1T6ZA

Crystal structure of riboflavin bound tm379
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
287
structure length
266
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ADP bound FAD synthetase
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords riboflavin kinase/FMN adenylyltransferase
total genus 72
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1t6zA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1t6zA01
1WQ4A 1O0BA 3CTAA 1KP3A 1QRSA 4RUKA 3ZXIA 5FO1A 3IVXA 1COZA 1PG0A 1YI8A 3RJZA 1MJHA 4MW4A 3SDBA 2A1UB 1I6MA 4OUDA 5H16A 4PBRA 1GTRA 5TRDA 3FIUA 3HGMA 4MUEA 2GM3A 2AG6A 1TFUA 1XNJA 3G59A 3ZJTA 5KCMA 1H1TA 4MWDA 4NDAA 3TQOA 2BYTA 2OYNA 3QTBA 2A86A 1M8KA 1OBCA 5A88A 1U3CA 3HL4A 3HZRA 4PBTA 5EKDA 1XNHA 4MUHA 1QU2A 2QUJA 2CT8A 2JA2A 3SZ3A 3SEZA 3N9IA 1U0BB 1TQ8A 2CYBA 2XRYA 4ZT4A 1EE1A 4CQNA 1O0CA 4PBSA 1YULA 3KT0A 4CDNA 2E21A 3CR8A 4XFJA 3KT6A 1QU3A 1O96A 4JZYA 1TYBE 2CSXA 4ZT7A 4R2LA 4ZCPA 1JEDA 4MVCA 4KPUB 4MVYA 3TS1A 1HYBA 4ZCRA 1IVSA 2Z08A 1QRTA 3F3MA 2X1LA 5TEVA 3ZUGA 1TYCA 1T9GR 4U7JA 3PXUA 4ND6A 3CLUC 1T9GS 4NX2A 1NB0A 4DDMA 4MUFA 4YP7A 3E27A 1N2JA 4MW5A 1WQ3A 3OP1A 2WB2A 2XRZA 4G5YA 5KHAA 4MWBA 2X0KA 4HJXA 2HGZA 2AKEA 4OJMX 2ZUEA 4KR6A 1M8GA 4OUDB 1MOPA 1F7UA 3MMXA 1KP2A 1Q11A 1R6XA 1JIJA 2DUMA 4YP5A 4JXXA 2J5BA 3ELBA 4RPIA 2VBTA 1EFVB 5K0SA 1IQRA 1O94D 3CLSC 4YMIA 3TNJA 3CLRD 3ZIUA 1PG2A 1EUYA 1H3EA 3COZA 2CUZA 3COYA 3N8HA 4EG6A 1WOYA 4EF6A 4A91A 1U7DA 4FZJA 1KR2A 1EFPA 1JIIA 3H9BA 1WXGA 2O8VA 2ZUFA 3U1VA 1O94C 2HZ7A 2CFOA 1K4KA 1KORA 2VTBA 1MB9A 1GZUA 1QNFA 1U3DA 1M8PA 3IODA 5J5AA 3VGJA 3A4IA 2NZ2A 3D6VA 1JILA 3VU8A 3CA8A 1LI5A 1OWOA 3PNYA 1J09A 1O95D 1S4MA 1OBHA 4ZT3A 5BNZA 1WXHA 3GLVA 3RHSA 1KH2A 4MLPA 1R6TA 1KQOA 1LW7A 3ZXSA 2P3MA 3NBAA 5TGTA 1NUTA 4ZCSA 3G5AA 5HG0A 4ZCTA 2QJOA 1JIKA 1LI7A 1O5TA 1I6LA 3ND6A 1TYAE 4UZFA 2PZAA 4L2IB 2EJCA 5AHWA 4F4HA 4G5FA 2QJFA 1KQNA 3G6KA 3MLAA 1F7VA 3PNBA 1ILEA 1WKBA 1T6ZA 3P0IA 4DDKA 2DERA 1KAMA 4MUNA 3D6UA 5TEWA 1NB9A 2DXIA 4JXZA 1VL2A 4Q16A 4EG8A 4BWVA 3COVA 1GN8A 3IMGA 3ND7A 4ZT2A 3S3TA 2QJTA 1N05A 1R6UA 3NBKA 1PFVA 3CVUA 1G59A 1XNGA 2VXOA 3MXTA 1QTQA 5DB4A 3RK0A 4ZT6A 5HUHA 5HUJA 1EUQA 5LFAA 3OTWA 2D13A 1I2DA 3X1JA 4MW9A 2R5WA 4QREA 1UFVA 1VBNA 2X1MA 3CLTC 4MVWA 2WQ7A 1YIAA 2QUKA 4ZCQA 2GKSA 1Q15A 2YXNA 4GRIA 4NAHA 1CT9A 1IHOA 1KH1A 1KQPA 3KT8A 1RQGA 3I05A 3FETA 1B6TA 3IUBA 1X8XA 2DR2A 4Q93A 4QRDA 2JANA 1ULHA 3ND5A 4MWEA 2E18A 1PFWA 1JMVA 3SYTA 4H3SA 4DE5A 1QJCA 1NUUA 1OWLA 2WQ6A 2E0IA 1TEZA 1WXFA 4I6EA 1T6YA 1N2HA 2VBSA 4EG3A 4F3RA 4KPUA 1ZH0A 2PFSA 3AFHA 5H7XA 4DJAA 1TYDE 2NSYA 4DNXA 1K4MA 1SURA 3MLBA 3CVVA 4YBRA 1YIDA 2C5SA 1MAUA 4ZT5A 2H29A 1GTSA 1N2GA 2YWCA 1H3FA 2PXHA 2BTEA 1N2BA 4P2BA 1J20A 2CYCA 2PZBA 2PG3A 1A8HA 4MVXA 4NAUA 1O97D 3SP1A 3A2KA 2DLCX 3FNRA 4L2IA 1Q9SA 4HJRA 1NURA 1WZ2A 2QTMA 1F4LA 3Q4GA 3CLSD 3LOQA 3IOBA 1T6XA 1V8FA 4EFKA 4NATA 3Q10A 4EGAA 3DV2A 1NP7A 1PFUA 2A7XA 5IJXA 3UC5A 4MW1A 3CVXA 2V0CA 2I1LA 3CVYA 4MWCA 4YP6A 1N2IA 1VBMA 2OQ2A 2QTNA 4MW0A 5TS2A 2A1TS 1NUSA 2JAXA 2Z09A 3SEQA 2D54A 3ILVA 3X1KA 3CVWA 2VTBB 3PRHA 2A88A 2J07A 3AG6A 3IMCA 1EFPB 3C8ZA 1BS2A 1H3NA 1N2EA 2X3FA 2YWBA 3IDFA 4EG1A 5JBNA 5K0TA 1G8FA 2Z3VA 3H99A 2A4MA 4EG7A 2A1UA 3TQIA 4DLPA 1KKUA 1JECA 2D5BA 2QUHA 3AIIA 4U63A 1NSYA 3RFFA 4R2MA 1N06A 2RD2A 1YUMA 3LCJA 2DEUA 1IQ0A 3K32A 1JGTA 1K97A 3UK2A 1GAXA 3AG5A 1N3LA 1J21A 1M8FA 3JXEA 3QTTA 1N75A 1IQUA 4R0NA 3BL5A 3ISJA 4MUKA 4HPWA 3ZJUA 1N1DA 5DASA 5LM3A 1F9AA 1P7PA 3AKZA 5KWVA 1NUQA 3K9WA 4MUJA 3HV0A 1O97C 1GLNA 1MBZA 2A1TR 1J1ZA 1WY5A 1G8HA 1OWPA 3Q12A 1Q77A 1M1ZA 2G36A 4MAFA 3A04A 3L93A 2E89A 4ND7A 3X1MA 4EG5A 3M5WA 2PZ8A 1M8JA 3HFJA 1I6KA 3IOCA 4DDHA 4I6JA 1N07A 4I6GA 3HMQA 4U8HA 1X6VA 3FWKA 3H05A 4XFDA 1WXEA 1N08A 2H2AA 3IVCA 2YY5A 2IELA 3FOCA 1VLHA 1O6BA 5DEOA 1YUNA 3DPIA 3DLAA 1WXIA 5A89A 3P52A 3TZEA 4AQ7A 3BNWA 1M83A 3P0HA 2CV1A 1OWNA 2A84A 1JHDA 4HK4A 4JFAA 4MULA 4MW7A 3KFLA 1NI5A 5J58A 4K03A 2VBUA 3GUZA 1G8GA 1MB2A 3FDXA 4MQ6A 3CLUD 2RE8A 1JZQA 1WJGA 4MUGA 3PNVA 3CLTD 2QTRA 1J1UA 3TZLA 1KH3A 3UY4A 1NZJA 2O5RA 3MUEA 2J4DA 2PIDA 1N77A 2AZXA 1FYDA 3FH0A 4PY2A 1JEEA 1IFXA 4MW6A 3A05A 5DK4A 5F23A 4K0RA 3N2YA 4XSVA 5J59A 4EG4A 1QQTA 2IP1A 5A8AA 1NUPA 1J70A 4TS1A 1Y42X 1PFYA 1MAWA 4G6ZA 4GU5A 1IH8A 4J75A 2WSIA 1MC1A 2J09A 1ZJWA 4KR9A 1KAQA 1U7XA 1XJQA 3QE4A 2IJGX 1N78A 4AS1A 1P4MA 1IRXA 3UOWA 2B7LA 1OD6A 1JZSA 4QBTA 3SZGA 1QRUA 2V0GA 4UZEA 1Q19A 4X0EA 5LLTA 1FFYA 1D2RA 3AL0C 1GPMA 3DO8A 1N2OA 3IOEA 3L92A 3RBAA 1ZUNA 1V47A 3H9CA 3LE8A 3UMVA 2VBVA 3IMEA 3IUEA 4WSOA 4JYZA 1EXDA 3KT3A 1O96B 2EL7A 3INNA 3NV7A 3RK1A 2ZP1A 5FNZA 3N05A 2OV4A 3ZGZA 4ARCA 2HMAA 1MRZA 3IVGA 1DNPA 3FI0A 5IHXA 1K92A 1EJ2A 4MUIA 3VRHA 2J08A 3FG9A 1O95C 2CV2A 4CDMA 2CYAA 2DPLA 3COWA 4KR7A 3FHJA 1VBKA 3P0JA 2QUIA 2TS1A 4ARIA 4S1OA 4MW2A 2CV0A 4WNYA 1NYLA 2DETA 3H97A 4CT0A 4E1AA 5FO0A 2GOYA 3IH5A 3FY4A 1ZH6A 3CLRC 1OWMA 4J76A 3GMIA 4KKVA 4NZPA 1EFVA 3ZJVA
chains in the Genus database with same CATH superfamily
1RM0A 1ECFA 3PTZA 4MWOA 2J8ZA 3GMTA 4DQDA 4RUKA 4UQPA 4M0DA 2W48A 1P7WA 1YI8A 1A7KA 3LX5A 3JSAA 4Q15A 3I6BA 1JKMA 1G21B 5ECWA 2WR8A 3K0CC 4CCYA 1UC9A 3JAMA 1I6MA 1WHTA 4DK0A 1XZBA 4TGLA 3M4ZA 5BMVF 3V2HA 1NJID 2E48A 5IZCA 1ZD2P 1EI9A 3HGMA 3HE3A 3K0KA 4JB0A 4R3WA 5AKEA 1KZ9A 4OREX 1SK9A 2VJPA 3DAPA 4WCFB 5C51B 2Y1LA 2ZIUB 3V8EA 1ZN2A 2A86A 1JU3A 2CJWA 1PAUA 2R8PA 1DO0A 2X42A 5A88A 3P0RA 1KVRA 2PGNA 4X1IA 2P6OA 4D97A 4DIOA 4GZ5A 1P80A 1D4AA 2X9VA 3ZHYA 2H31A 3AO0B 3OPYB 3W4IA 2B4YA 2C4UA 1NLZA 1Y8CA 2VH5R 1QU2A 1Z2AA 2P78A 3LUCA 3TVDA 2FPLA 2Q4BA 5HBRA 3N9IA 4PABA 1CR0A 4ZI2A 2F62A 4M9CA 1XAGA 3CW2A 3HCBA 3M1AA 4C87A 1NQTA 3CEPB 3HSSA 3ONVA 4IL5A 1P3Y1 3T38A 1O0CA 1CRPA 4HN2A 4CDNA 2XT9A 2E21A 2Y1DA 4JGIA 3I0MA 3HP4A 3PC7A 4KGXA 4QTXA 3WGHA 4WWVA 1DRJA 3O31A 4P3IA 1F1JA 3LX6A 4RYLA 4B6OA 3TM5A 1R0KA 1RHMA 3EVBA 4WVFA 4PR3A 4F8JA 1E7YA 1GT6A 5AJHA 4DLTA 4WNCA 1UH5A 2C92A 1G64A 4JYPA 2X8JA 1LB1B 3UGQA 4R31A 1YHNA 1NB0A 3A0RB 3VR3A 4C08A 3OMLA 5C31A 1O8BA 2ODAA 1N2JA 1BNCA 2NU6B 4KAFA 2H00A 2QX6A 3LDHA 2RG1A 1OIXA 3CMEB 4NG4A 4R9VA 4UNIA 4A8TA 2ZUEA 3WRYA 2X6YA 3VH3A 4R84A 4PHGA 1WF3A 4WLEA 4Y6OA 2JGFA 4BVBA 1A2OA 2CXSA 2W6MA 4LSWA 3L6UA 4NONA 1SVIA 3SBEA 5BN4A 3G13A 3D2CA 2VBTA 2A0KA 3JQDA 4N18A 3TSYA 5GV7A 5HIKA 1O5OA 3GZJA 3OQJA 4YJ3F 1B43A 1L4UA 4Q02A 2AJ8A 3B1ZA 1O87A 2VAXA 5FBLB 3K9FC 3X43A 4YELA 1SCDA 1IBSA 3CQ9A 3V8BA 2BI8A 4DG8A 4B74A 4B71A 4MYHA 4QXRA 1KR2A 5EIEA 1GKUB 3B9QA 1PFGA 4ZQGA 5K8IA 3LS2A 4HSGA 3HKEA 3OUUA 4MB0A 4DCJA 1O94C 4QYIA 1XU9A 2C5LA 2HZ7A 5KMGB 4BVLA 1K4KA 4JL8A 1N3BA 1QB8A 4OHMA 2A3NA 5K3BA 4B3DA 4DIMA 4XTRA 3STYA 3A31A 1J99A 2HUPA 3A4MA 2XHZA 2NO0A 1LVUA 3GPDG 4GH5A 4N9WA 4P4LA 5EKSA 3ZU5A 5KYWB 2WUFA 1HOXA 3NIGB 1PL7A 1V6AA 2P5SA 5JTTA 3ELWA 3OLWA 3O38A 5LLDA 1CUHA 2WINI 3D3WA 4Y1GA 1K9MD 4I8IA 1WXHA 3M49A 2EQAA 1D0VA 1SUDA 2HWXA 3OZRA 4I19A 4LECA 4MLPA 4K5QA 4KLCA 4P58A 3VU0A 4DWOA 1XHFA 2JAHA 1I51A 2C2HA 2KHZA 4BNHA 1E79A 1BXGA 1KDVA 5TF4A 3OZGA 1C9YA 2ZJ4A 1XEFA 2ATIA 2ZJ7A 1ZR2A 5J43A 1NUTA 2OHGA 5BSGA 2HRDA 2PM8A 1N2CA 5HG0A 3JU4A 1N7JA 2YQ5A 3KJFA 3TK1A 3H2GA 4GOJA 1W6RA 4WLOA 3H16A 2PGIA 4M1EA 2I7TA 3EJ6A 3O8OA 4JSTA 3IUMA 5AYVA 1KHTA 5KWVA 5GGYA 3WGJA 5IAGA 2OXFA 1U3TA 5C4IA 2VQEB 1IZ7A 3H9UA 1VCOA 2BGGA 1FXWA 2CB9A 2CE2X 1L7RA 3WFZA 3AZQA 1WDTA 2IC5A 2XE4A 2ISCA 1VYVA 4YRRA 1OPRA 3EBLA 1J5XA 2P5UA 1E64A 4QLOA 2P4SA 2VLBA 5TNXA 3UC9A 4ARAA 4CQLA 2DWUA 1G7TA 4QLBA 3KSMA 5TEWA 3RY8A 2HLPA 1SCNE 1NVWQ 1RHJA 1LDNA 2WVAA 4TMWA 2YICA 3NIDB 5CW2A 1IOVA 4B46A 3RKUA 2G5GX 4KXXA 3AGQA 5L3QB 1FP4B 3H4VA 1STOA 2FHSA 2XXBA 3JYHA 1U9JA 1GARA 4KREA 4HNQA 2RHMA 1M2JA 1XCLA 1DADA 2VIIA 2XUQA 2QT0A 1T5TA 5DJ5A 2OXIA 4H59A 4X0CA 4ZC1A 3C5EA 3OTWA 3WGQA 2V7XA 4HADA 4CDGA 1BEZA 3R9KA 3BS4A 3W3ZB 2Q5LA 3ZW8A 3NJRA 3P9PA 4MW9A 5G3ZA 2UUAB 1IHDA 2GZ3A 1KEZA 1GA6A 2FH5B 1VBNA 4F6RA 5B1YA 1L5HA 5JSZA 1JDPA 5LWQA 2ZI4A 4OHXA 1TU4A 4TTVA 1FXSA 4HEA1 2EF1A 1C3OB 4U7GA 3NKFA 5D1NA 1PJ4A 1KOLA 2AI2A 2HQBA 4G0PA 1K08A 2AYZA 1B6TA 2YBEA 4NI5A 3W5AA 2SHKA 3SC4A 5KYWA 2Z1NA 4IVNA 3FUVA 1I13A 4GNRA 1JXQA 1KSGA 1DQNA 4RAOA 2FE4A 4WA7A 1CDEA 1GT91 1JMVA 3SYTA 1TAHA 3ICWA 3RS7A 1D6NA 1Z7WA 3IXQA 3ZHVA 3TNYA 4WRRA 1L5FA 2IPXA 4PSUA 1MXHA 2CFSA 3FI9A 4ZODA 1D2EA 2FEPA 3WYCA 2O1SA 4I5DA 2R6GA 1J24A 4FR5A 1R18A 1AK2A 3K92A 1U1DA 4L22A 4CG2A 1CB7A 3D59A 4BYMA 4DJAA 3NLLA 4Y0NA 3QLJA 1SVUA 2QXTA 1RKQA 3GF4A 4RF2A 3LOUA 1EK5A 1YDHA 3Q3JB 3H3JA 4GYJA 4L76A 1ZINA 3P45A 5FLKA 3RC2A 1JEYA 1E94E 1TJPB 1TVMA 3ZDRA 5IK2A 2R96A 1VGQA 3L0IB 3O8QB 4JGBA 1QH0A 1TZCA 4JLUA 4X91A 1Q6ZA 2ERXA 3UH0A 4R1MA 1WG8A 2W2KA 4DIUA 5KNDD 3PI7A 4TWBA 5EESA 3KZXA 3RM3A 3DVSX 5BNIA 1Z2CA 3QWHA 3TPCA 3ZK9A 3TOSA 2BN4A 3G4SB 2C7PA 3IP6A 2CNKA 4GD3Q 3DVLA 4A2PA 3ESYA 3MCVA 3N75A 4OQYA 1ZL2A 3BMOB 3EOZA 2Q6TA 1UZLA 2ZJYA 4ZQEA 1UBKS 3P9SA 4IHJA 4R0VA 3T95A 3AHCA 4J7XA 5T8KA 1L5WA 1EWYA 1JWBB 1TT5A 2WHRA 4Z4UA 3BEOA 2IH4A 2RHRA 4RJTA 3H6KA 5LBTA 3IILA 3AEUA 1NSFA 1CZOA 1AGXA 3M1YA 3WWDA 4EPYA 2WWRA 3K9LA 4J4BA 4M60A 3IOBA 3WLMA 4BPBA 2TMYA 4XD7D 2DFTA 3VZCA 1XT6A 1YL6A 2C0PA 2UU9B 1Z4MA 1XKLA 2Q8QA 4O3MA 3NHFA 1E92A 4GOND 3QFTA 1XD2A 3EWNA 4MPJA 4MW1A 3E5NA 1KR5A 3DLCA 3GRPA 5TY0A 4NHOA 2JGRA 2QD2A 3ED5A 3GLRA 5CPBA 3UHPA 1NVBA 2Q0QA 1Q1AA 3EEOA 2FXVA 1YTUA 1ZVMA 1LWNA 2E9SA 5JXHA 3GNQA 5JFGA 1SGWA 4YUYA 3RC3A 2ONZA 2WU8A 4UTVA 1PGOA 1NQXA 3FJOA 3DGFC 3Q3CA 4KYVA 4IDOA 4BUJA 4QEDA 1BDIA 3I5YA 3PRHA 4H60A 2FRXA 2D0IA 5I9TA 4K8OA 2A14A 1T1RA 2FW6A 2PGOA 3K0EA 3W5VA 4MV8A 5GONF 1I30A 2C2XA 2Y77A 5EIWA 4MPPA 1P4RA 3IDFA 4MWZA 3SF0A 3SQWA 4EG0A 3OLVA 2YV5A 4LKOA 3GYGA 2CF4A 3HS3A 4F91B 3PGA1 1JHRA 4Y2PA 5F3DA 1A95A 1HT3A 3IAS1 4JSYA 5E1MA 2YRFA 1UK7A 3DR3A 4IJKA 4UEJA 4W5JA 1O1YA 3STUA 3R5FA 4BKPA 4PN7A 1G5TA 5JW6A 2B21A 2WG0A 3QELA 3MQ4A 2WK1A 4JWKA 4N3BA 2OFXA 3D3EA 4L0MA 4V2IA 4A4DA 1NVVQ 2X4IA 5ADHA 4B5KA 4DJTA 2IYLD 4O4HB 3ONDA 1NGSA 1C7FA 3QG1A 4UMVA 3DLTA 1L5ZA 3DTVA 1RAHA 3THXA 3OZWA 4RTKA 4A15A 3A3YA 1HZZA 2QBYB 3B9PA 3Q85A 1L3CA 3P9RA 4DQVA 3LFTA 3PNLA 1CQPA 1B0ZA 4GBED 2PEYA 1E9VA 1RXEA 3IMFA 2DFDA 4GPTA 5A5EA 2IWHA 3P32A 4O4IB 1ZNZA 3IR7A 1I0IA 4OQEA 3AILA 1CE8B 1SHJA 1EINA 4S1NA 3U3OA 4V0SA 3HB5X 1B4DA 4ZC8A 5KQSA 4WQMA 4HWKA 4NR0A 5CYFA 4POAA 3WKBA 3DXYA 5H02A 4CCSA 3AKZA 5FAXA 5DSZA 3I6ZA 1CCWA 2PKQO 5P8WA 5KS2A 1UBOS 4OM7A 2FFJA 4KO2S 1GLNA 3AM4A 4HX9A 4KO4S 1MBZA 3VKVA 4BLTA 4D42A 5DN6D 4NARA 4MYDA 2QAGA 3ROGA 4O2AB 1Z07A 2BMAA 2R8RA 4Q3CA 4BTLA 5HPYB 5B3JA 1EP9A 1IWPB 1KFCB 2GK4A 4KSCA 1ESEA 2PZ8A 2QRUA 5CUQA 2L17A 4OLBA 1X80B 1P1RA 2XTAA 4S05A 4G8JA 4PLCA 2GN1A 2H7XA 3MTJA 1F8GA 3N2GB 3R5KA 4U8HA 4UU1A 4A3SA 4F21A 1W2HA 3AB3A 1DRKA 4R2JA 1DG9A 1FDIA 4DKXA 1XZMA 2JAWA 1A50B 3IVCA 4LDRA 5F21A 2YJ4A 4Y2VA 3HCFA 4S04A 5AVXA 5F2OA 4KFCA 2C0CA 3DCJA 3P7MA 5LJLA 1Z17A 1W85B 3A10A 4I3HA 1LPOA 2AXEA 3LVFO 3VI3B 1F8FA 3OQHA 1JQJC 4RPGA 1QOPB 3WDLA 4QFMA 5G53C 2PBFA 3OZXA 2VJAA 5EP2A 5HQJA 3T5PA 4MS1A 1MPXA 1R9NA 3JQQA 3HJAA 3T9FA 4DR2B 1HO3A 1HURA 1KO1A 2VHCA 2WVHA 4RTPA 5K4AA 3KB2A 4KYTA 5E4FA 4QTUB 1FDVA 2AMFA 5JXGA 4JLOA 1KAGA 3SF8A 3SFZA 2Q5OA 4BP9A 3CXRA 3IR6A 4KE6A 2O9JA 5B6JA 1BWPA 1J1UA 5L3ZA 4OK5A 1Z12A 1ZJYA 1HRDA 1WY7A 4L8FA 1R12A 5CR9A 3BJEA 3OJFA 3SK0A 2X1HA 1KK1A 3LDGA 4Z4WA 3UANA 1QQBA 3WYEA 3SYKA 5DW3A 3EDCA 1UPFA 2O5VA 3FH0A 4C76A 2E1BA 4ZZ0A 5AQEA 5AVOA 3L79A 2BY4A 2YW9A 1EUZA 3SY8A 4IIJF 1YZLA 2WJPA 4XGIA 3BZUA 1VLYA 1KA9H 1V16A 2XNJA 1D9ZA 3KB1A 3UN1A 2E49A 3EPRA 2Z56A 1Z7GA 3L8HA 4D9EA 1AN9A 3U7GA 2PKEA 5BW6B 5FWYA 3IBSA 2ZAIA 3JVUA 5HZHA 2PMCA 2IU0A 2ZRAA 4H08A 1ZGBA 1ZBDA 4DCNA 4Z1MD 1S2OA 3H42B 2GUGA 4D9MA 4FNMA 1Y3CE 4Q24A 1AH2A 1EU1A 5C7YA 1Y1PA 2E6UX 4PFKA 2H52A 2RHLA 2REQB 1XVUA 3M0EA 2Q7OE 5KX5A 4LY6A 3EE6A 4DJEC 2VNKA 2GEBA 3DFMA 3PYMA 4R01A 1ZJWA 2JG3A 2CD9A 2CDNA 4JVNA 4RVUA 4AVYA 2X9GA 4BNJA 3BMNB 5C1OA 4GPD1 5LD2B 2JFFA 2PO7A 2JLZA 4FM9A 5CLJA 3OTIA 1L4HA 1DAMA 4JR2A 1OD6A 1ZG3A 2EXXA 3SZGA 4PQRA 5CJ2A 4C22A 1EEXB 2QRMA 1K7YA 3C6KA 2V97A 2Y0BA 4BMSA 2PS9A 4LISA 3WGTA 3SQDA 3I9OA 2HSGA 1T5EA 1T2CA 4E0FA 1ZUHA 1ZXXA 3LIIA 4YO8A 2JIRA 2QL6A 4FYPA 5EE1A 3T3PB 4CIYA 1JTFA 2GK7A 3DDZX 4H6WA 4RK1A 5CA0A 1NJ1A 3BGOS 4BO2A 3NIBA 1X1RA 3PHLA 4U2CA 4RDLA 3WLPA 4E0BA 1OROA 1PZEA 3V8MA 5CTJA 2VK1A 2Q1WA 4PZCA 2FCAA 2ZZEA 3PICA 2ZB8A 2J0UB 1XL0A 3FTCA 3WQRA 3WGMA 5I01A 1JQ5A 2M98A 5FWYB 2RH8A 4LYAA 2F43A 3WISA 4E5DA 4IUDS 4QOIA 1URPA 2FWNA 3KAKA 4YCNA 3BY1A 2YMMA 1W9XA 3RRYA 3L1HA 2ZKLA 2D7CA 3YASA 3EXFB 2C4VA 3MJRA 4G65A 3OZFA 2FWMX 1UMCB 3EVTA 2EU8A 4OJNA 3TTXA 3D7RA 3O83A 1JFTA 1OWMA 1SVNA 1N25A 3C74A 3DCIA 3HB4X 5FA8A 4C5BA 2O8DA 1ICEA 1E9AA 1L2TA 2I80A 3U2QA 3FYTA 2CMDA 3OEWA 4RJLA 2OGZA 2PYDA 1VJTA 1J2RA 1LFDB 1SC3A 5LNK1 2FPKA 1M0TA 2ZZKA 4JT9A 4CM5A 2F4NA 1DTWB 2ZCVA 1O2DA 1OZAA 5L9AA 3RJZA 1Z3CA 2KB0A 1E3XA 3UMRA 3Q2KA 3NG1A 3ZWXA 4FHGA 5KSPA 1GVHA 1E3EA 2A1UB 1X7ZB 3IEKA 4Q6WA 2QGFA 1BYUA 5AT1A 4WFKA 3CH7A 3LUDA 1Z6YA 3VBCA 4ZZ3A 2GARA 5EJ8A 4FBLA 1LC3A 3ESBA 3DEFA 2O8CB 2WTUA 4TT3A 1VLJA 4CUZA 1YA4A 1YR7A 4EGCB 4MR8A 4ZYXA 3AY6A 1T8WA 3NM5A 1GZ4A 2XOKD 4XOIA 2OSVA 1GGKA 2Y66A 3ONUA 4HDKB 5IH3A 5ITZA 3SVLA 4LOIA 5DN6A 1R0BA 4ENRA 4LYGA 2JA2A 4WTOA 1JQ3A 2DJ5A 4XW2A 2P1RA 2JCSA 3ZV5A 3Q8KA 1IPFA 3ORFA 4GI2A 4ALMA 2AC4A 2ZXEA 4KQEA 4LYJA 1UZAA 3V8VA 4BNVA 2XRYA 2R11A 5A05A 5FDFA 1WV1A 1L4MA 4D4MA 4TMXA 1DGQA 3NMUF 4WZLA 3OF2A 3FLAA 2QRHA 3PE4A 4WWHA 3B6EA 3NU1A 1XJ5A 3S70A 4DV2B 1OZ0A 5CB4B 2W2KB 3UBMA 5AJTA 1ELOA 1VG0B 4TX1A 5HZMA 4JI8B 1K8AD 3C6XA 2ID7A 5BUZA 2O2ZA 4F38A 1YVUA 4PC3A 3STWA 1AG9A 3KWMA 2C8LA 3V6MA 2XSZA 2HJSA 3ZU2A 1Z74A 1GCIA 3DNMA 2PUWA 2C8KA 1QCYA 3PBKA 4L27A 1NVFA 4UXHA 4EB6A 2PFGA 4JJGA 4M2LA 1YC2A 2OGUA 4JZKA 5L53A 4AAYA 1U2ZA 3B6IA 3CZ5A 1A5TA 4DNPA 4IS2A 4YRAA 3HVKA 3LC1O 4M7WA 3NM4A 3MWDB 1GYPA 1UAYA 4ANFA 3C7DB 3T1HB 2GD2A 2ZM6B 4M0MA 1SC4A 4QM7A 2QR2A 1TF2A 1K1EA 1FQWA 4IOMA 4EL5A 2ZXIA 1OT3A 2V7QA 4P3PA 3V46A 1IQRA 4FHZA 1HG0A 3DEJA 3QUBA 4IO1A 2HR1A 4AMYA 3W04A 3FZYA 3VR5A 2I3BA 4GVLA 3W7VA 1XLWA 3VC7A 5DEIA 3ZE1B 5CLIA 2QVBA 4L3VA 2B6NA 1PKEA 3T9DA 4IEIA 4K9DA 1BQ4A 4CMKA 4Z9XA 4C21A 4DHWA 1WXGA 4P4SB 3T1OA 4DM4A 1Y3FE 1GG8A 1PR9A 2PSFA 2ZVDA 5JU6A 3I32A 1JH8A 1HT1E 4NYMR 4QYMA 4UBLA 4GFDA 2ZFUA 3EX7C 4LXUA 3WYDA 2D59A 2E5LB 2JLAA 2VRCD 2Y1WA 4OH7A 2GNOA 2P40A 3X1DA 4CFYA 1JILA 4LJRA 3MAAC 1M6YA 4O4LF 1ADCA 4TT8A 3NEJA 4IIDA 3I73A 3LSYA 4PC6A 3FPSA 3FFXA 4WT7A 5DV9A 5P21A 1AGNA 3CIOA 5I6DA 2Y4NA 1QIEA 1GL7A 1YV9A 3D02A 3IHLA 2OGWA 1U28C 4HEJA 3ZZ0A 3QY9A 1QK5A 3PQ8A 3SJAA 1VSUA 5BWMA 5DTJA 5DCLA 2ZROA 4GP9A 2P2ZA 5DXJA 1IXZA 5UKDA 4UNQA 2BEVB 1QYVA 4GPEA 4ECAA 1QONA 5CDTA 1A9SA 1Y82A 1ORWA 4Z4CA 4DNQA 3C4QA 2LNDA 3C8MA 1EX1A 3IT0A 3PEEA 1O7JA 3AERA 4DA8A 3CJTA 4WNAA 4JJIA 3RBXA 4C4SA 1QGOA 3UH1A 5KNDA 3FMPB 1K63A 2CHQA 4ALKA 4R2KA 1N5LA 3W8DA 3ZVMA 1C8BA 4IIYA 3TNLA 2IHVA 4M38A 1BWRA 1CVIA 2JJYA 3E9QA 3PUWA 3OT5A 3GP8A 2C78A 2P9BA 2WTNA 5DMXA 1QH8B 2GTHA 4DDKA 3MF4A 2BF4A 3BMCA 3LNCA 4BUCA 1MX9A 2VSQA 3GARA 3B7GA 3BXHA 4I3FA 4ZFNA 2DHDA 4RXUA 5EIOA 4G0XA 3A1VA 4UMDA 4P0PB 3BYZA 2XB9A 1UPXA 3PL1A 3E61A 1SBIA 1JTEA 2I8CA 3IEUA 5BNWA 3AYZB 3F5MA 3BMXA 1M1YE 2ILTA 4R1NA 3TX6A 2CUTA 1T4MA 1AQIA 1ZK4A 2PUVA 3RUCA 5G2OA 4RD0A 3RTBA 5LFAA 4IGFA 4AB1A 4HF7A 1Q0UA 3L8GA 4O29A 1V0JA 2AI1A 1ECLA 2QTFA 2WHPB 3O21A 4FYVA 4PLHA 2R5WA 3N2GA 1J0BA 1U5BA 4MKFA 1VL6A 5F73A 1AIPA 4CR6A 5EQFA 1EWQA 1Q15A 2C1XA 2CLOB 2QRPA 3DDSA 4E5VA 3B20A 3FGNA 4LHZA 1P72A 1TADA 2I03A 3C5WP 4MLZA 4MP8A 4JI5B 3ZCTA 1DHTA 3B52X 4P3NA 2G1AA 2H11A 5ALNA 3HR8A 1PJBA 1UMDB 3ABOB 3ZC3A 1Y8QB 1EHCA 4BS9A 3AUFA 1YE3A 4ZO4A 4MS1B 1Y9AA 4JLKA 2P8JA 1K9SA 2L19A 4MROA 3GC6A 1K28D 2X5NA 3KUXA 3CF6R 5KTPA 4XIYA 1ZVQA 1G8JA 2H08A 2UYQA 2WJWA 1NHWA 4YAJA 1KQ3A 3KVVA 2ZL6A 1AZLA 2IHJA 5A9SA 2QI9C 4C6SA 4IO0A 3FTQA 4EO4A 1RWMA 2X40A 5AM0A 2R5FA 3ZDFA 1EFCA 4BNZA 2QTZA 3UWSA 2PL3A 1FYWA 4PX9A 4EOGA 4N65A 4ZHQB 2HWUA 2GEVA 3DAOA 2QA5A 5KDLA 3MLBA 4E2FA 4IHJB 4O5AA 2JIPA 2Y1KA 3Q7QA 3MMPA 2ZBVA 1ODLA 2HMUA 1JALA 4AP9A 1NAHA 1XELA 1EFHA 2QD3A 2VLIA 1GRCA 3OMWA 1GTSA 3KVNA 5CRIA 4A03A 3H1FA 1HR0B 3ISVA 5B3AA 3T6KA 1HYGA 2HSZA 1KQGA 2YOGA 3ZH9B 1M6NA 5C8XA 2BGWA 3EVGA 5C8YB 2FDRA 3ELDA 1XPOA 1XGKA 2PL9A 5CCBA 3LBNA 4H3VA 2X5XA 1WSBA 4OXRA 1QHNA 3SXUA 4X97A 3O8DA 1WQ1R 1G5IA 5D2CA 5ADUS 2R85A 1CUXA 1XKQA 1V9CA 2G9UA 2R84A 2ZPTX 3G9ZA 2BELA 2BM1A 1TTQB 4GE3A 3DJFA 3E2PA 3RV3A 1EG2A 2C1ZA 2AMVA 2JGJA 1MR3F 2V3WA 3PC6A 4BTVA 2PH3A 4DCOA 4OK6A 3UAXA 2GJ9A 2RGGA 2JI9A 4US0R 5A5DA 3R9XB 4GWLA 1PV4A 2DKFA 3VPFA 1YRWA 5AH0A 2Y67A 3TQHA 4J0GA 5IPFA 2B8EA 1Q0LA 2F3TA 2GT1A 4R4JA 5D3MA 2EJTA 3VZRA 1LTHR 1IHPA 3OFKA 2A1TS 3GEEA 1TKCA 1Z9BA 4RL6A 3A1NA 1JQLB 1GTMA 1NLFA 3DA8A 3OW2B 5IVKA 3W3AA 1H6CA 2EX0A 4OQPA 4ZU3A 3RBZA 4BMZA 3FFTA 2BFMA 3A3OA 4RSHA 3UJCA 3CWCA 5K0NA 1XPRA 3DT8A 3UWDA 5TPWA 1W36B 1PWYE 2EP7A 1XFDA 2A2ZA 1CJTC 4X1YA 5ALKA 1N8RD 4WVLA 5EHIA 1EFDN 2QNBA 1K6XA 2DHRA 4XZ3A 3C8ZA 4DAEA 4DXHA 5EZYB 1N2EA 1D7AA 1HZZC 2NO4A 3BT7A 2PUEA 5CX4A 3JPWA 4QGHA 4RXTA 1QF9A 1BMTA 2H9IA 2HA0A 1EAMA 3B1YA 3C6YA 1CUUA 3H8JA 4FUTA 3LFUA 4O4LA 2W98A 3KNZA 1M2OA 3NHUA 1HFJA 4EY4A 5JXJA 4MI1A 4HYEA 1LJLA 1DC7A 1SKYE 3GRKA 4P7BA 5LA6B 3GPIA 3MEQA 1I3NA 1Z16A 4L78A 2YZMA 1XMIA 1GZDA 1V6CA 3GMDA 5EIHA 3H0EA 1XDDA 2ZJFA 4LZPA 4AKHA 2GB4A 3WGKA 4DA6A 1RI5A 1PGNA 3C3KA 3EQZA 2X77A 2WTEA 1YUMA 4UM9D 4NEHB 1HK7A 3KKNA 3FOFC 1QCZA 4OLAA 1VP3A 4PAWA 4F5EA 3DDYA 4XPIB 3L01A 2UZ0A 1OB5A 5AW8A 5DCYA 2XVZA 2X2EA 4M8SA 2HBRA 1SXQA 3L5OA 3ICEA 4KDCA 2JF0A 2CXNA 3E5MA 4KIUA 5C8VA 4LJ6A 5CX1B 5F5LA 4EKNB 3GCZA 3AW9A 4CTKA 3DTTA 4R51A 4HMQA 2KI5A 3GGSA 2BONA 3O1IC 4Y1RB 4AYWA 1E6MA 2MR5A 1BU5A 4B3JA 1EFLA 1KNXA 2WF8A 5GWXA 1T2NA 4ZU6X 1E2UA 1UEJA 1Z83A 2A1TR 2PYIA 3JARA 3MB5A 1G8HA 1W7AA 1M1ZA 4QATA 4TM8A 4C3UA 4LFBB 1WZCA 3W5DA 1HQCA 2I9KA 3HCWA 4OP3A 1WKCA 1THTA 2OUKA 2V6GA 4AZVA 1MX1A 2IHZA 3O8CA 2WYWA 1O6GA 4I9HA 1QYDA 5CXUA 4HT3B 2Y71A 1BHO1 1LUAA 3IR5A 1GNLA 2J7PA 1QO9A 1ONBA 3HDVA 1JEQA 4O0MA 5F12A 1YR6A 4JLPA 3FKSD 1UBJS 5CA1B 1BOFA 3UTDA 2ZITA 4X1IB 1KWGA 1C0PA 1C50A 4X63A 2FPRA 2G4CA 2HB6A 3T61A 4Q6BA 3GJQA 5B5SA 2CV1A 3Q2IA 2JJ2A 5C3MA 4GQIA 1WA5A 1YZNA 1Z38A 1R1DA 2PA0A 3E3OA 4LMRA 2PKWA 2MTBA 1N33B 3U6BA 5IJ9B 1YA6A 3A6KA 1O3YA 4RA9B 4UXIA 2NT3A 1P2SA 2DY1A 3BVPA 3U44A 4RPJA 1RCTE 3EASA 4XE5A 5EJIA 3HJNA 5AM2A 1R8SA 3CLUD 2UXDB 3PC3A 1QBKC 5DLDA 3H9GA 3CLTD 3R8FA 2J30A 5HMLA 2XUFA 4KE8A 5ALZA 3UY4A 1QFYA 1XEWX 2HK9A 2WSMA 3MJDA 4LRWA 3MUEA 1DIBA 3H9JA 3K3PA 4RA6A 3NPMA 4TSFD 2O2YA 1XMSA 5C81A 1WR8A 4BNDB 3N2IA 4RZUA 2OYCA 1YF3A 1H2HA 3U7QA 2ST1A 1IY8A 5IYRA 1GOTA 4R8SA 3CONA 1PE0A 4E3WA 1GQYA 1IFXA 4DMKA 2I71A 1WL8A 1FYXA 2PA3A 1XXLA 4IXMA 5IU6A 3CCLB 2H4ZA 3TR0A 4DQLA 2WOOA 4UVGA 5AXCA 1FW6A 1KTVA 1J0XO 2C99A 4JWTA 2OSBA 5FI5A 2K2QB 4U9IS 2B0CA 4KQFA 1XG5A 5KNLA 5CM9C 5DXAA 1JMKC 1PFYA 4DLAA 3DXXA 3TOCA 3AHDA 5BN4B 3SHOA 3PWKA 2YINC 2QRNA 4HI0E 2OESA 2IZ5A 4AZSA 1NN0A 4HDMA 5FOSA 2ENWA 4NOLA 4YYZA 3ACDA 3IKTA 2XUHA 4MUBA 1UODA 4CMCA 3HTXA 1N6RA 1P9RA 1RXSA 5DM1A 1G16A 1M1NA 1FLVA 1VL0A 1N78A 2I2XB 4YR7A 3UJBA 2JH3A 3DEKA 4DHEA 1UMBA 4JODA 5C1IA 4C0LA 4C4YA 4L4RA 1GPDG 4JP5A 4CM7A 2C42A 5GGXA 1KYIA 3DZFA 2J7PD 2FP4A 1LPAB 1NG1A 4LF7B 5FUWA 4BO6A 4ZYTA 1EFRD 1IONA 2RGAA 2FGKA 2FN3A 1Q17A 3SR4A 2PUHA 2YCBA 3CMMA 3C7CB 3H5AA 5A1TA 5KB3A 5ALIA 1Z8HA 4DWWA 1T5LA 1Y9EA 2DFNA 3GYBA 4HE6A 4YY3B 4JYZA 3I76A 3KT3A 1SXJD 2PWAA 3E4CA 1ZOOA 3LDFA 3PHJA 3FB1A 3SI7A 1HXHA 3ETLA 4AU1A 4ZEVA 1RLJA 3HYNA 4Q21A 4O1IA 4PS1A 4RHYA 5DHFA 3PPYA 2RGXA 3AETA 3UMYA 4CMEC 4JUAA 4YRBA 1ZL0A 1FNBA 1TTTA 5LBIA 3IQXA 3C3EA 5LBUA 4ZEWA 4IIHA 4F4UA 3EXAA 2QMUA 4GLLA 1O95C 4Q1BA 2COEA 1AOXA 3LT4A 3QPBA 2A5LA 1JHZA 4GQBA 4X1KA 3AC0A 4R69A 4O3FA 2PE5A 2ET6A 2RHHA 3GIDA 2FZLA 4KOAA 3FCAA 4ARIA 1Y4DE 3EEQA 2JJ1A 4NCJA 3C3YA 1UWCA 4C4RA 2ASEA 2O14A 4X71A 3HHPA 3KYCA 5LXTB 2X85A 4DPMA 4LCBA 4GQNA 3B1XA 1ZH6A 1M2VB 5AN9A 1OXVA 4CYMA 4DSNA 3ZY2A 4D80A 3SJCA 4KR3A 2O8FA 4EJFA 3H9NA 4KKVA 3AKEA 5IYZA 3WKAA 4DR5B 1LGYA 1TGYA 3NAZA 4W5WA 1KK0A 4WCFC 2KYRA 2VZ8A 3NCHA 5JMOA 2XAUA 3ADDA 5NLLA 4HDOB 2V9ZA 2WV7A 2VT2A 2P1ZA 5KREA 2QQ5A 3ZI4A 5IS2A 4QUKA 2XGSA 3HADA 4DGQA 1N8NA 4OL0A 4QO8A 2NXCA 1MA0A 4PAOA 5AICA 3UVEA 4XWOA 1WRBA 4F4FA 1UP4A 1DRUA 2GM3A 1UP7A 5AJXA 5FLXA 1GGVA 3LQKA 2HIGA 4Q3DA 3G0OA 4JBNA 2CXHA 4OBWA 2Z3ZA 1YC5A 1L8LA 3I1IA 1RADA 1H1DA 2FW7A 2OL4A 5TJ9A 5AUOB 1W35A 1B14A 3HQ4O 4UEOA 1FSFA 1NASA 1TXGA 3MMSA 4Y8VA 1MV8A 1XFOA 1MIOB 1XPJA 3HZRA 4PBTA 4GVPA 5HCNA 3KPWA 4YJ2A 3HM2A 2W6CX 2XCUA 4XDZA 2PK3A 4DLUA 2PRIA 3K1TA 1Y1QA 1ZI6A 1IB6A 5DIZA 5CIQA 1FJHA 4Q9DA 5C1BA 2VPTA 2XUGA 3VZBA 1SB9A 3IEIA 3H8SA 3T5DA 3MRTA 3G2LA 3AOEC 3R3UA 4ZT4A 5BSVA 2R4UA 3DM5A 2PVCA 4HAXA 2VT6A 2HAEA 2B94A 4ETNA 3GH1A 3IP7A 3KPUA 3IP9A 2NPIA 4JZYA 3QU9A 5T3YA 4AKSA 1Q83A 4I4CA 3CRNA 2OYRA 1QP0A 1G0NA 1RKBA 1ENZA 2JL1A 4ZZ2A 4WL0A 1Y1RA 1JLLB 4UAJA 2F6RA 1QFXA 3NX4A 5JPIA 4CUJA 1FTWA 4HGQA 3ZDQA 3ZLUA 5JZ9A 2Q4RA 2Z08A 5DNEA 1KZHA 4YJHB 4AM8A 4ZIRB 2QMHA 1I9GA 4U7JA 3BK2A 3PXEA 3OETA 4CEIA 2D2XA 3DB2A 3KXPA 5M3BA 1BVUA 1XDZA 2IRWA 3TOZA 4A8JA 4AN0A 3I2YX 4EEZA 2GEDA 2P79A 4OJKA 1W5SA 5LB2A 1QX4A 3U1TA 5JECA 4RTSA 5KHAA 4YUWA 2E7ZA 4DYHA 4XLFA 1RWKA 2F1OA 3HWX1 3OF5A 3PR1A 4KR6A 1KVSA 1ZAYA 1WHTB 1ULTA 1KP2A 2IOFA 3MSCA 3PI6A 4Q9IA 3KXDA 4DA4A 3UPTA 5TGDA 4O33A 1SUSA 2J5BA 1RBMA 4JA0A 4LWZA 1Q91A 4KFTA 1BX0A 1GHTA 3H2HA 4XGQA 4YMIA 5IYZB 4JBGA 1NJFA 4KNWA 4M9QA 5E2BA 3TTUA 2IX9A 3M70A 4IOJA 2Q3DA 1YD7A 3P8ZA 1JAYA 3ACCA 1MU0A 2V9PA 1YRLA 4NH4A 4IS3A 1EFPA 4AC9A 1WTHD 2B8TA 2BIFA 1FQJA 3DC2A 1VA5A 4YRJA 4E51A 5I4IA 1KY5A 2VF2A 2XODA 4PZPA 5KYNA 4Y2HA 2UDPA 4FS8A 2NV4A 4R54A 2I7XA 3UENA 4DMMA 4MXDA 3RREA 5C1DA 1Z5WA 5BMOA 3HA7A 4BV8A 1Q92A 3CFYA 1F6WA 4B3IA 1FL9A 5AIBA 3I09A 3OU7A 4G36A 4J94A 4DPKA 4EA8A 3D4NA 4EJSC 1VGVA 1RXUA 4RTJA 4E7OA 1R4NA 3PEVA 4OHYA 4OJYA 4Q0MA 4XX0B 4YONB 4D9HA 3L7MA 4UFPA 1DZ3A 5BT8A 4AI6A 2B2CA 2QS9A 4MWSA 4B6PA 3VDQA 3VC3A 4G41A 5G40A 4NMMA 4C4ZA 1P1JA 4UREA 3HP1A 4E6PA 4WH0A 3C4JA 3RHZA 5I9LA 1GGEA 3CPSA 1IN8A 1K98A 2PKYX 3B13B 4JNCA 1YQDA 2HQSA 3NBAA 1RC8A 2ZRNA 1E1KA 1ZW6A 1RLMA 3D26A 2XDAA 3DWIA 3X44A 3UGJA 3SC2B 5FBHA 4REQB 4R2XA 3MJEA 4QARA 3QKRB 3QP9A 2O50A 2P2YA 2WE7A 4JC5A 3CUWA 3A35A 3GXOA 4H3KB 3CX3A 2CVZA 3CV3A 4DIDA 2W58A 2XIJA 4YPOA 4LZOA 3N87A 5HILA 3BFKA 2X5OA 3JYOA 4I0WB 4QPPA 4Q9JA 3T1QA 3F8SA 3HEBA 3ZIAD 1NNEA 3VBEA 3TEJA 1VJSA 4IHQA 1TCUA 4UNNA 1FX0B 1TYEB 4YFYA 4KRFA 1SKQA 2AFIA 4FX5A 4U39A 1BEEA 5F64A 2PZGA 4II7A 4DQUA 4BNWA 3QMVA 2AFHB 2HO5A 2OM6A 4FZ5A 5CM2Z 5EMKA 3D6UA 4QA9A 3OJWA 5HZKA 3ANXA 3VOSA 5KHLB 1Y8QA 1ZM7A 1AKQA 3EPLA 2JFVA 3V8RA 4GPAA 3BC9A 2P6MA 3N0VA 1J6UA 4YV7A 3NTXA 2PL1A 5DGTA 1M66A 1T8PA 1G7RA 3FX2A 4HQOA 1XCGB 5E2AA 4E03A 4C7BA 4JEMA 1XDWA 1EG7A 4UD6A 5BQFA 3T0GA 3CUVA 2X8WA 1V71A 3EEIA 2XCIA 3MS7A 5EHZA 5KOJA 5JAMA 4TZ0A 4ZMRA 3WSWA 5BUCA 3OI7A 4LVNA 1TC1A 1NBMA 1WZNA 2FXIA 3QSGA 3KKKA 4N40A 4O1MA 3QX3A 1X7WA 4HDNA 4MCJA 5K6TA 1OXUA 2IDKA 4KE7A 4R9SA 1LU9A 1YVRA 1USKA 5FL7A 1GA1A 5I3CA 4GM0A 1DTWA 1BGVA 3FETA 3TUZC 2DQSA 3B6ZA 3U1BA 5AVRA 3GLFE 4EJSB 3CN9A 1CERA 1A9ZA 2IU6A 3ND5A 2UYHA 1E2HA 5KKNB 1NPYA 3AEZA 2LD4A 1WCYA 1P17A 3LX4A 1YONA 4EK9A 3ETDA 4PWYA 1JDSA 1P4HA 4RVNA 3UT5A 2XUKA 4D99A 2I7CA 1OWLA 4UUQA 1SG0A 1KU6A 3SXPA 5KUTA 2OZVA 4QGGA 4ZICA 1MDFA 2JI7A 3I55B 1JBEA 1JLSA 4RTNA 4GR5A 1JLRA 1GRNA 3ABRB 4LOKA 3DHYA 3F6EX 1AMOA 4IGKA 2XB6A 5EG5A 3P97A 3ZZMA 3QW4B 2ZJ5A 3HC7A 4AK9A 3C7TA 3RFVA 2VF5X 2J3HA 3O1LA 4UASA 3EEFA 4URUR 4G1BA 1JI3A 4QHYA 2YMLA 3EG5A 3F9RA 3FZGA 4X6UA 4CKBB 4YAKA 3R9IA 2Z2ZA 3TCKA 1TMGE 2VYVA 2YWCA 1I7SB 2D7JA 3AR4A 3QF7A 3QLVC 2VWQA 4HFRA 1VQ9B 4L6IA 3UCEA 5C5DA 2ZL5A 4WI1A 3WGZA 4DMGA 5JHHB 5B58T 2QG9A 1VP9A 3A0UA 3IA2A 3IBYA 4DCTA 3SBOA 2NXWA 3MT8A 4Q4JB 4BBJA 1TM5E 3NVAA 4QSHA 1MO2A 2QYOA 2WM9B 4NJOA 3W5JA 2WLTA 2WMDA 1Y37A 3I9FA 4L2IA 1Q9SA 2HCBA 1JB1A 4LJSA 5EXEA 3T5CA 1DCTA 4J0HA 4N12A 1QV9A 3HJHA 3CZQA 3H6HA 4MVJE 2NTJA 3L43A 3PFCA 1F4LA 3F2VA 1ISFA 1P73A 4KC0A 3MGAA 3W3AD 3PX7A 4RESA 1HYHA 3EVFA 5AOBA 3AL2A 1HUQA 1ACLA 5AJUA 5LWHA 2AEEA 1B00A 1Q95A 1AE1A 2A7XA 3D0KA 3EXEA 1YMVA 4GKVA 4Y2UA 3PDWA 2OCBA 1SOMA 2VKQA 3AFMA 4TMZA 4R1LA 1ZNYA 4W6QA 1XQ9A 1TLLA 2PWYA 3FA2A 3VDNB 5AW1A 2EDCA 2OFPA 1M73E 2SBTA 3WLSA 3SZUA 1VQ5B 2C9YA 4H3HB 4OHPA 2BFCB 2FW1A 3DP7A 7ADHA 3TRFA 2FOLA 4RZSA 2XKBA 3TD6A 4AKTA 4JI0B 4F1WA 2RGNA 1SU6A 1DL5A 1VLOA 4BNUA 1M34A 1VOTA 1PL0A 1SBCA 2ZXFA 4ZAFA 1CF2O 3KO8A 1M2EA 3ESRA 3GVXA 3SYNA 4OV6B 2B2XA 2GQ0A 3RAJA 4PZZA 3DGEC 5HFJA 1I7NA 2C9CA 5BWOA 7GPBA 4IFTA 1YE5A 2ZOSA 4PLVA 5FPPA 3QNWA 2V4ZA 2JFQA 2YNMC 1O6ZA 1OAOC 2IUUA 1X2BA 2G9ZA 2OB1A 2IGTA 2WJ4A 1JDBC 4EW1A 2O5CA 2H2FA 3EXG1 4G7XA 5FTWA 3OSUA 1I4WA 2KMLA 5BYJA 2LUOA 1U0TA 3W2IA 2VDPB 3TR6A 4F4JA 3E7DA 1A82A 1J07A 1Y5IA 3FBWA 2YUTA 3H04A 2BFOA 4YQFA 1FPMA 4KXUA 5BWCA 1A71A 1CUCA 2R8OA 3BQMB 2AOXA 4RZ3A 2O8DB 2J9XB 2RD2A 3MWEA 1S8OA 2PBLA 3DZDA 2JATA 3UJ7A 5GONB 3NHJA 2V6JA 3OX2A 4UBOA 3WLHA 5JDIC 3G2NA 3MILA 2W2TA 4ZN6A 1E1RA 1L4EA 2FX2A 1IUOA 4M53A 2N1BA 3I12A 3TW8B 3PQDA 4BMOB 3QVKA 1N75A 2ZBEA 2P5TB 2OUIA 1QIMA 1DJMA 1N8KA 3M9XA 4OB8A 1C7JA 4KUGA 3IMKA 4X20A 4XKJA 5LM3A 3HJUA 4DLZA 4YIHA 3RSSA 3TG8A 2PYZA 1WUIS 1ND6A 2O3UA 4CEJA 3HSYA 2L42A 2MU1A 1H2RS 1YQQA 3NHSA 5AXDA 5I48A 4MYTA 4KRYA 4WKBA 4IQ0A 5BSUA 1J8MF 1GL3A 2QD5A 2QM8A 1E9CA 4IJMA 1GN9A 3FPPA 4R8KA 2FN8A 4WNIA 2NADA 3JQ7B 4KJZA 4TV9F 3T9EA 1E9FA 1G8YA 1UIRA 3PFBA 3TTYA 2YASA 3WKEA 4BQEA 4INOA 2Y8EA 2Q45A 3PDCA 4UPVA 1QBGA 2TSYB 3EQ8A 1Q77A 3FCYA 3HMKA 4R2WA 4US2R 4YR9A 2M9MA 5CDUA 1U7PA 3LQ4A 4ND7A 1F60A 3U37A 2HHCA 1IBCA 4AG5A 4CE6A 2PV0A 3HV2A 1V0FA 4P3YA 1VHJA 1PJSA 3W6UA 3Q5DA 1FZQA 1AGYA 4HDRB 2V8BA 1XZAA 2RB5A 2IY8A 2H2AA 1U9CA 3N2ZB 4E22A 3AJAA 5L3SB 2VPWA 3H1PA 3RRMA 1DDGA 3OE7A 4L6AA 2QE6A 5FL7D 5C9ZA 1U2GC 2VJNA 1F0NA 1FFWA 1BJRE 3ZCQA 4PPQA 2A5FA 4AQ7A 4ODIA 1QHGA 1NAIA 3HU1A 4UHEA 2Q2VA 2GLXA 4N0MA 3NXKA 2XYHA 3KFLA 4X00A 2FG6C 2XWJI 1LSUA 2NZXA 1Y3HA 1WOPA 2PR7A 2J3LA 1VMEA 3AR8A 3AX6A 1I3LA 3IA7A 4TRRA 1Y9JA 3OJ0A 3GA7A 1OAKA 1Q0QA 3UK7A 3LWDA 1DFIA 4BHTA 1YIJB 1CSEE 1R3UA 4EEKA 2NV2B 3W5SA 1MOZA 1U11A 3MOIA 1V8OA 2J31A 3UB3A 4FKMA 3CX6A 4B1FA 2DPYA 2V5UA 3KR1A 1YBMA 3C8DA 2BM8A 1J0EA 5A3QA 2FHPA 2XW6A 4IICA 3PS9A 1JLHA 1YZGA 3RS2A 1QQAA 2XWBF 5DLQC 3RWOA 1S2NA 4RY8A 4P26A 1YCFA 3JR7A 4NCXA 4NH0A 4BNLA 4ZMBA 1DP4A 4WADA 2ONJA 1EVZA 1OLOA 3EMBA 4KK3A 3O4GA 4EUSA 4Z7QB 3OIWA 4EY3A 3LPMA 1J23A 2HNAA 4JBYA 3W9UA 1OKKA 1B2RA 1ZM4A 4RF4A 4DZTA 3C6QA 1JQBA 3FUWA 5FPHA 2Z04A 4BDTA 1MJNA 1DX6A 3ORHA 4M54A 3OY2A 2AD1A 3UB2A 1UJ5A 1BWQA 3KZMA 1NN5A 3VO9A 1HKHA 3HRHA 4TS1A 2AEFA 2Q3HA 3EGVA 1NVGA 1A2QA 4FIDA 2ADOA 4B3TB 4OMFG 4KRXA 3GGPA 4IXNA 3BWEA 5I7EA 3ELYA 4P2NA 4EBBA 5KJ6A 1XJQA 1Q0ZA 4WLFA 1TLTA 4FYMA 2BBSA 1SJ9A 4FYXA 1N9GB 2WUVA 3QVSA 1SQ5A 2B7LA 2OP0A 2QSYA 3RFUA 4QBTA 2YY7A 3N2LA 4BAGA 1LBHA 3BG5A 2KSQA 4X0EA 4PAQA 1V1MA 4G4JA 1Z45A 3GUUA 3CS3A 1X80A 2DOKA 1FNSA 1OFIA 4H7HA 4RF5A 4DSUA 4DY6A 4AKIA 1T10A 1E1NA 2IE8A 5TMPA 4TYNA 2QPAA 4MMZB 4FWTA 4IGEA 2C5GA 1JDZA 2OVFA 4YALA 1FRVA 4OJTA 2RAVA 2Q99A 1HLGA 2QUAA 1TEXA 3QVOA 2FMIA 1J4AA 1RZ3A 1ML3A 2DVMA 2DUWA 4ARSA 1EK0A 4Q05A 3IBGA 4ZP1A 5CVUA 2ZP1A 2ZRMA 2R00C 1EVKA 4PRKA 5DM0A 1NVVR 5A0FA 1GNRA 4EW6A 4NLLA 1HDGO 2VDUE 4LJ4A 2EZ8A 1AHIA 2ZJ8A 1W4BA 3IDOA 3OIUA 4YRKA 1HY3A 4N76A 4L9RA 2WHEA 1SKUA 4RHFA 5LNK6 2PIAA 3L02A 2ID8A 4ER6A 3NALA 1I36A 1R0ZA 4B35A 4HZUA 4W1RA 1CZLA 1NOKA 4FDVA 1QFJA 4NL4H 2GPJA 1SIBE 2X3UA 3TQFA 4FOPA 4CLEA 4O4LB 2PLAA 4MW2A 1YASA 3T5GA 3ABSB 1N5DA 4CT0A 2XNSA 3QEKA 1UZMA 4B3HA 4YACA 3EDYA 3ZQJA 3AR6A 4DLBA 1A9TA 2H6EA 3LXRA 4UCWA 5TPWB 9ABPA 4ZCIA 3GLIA 4B6QA 2ZE7A 1VB3A 4GOXA 3T41A 2EFHB 3EMKA 4XTCS 2GHTA 3PHGA 4EJSA 3IVXA 2ANBA 1PG0A 4RE6A 5GJBA 3IBCA 4A0RA 4LZNA 2Q4OA 3HU3A 4BO8A 2FSFA 2QM0A 1JKXA 2W6JA 2BEUB 1O6FA 1THZA 1X38A 3FIUA 3OZVA 3GAZA 2AG6A 1CXZA 3GRVA 3G59A 3LC7O 4YLEA 1PZFA 3O47A 4JI1B 2BYTA 5JJLA 1PS9A 4PLYA 4D6PA 4PYRA 1GITA 2FR8C 1WCWA 2ZYGA 4MCIA 5JEDA 2XD4A 4CTNA 4Z4GA 5EEHA 2OHJA 3H0CA 4W7SA 4HQ6A 3SNHA 3FOAA 3FFWA 2GVNA 2R8BA 3M6UA 3S2UA 4BCDA 2Z3WA 1PJ5A 1XK7A 3L7JA 4XPZA 3SOPA 3H7IA 3ZLTA 4F5WA 2ONKA 1Y6GA 5D8DA 4BJ3A 1BCSB 2IOQA 2JFOA 1T91A 1MGPA 3GN1A 2JZOA 3QUCA 3EGXB 3EFOB 2WZPP 1D03A 1BX1A 2BCEA 4OQDA 5I8PA 1N7IA 4WOBA 1TPZA 5MFPA 4XJXA 1WDKA 1PYGA 3U80A 4OYHA 3U5ZB 2CSXA 5L40A 1ZONA 4ZCPA 4CCWA 1DKQA 1BLIA 3ZWPA 2KWIA 1MV5A 1WVMA 3ZD8A 3F7MA 5DM4A 4UOQA 5DTEA 5H81A 2ZXUA 4NZZA 3LBYA 1NI4B 3E9YA 2QE7D 2IQ5A 3W2FA 1GPYA 1I2AA 1L9XA 1UINA 1WEKA 3ZNQA 3FHTA 2E85A 1JX6A 2Q4TA 3K2IA 3OP4A 5IDVA 4DXDA 1M0EA 3ER9A 3E27A 1F4VA 4MW5A 1W93A 4AQDA 4HE5A 4EATA 3HNPA 4KAAA 4FB5A 5F52A 4XVUA 4DWVA 4RWEA 5FOWA 5CFLA 2VSFA 4HJXA 4QD3A 1TA4A 4NZNA 2C58A 1M8GA 2BR3A 1X0VA 1EGMB 4NV3A 1XLUA 5D3KA 5KPJA 4UZUA 1PDVA 2XOEA 4URXR 5HS4A 1MH1A 2XOKA 1GEGA 3V34A 2OM2A 5K2OA 3ZDBA 5K0SA 1RAEA 3TNJA 3RYCB 2XMCA 2O57A 4MR7B 4HRXA 1Z0JA 5JEEA 2D5LA 2CUZA 3V7YA 4B09A 3N8HA 4NCKA 2JD2A 3AZPA 3VOTA 2R7LA 1C1DA 1LVGA 2G25A 3DB1A 3GEPA 1YXMA 3DFIA 2EJVA 3AR2A 4RVDA 4X85A 1LPNA 5JCXA 5HKKA 1NLMA 3MCAA 2WU1A 3F1LA 4ACBA 3LT1A 2Y1XA 1KMNA 3U1VA 5G4KB 3ZHUA 2JAOA 2JAQA 4OQNA 3W5BA 1CJSA 4WN3A 1PQYA 2Q5FA 2UYGA 4HAOA 4ID9A 3KCNA 2HF2A 2OTCA 4I5IA 3AOGA 4OQQA 4X1YB 3GNSA 4UDNA 3V4LA 4HUJA 4X90A 3GIWA 1D3AA 5K45A 2ZSFA 4C0JA 1DC6A 1MA3A 2G77B 2OBBA 1FPQA 1QX3A 3L8FA 4P93A 4ZT3A 1J8DA 3TBFA 4DAOA 3BJRA 3QM1A 3QLUC 4EARA 1ZVVA 2PMFA 4HPXB 4PYMA 2R7NA 4ZZIA 1UM8A 1XMVA 2NUAB 4RLZA 1FFXA 4BKQA 2IITA 2MMGA 5MHTA 2HW8A 3V1KA 4KVFA 2ECKA 4DV0B 5JSFA 2PDAA 5C4MA 2G71A 3R3ZA 5BSKA 4BB0A 4ZOLF 1X74A 1J2UA 1LSOA 2FSUA 4RDKA 2Y93A 1RP7A 4NF2A 4TV8F 3HKCA 1LI7A 5KX5F 4YX9A 1AJEA 3G0CA 4ETIA 4I9NA 4JFRA 4XDGA 5EHGA 1PUXA 1YQTA 1U1EA 4HCJA 3KQKA 3PFFA 1AV7A 2IXGA 3ODPA 2VJDA 3MJVA 4KX3A 3DLPX 4X1OA 3E7FA 3M3PA 1AXGA 2Y68A 3SDSA 5EZSA 4JI6B 1KJNA 1XXHE 5IT9A 3O8RA 2L69A 3EBPA 2Z9CA 4S35A 3ROEA 4CI9A 1WKBA 3DTYA 2LCQA 6LDHA 3KFVA 2IH5A 1UXJA 2IYAA 2VF7A 3BERA 3P0IA 3JTEA 2WG1A 4JITA 4KKXB 2O54A 1JJ7A 4BJ5A 2BR4A 5E95A 4E5UA 3DG9A 4BLOA 3GHYA 3HR7A 3QKTA 3SWWA 1G1AA 4IF6A 1HETA 4ZAGA 4GC9A 1IUPA 3F6SA 5CHEA 3NH6A 2XQKA 2IEBA 3BC1A 4CIWA 1TM1E 1MW8X 3IIEA 2VJIA 3TGLA 4PLZA 3LWNA 3ANLA 1L5VA 1NR1A 4IMRA 3GRCA 8MHTA 1C7ZA 2YJZA 4PSDA 3CCMB 4H27A 2W6JD 3FPCA 3D1VA 4M1YA 3OZDA 1FNNA 4FFWA 4NYIR 3B70A 3QU4A 4OMUA 3K0FA 3O94A 4OGGA 4HDRA 2CLDX 4HNGA 4UBIA 1UFVA 5TDHA 1A9PA 5C2JB 1WSDA 4MVWA 4TTAA 3ZDAA 1IUKA 4Q9NA 4ENPA 5M34A 5REQB 2WLSA 1ZSVA 5K5EA 4J0CA 2FUCA 3LRXA 3NB0A 3THWB 4NAHA 1X1CA 2PX2A 2ZR9A 1RPTA 3NJ4A 3C3MA 1H2BA 1NIJA 3PD1A 4G1FA 4MJ7A 5TQ0A 4Z7OB 5BURA 5FUMA 1E7WA 3RYHB 1W9HA 4DBLC 4NAVA 4C5CA 2QENA 3IUBA 2G1JA 1KI6A 4HTFB 2EW1A 4MUAA 4Z3OA 4KQMA 2W6ID 3GT0A 4RJ2A 3K8ZA 4YO7A 1WZUA 4RFLA 6AT1A 5COQA 3LQ6A 5DNCA 4HVTA 1YCGA 3B8HA 4LOLA 1LBEA 1N0HA 1DXHA 2BM0A 1ZX1A 4IVQA 1B73A 1YZ3A 1KI9A 4XB6B 1TEZA 5ENVA 3C3CA 3I9V6 1T6YA 3BF8A 1KC8D 4IWNA 4MLCA 3LU1A 4RE5A 2JIDA 3N8KA 3PITA 2FDCA 1E7SA 1JR6A 4N6NA 1T3HA 2ZBFA 2Q49A 4ND8A 4R6XA 3ZOZA 2EWWA 2ANCA 2LV8A 3M82A 4ND2A 3V00A 1SIOA 5CTAA 3GLHB 2RJOA 2ZWMA 3RO7A 2ZAMA 2HDHA 3K70C 1ESNA 1Z0SA 3LGSA 4JT4A 4PHCA 3IIKA 3WLAA 1P7CA 1RYFA 2GJAA 1OLXB 4UEQA 2ODEA 2E4UA 3OKPA 1VIVA 3EA4A 3HEAA 3MGGA 2XYQA 5EMMA 2D2IA 2YVKA 3GT4A 4G8DA 2PBRA 3DL0A 1RBZA 1YOBA 1JYFA 1XFAA 1BKDR 2XB4A 4KQWA 4L8VA 2OZKA 1A96A 4EGSA 4K0KB 2OMEA 1E8MA 2QXYA 6Q21A 4Y6GB 3UUFA 2CYCA 1SXJB 1Q84A 2PG3A 2PZBA 3OLQA 4QUIA 3SLGA 2DLCX 3WJAA 1P3JA 1M7BA 4M87A 4AJ2A 2H5EA 3GELA 3IAM6 1MAAA 1BJKA 3GAMA 3AHFA 2ZT7A 2QP3A 1UPTA 3M4YA 1G5QA 3CPEA 4H18A 4KVZA 4X8MA 4CF7A 4C05A 5IKMA 1TEHA 3V42A 1LS1A 1A7JA 3TIVA 3UC5A 2ZZMA 4LYYA 2F90A 2HL6A 3MRSA 1Z15A 1EUCA 2JFWA 1JHUA 1YMQA 1VC2A 2VHVA 2ZTSA 3JCZA 3QYJA 4HDMB 3ZWAA 1OYWA 1Q7EA 3GV0A 4P53A 4AG3A 3U4IA 2E5WA 2B78A 1ZMTA 4OU4A 2F3UA 5TS2A 2PUBA 3A25A 2QLMA 3G2OA 3CHYA 4GC5A 1SO8A 1TM7E 4MV1A 4NFSA 4QYXA 2ISQA 4ZEXA 5JDIA 4O8CA 2IVZA 4HNRA 1FBTA 5F4MA 1D4OA 1MORA 4EJ6A 4NJMB 4PFQA 1U3FA 3AUXA 4UHBA 1JHAA 2IOHA 3AG6A 3IT2A 3K8OE 3ZKWB 4L9AA 3ZTTA 4EMBA 4O4IA 5H5JA 3RG8A 5JCOA 4EG1A 3I6IA 1J22A 2RHJA 5ECDA 2C8VA 1RWNA 4OGLA 5AJVB 3KCQA 3T0IA 2AS0A 2WJVA 4QDTA 3D6AA 4KACA 1N6KA 1TRHA 4ARZB 3NGLA 1N6OA 3S29A 2QY6A 3I58A 4XB1A 4KN8A 1W75A 2D5BA 2RC6A 1I4DD 3BL8A 4E5NA 2PE3A 2CNWD 4ALLA 1YNOA 4CTOA 1KMIY 5C7IO 2V55B 2PQ2A 1UC5B 1XLTA 3KBBA 2R6JA 1LDYA 4GG1A 1N4AA 4JU8A 1KL7A 2QZ9A 3B1JA 4QHTA 2HMTA 3AETB 1BG6A 1KO8A 4HN4B 1EFKA 1FFDA 3L82B 2B7CA 2IYTA 3EMDA 3WNDA 1W8IA 1NUAA 3IDZA 5BW5A 1F38A 5KYTA 4M0EA 2IHUA 4W7IA 2G9RA 3NFRA 4D4KA 1G1MA 2R7AA 2XWPA 4YRSA 3KJXA 2J3QA 2KLBA 3JXEA 2HPHA 4NKRA 4C01A 1VYUA 1CRWG 2WHQA 3U4MA 4HGOA 4HPWA 4IFBA 3VYUB 2G9NA 2C4WA 1F9AA 1YRBA 4H7FA 4HDQB 3DR5A 4JLMA 4PO3X 2J0SA 3MGCA 1YB7A 3V8NA 3BMOA 4MTLA 4OPMA 1A9XA 1OCEA 1XTQA 2GBFA 1K8YB 3AHIA 3PWTA 4NBVA 3VKWA 5B1IA 3ZLJA 4CCAA 2HJWA 1SCIA 2HH9A 4JP8A 2VDNB 5I9NA 4YXFA 1T1EA 2WT9A 1QAMA 1S2GA 1E9EA 1T13A 3P96A 4HH4A 5CGZA 4BNFA 3RAFC 1AHHA 1KIAA 4XJTA 5JC1A 1ZH8A 2G36A 5CCXA 1EUCB 2E89A 2ZATA 3KSRA 2DE0X 3CKYA 2ATCA 4FQ7A 2FSIA 1C3EA 2L2QA 3NH9A 4RM2A 3HFJA 4QELA 4GMGA 3A3KA 3UMGA 4NYJQ 5DNYB 1G42A 4LHYA 4NV0A 4C0QC 2YIJA 10MHA 3FWKA 4XFDA 4BGVA 4TSRA 1FB5A 2ZYAA 4DLLA 5BR8B 5SZJA 3SZRA 3RLFA 2W2MA 1WB5A 5B1HA 2UZ4A 2HT6A 3N86A 2PR2A 1HNZB 1L6IA 1TUBB 3JR3A 3P0HA 2H1HA 1H2XA 8LDHA 4ERNA 4XEHA 3SF8B 5D3QA 4MULA 3T4UA 1W59A 4GL2A 4M1WA 3GRZA 4Z0PA 1KZ7B 1CUGA 2H07A 3IPCA 4BNGA 2XQVA 2JFBA 2GPAA 3CT6A 1UL1X 1TZBA 3DE1X 3WICA 3F9CA 1OFVA 4BECA 2W6NA 3GO4A 1XQ6A 1QV7A 2R87A 3H17A 4KKUA 3AWIA 1T3TA 4I50B 5GOZA 1XDSA 4NC9A 4TYMA 4LN1A 3GLUA 4OOSA 4XIJA 5FV4A 1RIFA 4Y9RA 3UJAA 2GD1O 1KH3A 1CW2B 1JAXA 1YB6A 5HRUA 4OP7A 1DRVA 3QEJA 3W79A 1ZXLA 4LZLA 4RAQA 1P0PA 2J4DA 5CA1F 5FUQA 4HMPA 1U5BB 2VAWA 1NKTA 3TIFA 4I8DA 4UTXA 3LXXA 4OHOA 4AUNA 1KOJA 3VTFA 2GRUA 3S1AB 1J8QA 2JARA 3MTIA 3WHPA 1SCBA 1OIVA 4NPAA 1L4KA 4L3WA 2VSOA 3BUSA 1ND5A 3NHYA 1UXHA 4S1PA 3MNFA 4P12A 1HQDA 1TW3A 4M9RA 4Y18A 1GRRA 2ZQ5A 2CLFB 4OH1A 3HXOA 4D3DA 4JJ4A 4MR7A 2HRZA 5EJGA 3RARA 5A8AA 3NWEA 4IOKA 1IIRA 1YL7A 1ZISA 2AD5A 3GAAA 4WEOA 4EGJA 3AQ4A 5E6UA 3QBDA 3JQPA 3BQNB 4OAPA 4B3MB 1INLA 3QXGA 4Z4IA 1PVVA 3A8KA 3T7IA 2CBZA 2ERYA 1ZIOA 4DR4B 3I37X 1JMYA 4MS3A 3R20A 4QUAA 3SEAA 4Y0VA 2OECA 5MGNA 1FJGB 1TZMA 4IVRA 4KUEA 1TNDA 4UVIA 1WBDA 3WO0A 3UNXA 1YUBA 3A9TA 4GO1A 3KJIA 1R0WA 5HX7A 4D9JA 1VCNA 4LHSA 5CMLA 2GCNA 1GCOA 2JIZD 1N2OA 5AMXA 2VNSA 2W2XA 3L92A 1SVLA 4TVKA 3ABIA 1IBMB 4NEGA 4XLHA 3I4FA 3NT5A 4ZYZA 3GJTA 2ODPA 1PJ3A 1RZUA 4GLJA 3ED1A 4XCVA 1GGHA 1QKJA 1IM2A 1FCJA 2H9AA 1L7DA 3ICVA 1RYBA 3IIMA 3GLFA 2AHOA 2NQ2C 3C39A 3NV7A 3ASRA 1RVV1 2IDZA 4WLVA 5B2ZA 2X0IA 2BFDA 2CWDA 4I55B 3ZBQA 2Q41A 2O2JA 3B85A 3E48A 2ZRFA 1L5NA 4MHOA 4Z9YA 4D7AA 2H1SA 1S3FA 1B2LA 1DFGA 1CQJA 4K40A 2N46A 3KHTA 1MB4A 1YZKA 2WNIA 3JQEA 4YDSA 4DTIA 3QSYA 2C97A 4E21A 1JJFA 1UMCA 3PU6A 2EW8A 4P22A 1IMJA 1I01A 3CEMA 2QUIA 2FVGA 3CZ4A 3T1NA 4WXPA 1CTQA 2IIVA 4FFNA 5EMJA 4N5DA 3H5NA 1SBZA 1QFZA 3D4IA 3E8MA 4WCFA 1AN0A 4J1TC 4X7EA 5EIAA 1S9HA 3F4KA 3PJDA 1Y8RA 3CX8A 4PPFA 3WP1B 2C5BA 1I0ZA 4BX3A 2V5AA 4AIRA 2X0NA 1NPTO 5LYJF 1G3IA 2WIFA 2RK4A 4PGMA 3ZHCA 4AY2A 4RH3A 3TBHA 4ZO9A 3HJTA 1GSOA 3KEOA 4B45A 2ZJ1A 1C0IA 1NPDA 1X86B 2ZT8A 1J56A 4KVAA 1BE6A 4W9NC 2J3DA 3PA1A 4WERA 4C7JA 3PIDA 3UJ8A 5LMZA 3UYLA 5TRDA 4ZJUA 5LMNB 3TLAA 4L5CA 4QV2A 1QOQB 2G63A 3E9MA 1PW7A 5L45A 2IYRA 2R25B 2WTBA 4PAGA 1PUJA 1DJPA 4KXMA 4PFSA 5F2KA 5FQOA 3D4LA 2Z2YA 4K8RB 5KJ1A 1E6LA 1N9KA 1YJCA 3FTEA 2RHGB 4KXNA 3GROA 3AZOA 2NU9B 5DP1A 4CMGA 4HMOA 5K03A 2FPIB 2G17A 4V0MA 2HA7A 3T34A 4D57A 2O0KA 3KQHA 2QL5A 3OCXA 1A4RA 4NS1A 2IYWA 1TO1E 3SEZA 2HQOA 4ONEA 4PFJA 4PXAA 4XPIA 3B12A 2AZMA 5AK3A 5T3UA 2BDTA 4B80A 1U4NA 1NVDA 4OOEA 4JJZA 1Z68A 4KIJA 2JGMA 2AZ4A 1C0LA 3MRVA 3CC4B 4LTDA 5TV2A 1QH8A 1IL0A 2JHCA 2ZBDA 1CD5A 2R6FA 3H2IA 5ER6A 1NBIA 4WD3A 4P38A 2Q46A 3GDWA 2WWIA 4XYEA 4EHJA 1TYBE 1ZZEA 3JQGA 3KWFA 2II6A 4PXYA 1MAHA 4UULA 4ZT7A 4ZYLA 1Y5NA 2PH1A 2HHAA 2IYEA 3HI4A 5G41A 1TEVA 2OV6A 3TW4A 4MVYA 3KYCB 4CF3A 4XWAA 3QU2A 5FADA 4X07A 2GJKA 4IYJA 1MAVA 2QSJA 2QKYA 3ZUGA 1E3TA 4YAIA 4FYIA 4D9IA 1QR2A 2ZB2A 3WSTA 3ZXYA 2A6PA 4Z7NB 4YP7A 2BSXA 2DB3A 1V7PC 3ZWVA 3FPFA 1YQ9A 3KTAB 3AP3A 3RU7A 3O2NA 2CLHB 2IYQA 2NO5A 2YYAA 2XMRA 3HG7A 3HAGA 4MNTA 3S2FA 3ZE9A 4DCSA 3MAJA 1F2UA 3ZHRA 1WOMA 2NYUA 5G1PA 3VPGA 4WZEA 2VT7A 4M55A 1MRSA 3OESA 3UJDA 1UKYA 2GCGA 2QVXX 5JMWA 1VJ5A 1OLSA 5KQMA 2BR5A 3JALA 1PJ6A 1MNAA 1PNVA 2WG2A 3IUQA 4E2WA 3IJEB 3JU3A 2FY8A 1V11B 1Q2UA 2O2CA 1IOZA 421PA 3OZAA 1GVNB 2P2NA 5DX8A 5ECYA 1M2GA 1MFPA 3BK1A 1G60A 3GH3A 3KTOA 4I4TB 5CFZA 1LDBA 2P75A 3EXFA 3UCFA 3Q1KA 4GYKA 4KTVE 2V45A 1OI4A 4AW9A 5DBFA 4UUNA 5ALXA 2FNAA 4NJMA 3WL6A 3IPRA 1KQSB 2XADA 4RACA 1Q0SA 1M8PA 1CVRA 1IN1A 3H87A 1Z0UA 1KQFA 1DIHA 3H1GA 3EXIB 3IYLW 6REQB 1IJKA 4WOJA 1KI8A 3CCJB 5BNTA 1ILWA 3AF5A 3DV9A 4UHHA 3WLEA 4K6GA 1O4VA 5AXBA 1LI5A 1XHEA 3I2GA 4AJIA 1S4MA 3D0QA 2OY0A 2VDQB 4J7CA 3NUQA 2EC5A 4G23A 1J49A 2O7VA 3GLVA 4JLWA 2C5EA 1KH2A 3IQHX 1IEXA 1CUDA 3ZI7A 4DMCA 1KERA 2PX5A 2CVFA 2FZEA 1U1GA 4CIXA 3SLKA 1PLLA 3PKZA 4QJBA 1KOGA 2PJZA 1CFZA 2FEAA 5EERA 2DUNA 2FQYA 4OXXA 2JEYA 2VUTA 1MPTA 3DBIA 4HGZA 1A3CA 3MWFA 2L18A 3FROA 2R79A 1AUPA 4QAJA 4WNAB 5ALEA 5BVGA 3EXHC 4BKRA 4X7BA 1RE1A 1L5GB 1T34A 4ZCTA 4ZVVA 3SIPA 1ZUNB 4I1SA 4ZJZA 1BU8A 3Q39A 1T24A 3V33A 4ZJPA 3P9IA 8ABPA 3FW1A 3I4LA 3S2IA 4P3XA 3DQQA 1T5IA 1QTRA 2IEYA 3VU1A 3PPWA 2N75A 1TF7A 4RA6B 5LLSA 1TIKA 1W1IA 3WLOA 3ZHTA 5LSAA 3O8OB 4IIBA 1KQNA 1FVXA 7ABPA 5TMEA 4WN9A 1IWOA 5FNVA 4CQMA 5L4LA 3QRWA 5CT8A 4QYWA 4MVJH 3WLIA 1XX6A 2AKYA 4F2GA 2FMKA 4N5HX 5JDCC 5CNKA 4IP0A 2V4UA 4AF7A 2ZWIA 1WNTA 5SYNA 3PTLA 2X2PA 3K5WA 4R68A 2X5JO 2N3ZA 1XD8A 3CNOA 3COVA 3F7NA 1HPLA 3TAUA 1QDUA 4AN1A 4A82A 2LZJA 2ZGVA 5TQ2A 1GPJA 1RJGA 3ZDEA 2R8EA 2CRVA 4RVFA 3AJDA 5L7WA 5EHNA 4KPFC 1G3UA 4ZT6A 5DHSA 2AK3A 2NZVG 2P9ZA 4MAMA 3EXIA 2HJRA 3ZHSA 1F17A 1JSXA 3CRQA 3Q9NA 2D8AA 3UTCA 4I4TA 1A8SA 1YZVA 4AJNA 1WAMA 2VAPA 4BASA 5CDHA 2QRLA 1Q1BA 3SBDA 2AGVA 1KDPA 2YZKA 4ML3A 2P3LA 3LLUA 5EJ9A 1R9MA 2WPDA 3DBHA 1JS1X 1IHOA 1ITZA 1SD5A 3MJFA 3R7NA 1BC5A 3V9PA 2DQYA 3R3SA 2PGXA 3V1UA 4Q93A 2H4JA 3A28A 3AKCA 1YJ5A 5HIIA 3V8PA 1ZGCA 2P9YA 3A11A 3O7MA 4V0KA 3T7EA 4LBVA 3ZR4B 2G6TA 3GLSA 3HFSA 4BIIA 2IEIA 3TDKA 1HDRA 2V3CC 3NHLA 4M0UA 2RHTA 4MIEA 3QPAA 5HF9A 3SX0A 4DYDA 1QJCA 4FYKA 4Z99A 1GPUA 2VFAA 1EVLA 2HRRA 3LCCA 3Q7PA 3NEYA 1KD1D 5JSZB 2VJCA 2VHQA 4ZK2A 2G0AA 3ETGA 4F9TA 3PYXA 4IFEA 1O5IA 1Y6QA 2QMOA 4UUAA 2PD4A 5JXIA 4NCNA 1OOEA 2PKRA 4C6RA 5IRCD 2IOFK 2A92A 3AUUA 3E81A 1RI2A 3U6KA 1MAUA 4P3KA 4B82A 3CCRB 1L7XA 1N6NA 1YS6A 1P6QA 3T7SA 3M6LA 4A23A 5EP4A 4M7RA 4PIPA 2FLWA 3R7WA 1C9MA 5HM8A 4L0CA 5F2EA 4KAXA 2Z4SA 4R0MA 1C41A 2H4XA 5D7NA 4WFIA 4OI2A 3EGOA 4MV0A 3L06A 2XMSA 1ZWLA 4KXLA 4FW8A 4BFXA 2ZI9A 2QN7A 1QLJA 4GEGA 1K27A 3O1HB 2I2WA 1NI4A 3KUDA 5EXTA 4AP6A 3RAPR 3LZCA 2BEKA 1JI0A 2UZ1B 1ZD5A 3BGDA 3CRW1 3INGA 3JASA 1K4YA 3EW9A 3JD0A 3PR2B 4OHFA 4K86A 2BFFA 4P7FA 4ABTA 3BIXA 1RWXA 4IWYA 4LFCB 3WIVA 3K2QA 1W34A 2V6IA 2ZBUA 2VWPA 4GMKA 4QBGB 3S8MA 2D00A 2QN8A 1FLNA 4YDQA 5FX2A 2C29D 5HW0A 1C9JA 1EBBA 1X7ZA 3MINB 5EPEA 5FBWB 1N2IA 2C96A 3CVYA 2I29A 3MC1A 5KYUA 3I3SR 2FEOA 3VHXA 1PDWA 4AYXA 2B36A 4A8HA 5BYAA 2O2DA 1RABA 1N36B 4N0QA 4D4HA 1TOAA 2LXNA 3I9LA 4Y1FA 3TZHA 4ARZA 2H65A 3ABQB 4F2WA 1ZHFA 3WYBA 1PVDA 2J6IA 4X62B 1M6VA 2DH5A 1PR5A 3WXBA 4DBZA 4F2HA 2ZDQA 1EXNA 2W70A 2EWMA 4Z4SA 5J2TA 1A9OA 3W8FA 3CNEA 2N47A 3KDAA 2Q1YA 2P9CA 1H3NA 3P19A 3PUZA 3JTMA 4QQ8A 1CF9A 4XNFA 1DB3A 4OP1A 2PTGA 3UQYS 2ZB7A 2ZRDA 2C9ZA 1IZ0A 3DE7X 4J9VA 2V7QD 2AYYA 1PQUA 3NVKI 2M6RA 4ZIRA 1ZCJA 2H92A 1R0RE 1ESMA 2VRNA 2HFKA 2ZSUA 1GV1A 3HLTA 3LCUA 4P82A 1RQ2A 2OC9A 3IHKA 5DX1A 5EWLB 5EIFA 3PVZA 1PR2A 3A2LA 4N0DA 1IJEA 4WK0B 3JARB 3RVRA 4CBVA 2QN3A 1XTZA 3RRZA 1OVMA 3A9WA 1RCUA 2DCUA 2XY4A 4A6XA 2GUWA 1N06A 3WB9A 2FPSA 2QE7A 1YA8A 3K2BA 3QPWA 4P98A 5ALSA 4NV1A 4D3FA 4UOEA 2IZOA 5CU7A 3M6WA 1IQ0A 3BM5A 5TF0A 3S2YA 2DP4E 4DSAA 1JU9A 4P3OA 1DLIA 3JASB 4JCCA 5KWIA 1CUAA 3UFXB 4ARVA 4WX2B 4MRPA 1GL6A 1IZ9A 2HOQA 1MX3A 2XE7A 2ZLBA 1H6BA 4XM2A 4O2BB 5AI4A 4DIKA 4FXUA 5DASA 3ZJUA 5FJJA 4IZOA 4HNHA 4GVXA 4RHEA 5JE8A 3F90A 3UHJA 4BEBA 2VHZA 1V3QE 4MIKA 3RFTA 5HKKD 4PCAA 2ESRA 4D4LA 4L4ZA 4KODA 1RQ7A 2IDMA