1T9FA

Structural genomics of caenorhabditis elegans: structure of a protein with unknown function
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
178
structure length
178
Chain Sequence
GSDEDFVTCYSVLKFINANDGSRLHSHDVKYGSGSGQQSVTAVKNSDDINSHWQIFPALNAKCNRGDAIKCGDKIRLKHLTTGTFLHSHHFTAPLSKQHQEVSAFGSEAESDTGDDWTVICNGDEWLESEQFKLRHAVTGSYLSLSGQQFGRPIHGQREVVGTDSITGGSAWKVAEGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function.
rcsb
molecule keywords protein 1d10
molecule tags Structural genomics, unknown function
source organism Caenorhabditis elegans
total genus 49
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2004-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02815 MIR MIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1t9fA00
2QN4A 3WINC 1HIBA 3P6IA 1G9BA 1AVUA 4ISQA 21BIA 3UJ4A 2FDBM 4P0KA 1FWVA 5EHAA 3BAQA 1Z2VA 3CA3A 3Q7XA 4I4XA 3SNVA 5F8YA 3WO2A 3ZXGA 2DREA 3WA1A 3PMEA 4J2YA 3CRIA 2IHOA 2LIEA 4GAIA 3IM7A 3Q7WA 1TTUA 4XKIA 3S8KA 3FGMA 2VUAA 5HPZA 1IT0A 4Q9GA 4AN7B 5DUYA 3RTIB 3N0KA 4QD2B 2Y9XE 3WMVA 3VSFA 1QQKA 4QKRA 4H04A 4AN6A 1FMMS 4LO8B 4ZA3B 4ZFUB 5BXRA 3H6QA 4P6AA 8I1BA 31BIA 4XFUA 3H6RB 3VT0A 3BADA 2Q9XA 2AXMA 3BRGC 2ZQOA 1YXWA 1JT3A 1S0LA 4OWLA 3BB2A 1DZDA 1S0GA 2KH2A 1WD4A 4I6IA 1EYLA 1FV3A 2VXTI 1IOBA 4ZLBB 3NBDA 1EPWA 5F8WA 1XZZA 4I8MA 2D23A 1PUMB 3FJ9A 4QBVA 5DSSB 2WRYA 5EC5A 5DZUA 1W3FA 1JY0A 1TOOA 4X37A 4GP3A 3KMVA 3V0AB 1AFCA 3VUOA 2FO1A 1R8NA 3WMUA 1PC8B 1K5UA 1YF8B 2BFHA 1FN0A 5BXTA 4R6UB 4JKQA 4EEEB 3IAGC 1BFGA 3T8SA 4EB2B 3O5WB 1Q04A 1RY7A 1DIWA 1M2TB 1RZOB 4CJMA 1TP0A 4Z8SB 1HWPB 1ILR1 3A21A 1ISYA 3UJ0A 4QKSA 4USOA 2KI4A 3POKA 2GZBA 4I7IA 3V79C 2Z48A 4LO2A 3BAOA 3FJCA 3N7LA 3I2AA 1IILA 3JUTA 4OUJA 3BRDA 1AF9A 3CU1B 3UD9A 4ZGRB 1JQZA 1OQLB 3F62B 1HWOB 3V0AA 1QXMA 3FJAA 4J2XA 4X3AA 3D7WB 3AJ5A 2VSAA 1SZ6B 4Q91A 6I1BA 3BAGA 2DS0A 4A7KA 3FJ8A 4GAFA 1HCEA 1KNMA 3BAUA 3AZVA 1TWEA 4G1RA 1DFCA 1FQ9A 3NBNA 2NTDA 4G6MA 3FJFA 9ILBA 1JT7A 4OEGA 3I29B 3A23A 4TLPA 4USPA 1I1BA 3R4UA 5BQUA 1IJTA 5DVHA 2AQZA 2AFGA 1G9AA 1SR4A 1S0CA 1DLLA 4P0JA 5FNWA 4I3NA 1BFBA 3OBTA 3UDAA 3MALA 1DZCA 4KEIA 4QALA 1F31A 2ERMA 1Z4SA 1XHBA 1IHKA 2FFUA 3CA0A 1EV2A 2K43A 4DEPA 1ABRB 4IY9A 1WBAA 2VXRA 4XFTA 5GAQA 4LO7B 4F34A 4H9WA 1QQLA 2FGFA 4Q9PA 1PWAA 4I4OA 2E4MA 5EG6C 4I4UA 3O4AA 3PHZA 2Z49A 4G9NA 4LO7C 2X2SA 4J2SA 4GP0A 1HKNA 1JTCA 3HMYA 1ISVA 2MC2A 4LO3A 3A07A 4QD2C 1M16A 2NM1A 2YUGA 3VSZA 3CA6A 1FV2A 2F2FA 4LO1C 3QYDA 3FJHA 3Q7YA 1ONKB 4HJJA 1T4QA 3AKHA 4GOYA 2D43A 4OEEA 3AKGA 2ET2A 2VLCA 3BAVA 4EFQA 4LO2C 3HALA 1K5VA 2BEBA 3OJ2A 2VU9A 4KBBA 2X2TA 4L4IA 3RTJB 3FJKA 4G6JA 1I1EA 3AKFA 2HWMA 4QO3A 4LO1A 2Y9FA 1RMLA 4KEKA 4I96A 1BARA 1BLAA 3F1RA 4II0A 4P0LA 5BP5A 1A8DA 1AVXB 3FUOA 1JT5A 4JRAA 2K4AB 2F8XC 3FJBA 3RMXA 3AH4A 2M49A 3QR5A 3PUBA 3RSJA 4I4YA 1NZKA 1T9FA 2XOAA 4XFSA 4PC4A 4I4RA 4KC3A 3JRRA 4LO0C 3BA4A 3P6JA 4X39A 5F90A 4D0TA 3BA5A 4IONA 5D62A 1WD3A 5BQUC 3BX1C 1BA7A 1AXMA 3VT2A 3CA5A 1GGPB 2Q3NB 4ZFWB 3FJDA 3NJ5A 1SR4C 5JLVA 1CVSA 2VSEA 3O49A 3NBEA 2IWTB 1VCLA 3O4OA 2RSTA 1Q03A 1YBIA 4WBCA 1S0EA 5G00A 4LO0A 2NZ9A 2ZR1B 3HN1A 3OJVA 1HCDA 4IQPA 1D0HA 3MPPG 3LTQA 4I4VA 4EFRA 3WO3A 4IY8A 1DJSB 4I1EA 1JT4A 2MIBA 1ISXA 3C9ZA 1ITBA 2D7IA 2E4MC 3CA1A 3I2XA 4FVVA 2DRYA 1FMZA 1YYNA 2HW9A 2RG9B 3N7MA 5FZYA 4LO3C 3K1XA 3CRHA 1HWMB 3IIRA 4JAWA 4HR6C 2F2FC 4A7YA 1V6UA 1BLDA 1TFMB 3IM5A 3N7KA 3AKIA 1JLXA 5E24E 3BRFA 1V6WA 3ZXDA 2Y9GA 2LIQA 3FJJA 1DFQA 5BXSA 4IZXA 4F83A 1UPSA 4ZKTB 1G9CA 4G9MA 2HZ9A 3N7JA 4I4PA 4OW4A 1BFCA 7I1BA 2BEAA 3AZWA 3ZC8A 2Y9WC 3HBWA 2NP0A 1S0DA 4I2SA 3HSMA 4IHZA 4ZBVB 3ILAA 2WBCA 4QC4A 3O4DA 3IM6A 3S8JA 3WINA 2D44A 3O4CA 1P63A 1J0SA 5BP5C 1G9DA 1ISZA 2D1ZA 3OGGA 4IYBA 1S0FA 4YOLA 3FUQA 1DQOA 1V6VA 2ZQNA 4ZOTA 2ESUA 3O4BA 3H6SE 4EFPA 1AVAC 1ISWA 3PG0A 2D22A 4ISRA 4OWKA 3ZC9A 4I4QA 1XG6A 2GO2A 3AJ6A 1FGAA 3EF2A 1PUUB 3UD8A 3ZX7A 4HA2A 1V6XA 2D7RA 2L5XA 2NYYA 5F8SA 3UD7A 4A7ZA 3R4SA 2MLLB 4DCKC 2NVHA 1HWNB 1Z0HA 3W9TA 1EVTA 1TIEA 3NBCA 4JPZA 4I0YA 2D20A 3RMYA 2DRZA 2P39A 1Q1UA 3BA7A 3HOMA 2QYIB 5JMCA 4I37A 3CA4A 3OGFA 3CRGA 3CQAA 4QBCA 1W3AA 4J23B 3H6RA 4DENA 3CAHA 4FGFA 1JLYA 3BAHA 2KKIA 2FFVA 3O44A 1BFFA 1WBCA 5FZZA 3VEQA 2AAIB 5FZUA 1AVWB 2K8RA 4I4SA 1G82A 1FWUA 5D63A 1YTOA 1NUNA 1E0OA 4OEFA 4JQ0A 2J3PA 1L2HA 4ENDA 4IZEA 1DQGA 3FJIA 1N4KA 2R9KB 3V0BB 3LLPA 1MD6A 3AH2A 2HWAA 4JKXB 3WO4A 1II4A 1W3GA 4L4HA 4EKXB 41BIA 3BTAA 2D24A 3VT1A 4D0ZA 3OBRA 1CE7B 1BASA 2KLLA 1MC9A 1IRAX 5D61A 3TC2A 2KI6B 5I1BA 4JP0A 4Z9WB 1XYFA 5FNXA 1IRPA 3B9UA 4D8HA 3P53A 2RQ9A 3O3QA 1TWMA 1S0BA 4KEJA 5BOWA 3E8LC 3OJMA 1R8OA 3A22A 2UUSA 3AH1A 4GOVA 1PZZA 4J2KA 2I1BA 3FFZA 2P23A 5BVPI 3FJEA 3VWCA 1RG8A 5BXPA 5B2HA 4ZFYB 3V0BA 4OWJA 4I1BA 4X38A
chains in the Genus database with same CATH superfamily
2QN4A 3WINC 1HIBA 3P6IA 1G9BA 1AVUA 4ISQA 21BIA 3UJ4A 2FDBM 4P0KA 1FWVA 5EHAA 3BAQA 1Z2VA 3CA3A 3Q7XA 4I4XA 3SNVA 5F8YA 3WO2A 3ZXGA 2DREA 3WA1A 3PMEA 4J2YA 3CRIA 2IHOA 2LIEA 4GAIA 3IM7A 3Q7WA 1TTUA 4XKIA 3S8KA 3FGMA 2VUAA 5HPZA 1IT0A 4Q9GA 4AN7B 5DUYA 3RTIB 3N0KA 4QD2B 2Y9XE 3WMVA 3VSFA 1QQKA 4QKRA 4H04A 4AN6A 1FMMS 4LO8B 4ZA3B 4ZFUB 5BXRA 3H6QA 4P6AA 8I1BA 31BIA 4MZHA 4XFUA 3H6RB 3VT0A 3BADA 2Q9XA 2AXMA 3BRGC 2ZQOA 1YXWA 1JT3A 1S0LA 4OWLA 3BB2A 1DZDA 1S0GA 2KH2A 1WD4A 4I6IA 1EYLA 1FV3A 2VXTI 1IOBA 4ZLBB 3NBDA 1EPWA 5F8WA 1XZZA 4I8MA 2D23A 1PUMB 3FJ9A 4QBVA 5DSSB 2WRYA 5EC5A 5DZUA 1W3FA 1JY0A 1TOOA 4X37A 4GP3A 3KMVA 3V0AB 1AFCA 3VUOA 2FO1A 1R8NA 3WMUA 1PC8B 1K5UA 1YF8B 2BFHA 1FN0A 5BXTA 4R6UB 4JKQA 4EEEB 3IAGC 1BFGA 3T8SA 4EB2B 3O5WB 1Q04A 1RY7A 1DIWA 1M2TB 1RZOB 4CJMA 1TP0A 4Z8SB 1HWPB 1ILR1 3A21A 1ISYA 3UJ0A 4QKSA 4USOA 2KI4A 3POKA 2GZBA 4I7IA 3V79C 2Z48A 4LO2A 3BAOA 3FJCA 3N7LA 3I2AA 1IILA 3JUTA 4UY4A 4OUJA 3BRDA 1AF9A 3CU1B 3UD9A 4ZGRB 1JQZA 1OQLB 3F62B 1HWOB 3V0AA 1QXMA 3FJAA 4J2XA 4X3AA 3D7WB 3AJ5A 2VSAA 1SZ6B 4Q91A 6I1BA 3BAGA 2DS0A 4A7KA 3FJ8A 4GAFA 1HCEA 1KNMA 3BAUA 3AZVA 1TWEA 4G1RA 1DFCA 1FQ9A 3NBNA 2NTDA 4G6MA 3FJFA 9ILBA 1JT7A 4OEGA 3I29B 3A23A 4TLPA 4USPA 1I1BA 3R4UA 5BQUA 1IJTA 5DVHA 2AQZA 2AFGA 1G9AA 1SR4A 1S0CA 1DLLA 4P0JA 5FNWA 4I3NA 1BFBA 3OBTA 3UDAA 3MALA 1DZCA 4KEIA 4QALA 1F31A 2ERMA 1Z4SA 1XHBA 1IHKA 2FFUA 3CA0A 1EV2A 2K43A 4DEPA 1ABRB 4IY9A 1WBAA 2VXRA 4XFTA 5GAQA 4LO7B 4F34A 4H9WA 1QQLA 2FGFA 4Q9PA 1PWAA 4I4OA 2E4MA 5EG6C 4I4UA 3O4AA 3PHZA 2Z49A 4G9NA 4LO7C 2X2SA 4J2SA 4GP0A 1HKNA 1JTCA 3HMYA 1ISVA 2MC2A 4LO3A 3A07A 4QD2C 1M16A 2NM1A 2YUGA 3VSZA 3CA6A 1FV2A 2F2FA 4LO1C 3QYDA 3FJHA 3Q7YA 1ONKB 4HJJA 1T4QA 3AKHA 4GOYA 2D43A 4OEEA 3AKGA 2ET2A 2VLCA 3BAVA 4EFQA 4LO2C 3HALA 1K5VA 2BEBA 3OJ2A 2VU9A 4KBBA 2X2TA 4L4IA 3RTJB 3FJKA 4G6JA 1I1EA 3AKFA 2HWMA 4QO3A 4LO1A 2Y9FA 1RMLA 4KEKA 4I96A 1BARA 1BLAA 3F1RA 4II0A 4P0LA 5BP5A 1A8DA 1AVXB 3FUOA 1JT5A 4JRAA 2K4AB 2F8XC 3FJBA 3RMXA 3AH4A 2M49A 3QR5A 3PUBA 3RSJA 4I4YA 1NZKA 1T9FA 2XOAA 4XFSA 4PC4A 4MZFB 4I4RA 4KC3A 3JRRA 4LO0C 3BA4A 3P6JA 4X39A 5F90A 4D0TA 3BA5A 4IONA 5D62A 1WD3A 5BQUC 3BX1C 1BA7A 1AXMA 3VT2A 3CA5A 1GGPB 2Q3NB 4ZFWB 3FJDA 3NJ5A 1SR4C 5JLVA 1CVSA 2VSEA 3O49A 3NBEA 2IWTB 1VCLA 3O4OA 2RSTA 1Q03A 1YBIA 4WBCA 1S0EA 5G00A 4LO0A 2NZ9A 2ZR1B 3HN1A 3OJVA 1HCDA 4IQPA 1D0HA 3MPPG 3LTQA 4I4VA 4EFRA 3WO3A 4IY8A 1DJSB 4I1EA 1JT4A 2MIBA 1ISXA 3C9ZA 1ITBA 2D7IA 2E4MC 3CA1A 3I2XA 4FVVA 2DRYA 1FMZA 1YYNA 2HW9A 2RG9B 3N7MA 5FZYA 4LO3C 3K1XA 3CRHA 1HWMB 3IIRA 4JAWA 4HR6C 2F2FC 4A7YA 1V6UA 1BLDA 1TFMB 3IM5A 3N7KA 3AKIA 1JLXA 5E24E 3BRFA 1V6WA 3ZXDA 2Y9GA 2LIQA 3FJJA 1DFQA 5BXSA 4IZXA 4F83A 1UPSA 4ZKTB 1G9CA 4G9MA 2HZ9A 3N7JA 4I4PA 4OW4A 1BFCA 7I1BA 2BEAA 3AZWA 3ZC8A 2Y9WC 3HBWA 2NP0A 1S0DA 4I2SA 3HSMA 4IHZA 4ZBVB 3ILAA 2WBCA 4QC4A 3O4DA 3IM6A 3S8JA 3WINA 2D44A 3O4CA 1P63A 1J0SA 5BP5C 1G9DA 1ISZA 2D1ZA 2NS2A 3OGGA 4IYBA 1S0FA 4YOLA 3FUQA 1DQOA 1V6VA 2ZQNA 4ZOTA 2ESUA 3O4BA 3H6SE 4EFPA 1AVAC 1ISWA 3PG0A 2D22A 4ISRA 4OWKA 3ZC9A 4I4QA 1XG6A 2GO2A 3AJ6A 1FGAA 3EF2A 1PUUB 4H75A 3UD8A 4HA2A 3ZX7A 1V6XA 2D7RA 2L5XA 2NYYA 5F8SA 3UD7A 4A7ZA 3R4SA 2MLLB 4DCKC 2NVHA 1HWNB 1Z0HA 3W9TA 1EVTA 1TIEA 3NBCA 4JPZA 4I0YA 2D20A 3RMYA 2DRZA 2P39A 1Q1UA 3BA7A 3HOMA 2QYIB 5JMCA 4I37A 3CA4A 3OGFA 3CRGA 3CQAA 4QBCA 1W3AA 4J23B 3H6RA 4DENA 3CAHA 4FGFA 1JLYA 3BAHA 2KKIA 2FFVA 3O44A 1BFFA 1WBCA 5FZZA 3VEQA 2AAIB 5FZUA 1AVWB 2K8RA 4I4SA 1G82A 1FWUA 5D63A 1YTOA 1NUNA 1E0OA 4OEFA 4JQ0A 2J3PA 1L2HA 4ENDA 4IZEA 1DQGA 3FJIA 1N4KA 2R9KB 3V0BB 3LLPA 1MD6A 3AH2A 2HWAA 4JKXB 3WO4A 1II4A 1W3GA 4L4HA 4EKXB 41BIA 3BTAA 2D24A 3VT1A 4D0ZA 3OBRA 1CE7B 1BASA 2KLLA 1MC9A 1IRAX 5D61A 3TC2A 2KI6B 5I1BA 4JP0A 4Z9WB 1XYFA 5FNXA 1IRPA 3B9UA 4D8HA 3P53A 2RQ9A 3O3QA 1TWMA 1S0BA 4KEJA 5BOWA 3E8LC 3OJMA 1R8OA 3A22A 2UUSA 3AH1A 4GOVA 1PZZA 4J2KA 2I1BA 3FFZA 2P23A 5BVPI 3FJEA 3VWCA 1RG8A 5BXPA 5B2HA 4MZGB 4ZFYB 3V0BA 4OWJA 4I1BA 4X38A
chains in the Genus database with same CATH topology
2QN4A 3WINC 1HIBA 3P6IA 1G9BA 1AVUA 4ISQA 21BIA 3UJ4A 2FDBM 4P0KA 1FWVA 5EHAA 3BAQA 1Z2VA 3CA3A 3Q7XA 4I4XA 3SNVA 5F8YA 3WO2A 3ZXGA 2DREA 3WA1A 3PMEA 4J2YA 3CRIA 2IHOA 2LIEA 4GAIA 3IM7A 3Q7WA 1TTUA 4XKIA 3S8KA 3FGMA 2VUAA 5HPZA 1IT0A 4Q9GA 4AN7B 5DUYA 3RTIB 3N0KA 4QD2B 2Y9XE 3WMVA 3VSFA 1QQKA 4QKRA 4H04A 4AN6A 1FMMS 4LO8B 4ZA3B 4ZFUB 5BXRA 3H6QA 4P6AA 8I1BA 31BIA 4MZHA 4XFUA 3H6RB 3VT0A 3BADA 2Q9XA 2AXMA 3BRGC 2ZQOA 1YXWA 1JT3A 1S0LA 4OWLA 3BB2A 1DZDA 1S0GA 2KH2A 1WD4A 4I6IA 1EYLA 1FV3A 2VXTI 1IOBA 4ZLBB 3NBDA 1EPWA 5F8WA 1XZZA 4I8MA 2D23A 1PUMB 3FJ9A 4QBVA 5DSSB 2WRYA 5EC5A 5DZUA 1W3FA 1JY0A 1TOOA 4X37A 4GP3A 3KMVA 3V0AB 1AFCA 3VUOA 2FO1A 1R8NA 3WMUA 1PC8B 1K5UA 1YF8B 2BFHA 1FN0A 5BXTA 4R6UB 4JKQA 4EEEB 3IAGC 1BFGA 3T8SA 4EB2B 3O5WB 1Q04A 1RY7A 1DIWA 1M2TB 1RZOB 4CJMA 1TP0A 4Z8SB 1HWPB 1ILR1 3A21A 1ISYA 3UJ0A 4QKSA 4USOA 2KI4A 3POKA 2GZBA 4I7IA 3V79C 2Z48A 4LO2A 3BAOA 3FJCA 3N7LA 3I2AA 1IILA 3JUTA 4UY4A 4OUJA 3BRDA 1AF9A 3CU1B 3UD9A 4ZGRB 1JQZA 1OQLB 3F62B 1HWOB 3V0AA 1QXMA 3FJAA 4J2XA 4X3AA 3D7WB 3AJ5A 2VSAA 1SZ6B 4Q91A 6I1BA 3BAGA 2DS0A 4A7KA 3FJ8A 4GAFA 1HCEA 1KNMA 3BAUA 3AZVA 1TWEA 4G1RA 1DFCA 1FQ9A 3NBNA 2NTDA 4G6MA 3FJFA 9ILBA 1JT7A 4OEGA 3I29B 3A23A 4TLPA 4USPA 1I1BA 3R4UA 5BQUA 1IJTA 5DVHA 2AQZA 2AFGA 1G9AA 1SR4A 1S0CA 1DLLA 4P0JA 5FNWA 4I3NA 1BFBA 3OBTA 3UDAA 3MALA 1DZCA 4KEIA 4QALA 1F31A 2ERMA 1Z4SA 1XHBA 1IHKA 2FFUA 3CA0A 1EV2A 2K43A 4DEPA 1ABRB 4IY9A 1WBAA 2VXRA 4XFTA 5GAQA 4LO7B 4F34A 4H9WA 1QQLA 2FGFA 4Q9PA 1PWAA 4I4OA 2E4MA 5EG6C 4I4UA 3O4AA 3PHZA 2Z49A 4G9NA 4LO7C 2X2SA 4J2SA 4GP0A 1HKNA 1JTCA 3HMYA 1ISVA 2MC2A 4LO3A 3A07A 4QD2C 1M16A 2NM1A 2YUGA 3VSZA 3CA6A 1FV2A 2F2FA 4LO1C 3QYDA 3FJHA 3Q7YA 1ONKB 4HJJA 1T4QA 3AKHA 4GOYA 2D43A 4OEEA 3AKGA 2ET2A 2VLCA 3BAVA 4EFQA 4LO2C 3HALA 1K5VA 2BEBA 3OJ2A 2VU9A 4KBBA 2X2TA 4L4IA 3RTJB 3FJKA 4G6JA 1I1EA 3AKFA 2HWMA 4QO3A 4LO1A 2Y9FA 1RMLA 4KEKA 4I96A 1BARA 1BLAA 3F1RA 4II0A 4P0LA 5BP5A 1A8DA 1AVXB 3FUOA 1JT5A 4JRAA 2K4AB 2F8XC 3FJBA 3RMXA 3AH4A 2M49A 3QR5A 3PUBA 3RSJA 4I4YA 1NZKA 1T9FA 2XOAA 4XFSA 4PC4A 4MZFB 4I4RA 4KC3A 3JRRA 4LO0C 3BA4A 3P6JA 4X39A 5F90A 4D0TA 3BA5A 4IONA 5D62A 1WD3A 5BQUC 3BX1C 1BA7A 1AXMA 3VT2A 3CA5A 1GGPB 2Q3NB 4ZFWB 3FJDA 3NJ5A 1SR4C 5JLVA 1CVSA 2VSEA 3O49A 3NBEA 2IWTB 1VCLA 3O4OA 2RSTA 1Q03A 1YBIA 4WBCA 1S0EA 5G00A 4LO0A 2NZ9A 2ZR1B 3HN1A 3OJVA 1HCDA 4IQPA 1D0HA 3MPPG 3LTQA 4I4VA 4EFRA 3WO3A 4IY8A 1DJSB 4I1EA 1JT4A 2MIBA 1ISXA 3C9ZA 1ITBA 2D7IA 2E4MC 3CA1A 3I2XA 4FVVA 2DRYA 1FMZA 1YYNA 2HW9A 2RG9B 3N7MA 5FZYA 4LO3C 3K1XA 3CRHA 1HWMB 3IIRA 4JAWA 4HR6C 2F2FC 4A7YA 1V6UA 1BLDA 1TFMB 3IM5A 3N7KA 3AKIA 1JLXA 5E24E 3BRFA 1V6WA 3ZXDA 2Y9GA 2LIQA 3FJJA 1DFQA 5BXSA 4IZXA 4F83A 1UPSA 4ZKTB 1G9CA 4G9MA 2HZ9A 3N7JA 4I4PA 4OW4A 1BFCA 7I1BA 2BEAA 3AZWA 3ZC8A 2Y9WC 3HBWA 2NP0A 1S0DA 4I2SA 3HSMA 4IHZA 4ZBVB 3ILAA 2WBCA 4QC4A 3O4DA 3IM6A 3S8JA 3WINA 2D44A 3O4CA 1P63A 1J0SA 5BP5C 1G9DA 1ISZA 2D1ZA 2NS2A 3OGGA 4IYBA 1S0FA 4YOLA 3FUQA 1DQOA 1V6VA 2ZQNA 4ZOTA 2ESUA 3O4BA 3H6SE 4EFPA 1AVAC 1ISWA 3PG0A 2D22A 4ISRA 4OWKA 3ZC9A 4I4QA 1XG6A 2GO2A 3AJ6A 1FGAA 3EF2A 1PUUB 4H75A 3UD8A 4HA2A 3ZX7A 1V6XA 2D7RA 2L5XA 2NYYA 5F8SA 3UD7A 4A7ZA 3R4SA 2MLLB 4DCKC 2NVHA 1HWNB 1Z0HA 3W9TA 1EVTA 1TIEA 3NBCA 4JPZA 4I0YA 2D20A 3RMYA 2DRZA 2P39A 1Q1UA 3BA7A 3HOMA 2QYIB 5JMCA 4I37A 3CA4A 3OGFA 3CRGA 3CQAA 4QBCA 1W3AA 4J23B 3H6RA 4DENA 3CAHA 4FGFA 1JLYA 3BAHA 2KKIA 2FFVA 3O44A 1BFFA 1WBCA 5FZZA 3VEQA 2AAIB 5FZUA 1AVWB 2K8RA 4I4SA 1G82A 1FWUA 5D63A 1YTOA 1NUNA 1E0OA 4OEFA 4JQ0A 2J3PA 1L2HA 4ENDA 4IZEA 1DQGA 3FJIA 1N4KA 2R9KB 3V0BB 3LLPA 1MD6A 3AH2A 2HWAA 4JKXB 3WO4A 1II4A 1W3GA 4L4HA 4EKXB 41BIA 3BTAA 2D24A 3VT1A 4D0ZA 3OBRA 1CE7B 1BASA 2KLLA 1MC9A 1IRAX 5D61A 3TC2A 2KI6B 5I1BA 4JP0A 4Z9WB 1XYFA 5FNXA 1IRPA 3B9UA 4D8HA 3P53A 2RQ9A 3O3QA 1TWMA 1S0BA 4KEJA 5BOWA 3E8LC 3OJMA 1R8OA 3A22A 2UUSA 3AH1A 4GOVA 1PZZA 4J2KA 2I1BA 3FFZA 2P23A 5BVPI 3FJEA 3VWCA 1RG8A 5BXPA 5B2HA 4MZGB 4ZFYB 3V0BA 4OWJA 4I1BA 4X38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QN4 A;  3WIN C;  1HIB A;  3P6I A;  1G9B A;  1AVU A;  4ISQ A;  21BI A;  3UJ4 A;  2FDB M;  4P0K A;  1FWV A;  5EHA A;  3BAQ A;  1Z2V A;  3CA3 A;  3Q7X A;  4I4X A;  3SNV A;  5F8Y A;  3WO2 A;  3ZXG A;  2DRE A;  3WA1 A;  3PME A;  4J2Y A;  3CRI A;  2IHO A;  2LIE A;  4GAI A;  3IM7 A;  3Q7W A;  1TTU A;  4XKI A;  3S8K A;  3FGM A;  2VUA A;  5HPZ A;  1IT0 A;  4Q9G A;  4AN7 B;  5DUY A;  3RTI B;  3N0K A;  4QD2 B;  2Y9X E;  3WMV A;  3VSF A;  1QQK A;  4QKR A;  4H04 A;  4AN6 A;  1FMM S;  4LO8 B;  4ZA3 B;  4ZFU B;  5BXR A;  3H6Q A;  4P6A A;  8I1B A;  31BI A;  4XFU A;  3H6R B;  3VT0 A;  3BAD A;  2Q9X A;  2AXM A;  3BRG C;  2ZQO A;  1YXW A;  1JT3 A;  1S0L A;  4OWL A;  3BB2 A;  1DZD A;  1S0G A;  2KH2 A;  1WD4 A;  4I6I A;  1EYL A;  1FV3 A;  2VXT I;  1IOB A;  4ZLB B;  3NBD A;  1EPW A;  5F8W A;  1XZZ A;  4I8M A;  2D23 A;  1PUM B;  3FJ9 A;  4QBV A;  5DSS B;  2WRY A;  5EC5 A;  5DZU A;  1W3F A;  1JY0 A;  1TOO A;  4X37 A;  4GP3 A;  3KMV A;  3V0A B;  1AFC A;  3VUO A;  2FO1 A;  1R8N A;  3WMU A;  1PC8 B;  1K5U A;  1YF8 B;  2BFH A;  1FN0 A;  5BXT A;  4R6U B;  4JKQ A;  4EEE B;  3IAG C;  1BFG A;  3T8S A;  4EB2 B;  3O5W B;  1Q04 A;  1RY7 A;  1DIW A;  1M2T B;  1RZO B;  4CJM A;  1TP0 A;  4Z8S B;  1HWP B;  1ILR 1;  3A21 A;  1ISY A;  3UJ0 A;  4QKS A;  4USO A;  2KI4 A;  3POK A;  2GZB A;  4I7I A;  3V79 C;  2Z48 A;  4LO2 A;  3BAO A;  3FJC A;  3N7L A;  3I2A A;  1IIL A;  3JUT A;  4OUJ A;  3BRD A;  1AF9 A;  3CU1 B;  3UD9 A;  4ZGR B;  1JQZ A;  1OQL B;  3F62 B;  1HWO B;  3V0A A;  1QXM A;  3FJA A;  4J2X A;  4X3A A;  3D7W B;  3AJ5 A;  2VSA A;  1SZ6 B;  4Q91 A;  6I1B A;  3BAG A;  2DS0 A;  4A7K A;  3FJ8 A;  4GAF A;  1HCE A;  1KNM A;  3BAU A;  3AZV A;  1TWE A;  4G1R A;  1DFC A;  1FQ9 A;  3NBN A;  2NTD A;  4G6M A;  3FJF A;  9ILB A;  1JT7 A;  4OEG A;  3I29 B;  3A23 A;  4TLP A;  4USP A;  1I1B A;  3R4U A;  5BQU A;  1IJT A;  5DVH A;  2AQZ A;  2AFG A;  1G9A A;  1SR4 A;  1S0C A;  1DLL A;  4P0J A;  5FNW A;  4I3N A;  1BFB A;  3OBT A;  3UDA A;  3MAL A;  1DZC A;  4KEI A;  4QAL A;  1F31 A;  2ERM A;  1Z4S A;  1XHB A;  1IHK A;  2FFU A;  3CA0 A;  1EV2 A;  2K43 A;  4DEP A;  1ABR B;  4IY9 A;  1WBA A;  2VXR A;  4XFT A;  5GAQ A;  4LO7 B;  4F34 A;  4H9W A;  1QQL A;  2FGF A;  4Q9P A;  1PWA A;  4I4O A;  2E4M A;  5EG6 C;  4I4U A;  3O4A A;  3PHZ A;  2Z49 A;  4G9N A;  4LO7 C;  2X2S A;  4J2S A;  4GP0 A;  1HKN A;  1JTC A;  3HMY A;  1ISV A;  2MC2 A;  4LO3 A;  3A07 A;  4QD2 C;  1M16 A;  2NM1 A;  2YUG A;  3VSZ A;  3CA6 A;  1FV2 A;  2F2F A;  4LO1 C;  3QYD A;  3FJH A;  3Q7Y A;  1ONK B;  4HJJ A;  1T4Q A;  3AKH A;  4GOY A;  2D43 A;  4OEE A;  3AKG A;  2ET2 A;  2VLC A;  3BAV A;  4EFQ A;  4LO2 C;  3HAL A;  1K5V A;  2BEB A;  3OJ2 A;  2VU9 A;  4KBB A;  2X2T A;  4L4I A;  3RTJ B;  3FJK A;  4G6J A;  1I1E A;  3AKF A;  2HWM A;  4QO3 A;  4LO1 A;  2Y9F A;  1RML A;  4KEK A;  4I96 A;  1BAR A;  1BLA A;  3F1R A;  4II0 A;  4P0L A;  5BP5 A;  1A8D A;  1AVX B;  3FUO A;  1JT5 A;  4JRA A;  2K4A B;  2F8X C;  3FJB A;  3RMX A;  3AH4 A;  2M49 A;  3QR5 A;  3PUB A;  3RSJ A;  4I4Y A;  1NZK A;  1T9F A;  2XOA A;  4XFS A;  4PC4 A;  4I4R A;  4KC3 A;  3JRR A;  4LO0 C;  3BA4 A;  3P6J A;  4X39 A;  5F90 A;  4D0T A;  3BA5 A;  4ION A;  5D62 A;  1WD3 A;  5BQU C;  3BX1 C;  1BA7 A;  1AXM A;  3VT2 A;  3CA5 A;  1GGP B;  2Q3N B;  4ZFW B;  3FJD A;  3NJ5 A;  1SR4 C;  5JLV A;  1CVS A;  2VSE A;  3O49 A;  3NBE A;  2IWT B;  1VCL A;  3O4O A;  2RST A;  1Q03 A;  1YBI A;  4WBC A;  1S0E A;  5G00 A;  4LO0 A;  2NZ9 A;  2ZR1 B;  3HN1 A;  3OJV A;  1HCD A;  4IQP A;  1D0H A;  3MPP G;  3LTQ A;  4I4V A;  4EFR A;  3WO3 A;  4IY8 A;  1DJS B;  4I1E A;  1JT4 A;  2MIB A;  1ISX A;  3C9Z A;  1ITB A;  2D7I A;  2E4M C;  3CA1 A;  3I2X A;  4FVV A;  2DRY A;  1FMZ A;  1YYN A;  2HW9 A;  2RG9 B;  3N7M A;  5FZY A;  4LO3 C;  3K1X A;  3CRH A;  1HWM B;  3IIR A;  4JAW A;  4HR6 C;  2F2F C;  4A7Y A;  1V6U A;  1BLD A;  1TFM B;  3IM5 A;  3N7K A;  3AKI A;  1JLX A;  5E24 E;  3BRF A;  1V6W A;  3ZXD A;  2Y9G A;  2LIQ A;  3FJJ A;  1DFQ A;  5BXS A;  4IZX A;  4F83 A;  1UPS A;  4ZKT B;  1G9C A;  4G9M A;  2HZ9 A;  3N7J A;  4I4P A;  4OW4 A;  1BFC A;  7I1B A;  2BEA A;  3AZW A;  3ZC8 A;  2Y9W C;  3HBW A;  2NP0 A;  1S0D A;  4I2S A;  3HSM A;  4IHZ A;  4ZBV B;  3ILA A;  2WBC A;  4QC4 A;  3O4D A;  3IM6 A;  3S8J A;  3WIN A;  2D44 A;  3O4C A;  1P63 A;  1J0S A;  5BP5 C;  1G9D A;  1ISZ A;  2D1Z A;  3OGG A;  4IYB A;  1S0F A;  4YOL A;  3FUQ A;  1DQO A;  1V6V A;  2ZQN A;  4ZOT A;  2ESU A;  3O4B A;  3H6S E;  4EFP A;  1AVA C;  1ISW A;  3PG0 A;  2D22 A;  4ISR A;  4OWK A;  3ZC9 A;  4I4Q A;  1XG6 A;  2GO2 A;  3AJ6 A;  1FGA A;  3EF2 A;  1PUU B;  3UD8 A;  3ZX7 A;  4HA2 A;  1V6X A;  2D7R A;  2L5X A;  2NYY A;  5F8S A;  3UD7 A;  4A7Z A;  3R4S A;  2MLL B;  4DCK C;  2NVH A;  1HWN B;  1Z0H A;  3W9T A;  1EVT A;  1TIE A;  3NBC A;  4JPZ A;  4I0Y A;  2D20 A;  3RMY A;  2DRZ A;  2P39 A;  1Q1U A;  3BA7 A;  3HOM A;  2QYI B;  5JMC A;  4I37 A;  3CA4 A;  3OGF A;  3CRG A;  3CQA A;  4QBC A;  1W3A A;  4J23 B;  3H6R A;  4DEN A;  3CAH A;  4FGF A;  1JLY A;  3BAH A;  2KKI A;  2FFV A;  3O44 A;  1BFF A;  1WBC A;  5FZZ A;  3VEQ A;  2AAI B;  5FZU A;  1AVW B;  2K8R A;  4I4S A;  1G82 A;  1FWU A;  5D63 A;  1YTO A;  1NUN A;  1E0O A;  4OEF A;  4JQ0 A;  2J3P A;  1L2H A;  4END A;  4IZE A;  1DQG A;  3FJI A;  1N4K A;  2R9K B;  3V0B B;  3LLP A;  1MD6 A;  3AH2 A;  2HWA A;  4JKX B;  3WO4 A;  1II4 A;  1W3G A;  4L4H A;  4EKX B;  41BI A;  3BTA A;  2D24 A;  3VT1 A;  4D0Z A;  3OBR A;  1CE7 B;  1BAS A;  2KLL A;  1MC9 A;  1IRA X;  5D61 A;  3TC2 A;  2KI6 B;  5I1B A;  4JP0 A;  4Z9W B;  1XYF A;  5FNX A;  1IRP A;  3B9U A;  4D8H A;  3P53 A;  2RQ9 A;  3O3Q A;  1TWM A;  1S0B A;  4KEJ A;  5BOW A;  3E8L C;  3OJM A;  1R8O A;  3A22 A;  2UUS A;  3AH1 A;  4GOV A;  1PZZ A;  4J2K A;  2I1B A;  3FFZ A;  2P23 A;  5BVP I;  3FJE A;  3VWC A;  1RG8 A;  5BXP A;  5B2H A;  4ZFY B;  3V0B A;  4OWJ A;  4I1B A;  4X38 A; 
#chains in the Genus database with same CATH topology
 2QN4 A;  3WIN C;  1HIB A;  3P6I A;  1G9B A;  1AVU A;  4ISQ A;  21BI A;  3UJ4 A;  2FDB M;  4P0K A;  1FWV A;  5EHA A;  3BAQ A;  1Z2V A;  3CA3 A;  3Q7X A;  4I4X A;  3SNV A;  5F8Y A;  3WO2 A;  3ZXG A;  2DRE A;  3WA1 A;  3PME A;  4J2Y A;  3CRI A;  2IHO A;  2LIE A;  4GAI A;  3IM7 A;  3Q7W A;  1TTU A;  4XKI A;  3S8K A;  3FGM A;  2VUA A;  5HPZ A;  1IT0 A;  4Q9G A;  4AN7 B;  5DUY A;  3RTI B;  3N0K A;  4QD2 B;  2Y9X E;  3WMV A;  3VSF A;  1QQK A;  4QKR A;  4H04 A;  4AN6 A;  1FMM S;  4LO8 B;  4ZA3 B;  4ZFU B;  5BXR A;  3H6Q A;  4P6A A;  8I1B A;  31BI A;  4MZH A;  4XFU A;  3H6R B;  3VT0 A;  3BAD A;  2Q9X A;  2AXM A;  3BRG C;  2ZQO A;  1YXW A;  1JT3 A;  1S0L A;  4OWL A;  3BB2 A;  1DZD A;  1S0G A;  2KH2 A;  1WD4 A;  4I6I A;  1EYL A;  1FV3 A;  2VXT I;  1IOB A;  4ZLB B;  3NBD A;  1EPW A;  5F8W A;  1XZZ A;  4I8M A;  2D23 A;  1PUM B;  3FJ9 A;  4QBV A;  5DSS B;  2WRY A;  5EC5 A;  5DZU A;  1W3F A;  1JY0 A;  1TOO A;  4X37 A;  4GP3 A;  3KMV A;  3V0A B;  1AFC A;  3VUO A;  2FO1 A;  1R8N A;  3WMU A;  1PC8 B;  1K5U A;  1YF8 B;  2BFH A;  1FN0 A;  5BXT A;  4R6U B;  4JKQ A;  4EEE B;  3IAG C;  1BFG A;  3T8S A;  4EB2 B;  3O5W B;  1Q04 A;  1RY7 A;  1DIW A;  1M2T B;  1RZO B;  4CJM A;  1TP0 A;  4Z8S B;  1HWP B;  1ILR 1;  3A21 A;  1ISY A;  3UJ0 A;  4QKS A;  4USO A;  2KI4 A;  3POK A;  2GZB A;  4I7I A;  3V79 C;  2Z48 A;  4LO2 A;  3BAO A;  3FJC A;  3N7L A;  3I2A A;  1IIL A;  3JUT A;  4UY4 A;  4OUJ A;  3BRD A;  1AF9 A;  3CU1 B;  3UD9 A;  4ZGR B;  1JQZ A;  1OQL B;  3F62 B;  1HWO B;  3V0A A;  1QXM A;  3FJA A;  4J2X A;  4X3A A;  3D7W B;  3AJ5 A;  2VSA A;  1SZ6 B;  4Q91 A;  6I1B A;  3BAG A;  2DS0 A;  4A7K A;  3FJ8 A;  4GAF A;  1HCE A;  1KNM A;  3BAU A;  3AZV A;  1TWE A;  4G1R A;  1DFC A;  1FQ9 A;  3NBN A;  2NTD A;  4G6M A;  3FJF A;  9ILB A;  1JT7 A;  4OEG A;  3I29 B;  3A23 A;  4TLP A;  4USP A;  1I1B A;  3R4U A;  5BQU A;  1IJT A;  5DVH A;  2AQZ A;  2AFG A;  1G9A A;  1SR4 A;  1S0C A;  1DLL A;  4P0J A;  5FNW A;  4I3N A;  1BFB A;  3OBT A;  3UDA A;  3MAL A;  1DZC A;  4KEI A;  4QAL A;  1F31 A;  2ERM A;  1Z4S A;  1XHB A;  1IHK A;  2FFU A;  3CA0 A;  1EV2 A;  2K43 A;  4DEP A;  1ABR B;  4IY9 A;  1WBA A;  2VXR A;  4XFT A;  5GAQ A;  4LO7 B;  4F34 A;  4H9W A;  1QQL A;  2FGF A;  4Q9P A;  1PWA A;  4I4O A;  2E4M A;  5EG6 C;  4I4U A;  3O4A A;  3PHZ A;  2Z49 A;  4G9N A;  4LO7 C;  2X2S A;  4J2S A;  4GP0 A;  1HKN A;  1JTC A;  3HMY A;  1ISV A;  2MC2 A;  4LO3 A;  3A07 A;  4QD2 C;  1M16 A;  2NM1 A;  2YUG A;  3VSZ A;  3CA6 A;  1FV2 A;  2F2F A;  4LO1 C;  3QYD A;  3FJH A;  3Q7Y A;  1ONK B;  4HJJ A;  1T4Q A;  3AKH A;  4GOY A;  2D43 A;  4OEE A;  3AKG A;  2ET2 A;  2VLC A;  3BAV A;  4EFQ A;  4LO2 C;  3HAL A;  1K5V A;  2BEB A;  3OJ2 A;  2VU9 A;  4KBB A;  2X2T A;  4L4I A;  3RTJ B;  3FJK A;  4G6J A;  1I1E A;  3AKF A;  2HWM A;  4QO3 A;  4LO1 A;  2Y9F A;  1RML A;  4KEK A;  4I96 A;  1BAR A;  1BLA A;  3F1R A;  4II0 A;  4P0L A;  5BP5 A;  1A8D A;  1AVX B;  3FUO A;  1JT5 A;  4JRA A;  2K4A B;  2F8X C;  3FJB A;  3RMX A;  3AH4 A;  2M49 A;  3QR5 A;  3PUB A;  3RSJ A;  4I4Y A;  1NZK A;  1T9F A;  2XOA A;  4XFS A;  4PC4 A;  4MZF B;  4I4R A;  4KC3 A;  3JRR A;  4LO0 C;  3BA4 A;  3P6J A;  4X39 A;  5F90 A;  4D0T A;  3BA5 A;  4ION A;  5D62 A;  1WD3 A;  5BQU C;  3BX1 C;  1BA7 A;  1AXM A;  3VT2 A;  3CA5 A;  1GGP B;  2Q3N B;  4ZFW B;  3FJD A;  3NJ5 A;  1SR4 C;  5JLV A;  1CVS A;  2VSE A;  3O49 A;  3NBE A;  2IWT B;  1VCL A;  3O4O A;  2RST A;  1Q03 A;  1YBI A;  4WBC A;  1S0E A;  5G00 A;  4LO0 A;  2NZ9 A;  2ZR1 B;  3HN1 A;  3OJV A;  1HCD A;  4IQP A;  1D0H A;  3MPP G;  3LTQ A;  4I4V A;  4EFR A;  3WO3 A;  4IY8 A;  1DJS B;  4I1E A;  1JT4 A;  2MIB A;  1ISX A;  3C9Z A;  1ITB A;  2D7I A;  2E4M C;  3CA1 A;  3I2X A;  4FVV A;  2DRY A;  1FMZ A;  1YYN A;  2HW9 A;  2RG9 B;  3N7M A;  5FZY A;  4LO3 C;  3K1X A;  3CRH A;  1HWM B;  3IIR A;  4JAW A;  4HR6 C;  2F2F C;  4A7Y A;  1V6U A;  1BLD A;  1TFM B;  3IM5 A;  3N7K A;  3AKI A;  1JLX A;  5E24 E;  3BRF A;  1V6W A;  3ZXD A;  2Y9G A;  2LIQ A;  3FJJ A;  1DFQ A;  5BXS A;  4IZX A;  4F83 A;  1UPS A;  4ZKT B;  1G9C A;  4G9M A;  2HZ9 A;  3N7J A;  4I4P A;  4OW4 A;  1BFC A;  7I1B A;  2BEA A;  3AZW A;  3ZC8 A;  2Y9W C;  3HBW A;  2NP0 A;  1S0D A;  4I2S A;  3HSM A;  4IHZ A;  4ZBV B;  3ILA A;  2WBC A;  4QC4 A;  3O4D A;  3IM6 A;  3S8J A;  3WIN A;  2D44 A;  3O4C A;  1P63 A;  1J0S A;  5BP5 C;  1G9D A;  1ISZ A;  2D1Z A;  2NS2 A;  3OGG A;  4IYB A;  1S0F A;  4YOL A;  3FUQ A;  1DQO A;  1V6V A;  2ZQN A;  4ZOT A;  2ESU A;  3O4B A;  3H6S E;  4EFP A;  1AVA C;  1ISW A;  3PG0 A;  2D22 A;  4ISR A;  4OWK A;  3ZC9 A;  4I4Q A;  1XG6 A;  2GO2 A;  3AJ6 A;  1FGA A;  3EF2 A;  1PUU B;  4H75 A;  3UD8 A;  4HA2 A;  3ZX7 A;  1V6X A;  2D7R A;  2L5X A;  2NYY A;  5F8S A;  3UD7 A;  4A7Z A;  3R4S A;  2MLL B;  4DCK C;  2NVH A;  1HWN B;  1Z0H A;  3W9T A;  1EVT A;  1TIE A;  3NBC A;  4JPZ A;  4I0Y A;  2D20 A;  3RMY A;  2DRZ A;  2P39 A;  1Q1U A;  3BA7 A;  3HOM A;  2QYI B;  5JMC A;  4I37 A;  3CA4 A;  3OGF A;  3CRG A;  3CQA A;  4QBC A;  1W3A A;  4J23 B;  3H6R A;  4DEN A;  3CAH A;  4FGF A;  1JLY A;  3BAH A;  2KKI A;  2FFV A;  3O44 A;  1BFF A;  1WBC A;  5FZZ A;  3VEQ A;  2AAI B;  5FZU A;  1AVW B;  2K8R A;  4I4S A;  1G82 A;  1FWU A;  5D63 A;  1YTO A;  1NUN A;  1E0O A;  4OEF A;  4JQ0 A;  2J3P A;  1L2H A;  4END A;  4IZE A;  1DQG A;  3FJI A;  1N4K A;  2R9K B;  3V0B B;  3LLP A;  1MD6 A;  3AH2 A;  2HWA A;  4JKX B;  3WO4 A;  1II4 A;  1W3G A;  4L4H A;  4EKX B;  41BI A;  3BTA A;  2D24 A;  3VT1 A;  4D0Z A;  3OBR A;  1CE7 B;  1BAS A;  2KLL A;  1MC9 A;  1IRA X;  5D61 A;  3TC2 A;  2KI6 B;  5I1B A;  4JP0 A;  4Z9W B;  1XYF A;  5FNX A;  1IRP A;  3B9U A;  4D8H A;  3P53 A;  2RQ9 A;  3O3Q A;  1TWM A;  1S0B A;  4KEJ A;  5BOW A;  3E8L C;  3OJM A;  1R8O A;  3A22 A;  2UUS A;  3AH1 A;  4GOV A;  1PZZ A;  4J2K A;  2I1B A;  3FFZ A;  2P23 A;  5BVP I;  3FJE A;  3VWC A;  1RG8 A;  5BXP A;  5B2H A;  4MZG B;  4ZFY B;  3V0B A;  4OWJ A;  4I1B A;  4X38 A; 
#chains in the Genus database with same CATH homology
 2QN4 A;  3WIN C;  1HIB A;  3P6I A;  1G9B A;  1AVU A;  4ISQ A;  21BI A;  3UJ4 A;  2FDB M;  4P0K A;  1FWV A;  5EHA A;  3BAQ A;  1Z2V A;  3CA3 A;  3Q7X A;  4I4X A;  3SNV A;  5F8Y A;  3WO2 A;  3ZXG A;  2DRE A;  3WA1 A;  3PME A;  4J2Y A;  3CRI A;  2IHO A;  2LIE A;  4GAI A;  3IM7 A;  3Q7W A;  1TTU A;  4XKI A;  3S8K A;  3FGM A;  2VUA A;  5HPZ A;  1IT0 A;  4Q9G A;  4AN7 B;  5DUY A;  3RTI B;  3N0K A;  4QD2 B;  2Y9X E;  3WMV A;  3VSF A;  1QQK A;  4QKR A;  4H04 A;  4AN6 A;  1FMM S;  4LO8 B;  4ZA3 B;  4ZFU B;  5BXR A;  3H6Q A;  4P6A A;  8I1B A;  31BI A;  4MZH A;  4XFU A;  3H6R B;  3VT0 A;  3BAD A;  2Q9X A;  2AXM A;  3BRG C;  2ZQO A;  1YXW A;  1JT3 A;  1S0L A;  4OWL A;  3BB2 A;  1DZD A;  1S0G A;  2KH2 A;  1WD4 A;  4I6I A;  1EYL A;  1FV3 A;  2VXT I;  1IOB A;  4ZLB B;  3NBD A;  1EPW A;  5F8W A;  1XZZ A;  4I8M A;  2D23 A;  1PUM B;  3FJ9 A;  4QBV A;  5DSS B;  2WRY A;  5EC5 A;  5DZU A;  1W3F A;  1JY0 A;  1TOO A;  4X37 A;  4GP3 A;  3KMV A;  3V0A B;  1AFC A;  3VUO A;  2FO1 A;  1R8N A;  3WMU A;  1PC8 B;  1K5U A;  1YF8 B;  2BFH A;  1FN0 A;  5BXT A;  4R6U B;  4JKQ A;  4EEE B;  3IAG C;  1BFG A;  3T8S A;  4EB2 B;  3O5W B;  1Q04 A;  1RY7 A;  1DIW A;  1M2T B;  1RZO B;  4CJM A;  1TP0 A;  4Z8S B;  1HWP B;  1ILR 1;  3A21 A;  1ISY A;  3UJ0 A;  4QKS A;  4USO A;  2KI4 A;  3POK A;  2GZB A;  4I7I A;  3V79 C;  2Z48 A;  4LO2 A;  3BAO A;  3FJC A;  3N7L A;  3I2A A;  1IIL A;  3JUT A;  4UY4 A;  4OUJ A;  3BRD A;  1AF9 A;  3CU1 B;  3UD9 A;  4ZGR B;  1JQZ A;  1OQL B;  3F62 B;  1HWO B;  3V0A A;  1QXM A;  3FJA A;  4J2X A;  4X3A A;  3D7W B;  3AJ5 A;  2VSA A;  1SZ6 B;  4Q91 A;  6I1B A;  3BAG A;  2DS0 A;  4A7K A;  3FJ8 A;  4GAF A;  1HCE A;  1KNM A;  3BAU A;  3AZV A;  1TWE A;  4G1R A;  1DFC A;  1FQ9 A;  3NBN A;  2NTD A;  4G6M A;  3FJF A;  9ILB A;  1JT7 A;  4OEG A;  3I29 B;  3A23 A;  4TLP A;  4USP A;  1I1B A;  3R4U A;  5BQU A;  1IJT A;  5DVH A;  2AQZ A;  2AFG A;  1G9A A;  1SR4 A;  1S0C A;  1DLL A;  4P0J A;  5FNW A;  4I3N A;  1BFB A;  3OBT A;  3UDA A;  3MAL A;  1DZC A;  4KEI A;  4QAL A;  1F31 A;  2ERM A;  1Z4S A;  1XHB A;  1IHK A;  2FFU A;  3CA0 A;  1EV2 A;  2K43 A;  4DEP A;  1ABR B;  4IY9 A;  1WBA A;  2VXR A;  4XFT A;  5GAQ A;  4LO7 B;  4F34 A;  4H9W A;  1QQL A;  2FGF A;  4Q9P A;  1PWA A;  4I4O A;  2E4M A;  5EG6 C;  4I4U A;  3O4A A;  3PHZ A;  2Z49 A;  4G9N A;  4LO7 C;  2X2S A;  4J2S A;  4GP0 A;  1HKN A;  1JTC A;  3HMY A;  1ISV A;  2MC2 A;  4LO3 A;  3A07 A;  4QD2 C;  1M16 A;  2NM1 A;  2YUG A;  3VSZ A;  3CA6 A;  1FV2 A;  2F2F A;  4LO1 C;  3QYD A;  3FJH A;  3Q7Y A;  1ONK B;  4HJJ A;  1T4Q A;  3AKH A;  4GOY A;  2D43 A;  4OEE A;  3AKG A;  2ET2 A;  2VLC A;  3BAV A;  4EFQ A;  4LO2 C;  3HAL A;  1K5V A;  2BEB A;  3OJ2 A;  2VU9 A;  4KBB A;  2X2T A;  4L4I A;  3RTJ B;  3FJK A;  4G6J A;  1I1E A;  3AKF A;  2HWM A;  4QO3 A;  4LO1 A;  2Y9F A;  1RML A;  4KEK A;  4I96 A;  1BAR A;  1BLA A;  3F1R A;  4II0 A;  4P0L A;  5BP5 A;  1A8D A;  1AVX B;  3FUO A;  1JT5 A;  4JRA A;  2K4A B;  2F8X C;  3FJB A;  3RMX A;  3AH4 A;  2M49 A;  3QR5 A;  3PUB A;  3RSJ A;  4I4Y A;  1NZK A;  1T9F A;  2XOA A;  4XFS A;  4PC4 A;  4MZF B;  4I4R A;  4KC3 A;  3JRR A;  4LO0 C;  3BA4 A;  3P6J A;  4X39 A;  5F90 A;  4D0T A;  3BA5 A;  4ION A;  5D62 A;  1WD3 A;  5BQU C;  3BX1 C;  1BA7 A;  1AXM A;  3VT2 A;  3CA5 A;  1GGP B;  2Q3N B;  4ZFW B;  3FJD A;  3NJ5 A;  1SR4 C;  5JLV A;  1CVS A;  2VSE A;  3O49 A;  3NBE A;  2IWT B;  1VCL A;  3O4O A;  2RST A;  1Q03 A;  1YBI A;  4WBC A;  1S0E A;  5G00 A;  4LO0 A;  2NZ9 A;  2ZR1 B;  3HN1 A;  3OJV A;  1HCD A;  4IQP A;  1D0H A;  3MPP G;  3LTQ A;  4I4V A;  4EFR A;  3WO3 A;  4IY8 A;  1DJS B;  4I1E A;  1JT4 A;  2MIB A;  1ISX A;  3C9Z A;  1ITB A;  2D7I A;  2E4M C;  3CA1 A;  3I2X A;  4FVV A;  2DRY A;  1FMZ A;  1YYN A;  2HW9 A;  2RG9 B;  3N7M A;  5FZY A;  4LO3 C;  3K1X A;  3CRH A;  1HWM B;  3IIR A;  4JAW A;  4HR6 C;  2F2F C;  4A7Y A;  1V6U A;  1BLD A;  1TFM B;  3IM5 A;  3N7K A;  3AKI A;  1JLX A;  5E24 E;  3BRF A;  1V6W A;  3ZXD A;  2Y9G A;  2LIQ A;  3FJJ A;  1DFQ A;  5BXS A;  4IZX A;  4F83 A;  1UPS A;  4ZKT B;  1G9C A;  4G9M A;  2HZ9 A;  3N7J A;  4I4P A;  4OW4 A;  1BFC A;  7I1B A;  2BEA A;  3AZW A;  3ZC8 A;  2Y9W C;  3HBW A;  2NP0 A;  1S0D A;  4I2S A;  3HSM A;  4IHZ A;  4ZBV B;  3ILA A;  2WBC A;  4QC4 A;  3O4D A;  3IM6 A;  3S8J A;  3WIN A;  2D44 A;  3O4C A;  1P63 A;  1J0S A;  5BP5 C;  1G9D A;  1ISZ A;  2D1Z A;  2NS2 A;  3OGG A;  4IYB A;  1S0F A;  4YOL A;  3FUQ A;  1DQO A;  1V6V A;  2ZQN A;  4ZOT A;  2ESU A;  3O4B A;  3H6S E;  4EFP A;  1AVA C;  1ISW A;  3PG0 A;  2D22 A;  4ISR A;  4OWK A;  3ZC9 A;  4I4Q A;  1XG6 A;  2GO2 A;  3AJ6 A;  1FGA A;  3EF2 A;  1PUU B;  4H75 A;  3UD8 A;  4HA2 A;  3ZX7 A;  1V6X A;  2D7R A;  2L5X A;  2NYY A;  5F8S A;  3UD7 A;  4A7Z A;  3R4S A;  2MLL B;  4DCK C;  2NVH A;  1HWN B;  1Z0H A;  3W9T A;  1EVT A;  1TIE A;  3NBC A;  4JPZ A;  4I0Y A;  2D20 A;  3RMY A;  2DRZ A;  2P39 A;  1Q1U A;  3BA7 A;  3HOM A;  2QYI B;  5JMC A;  4I37 A;  3CA4 A;  3OGF A;  3CRG A;  3CQA A;  4QBC A;  1W3A A;  4J23 B;  3H6R A;  4DEN A;  3CAH A;  4FGF A;  1JLY A;  3BAH A;  2KKI A;  2FFV A;  3O44 A;  1BFF A;  1WBC A;  5FZZ A;  3VEQ A;  2AAI B;  5FZU A;  1AVW B;  2K8R A;  4I4S A;  1G82 A;  1FWU A;  5D63 A;  1YTO A;  1NUN A;  1E0O A;  4OEF A;  4JQ0 A;  2J3P A;  1L2H A;  4END A;  4IZE A;  1DQG A;  3FJI A;  1N4K A;  2R9K B;  3V0B B;  3LLP A;  1MD6 A;  3AH2 A;  2HWA A;  4JKX B;  3WO4 A;  1II4 A;  1W3G A;  4L4H A;  4EKX B;  41BI A;  3BTA A;  2D24 A;  3VT1 A;  4D0Z A;  3OBR A;  1CE7 B;  1BAS A;  2KLL A;  1MC9 A;  1IRA X;  5D61 A;  3TC2 A;  2KI6 B;  5I1B A;  4JP0 A;  4Z9W B;  1XYF A;  5FNX A;  1IRP A;  3B9U A;  4D8H A;  3P53 A;  2RQ9 A;  3O3Q A;  1TWM A;  1S0B A;  4KEJ A;  5BOW A;  3E8L C;  3OJM A;  1R8O A;  3A22 A;  2UUS A;  3AH1 A;  4GOV A;  1PZZ A;  4J2K A;  2I1B A;  3FFZ A;  2P23 A;  5BVP I;  3FJE A;  3VWC A;  1RG8 A;  5BXP A;  5B2H A;  4MZG B;  4ZFY B;  3V0B A;  4OWJ A;  4I1B A;  4X38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...