T3PE 3LCYA 4U6HB 3O9WA 4JHWH 5FV1L 3MREA 3S37H 5KAQF 4NO3B 4FFYL 4HWZB 5FF6A 4G6ML 5FYJH 2HT4C 4Z7VB 1MRFL 5DD6A 1EHNA 3I6LE 5DHVH 2XZQH 2DQHL 2HJFB 3MODL 1IRAY 4CGTA 4LSUL 4EEEA 2JCCF 4MSWB 2WNGA 1FSKC 1U3HD 3QJHB 5LCVH 1QKZL 4PJ9B 5MP6L 3KS0J 4Y8AA 1DVFA 3SDCA 4QHNA 4WI6A 5D93B 5FCUL 3BYYA 2EDWA 1YQ2A 3MROB 5EO9B 4FQHB 3PWJA 1ONQA 2GTZA 5E95B 4NWTH 2BXYA 5JXAH 3QUMH 3MRMB 5KANG 5FKAA 3TV3H 5IEKB 1V3MA 5BS0A 5GGSB 1TPXB 3G6JF 5CBAA 1WITA 2ZP0T 3QUXD 4M1CC 5A2JH 4OZHA 3SE8L 2R15A 3NZ8B 1DEEA 1V7MH 1I85C 3VXRA 2R1XA 4G8EB 4OLWH 2CDFA 1KCUL 4GMTL 4JM4L 3N1PC 4WCYH 3CK0H 1E6OL 1RHHB 4AENA 5GZOD 4NCDA 3MCLL 3F5WA 2PO6B 3PWPA 4FQIL 5E1AB 2LTQC 2R1WB 2EDLA 5I17A 5FEBA 4HWEH 3TNMB 2XPGB 4OZIA 3LZFL 1FNEB 2DWDB 4JFPB 3VXUA 4NNXA 3D48R 2JF1A 4FMFA 1EEYA 1RUMH 4F80A 4HC1L 5GHWH 3KPSA 4RMVA 4IRJB 3GI9L 3GSNL 1AP2B 4YDKH 2VTFA 1N5AB 3EBAA 3FN0L 4XAWH 5CSBA 1EAPB 3R8QA 1BREA 4ODXB 3B9AA 3GIVB 1TFHA 1KPRB 1OSZA 4QRQA 3M17A 3N1GC 4X6FA 4P2QA 4OZFG 1GZPA 5ECJE 3R0MA 2Z91B 3V4PL 1FLRL 4X6DA 1CD0A 3O2WL 1T6VN 4F8QA 4OAWB 3LIZH 5CIPB 4DGIL 3QO0B 3QFJA 2BERA 2XWBA 1A1OA 3MFFB 3UDWC 4RGND 4UUJA 3IDMA 4XVTH 5F8RC 3UTTB 4ETQB 3G6DH 5C0RL 4XVSH 4X4XB 3L7EB 4Y16D 5ICZA 3B4NA 4JN1L 3LQAL 1GXEA 2FIKB 2E7HA 5CEYA 5KSBE 3MJ8A 3RWFB 1B4RA 1JI1A 2XZCL 1JNNH 1GZQB 3VFTB 1QLFB 1UXSB 3KNBB 2ZCHL 4PJ9C 1ADQA 5GSVB 3DETC 1GHFL 2X4NA 5D93C 3DX6B 4G9FA 4NIKB 1FNFA 3F6LA 3S34L 1LGVA 5D72H 1KLUB 1QRNA 1MHEA 2A1WL 1QBLL 3FO2A 4R26L 3CVHB 1TPXC 1YNLL 2E27L 4KPHL 5IVOA 1HOCB 3BKML 5HGBA 4PGBB 4QCIB 5D7KD 2F54A 5EA0L 5GS0L 2UY6A 5EORL 1KF9B 4A2MA 4HUVB 4LMQE 5K9QG 1LP9F 3CH1A 5IMKA 4FQJH 2PO6C 2BHZA 1BD2E 2QQKH 5IBTL 2B0SH 4KMQA 3BEVB 4JQVA 3IRZA 2P43B 3QULA 3WFHB 5AZ2L 4K7PL 2MNUA 2OP4L 1K5NA 3VGHA 5F9JB 1BVKB 4I2XE 4CVWA 1FBIH 4GAYB 1MPAL 3VFMB 3DX8B 2GFBA 4HK3J 4I2XB 2OR8A 4Z9KB 5EBWB 3FB8A 1WWCA 4ZYKA 4S1RH 5GISL 3Q48A 4L5FH 5AUMB 1N3NB 2J7LA 4GRLD 4KFZC 3GEWB 5C0CB 4AJ0A 5J7CC 1N59A 3PHOB 1BGXH 4X98B 4XNMB 3LN9A 1BOGB 2HKFH 2W0LA 4Q58C 2QSCL 3DXAE 1KTLB 5M95B 1XR8A 4MS8D 1OP5H 4CJ1A 1QR4A 3RTQA 4R0LB 2LU3A 4OCRL 3DXAB 3ARGA 3UCRA 1FVEB 3WO3B 1IGTA 3GDBA 1Q94A 3ZDZE 1CXLA 2X6MA 4OT1H 4ZOCA 5CJOH 4H26B 3JVGC 4NWUL 3EZ8A 1T03L 5JXEA 3RWHB 1XF5B 1DQDL 2DKMA 1FL3B 2KKQA 4P3CL 2B2XH 3QUZD 3T1FB 4D9RD 4NM8H 3BRGC 3GSNB 5SWSB 5DJ2B 1WVZA 3NACL 2JIXA 1MAMH 1BFSA 5ITFB 4JLRB 1J8HA 3CDFA 1AY1L 5EU7E 1IQWL 4NQCB 1UXWB 2KZWA 4KUCD 4DKEL 1PKOA 4PJHE 1TCRA 3VGBA 3GGWA 3S88H 1I1CA 3WJLA 2EDTA 4NFDA 4X83A 5ID1B 3IJYA 1JK8A 5L6YH 1MRDH 3RU8H 43C9B 4UU9A 2A74A 1ZLVK 2IMMA 3WFCL 5HHOE 4XNUL 1G7IA 3DV6A 4EOWH 4D3CH 4B50A 2C26A 2KQNA 2V2XA 4WHCA 4PTTB 4MAYA 4FQCH 3T0EE 1GYAA 5MENB 3OKOB 3ZYZA 2GT9B 1C5BH 4X6CF 3QDJB 3CLFH 5C6WH 3DURA 4TVPH 1J12A 1JNLL 3CXHJ 2VLJA 35C8H 1F2QA 1JHLH 4PJIB 1OAUL 2JJSC 3NCBB 3FB5A 4ZSOE 1XCTA 4JPWH 1Q72H 4CVUA 4C57C 2D7MA 5IB3B 1H9VA 3R8BB 4Z77A 4LDOB 4LSQL 2NTFA 4ZOBA 3BZFB 2IAND 1MWAL 3V6OA 4NRYA 5MEOA 1SYVB 1FZMB 1A7BA 5T3ZD 4ETYA 1CD8A 4DOHE 4KQ3L 1IL1B 4KK6D 3ULVD 2BVEA 1MFCL 4I48A 3DHJA 2F8OA 3B8SA 3DX7B 3FO9A 3ARWA 2QQLH 4HIXL 4F7TA 1RK0B 3MO1A 1ZHLB 4R0LC 4P5KB 5DUBA 1CGWA 4DQOL 2BZDA 4X80H 3QHFL 2F74A 1P7HL 3OQ3B 3V52L 2XQBL 1JRHL 4V2CB 3WNLA 4QTIH 5GGVL 3LN5B 3IDYB 2BSSA 4YX2L 2ZG3A 4MJ2A 5JIPA 2ADJB 3PHQA 4NDMB 1HHGA 1WFUA 2OR9L 3JV0A 2WZPD 4ALAH 4NN6B 1FV1A 3FCTB 3MLXL 3EUUA 3H6JA 1T5WB 3AY4C 3FFCB 4U6XB 1YEKL 1KCRL 4POZC 3QUYD 5HVHB 4S1QH 3MV7B 5J1TC 3D5OF 1NBVH 1EH9A 4MJ4A 4KZEL 1MCWW 3MLVH 3JBG7 4P3WA 1FYTE 2BCKA 3L3JA 4L29B 1LE9B 1W0WA 3LD8C 1R3IL 4PJ7A 3T4AA 4CKVX 2R0KH 2ZUQB 3VMNA 4WW1A 1IAIM 2F8VA 4PY8J 3G5ZA 1HQ4B 1HILA 3FTGA 5JMRA 1ZHKB 2V17H 1IGJB 4WFEE 3MNWB 2CDGA 3PG2A 5IEHB 1FC2D 1MCPL 1T2JA 2VQTA 5D7JB 4YXLL 2P8MB 1PX4A 4YXKL 4YPGB 3UC0L 4X7EC 2MQ3A 5GRJH 2B4CH 5HDLA 3DSFH 2H6PA 3JV4B 5J89A 4GAGL 2R9HD 5EBLB 5D7IA 2VITB 2YD7A 1KN2L 1SY6L 1FNSL 2HLAA 4RZCA 3U7YL 4EUPB 4X4YB 1OGAA 4XWGH 2WBJB 4UT6L 4RBPK 1U8JB 2XA8H 1AQDA 4JAMA 2DM2A 2O93L 3W0WA 4MQXD 1KV3A 1NANI 1QO3A 3OR6A 2E7LA 5MEQB 3ZKMD 1KJ2A 1NAKL 4PV9A 5DGQA 4RISL 3Q1SH 1I1RA 3TPUA 3RWCA 5B8CA 3DO7A 4LLDB 5GS0C 4KJPD 1G7LA 3TBSB 4HKXB 4FQ1H 4PJAB 1BX2B 4Z7OE 2QV2A 4LPYA 5DRZB 4C4KT 4LBEB 4ODWB 3IDYC 1JHKH 2PYFA 5BQ7B 4HX1A 2P5WB 2ZOLA 4NN6C 2DM3A 5HY9B 3QIWA 3HZYA 4OF5A 5C92A 4G6KH 3H3BC 2BY1A 2RFXA 2WIIB 5J9PB 2XNAA 1G9NH 5HVHC 1UWGL 1IEAB 4NN5B 4F7CB 3ARFB 1HXYA 4M6OL 1B2WL 1FQ9C 4JFDE 4XH2A 2C4FT 2FB4L 3LS5L 4Y19A 1L6ZA 1MJJA 3MBEB 5DEGB 5C1MB 1JJUA 2Z0BA 4MA1B 2VSCA 2ZUQC 3G5XA 2XTJD 3MA7B 2GW5A 4KVCH 2ATPB 1NFDF 5LJYH 4PUBL 1MUJA 2OTUB 4YJZL 3HI5H 1U8MB 3NAAL 3KXFB 5C0BD 3T0DA 4Y1AA 1S3KH 3MV9E 4QRTB 4LLMA 4OFYA 5HTSA 4EBQL 3QWOA 4NO5B 4WNQB 5D7SH 1LDPH 5D7JC 5DT1L 3WYRA 3EO9L 3P4NB 4JG1L 4K7FA 1Q1JL 2AQ1A 2HMID 1A7RL 4JCMA 3P4LA 4TRPH 3GKZA 2YMXH 3F7VA 2AK4D 3ZDXE 4APQA 3JUZA 2F5BL 3FB6B 1NGPL 3IDIB 3VGAC 4PJDA 3D85B 5TQ2L 1CFVH 2WBJC 5KN5B 4LL9A 4G5ZH 5JW4R 2FWOB 1IQDB 4NOBA 3FQNB 1DLHB 1DBBH 2YD1A 3MACL 1FRGH 4ERSL 5CZKA 5JOFA 2CKBA 3FOLB 4OCWL 2ITDB 4GFTB 4Z5RB 4ODHL 3WDHA 2FLRT 3KPMB 4IHOB 4ELME 4QRPA 5L2KD 3INUH 4YHOH 3ETBF 3BDXA 1A3LH 3BE1H 2FSEB 2HFEA 4XC3H 4C83B 3BWUC 3LHPL 4WTZG 1RURH 4BZ1L 3FN9A 3SE9L 4XT1C 1L7IL 1ZLUK 4XXCC 1F97A 4YGVA 5AYQA 3RIAK 1T83A 5D2LB 5E2VH 4QO1A 2DWEA 2YRLA 2A73B 1VB9A 3BPCA 4YHLH 2IWGA 5IJKA 5GRXG 3TT3H 3SDAA 2BSRB 3CSBA 2LFGA 1TZIB 1CGUA 3KPQA 5CUSH 1AHWA 1YC8A 3MGTB 3H9SE 4NN5C 3ARFC 1P7QA 4D94A 5ICYA 2FR4B 3QCTL 1AGFB 1SBSH 1XF3B 2GJ6A 5E8DH 3O2DL 4G6MH 5IK3B 1MRFH 3TZVA 1FFQA 2DAVA 3O3DB 2VR5A 3S97C 5CINL 2NLJA 4OLVL 1XIWB 3MBEC 5ALBL 5EOQL 3L3GB 1Z9MA 4P9ML 4MA1C 1P84K 1I7ZA 3MRJB 1GC1L 1RUQH 1H8NA 2VC2H 1QR1B 1KGCD 2GAZA 3GIZH 4XBEL 3U2SA 3MUGA 4LKXB 4LQFL 3V0WL 2MWCA 5TH2A 4GG6A 2X9XA 4KI5D 4HJGA 4NKQB 4PY7B 2VWEE 4JGJA 7CGTA 3RWJB 2H3NB 3S5LG 1PD6A 4M7JL 4Z18A 5HYQB 4JO1H 5IM7A 2HRLA 5KZCD 1YUHB 2G2RB 3HR6A 3ZZ1A 5JDSA 3SE8H 2B1AH 1JYXA 2YPLE 1KCUH 4Z7UA 5F3BB 4P23A 3NA9L 1E6OH 1T66C 3UBXB 4AEIH 3W9EA 5EOTA 3S35H 3SKNB 5J12B 2GK0B 4J3TA 3D9AH 1YPZF 1OAYH 4J4PA 3LV3A 1KCVL 2D4FA 4WFGD 3TBTA 1MJUH 3IFPB 4Y5XB 2Y5TB 5KTEL 2YKLL 3LZFH 2NXYD 4M43L 4JY4A 2QADD 5L7XL 4WW2F 3BQUA 1HHKA 1RZ8A 4KROD 3CH8A 3F6IA 2VLLB 3GB7A 5I1KL 1AD9B 1XAUA 5EU5B 4F58L 5FGCB 1ZOXA 1CFTB 5KSAD 1TZGH 4Y2OA 1OAZL 2PCPA 3QDAA 3EHBD 1M05A 4XI5C 3QDME 2BVPA 3DNKA 4WUKH 4AG4L 3WN5A 5KSUB 3CLEL 4FS0A 1B6DA 3SBWA 5ID0A 5KOMC 5KVGL 2F19H 4YXHL 2LAGB 1HSAB 1X7QA 3RWDB 2X70B 5F72S 3S3PA 4X8JA 3RZCB 1Z5LB 2QSVA 4HS3A 5CJBA 5ANME 5F7NC 4ZTOL 2Z31A 2DD8H 3WS3A 3V4PH 1FLRH 4JJ5B 2BRQA 4K3HA 4DGIH 1RULH 3LSOA 1MF2H 4JKWA 5EO1A 3STZA 2VDLL 3C6LB 4ESKA 4RRPA 3WL9B 1G7MB 1ETZA 3JSSA 2BNRE 5AYUL 32C2B 4HCRA 2C1OA 4UTBL 1XIWC 3WHE0 3ULUF 4OFIA 1WZLA 3WXVH 1OP3H 4JN1H 3LQAH 2J88L 4GQ9L 5C08A 5IV2A 1NKOA 3K2UL 1MHHA 3V79C 4PJBE 3LKRA 2ZCHH 2VZOA 1CCZA 1ZT1A 1WCBA 3U9UA 3LS4L 1GHFH 5AZEL 4WTWA 4PGDA 3S34H 2C3XA 1NCWL 5B38G 2R56L 5AEAA 4NQDA 2JELL 1K8IA 1YNLH 2E27H 2V7HA 3FFDA 3L5HA 3ZHDA 5INDA 1X5KA 3ECBA 2VWEC 3ZSSA 3L1OL 3FQXA 4OCMC 5EPMB 5I8EB 1B0RA 2W38A 1NAMA 2YRPA 4ZUSB 3AXLA 3PWLB 1YMME 3NFPB 3OKNA 5TDNA 3X11A 5EUOF 2GITA 5J12C 3C60A 5IBTH 5I16A 2VDOL 4AQ1B 3BDBA 1ZVHA 1IC7L 4Y5XC 5AZ2H 4XP4L 4PRPD 2EDBA 5B4MD 4JO2L 4U1IB 4I1NB 4XVUC 2PR4H 5E6ID 4PBVC 2YPVH 2FL5A 4M7KH 4B7IA 1YN6A 4H0HB 2ED9A 3T4YB 3A6CH 1QEWA 3OAYH 3W9DB 3DUSA 4HIHA 1CDIA 5GISH 3N9GL 1NMBH 3LDBB 5FDWB 3I85A 3DVGB 5ESAB 1QACA 3TYFA 2C9AA 3P73B 1FP5A 1NUNB 3HCVB 2IJ0C 4OLZL 4J3SA 4NKDB 5ESVA 2PTVA 3RP1A 3RZCC 5CBEB 4D9QE 5C0AB 1J5OH 2OL3L 3QIBD 3MXVL 3FRPG 3S7GA 3M1BB 1XGRB 4PJFF 4PLNC 3SDYL 2P5EA 5DJAB 2NXZD 5F6HI 2A6IB 3C6LC 1NGWA 2HH0H 4AT6A 3MLZL 2XN9A 3K1KC 2P44B 4LGPB 1CT8B 3WFBL 3O0RL 5IWLA 3UTQB 1T03H 4WWID 4FTVA 5DRWA 3WV0A 4LIQL 3U0WH 3CSPA 4K2UH 1OAQL 3D69A 3VD3A 2EEAA 3UZVB 1HNGA 1T21A 3HAEG 1WWWX 3NACH 4XNXH 1A6VH 4WI5A 4QYOA 4XVJH 1QUNA 1AY1H 4JB9L 3RI5K 2C5DC 1IQWH 4Z0BL 4DKEH 1IBGL 4PJEF 1FZJB 1SYSA 4PG2A 2YUWA 1KIRA 2P8LB 3CNKA 2ENYA 2F53E 4JFFE 4XX1E 1ZKAA 1N0XL 1KB5A 5HYJD 4XPHL 1ZGLB 1MVUB 2EICA 3WCYA 4D8PA 2AXFA 2YR3A 5D1QB 5C0GB 3RUGE 1J1OH 5ALCL 1HEZB 4XPTH 3WFCH 1NCTA 5I18L 3PGCB 1C8PA 2C3GA 3EGSA 3KLAB 4XNUH 3QQ3A 2QKIB 4PG9A 4ELKA 1HYRC 2KBGA 5C09A 3U79A 3OX8A 2AJXL 1KT2B 1DQTA 1T2QL 1A4KA 4TSAL 3VXOA 4CN1A 4YH6A 4PRBB 1JNLH 1XGTB 1PGRB 2DQDL 1T1XB 1G7PB 5CGYD 2B20A 1YY8A 4G80B 4IRZL 4KI1A 1T4KA 3ZT5A 3OAZH 4FABL 4NQTA 3AS2A 1S7VA 2R4RL 3CCHA 3LDBC 2BNQA 4OD2A 4PBWD 5H37G 3L3IA 4UOW1 3UJJL 2E8YA 1QLEL 2HYMA 4LNVA 4MD4A 3U36B 3VXQA 1RAMA 4KQ3H 5I2IB 1T20B 3KYKL 4RFOL 2HJKA 1LD9B 5B3JF 4IRSB 5HGAA 3SKJL 4DQOH 2D0GA 1N5YL 5HHNB 3V7AG 5FGBC 1Q0XH 1NGYB 2XQBH 3MQIA 2V5MA 4MJ6B 5D5MB 5C0NC 4NJAL 2BY0A 5DTFB 5F70A 3UPRB 4JHBA 1ZVSA 4NQXB 3MLXH 1F11A 4M5ZL 4FZEL 3WNPA 4E41A 5JPNA 2DTMH 2VL5A 1YEKH 4ISVB 2Q8AH 3WUWA 3CDGA 5H2BA 1NEZB 1WIUA 1NC4B 4BJLA 3HZKA 4JFXA 5EU3A 4M7LT 1CLOL 3KPLB 1CU4H 5DS8A 5GGUA 3MRQA 1R3IH 4GKZB 1HXMB 1LNUA 1VACB 4ZFZB 1YNKL 1FJ1B 3V95A 1FFNB 4ONGL 2QR0B 5ACLA 5L8KB 43CAA 1MI5B 2AERT 4HUWB 3NCMA 3TO4D 5FO8A 2OL3B 4LCWA 3BZEB 5DHXB 3LKPB 5D1QC 4UTAL 2E5EA 1MCPH 4BZYA 4QOKD 4PB0L 3ZE2F 5DHVA 4OZGF 4RQQA 1PKQA 1NC2D 2J8UA 2FECI 3UC0H 3RGVB 4PPTA 5HYSG 1YJDL 1B4JL 4LIQE 4HDIB 2X9YA 5ACMA 4X6BA 3DOSA 4J8RA 3U7YH 2R0ZH 1BBJB 4ZFOL 2H32B 3U4EB 4Y7MA 3DBXB 5CEZD 3UAJD 1RD6A 1UZ6E 3A6BL 1CZ8L 3AB0B 3OKYA 4L4VA 3QUMA 4RGNE 3HKFA 4QHMA 1I7RB 3SKOB 4TNVK 3WJJC 5F7WC 1FL5B 5EIVA 3V6ZB 1G7JB 3NZHH 4ODBD 3VW3L 4CNIA 1Q8MA 1QFOA 3X13A 2NY5L 4GW5A 3T2PA 1NMCB 5GGRA 3SOBL 1JI2A 1GAFH 4JRYB 5SWZA 4IRSC 4ORGB 4MNGE 5KVMC 2CIKA 5T1LB 4O4YL 1CICB 3TN0D 4HK0B 1R3KB 3EFFA 4LNRB 4OCYL 2R2HB 4JDZA 5D7KE 1HQRA 1TTGA 2Y7QA 2MCG1 4LPWA 4ZOEA 3K74B 3U0TA 1CFBA 2D7OA 3QPXL 1DDHA 2NY3D 1F3JB 3G04A 4L3ED 4EVNB 1L0YA 4KJQD 1BQHA 3OJDB 1WEJH 5T3ZL 4ENED 3ULVL 4M6OH 1B2WH 3HUJB 3CMOL 1FZOA 3LKQB 3QCUH 3VFVB 4PJCE 1DUYB 3LN4A 4FQXD 3T65B 2AEQL 3LS5H 5GZOC 3ULUD 3QNYA 4YHYB 4HUMB 5EZLA 5F7DA 3QI9A 1UZ8A 4OI9A 4L8CA 2WAHA 3UO1L 1AQKL 3MLSL 2NW3B 4MYWB 2ENSA 1Q9WB 4KKBD 1FE8H 3MRFA 1HDMA 2DYPA 5E8NB 5BO1L 3CU1A 2J6EL 3MR9B 4YO0A 2ESVA 1FCCA 5DT1H 3CZFB 1Q1JH 1JZ7A 1I9RL 1A7RH 1K2DA 3RGVC 1R5WA 1OQOA 5DMKA 3FQWA 1NGPH 2K9UA 3V0AC 5IW6B 1G9MH 1NUFA 4MVBC 1KTDB 4WEBL 4CVXA 4Y4KD 5SV4A 4G8FB 4Q97A 1J11A 3BD5A 2VDKL 3P30L 1S78D 4KK9D 5ENWA 4ZXBD 1WJ3A 3EO1A 3AB0C 5EU6A 5C9JA 1BQUA 2AV7B 1T89C 1FNGB 4CADA 3MACH 4IOFD 4PJXF 4RGNC 4GBXB 3BKYH 4K3JL 3DI2B 5LAXB 4Y2DD 1YNTB 3SCMB 5JR1L 4ODHH 5MERA 4D9RE 4IJ3B 1XGYL 5DDHA 2A6JA 4EJ1C 3FT3A 4BK5A 1CGXA 5BMFH 5K93A 2GSGA 3A6OA 4JQIH 3LHPH 3FQTB 3ZHKA 4M61B 3SE9H 3SDXE 1N4XH 4MAUL 4NHCH 1HCFX 4F2MA 3HZMA 1CICC 1KPUB 3F7RA 2XKNB 1E4XI 3BEWA 5C0DA 3RHWK 5ERWB 3DECA 5D1XA 2G75B 3VXMD 4ZFOB 4NKMB 2JB6A 3ISWA 3B5TA 4PJGE 4NQUA 3L3HA 2MQCA 1ACZA 6FABL 2X4SA 5DQ9A 4P57B 5CEXB 2DDQH 1ORSB 4PP2A 5HYIA 4KH2A 3VU2A 3NFNA 2NY2D 3QQNA 3BPOC 2Y4SA 3TBYB 4N8VB 5JOPD 3V5DB 2P8PA 2E7MA 4YHYC 4FFVC 3V2AR 5CINH 4OLVH 5ALBH 5EOQH 2LU4A 3R1GL 3WLBA 5C3TA 2R0LH 5DK0B 1GC1H 3BUYA 2DLIA 4MNHA 1D6EB 4PJ5B 4LEOA 3DSNA 3R06B 4P2OD 3WDIA 5GGTL 4WY7L 4DUWA 4PGEA 2FYYB 4LQFH 4NQED 3V0WH 4YFEA 1QD0A 2IANE 1SVCP 4KGLA 3LKSB 4M7JH 5T3ZE 4PRHB 2APFA 4EN3B 3ULVE 1W8OA 3Q0HA 1D5BB 5IB1B 1KCLA 5HDBE 3PQYB 4XPGH 2IH1A 3HRPA 5E8PA 5BVJB 2BOCA 1K8DA 3MOBH 4U31A 3B9KB 3ARBA 3PHSA 3J8F7 5DD3L 2VIRB 1V5JA 2VDMH 2X1PA 4DVBA 4XXDB 1D5ZA 5KTEH 3C5ZA 2YKLH 4RCAA 2XI9A 1PW3A 1KELL 2YZ1A 4GBXC 4M43H 2XZAH 3ESVF 4YC2B 3SCMC 3IDGB 3IKKA 4NO0B 5ELIA 4HUUA 4IJ3C 4RX4D 5I1KH 5DVMA 5I15H 2VLKD 3WKML 5CZVH 1DBAL 5LGHH 1FHGA 1KEMH 1GOFA 4UQ3A 4MHHI 2CMRL 4HWUA 5TFSL 3SJVB 1Z9LA 1ZA3A 3WIHA 3VCLA 3P4OB 3NGBB 5EZOH 4EI5A 4PGCA 5D9SB 1YJDC 4HPOL 4R7NB 5KVGH 4YXHH 1EFXB 1IEBB 1JFQL 1OD9A 5AAMA 3GRWL 3PE9A 4N0UE 2JCCB 2I9LB 3K4DA 2VZSA 1JWUA 5SX4I 3QSKB 4XCNB 1KBGL 4UDUA 4X0KA 4ZAKA 3G6JE 3TNNB 4WU7B 5EC1B 3FQUA 4OIIL 5IBLD 5TDPA 1UA6L 4C54A 4GKSA 3ZKND 2R2BA 4S1SH 3X17A 4W68A 5AYUH 4JKPL 4Z7WB 1INDL 4E42B 1W72L 3ARXA 2J88H 1U8NB 1CFNB 3GHBL 1AI1L 4HWBL 2NY5C 1IGCH 5ESQA 5BV7L 1P4BH 4HIJB 3X14A 1RZ7H 5C0JA 3VG0L 1MFBL 3V5HB 5KVEL 2CIIA 2C1PB 3RL1A 5EOCH 2BDNL 2AI0L 4U05A 3LS4H 1ZS8B 1P4LB 1TIUA 3AM8C 3QXDB 3FL7A 1KIPB 4LLWB 5IF0A 3U46A 4EN3C 1VPOL 4J2XA 4JVPA 3LEXB 1DZBA 4MZ3A 4XHQA 3NIGF 5E99L 1T5XB 1X5LA 3HG1D 1LEGA 3IFLH 4WHTB 4RFEB 2FCBA 3O6ML 4M6NL 5J13B 4G8GE 2MFNA 5DFWH 2AKRA 3OF6D 2DQCH 3B9KC 4GRWH 1MCWM 1NMAH 3BWAB 4G8GB 4JQXC 3PJSA 4OZIF 4XPBL 2GSIA 2XN9D 2FJHA 5DURB 4XP4H 4Z7NE 5C70A 4KJYB 5GSRB 4CU6A 1I4FA 2R8SL 3QEHB 4YC2C 1A4JB 2GUOB 1B88A 4WV1B 1I9JL 1L9NA 3D3VA 3V0VB 3PGDA 1CG9B 1MFNA 1TMCB 4RAUB 4G43A 5E8OA 2EYRB 4JJHA 2KDGA 3NGBC 2ADIA 2XTJE 5F3HB 1WFOA 3K8LA 5EDXA 2VLRD 3TVMB 2DLEA 3QEQA 1KACB 1OT1A 5DR5L 4P4RB 5C0BE 4DTGH 4XB7A 3VJ6B 4X6DF 2ORBL 4Y4FA 1O7SA 1E4KA 1ZHNB 2BHUA 4AEEA 1U8PB 1TDQA 4G9DB 2AEWA 5IVXE 3I50H 1YC7A 1S7RA 1JZ6A 3GMPA 1QNZH 1WFTA 4J1UB 5I1CH 4LF3B 1YYLH 5F89A 1NUGA 2AK4E 1NGXB 3WEXB 4P2RD 1KJVB 3PL6D 2F5AL 1OTUD 1RZGB 3C8KB 3DJ9A 1TZHB 1ZT4A 3OKLB 1A7OH 2AK4B 2R9HC 1SJEB 5IFHH 3IF1A 2H2PD 3ALPA 3MV8D 1E6JL 4LIQH 5GQBA 3T77B 3W2DH 1LP9B 4FQHA 2YPKB 2EIZB 3DGGB 4MQXC 4B41A 3SQBA 4KJWC 2XZZA 4DCQA 4LRIC 4Z95H 1HK6A 1IBGH 4K23L 3C5JA 5JORB 5L2KE 2YD5A 4OTXH 5FGSA 4CAGA 2YUZA 4JE4B 3C2AL 4UB0H 2ZCLL 3MJ6A 4LLQB 4R3SB 2Y06L 5DK3A 5J13C 4PLOB 5FHBL 2EYSA 4LPCA 1IAKB 4QHLB 4KZDH 5E70A 2PO6A 4M4RA 1CTNA 1F02I 1YEDA 4UOW0 3IAPA 2HN7B 4KKCC 4U1JA 4AIOA 3LAFA 1VHPA 4KDTA 1VGKA 4X7SL 3I75B 4HPYL 1NCUA 5IJVA 4LASH 2X1XR 2A9MH 3EOBB 3B2UD 4KRLB 5LKNA 1CDCA 2WINB 1EJOH 4TSCL 4O2FB 4ZS6D 3VXSD 1JVKA 1S7UB 2J8HA 4MLIA 4WV1C 3EDJA 4K3EL 1C5DA 1JPGB 3E3QE 5FO9A 1QSFD 3MRCA 2FATL 5ABDE 5HPMB 2ZSVB 5D2NE 4CW1B 4FABH 5FECB 3MLTA 3JWDL 2R4RH 5HI3D 4XP5H 2YN5A 2WBKA 1KPRA 3PDGA 1FG9C 1YEGH 3TVMC 4C56D 4O5LL 1K3ZA 1I7UA 1WAAF 2GCYA 1LMKA 1KGCE 4J7RA 5E9DD 2X10A 2H26A 1YEFH 1XR9B 5IROA 3K8MA 3QJFA 5IHUL 4NSKA 3SKJH 1BQLL 4JEGB 4KI5E 1P2CB 2FHBA 2J8OA 2BRRH 3VE0A 2VERN 1CLZL 2BHYA 4LCCB 3DTXB 3HC0A 3KYMB 4IIQB 1QFUL 4NJAH 4G8IA 2FIKA 4TUJA 3RKDC 3PGFL 2UZXB 5GJSL 4K8RD 4RNRB 3RX7A 3RFZC 3V8CA 4ZUWB 4OIBA 1G7QB 5KSBA 5EFIA 2YK1L 3D1MC 4P46B 3FZUD 1ITBB 3BFOA 3QDGD 1DQLH 2P7TA 3OXSA 2IAMA 3GSRA 3QP3A 1GL4B 1AXSA 3CVHA 1AO7B 2YWZA 3BXNA 2EEBA 4DZ8B 1HOCA 1BIIA 4PGBA 1S5IL 4P2YA 5F1SA 2Q3ZA 4X6CB 5ADOH 1U91B 1IAOB 4FQPA 3T0BA 4LCYA 5FB8A 2CO6B 3QEUB 2Q7YB 1FO0H 4BQ8A 4PB0H 1VGEH 5GRVL