1TA0A

Three-dimensional structure of a rna-polymerase ii binding protein with associated ligand.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
180
Chain Sequence
MQYLLPEAKAQDSDKICVVILDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Structure and Mechanism of RNA Polymerase II CTD Phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 180
sequence length 181
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1ta0A00
1T5TA 3W5BA 2HDOA 3R9KA 4Y2TA 5ALWA 1RKQA 5ALYA 4Y2SA 4BYGA 5AK6A 5ALVA 1J8DA 4XE5A 1L6RA 3KZXA 5AW7A 4Y2QA 1NNLA 5ALIA 3SKXA 2G08A 2HSZA 3BA6A 3HLTA 2CN1A 3FZQA 3WGUA 5ALLA 1U2SA 2WF8A 3AR4A 4UMEA 2G07A 1PW5A 4UAVA 2OYCA 5ALGA 5AM2A 1QQ7A 1YDFA 1RPZA 1RLOA 4GXTA 2HF2A 3KOOA 5AVVA 4EZEA 5AIBA 3ZTWA 3QU5A 1SWVA 4E88A 2B1QA 3OCYA 2C4NA 2IYEA 4PNHA 4OHFA 5AICA 2HEGA 3QUCA 5AI5A 4Y3UA 4NABA 4UAUA 4XOUA 4KYTA 5AK4A 3L5KA 2ZBFA 2R8YA 4L6AA 3WKCA 3FM9A 2W43A 5ALJA 2G09A 1SU4A 2OA0A 1LTQA 1L7NA 5AM3A 5AW0A 4YCLA 1XP5A 5E0OA 1CR6A 5AVZA 3QU7A 4AS3A 5ALZA 2CFTA 4IG4A 2FDRA 4DCCA 2ZBDA 4CF3A 2HOQA 1LVHA 3ZW7A 5AVWA 2I7DA 5ALPA 3K1ZA 3ZX4A 3U7EB 2YFYA 4KNVA 1QQ5A 3KBBA 3KDPA 4HGRA 1RRCA 2WF7A 5ALRA 3B9BA 3NALA 2VKQA 3ESRA 4ZEXA 4UMDA 2G80A 3SD7A 5AW4A 3U26A 3DAOA 1Z5GA 2IA5A 5AKGA 3BWVA 4MUMA 4UMVA 1YV9A 3U7GA 1U2TA 4KN8A 2YJ6A 3UM9A 3A3YA 1L8OA 4EX6A 1F5SA 1MH9A 4G9BA 3AR8A 2JGAA 4BBJA 5AI9A 3AR2A 3I6BA 1Z4JA 1ZS9A 2B30A 3QX7A 3ZVNA 3MN1A 2RAVA 2YJ5A 4OFZA 1RMQA 4CNQA 2JAOA 5FP0A 3A1EA 1RDFA 3MC1A 5ALHA 1S2OA 3CZ4A 4HGOA 3QGMA 3SHQA 2BDEA 5AM5A 3B9RA 4Y2YA 2NYVA 2C8LA 5A3QA 1XVIA 1RKVA 4UASA 3F9RA 2ZBEA 3WK8A 2G0AA 3UMGA 5A3SA 4QJBA 1ZRNA 5AW1A 4UU1A 4GIBA 4Y2VA 5ALMA 1TE2A 1RQNA 5AVUA 3WK6A 2FPSA 3I76A 3FPBA 5AM1A 3ONNA 3W5AA 4Y2PA 4NAVA 1ZRMA 3SLRA 4AS2A 2R8XA 5AK3A 5IT4A 5AKIA 3E58A 2CFSA 3RF6A 2OM6A 3CNHA 3EF1A 2I54A 3NASA 2C8KA 1Z4IA 3L0YA 2FPRA 2FPXA 3L1VA 2I33A 5AI8A 4EX7A 1WVIA 2R8EA 3UMCA 5AW3A 5AVXA 4KX3A 2CFRA 2P11A 1O08A 5AVTA 3RFUA 2FEAA 2X4DA 2HO4A 4YIHA 3UMBA 3HYCA 4NV0A 3NIWA 3ESQA 3DV9A 3OTQA 4KX5A 4BX3A 2WM8A 4XPZA 3N8GA 3L0BA 4EENA 5AKJA 1X42A 3A1CA 2I55A 3J7TA 4ZEVA 1Z4NA 2PKEA 2I6XA 5AKZA 4RETA 4C4RA 1WZCA 2HF7A 3IB6A 3WKAA 5ALXA 1Z4MA 1U7PA 3WK5A 5ALNA 2B1RA 4FE3A 3AR6A 5ALOA 3W5DA 2YMPA 5AVRA 4YCNA 1YJ5A 3QUQA 3ZUPA 4HGNA 4L57A 2GMWA 3ZWDA 2AGVA 1IWOA 4C4SA 3KC2A 2YJ4A 3L8HA 3L0CA 4AP9A 3ZVMA 2GHTA 3DDHA 1Y8AA 4Y2JA 4H1WA 4HGPA 3WGVA 1FEZA 3DNPA 4I9GA 2P9JA 2I34A 1YS9A 5ALUA 2YMLA 5ALQA 4F71A 2AUTA 2NO4A 3PGLA 3QUBA 3PGVA 1S8OA 3ZWKA 1Z4LA 2W4MA 5AW2A 1VJRA 1TJ5A 4DWOA 3L8GA 1Q91A 4YGYA 1ZD3A 3PDWA 2HHLA 1K1EA 3NRJA 1YMQA 3SMVA 3ZTYA 3A1DA 4YH1A 4B6JA 2PR7A 3VAYA 2NO5A 2HX1A 3WK4A 1RKUA 1T5SA 3U7FB 4O8CA 1L7PA 2YN4A 2EAUA 4JDPA 1RLTA 2GHQA 1YNSA 3GYGA 1TJ4A 2IOHA 4YCMA 4UARA 3EF0A 1RC8A 2G1AA 1Z4KA 1ZD2P 3N07A 2FUEA 3OCXA 3E81A 2B8JA 5AM0A 3ET4A 4ZEWA 4BX2A 1CQZA 4UW9A 3KD3A 3NUQA 1Z4OA 5AM4A 5JJBA 2QLTA 3N28A 5IT0A 3NAMA 3QNMA 5AIAA 2ZG6A 5ALKA 5ALSA 2PQ0A 2RBKA 3QU2A 2MU1A 1ZD4A 5AI0A 5AI4A 5AK5A 2C88A 2RB5A 3AR7A 2Q4TA 1QQ6A 5ALDA 3E8MA 1TJ3A 2YY6A 1Q92A 3ET5A 3WKDA 4BX0A 3QU9A 3MMZA 2P27A 3TLMA 3OCVA 5A3RA 2WF5A 1WPGA 4UATA 3FGOA 4XQ0A 3WKEA 5AVYA 4J2TA 3L8FA 1J97A 1RMYA 2YBDA 1KYTA 2IOFK 4C4TA 4YIKA 3U7HB 3N5KA 2W11A 1NF2A 3MPOA 3QUTA 2JAUA 5AKKA 5AKHA 1Z4QA 3M9LA 5AKEA 1NRWA 1VJ5A 3WKBA 5AW6A 2O9JA 4G63A 3EPRA 4F72A 2WHEA 1Z88A 4CE6A 4RESA 4J03A 2Q5EA 2WF6A 3E84A 2ZOSA 3U19A 2EARA 3WK7A 3W5CA 1JUDA 1L7MA 2EATA 4FFDA 4OCZA 1ZD5A 4I9FA 4UM5A 3OPXA 1QH9A 2HCFA 4MWOA 2GO7A 2R8ZA 3AR5A 2B0CA 3EWIA 3ED5A 2ZBGA 1QYIA 2MSNA 2P69A 2B82A 3B8EA 2FUCA 3AR9A 5AW5A 3I1YA 2AH5A 2YMMA 1TA0A 4EELA 1N9KA 1AQ6A 2C9MA 4FYPA 1T9ZA 3OCZA 5AI6A 3L8EA 4OD0A 3WK9A 3SKYA 3ZU6A 3QXGA 4BNDA 1RMTA 1SWWA 4NFLA 4DW8A 3L1UA 1EK1A 2BDUA 2FPUA 1RLMA 3QLEA 4BKMA 5AKXA 1Z4PX 1XPJA 2FI1A 4CF5A 1ZOLA 4BNDB 4DFDA 3QYPA 2Q4RA 1O03A 5AW8A 3ZVLA 4CF4A 3P96A 2WF9A 4UM7A 2FPWA 3M1YA 2QYHA 3ZI4A 2O2XA 1VFPA 4Y2RA 2WFAA 1EK2A 4JB3A 4L6CA 1L7OA 2JAWA 3PCTA 2G06A 5IS2A 4UU0A 3FPSA 3I28A 5AVSA 2AMYA 3NANA 3N1UA 3SF0A 3OCUA 2BY4A 5T41A 3OCWA 4QQFA 3L7YA 2HI0A 4UMFA 2RARA 5AW9A 4BEVA 4Y2XA 1N8NA 2IOFA 3AR3A 4HYTA 3QU4A 2JARA 4NWIA 5AKLA 5ALEA 5ALTA 4EEKA 2ODAA 4BEWA 1L8LA 2YJ3A 4HGQA 3IRUA 5AHXA 4Y2UA 4HAIA 1RQLA 1U02A 2GFHA 3R09A 4IFTA 1WR8A 1ZJJA 2OBBA 2B8EA 2ZXEA 5AESA 2YMQA 1Z5UA 2D2VA 2DQSA 5AKYA 3IJ5A 1U7OA 3D6JA 3FVVA 3U13A 5AVQA 4KNWA 5ALFA 3ZX5A 3S6JA 3R4CA
chains in the Genus database with same CATH superfamily
1XAJA 1T5TA 3W5BA 4ONEA 3QEAZ 2SKEA 3JQBC 3S40A 4GYJA 2V98A 4HUQB 4AKTA 5DCLA 2RGNA 3N0WA 1DINA 4ZKDA 4YRMA 2A5YB 5G0VA 2W2MA 3TTVA 3KPWA 4PSKA 1LLFA 1BN7A 2GASA 3HVHA 1UZAA 3L93A 4PSUA 4RKEA 2NSLA 5K8CA 1QG4A 2JIZA 3EVFA 4ZICA 5BN3A 1YR2A 1KO7A 5IAAA 2FG7C 2SKDA 4X7PA 1ZSVA 2AX3A 5ENZA 5HKLA 3I6YA 4D9NA 2ORVA 4AP5A 1A7UA 4LDNA 3O91A 1H3EA 2BL4A 4M53A 3C3XA 1Y8RA 1U04A 1UPFA 1I30A 2XUDA 3M5CA 3WGUA 3HDYA 2CNDA 4FXPA 1JHVA 4A10A 4DEXA 2CCJA 2A0FA 2IPOA 1JZQA 1RJWA 4MMYB 4TTRA 3RVDA 4KWIA 1DDIA 2O7SA 3ENNA 4HFMA 4AMYA 5J4HA 2IEZA 1RC0A 5KTTA 3T3NA 2ZAGA 2ATCA 1RPNA 1ZIOA 4XVRA 5PGMA 4LRWA 2VXYA 2NOAA 3LVFO 5T8KA 3QVVA 4HB2A 4CT5A 2I6QA 2AI3A 3CM0A 5IH3A 3E0QA 1GPUA 4AIRA 4N7MA 1OE0A 3B8HA 3O9MA 2VCHA 3WGHA 4CMIA 1D2EA 1JSLA 1Q57A 1HQKA 1KZ4A 1TF5A 1HQDA 2OCGA 2VF2A 1MGOA 3DE6X 3O84A 4R2LA 4YO7A 3Q3JB 4UBIA 2WWWA 2VJPA 2O1SA 5JEEA 4RE5A 1AX9A 1D2AA 2YUTA 4V3CA 1L5HA 3QJ5A 1IOLA 3MNFA 2IYEA 4PNHA 1P45A 1ZL2A 2ZYIA 4C3OB 1B76A 4ES6A 4Y3UA 4Q3EA 2LUOA 4MVWA 1ISFA 2PM8A 4O2RA 3ON5A 2BM0A 4CU2A 3GQVA 1BJTA 2X9LA 3Q3HA 4KPGA 2X8LA 1YCDA 1PNQA 1KI7A 3S28A 1JQBA 3I9MA 4Z7NB 4HYQA 2XXAA 1K88A 2YDXA 4OI1A 2HMSA 3SIPA 3Q8MA 4MWBA 2ZRDA 5EHQA 5AW0A 5TPWA 3DR3A 3NZEA 1CSEE 4GBJA 4NR0A 2JLCA 3BBLA 2VJDA 1GGKA 4GUDA 4H7HA 3VH1A 3J80A 1CHDA 2WMOB 3TPCA 2PEYA 1B00A 4KW7A 5FIUA 1HURA 3TIVA 3VNQA 1ID1A 5DM60 1U5BB 3HUFA 5FXMA 1QYVA 2FQXA 1WEKA 1TKAA 2ZI7A 3OU6A 4FYJA 3O2SB 1G21B 4MMZB 4BIIA 3FYHA 2C04A 5HWSA 5HF8A 4HGRA 1O97C 4DR7B 3P2YA 5IK2D 4B85A 5F78A 2PY6A 2EP7A 2QRZA 3Q7PA 4GGPA 1WCIA 1GTMA 3V6MA 3ESRA 5CDUA 2PV0A 1KE2A 5I7RA 4PZAA 4MYCA 4HQRA 2AXNA 3MB5A 3T6KA 5A5FA 4TLBA 3W1EA 1ZUWA 5TX7A 4CKWB 3BREA 4X7BA 2X8AA 2L18A 4GVLA 4DTIA 3U7JA 4D8WA 3THSA 3A3YA 4K9NA 3UFXB 1Y7HA 3BERA 5CYOA 3U62A 4CT0A 5EIEA 2ZWOA 2ZJYA 3G9QA 4NG5A 4KO1S 3QOFA 2JGKA 1QK4A 2VXCA 3OZWA 2WZCA 3BMNA 4FDVA 3RC7A 5EQDA 1B2LA 1AS0A 2EV9A 3H7IA 1J06A 5HF6A 2F1JA 5BUQA 5JHGB 3W0LB 2VZEA 4QBHA 3IB3A 5D85A 1R6UA 1T1SA 2K87A 3D3WA 1C8BA 2XGOA 4CUZA 3B6MA 3SC4A 1JFTA 1RYEA 1CEYA 4OFZA 1S2DA 4Y30A 1YS7A 1JKJA 2C57A 4M0DA 5I4IA 1Z07A 4BUCA 1QFSA 3ILSA 3K6KA 3URKA 4RHCA 1TMOA 5JVDF 2QB5A 4NHOA 1OAOA 2E55A 1E2HA 3B6IA 1DV2A 2NYVA 2UXCB 3QOXA 2C0QA 3ELUA 3NEJA 4J9UE 3M6AA 5CXSA 3OUTA 4J16A 5TQ2A 5ICGA 2ZRLA 4KQXA 4HT3B 1LCIA 2W6PA 3G88A 5I9TA 1VE5A 4QULA 4EHIA 1MX1A 2XIQA 1MA0A 4G1BA 1MTOA 1WB5A 2J7KA 4QGAA 2BMVA 2BMAA 4FMPA 3LD9A 1EUZA 1COWD 3L46A 3WYEA 5D7NA 2R65A 5E9JA 4YJGA 3S81A 1QWSA 2LCIA 2P62A 5J2UF 4LF8B 1G6HA 4OKSA 4IGEA 2WJ4A 2GM9A 3VGJA 4GX2A 4Q9LA 1FRNA 2PJRA 1ZRMA 1N33B 3DW3X 3IP3A 2WZDA 2I1WA 3KJZA 4P3OA 3TBHA 4UBKA 3ZWXA 4WZBB 3DBRB 4C6SA 5E4TA 1E1QD 1BE6A 5EZ5A 5B1IA 4JGGA 3ZK7A 3WZMA 4EG3A 1G2QA 1P9LA 2XNSA 4R7ZA 1DFHA 3ZNQA 3EAGA 2UYHA 1AQNA 1WETA 4OJKA 5FFFA 5JAPA 5HKKA 2AQHA 1M6YA 3VOAA 4OGGA 1HZJA 3LP6A 4AYWA 1WVIA 2I76A 3HJUA 5F73A 3SXUB 1N6IA 5F2KA 1XA0A 2QI9C 5I9NA 1P80A 1O6BA 3CZ5A 4ZREA 1N34B 4U2DA 1J7JA 1R5BA 3HYNA 3BTSA 1WF6A 3EEQA 2MSDB 3WKCA 1DC3A 3T1HB 1G66A 3Q40A 2Y1WA 2J0UB 2C7RA 2R3SA 2YJGA 1LXCA 5K3DA 5B37A 5F3WB 3CJQA 3MTDA 1IATA 4ZCPA 1JEQA 2WVGA 1SIWA 3HZHA 3HYCA 4I19A 1FTYA 4QSHA 4CTMA 1AA6A 1UT8A 4A8PA 2J41A 2NTNA 2QRKA 5EN4A 4WEOA 2XYVA 1V71A 3I30X 4R8VA 1TT7A 2R4UA 3L0BA 1V41E 5IM5A 2E49A 5AKJA 4UUNA 4OO3A 3ZW8A 2I55A 4TMKA 1VSQA 1M2OA 4C0LA 3L0OA 2FMTA 1BGVA 4Z4HA 4GZ3A 1QCCA 1ACJA 2CFCA 2ZYGA 3Q41A 3UY4A 2A5GA 2RI0A 4FGWA 4NARA 4XEUA 4ZOQI 2R7KA 2ZSEA 1JKMA 2JGRA 2ZYSA 3EXHA 2I2AA 2JCSA 4R2IA 1ICIA 1MC5A 3E3LA 4FPXA 1K6XA 3VPSA 3KSZO 4HLCA 5ALNA 3ONEA 3VSAA 1ZIPA 3JVIA 3S2SA 1YZUA 4U7JA 4YP5A 1WDLA 4KDFA 3SQLA 3FR8A 3F5QA 1XCLA 1RBYA 2BLNA 4FFSA 1S2IA 4C29A 2ZVPX 4KMMA 4MPTA 1R6BX 4WASA 1MHTA 4D3ZA 3ZWDA 2O3QA 1Y8QB 4LPSA 5EMNA 1CETA 2EX0A 3HYSA 4L3WA 5BO5A 4UBOA 1LPAB 2XWQA 4H1WA 5JS8A 3Q88A 4Z1MA 1OC2A 1P7WA 4I9GA 1DL5A 3WB9A 4TM7A 2VHCA 4XDHA 2BFCA 3HGQA 5CLHA 3EY9A 5ALUA 2C0CA 3QM1A 1XWFA 2UAGA 1M2KA 4IQ8A 4R1NA 4IICA 3FRIA 4UVGA 1LNSA 4B6RA 2FSFA 3W77A 3DQPA 1HC7A 1Z4LA 1VKJA 2I87A 2PZ8A 3CB4A 3P2IA 4EHNA 5C7IO 1OT5A 1J5EB 1TFRA 2DFLA 3AKZA 2QVZX 4YGYA 2FZGA 3MOIA 2NYAA 4LK3A 4Y98A 4BLOA 1ZR2A 4YRZA 2VJMA 1LDBA 4JBNA 5CDGA 3ZS9A 3MMNA 3UAZA 3UGTA 5BW6B 2ZT5A 4BFUA 4TZ6A 1DGQA 3SBOA 3SZRA 2VA8A 2R00A 2CB0A 5DT2A 3CRQA 4LHXA 4PLZA 5KOHA 1K68A 1YDMA 3QF4B 3TRFA 4B44A 1UMDB 5JECA 4DA6A 1XEFA 1Q6YA 1YNSA 3G0CA 4JP1A 3VC1A 5TMBA 5F1KA 4EVSA 3OQIB 1DVRA 4KUEA 5F7XA 1Y80A 3C3CA 5DM1A 5E6UA 1SKBA 1O9BA 4JYMA 3NHUA 4Y0VA 2GVNA 2DWOA 5CH8A 1PDWA 1AQYA 4HB4A 4LJ5A 3W3AH 1B15A 2PX8A 3GJXC 4BNIA 4FEYA 1YMUA 4MWEA 4HYYA 2BJVA 3ZGXA 1GNVA 821PA 3QP9A 3LPCA 3CJTA 2VH2A 4MMXB 1GN8A 2ZAYA 1X77A 2BW0A 4NS1A 5IFKA 5JLAA 1Z68A 1TO2E 2IEGA 5AM4A 4J3NA 5ILOA 4RVNA 4XD2A 4ZVUA 2BZ1A 4FILA 4UCQA 1XQ6A 4Y7DA 3HACA 1KPGA 3ECSA 1C9MA 1FZTA 1DEKA 3CA8A 3WLAA 4Y6LA 1WOMA 4TUYA 1XD2A 4KQJA 5IAKA 2JBWA 3LBIA 3T4PA 1V5GA 4B3CA 5LM3A 3JQ7B 1EK5A 3CIFA 3NORA 4GM4A 3TW8A 4C01A 3CVVA 1QTQA 3RNOA 1R4AA 3PLAE 3FWKA 3AVYA 4QYIB 4MWCA 1G5RA 3E8MA 2OBLA 1E1YA 3IUQA 3EZFA 3KV1A 4INJA 5F9MA 2BP7A 1G5FA 3WJ2A 2YTZA 1RYZA 1ULUA 3I2GA 1R6VA 5LB2A 3C4VA 2A5LA 2QF7A 2ZJ2A 2H8KA 1X86B 3WL8A 4DDHA 1PX0A 3EVAA 2RONA 4C0HA 3ITNA 4YCAA 3X1WA 4L0QA 3VYUB 3KYCA 4J2TA 2IUSA 1UWCA 3B38A 3LT0A 1R64A 1VYUA 2REBA 1U31A 2OCYC 2B7BA 4GWLA 4OXRA 3HJNA 2YXNA 4K8RB 3NEAA 4RS3A 3LTEA 2IUUA 3WS7A 4FEGA 1GY8A 2C2ZA 3BXGA 1IXRC 4DR6B 4D0SA 4CEHA 2FZLA 4DLLA 1DKPA 2GEDA 3RWOA 1N1DA 4P8RA 5KOIA 4PICA 1NRWA 1VXRA 3STVA 1P4RA 1R15A 3AVVA 1E7WA 3VGPA 3HXKA 2QA5A 4N6OA 1ZUD1 2UVQA 4RTPA 1E1MA 2QRPA 3IE0A 3FTDA 1N2XA 2UXBB 2QRLA 3OX3A 3GLFA 2ZPUA 1QIKA 3UJCA 1Z7YA 1Z8DA 1L7MA 3G9XA 4QEKA 5CDYA 3MXOA 1ZD5A 4I9FA 4EFNA 5JLJA 1EFDN 4OHPA 4QYWA 4AIIA 3RAGA 2VP0A 3UBTA 1NC1A 3PEWA 1TJNA 1RJFA 2IZ5A 2RC6A 5CG2A 5IU6A 3I61A 1IJFA 3HSYA 1XSEA 3A1FA 3PPXA 4LQCA 4ENQA 1ADBA 2B82A 5D7BA 4B71A 1U6JA 2AB0A 4D0LB 3WFJA 2C2KA 5K3FB 4K6OA 1L4EA 2Z83A 1PFWA 3FI0A 3OCZA 3ZZTA 1UM9A 2J3IA 3FIUA 4C6RA 2QW8A 1P2UA 1LBIA 2Y99A 1TC1A 1D8AA 2XEDA 3ANMA 2HTEA 3G5LA 3O8DA 3MRSA 3RTCA 3PFIA 5IAGA 1YKFA 4R9NA 1USWA 2PL1A 4FFPA 4JVLA 4WLEA 4QWWA 1I4WA 4BZXA 3HXMA 2IYUA 3DZDA 4NE2A 3RS2A 3NDJA 4EY5A 2JCVA 3L01A 4LGVA 4BO6A 1A95A 1P18A 3B7GA 3GLQA 4IINA 4L9WA 1DRJA 4UPDA 3QLEA 3N6RA 1RLMA 4YP0A 5B36A 1YOVB 4NPCA 2B4YA 3PSAA 5CB4B 7REQB 1OFVA 1XAHA 3ROGA 2BSAA 3WLTA 1P2VA 2WAAA 4O4LF 4ILEA 1H4TA 3HJTA 1QFMA 1TTPB 3AY7A 3M0EA 4MIYA 4PPGA 3ZWAA 3FBWA 2O7VA 3GCGA 1VA5A 4N39A 2ZRFA 3R5SA 1CQJB 3M1YA 4CN9A 4AQ7A 4TL6A 3RYFB 3UB4A 4TV8B 2CXTA 2OILA 2QRMA 5C2JB 3ZZMA 1OTXA 4L6CA 3B3JA 4RL4A 3ROQA 1MIOA 3AOEA 4MR8A 3AJDA 2XQFA 3DT6A 3RVLA 2BH9A 3K94A 4LVUA 1E4EA 1PR0A 3KZOA 1SUWA 1DRWA 3PXBA 4FMBB 1PV4A 3UFBA 4X61A 3I28A 3LQ4A 4C7BA 4C2UA 3DDWA 1SCQA 4H6XA 4F6RA 5JFTA 2ECPA 2PFKA 3AM5A 3OTHA 4ILKA 4KXLA 4V02A 1T4CA 1G8SA 5T41A 4AQYB 2C03A 3VPFA 3W90A 1U2PA 2FZEA 3BK2A 1TEHA 2WM2A 3PVSA 4LXIA 4UTRA 4Z51A 4MDFA 3T38A 3ZBQA 2ESRA 1XTBA 2BGJA 4TZKA 3UH0A 5JD6A 3AKEA 3AUFA 3IEKA 1L8LA 3O1HB 3NQ41 4W4TA 2HPVA 2PS3A 5I3CA 5T4EA 1XMSA 2FF7A 2MSLA 3QFHA 3FHCB 3IUMA 4RNCA 2B6NA 4UNQA 5JNTA 1XCBA 2IU4A 4MYRA 2RKWA 3GQBA 1KQGA 4QJIA 4BVKA 4BMCA 1NVBA 2NPIA 2VJQA 1IWPB 1J2EA 1UBLS 2W93A 2Z2IA 5E7MA 5TC4A 2GERA 2GPYA 2MINA 1K5HA 2FRDA 2X1VA 4WACA 1B2RA 1NTRA 2QTCA 1R4MB 3QVXA 4A6DA 5C8DA 3W6PA 1AKYA 3H86A 3RAFC 4ZQHA 3R9XB 1KORA 4PAWA 3HR7A 3IALA 5EQJB 4N8DA 2IV3A 3ZCPA 4B3BA 3R6DA 1QHSA 2CZQA 5MGNA 1F2UA 3VPHA 4QWMA 3H18A 3R4CA 3KOYA 4HN2A 4W6QA 4YMGA 2BFBB 4F3TA 5FBWB 4DYDA 1KI9A 2DQKA 2IYTA 1OZFA 1Y37A 1XN1A 1ZSYA 4BYGA 1U7ZA 4EVQA 5HKBA 1P72A 2QW0X 3K5IA 3SX0A 1ZH0A 1VKNA 3H5TA 2GPJA 2ZSBA 2JVIA 1CY1A 3CG0A 2PFSA 5K8TA 3HA7A 5BWNA 1QQTA 2FFJA 1JDPA 2G63A 2COKA 2VBGA 2FAXA 2IS1A 5J4YA 1L5RA 4UNNA 5A71A 3F3MA 3RJ9A 5I9IA 3LQ2A 1E98A 2XTZA 4B4UA 1RQPA 2A86A 3IXLA 3VDXA 3PUIA 1NN1A 2CXQA 4F93B 3FVRA 4JU9A 1YKSA 1CX9B 4UTZA 4DOMA 3R3XA 5SYAA 4YT2A 3USCS 2XZOA 3SHTA 5AM2A 3QTLA 4G9GA 4QXQA 3V3TA 4TSFD 3PLNA 2CWDA 3EF3A 3ZIAD 4CKXA 1ULAA 1VL8A 4E33A 4KVGA 5KU1A 2IEBA 3ICQB 4PFQA 5GINE 2WTNA 3ZDYB 1VYTA 2PQ6A 3WL7A 5BR4A 4OP2A 1HETA 3CE9A 4GZ6A 4KE7A 4RGQA 4D8VA 5CDFE 3CVUA 3THXB 2EJCA 2ZIAA 3EVEA 3T9EA 1WULS 2H54A 1P1BA 3VNAA 1QBKC 2PLAA 3ZTWA 2RGXA 2FOIA 3UUWA 1SWVA 1KI4A 1XXHB 4E88A 4MUAA 4D45A 2RD2A 3EVDA 1W19A 1QIIA 1K0UA 2CBGA 1T2EA 3AUXA 3R3ZA 5AI5A 2G4VA 2HA0A 4UAUA 3AX6A 5DBGA 1FFHA 4EBBA 3TUIC 4GPEA 1I1HA 2FTKE 4UPEA 1MLDA 2VUTA 2WTAA 4MRRA 1QIGA 3I1JA 4A2QA 3F3KA 1ADYA 1BKYA 3U1BA 4RPJA 2ZE5A 4NDNE 5ALJA 4BNYA 5CA1F 1LTQA 4E2FA 5A03A 5E0OA 4NBVA 5ICEA 4MHTA 1G5QA 1RADA 2CXPA 3ZHUA 1KU6A 1TZJA 5CG1A 2LCFA 1NX9A 1R0WA 1HYQA 5ARBA 2P6NA 5HKAA 4L28A 4D6PA 4UVHA 1RHJA 2MYNA 1J90A 3KZMA 1XXHE 1JDJA 2OAP1 5GQSA 3BUSA 3HEBA 5FR2A 1K6IA 4UAGA 2JHCA 5BN1A 3WO1A 1FP7A 1NSFA 2A84A 4BFVA 1OV6A 5JDIC 3BH0A 4LJ8A 4RAOA 3L82B 2HSGA 3MWGA 3K0FA 4EJSB 1AK2A 2CHEA 5TGZA 3ESZA 1RQRA 4XQ9A 3CO0S 3EG5A 3CBQA 1YKGA 3ECCA 2BR3A 3BF7A 2FMHA 3GMSA 3YASA 4Z4FA 2HB6A 1JYFA 3DAOA 2VLIA 4QARA 1E5DA 1NUPA 1Y9AA 2YZMA 4D9KA 4PGFA 4KR2A 4DQUA 1MNQA 3K1AB 1J25A 4MRSA 2YJ6A 1BMFD 1X9HA 3KEGA 3PK0A 3R0QA 2O3JA 2UZ0A 1T2NA 2XCIA 1W75A 4PXAA 4MTLA 1HDCA 2CNNA 1FTNA 1P6XA 1VPTA 1DXYA 5J1SB 4ROSA 1REQB 4XCQA 1U1FA 3GDHA 3MJVA 3KU1A 3R40A 4LQDA 1EP1B 1EJBA 1HYGA 1JS1X 2QSUA 1F2TA 3ETLA 4JLNA 2ZI5A 4JYCA 4YUVA 3R76A 4MLPA 1NURA 2ZVJA 2XTNA 4JLPA 1L5GB 4H4DA 3P0FA 1QMGA 4G0YA 2DETA 3PICA 4FD3A 1RMQA 1KK2A 5BR7A 5C4MA 3AOGA 2ZCJA 1TIKA 1B0PA 2F00A 2FZKA 4EKGA 2PH5A 2Z95A 4QIHA 4Y9DA 5ALHA 4JI0B 5JASA 1QGYA 3D3EA 3EEYA 4NY1A 3VR6H 3AF6A 2XT9A 2RGDA 4BNXA 4DXHA 2C8LA 5T57A 1IUPA 2W6NA 4Q48A 3P2KA 1VMDA 4D26A 4ZO4A 1T9GS 3TM5A 1K9VF 2PXCA 4XIGS 4Y0NA 2V1UA 1PGOA 1NMYA 1YUBA 1P9WA 2FWMX 3QVGB 4YAWA 1R9MA 1R1DA 1ZRNA 5B6IA 1J0CA 2O1XA 3SI7A 4ABYA 4MAAA 3AEXA 1XZAA 1WAMA 5LZ7A 4BAZA 4DRYA 1L7AA 1HDXA 3EUEA 3SBEA 1RQNA 5EKXA 1QHEA 4MVJF 2WSLA 4YYEA 2QZSA 2P4UA 2IHBA 3ENVA 2F43B 3G6WA 4WK0B 3T94A 4AROA 4OX9Y 4HDNA 1B6TA 1DT3A 2WE8A 3FPLA 5B3JA 3I73A 4IBOA 3E3OA 5F2NA 2FVYA 2WZBA 4LY3A 4QGGA 5DMHA 2ZYDA 2VXBA 3KR9A 4H7IA 4M0PA 4XB2A 5ENVA 3ZWWA 2B8TA 3QIAA 4B2LA 1Q0PA 3ZYZA 4GF5A 4XCVA 5KSZA 4TWIA 1MHPA 2WAYA 3WYFA 1QDUA 2C2MA 4YMUA 2EKPA 5TQVA 3H2IA 1ZK1A 2C8KA 2R9VA 2CNWD 2BHTA 2H9IA 3GLUA 3GG2A 3T3GA 2OVFA 3HNRA 4OGFA 1GADO 4GC9A 4NOLA 3CEMA 3BQMB 1UP6A 3AM1A 1T4GA 4PLTA 5T7BA 4NKRA 2B2NA 4JDUA 4NYIR 2B36A 4YC7A 5TS2A 2RDMA 5DLPA 1B6SA 1J07A 5JJCA 4XKJA 4PNEA 3STXA 1GTG1 4JLOA 3AZPA 5HJ7A 2OHVA 3LYHA 2YFHA 2FN4A 1CVIA 4ENWA 4GM0A 3JD3A 4LJ7A 2OUKA 4CV2A 2WU3A 3LL4A 2IL1A 1HF3A 2P9HA 3CW8X 1X42A 2BFPA 3OZGA 2ZRQA 3I9FA 4Q00A 1RAHA 1EB9A 3LRPA 3R7NA 1N2IA 5IWAB 3C8DA 4B3IA 4D8TA 4EUEA 5B58C 5BWMA 1TQ2A 1ZNYA 3PQ8A 3I2FA 4B6SA 5CT5A 1U7PA 5SZJA 2P2YA 3RYTC 4KC0A 4EHLA 1YBVA 1GDTA 2H5EA 3WK5A 1GLGA 4P33A 3O95A 3HRKA 3LLMA 2J45A 2CVFA 3KXDA 1SXJE 1GPH1 1IHOA 2YXLA 4HEA1 4INOA 4LJ6A 4QO8A 3F9CA 3H13A 1XZKA 3HKDA 1NOKA 2LTAA 3LDGA 5AVRA 3KK0A 4DNFA 1GPAA 1Y3DE 4Q37A 2X5XA 3UJNA 4GLOA 1XTUA 4AY6A 3PUVA 4EFDA 1AXGA 4CKCB 3KC2A 2J3MA 5I9LA 2QMEA 1YRAA 2ZITA 4IGIA 4QXPA 3C5VA 2FP4B 1FP2A 5TQJA 1DQYA 4PPQA 1WZNA 4QC2A 4ARZB 2OBNA 3M33A 1QUEA 3PR1A 2GTIA 4JP5A 5TNXA 4HVLA 5G4KB 1BSVA 4RKYA 4TMFA 4CIAA 2FP3A 4C1BA 1ZNXA 4KH0A 4BS9A 1YB1A 1Z73A 2BT4A 3MEQA 4XWYA 3OPYI 4XVQA 5KAMA 1UM8A 3TEFA 5HFJA 1C29B 1CU1A 1LDNA 3L8GA 5I9SA 2OHJA 2IYAA 3ZQ4A 3NFRA 1TPZA 2QUKA 2RBGA 3QBDA 3E3NA 1MO6A 4WFKA 1C9DB 4OMDA 4LNUA 3TN7A 3G2OA 3IL2A 4LOKA 4C2AA 1JVNA 2J3KA 2BGKA 2TMYA 4LXQA 2ZI3A 1RJ9A 4RACA 4PE5B 5TMEA 1RHMA 3UV3A 1DG1G 1Z5ZA 1BWQA 3G59A 4KZPA 2R86A 5K0BA 3GLIB 4B9EA 4ND7A 4ZEMA 3ZY5A 3HEAA 4JQOA 4ZI7F 2AJTA 4LYEA 1DHTA 2HA7A 2OLEA 3IRVA 4HFJA 4X44A 3HU3A 5TGDA 5FLYA 2EX1A 5AUOB 5DWDA 3L2OB 3N2IA 1E58A 5CEJA 2HLDD 2I71A 4DA7A 5HK9A 3RADC 2PO5A 4EY8A 3ADBA 4YUXA 2BI4A 3TRHA 1XRRA 3KSAC 3CFYA 3GEHA 4HQKA 4ADSG 3TOCA 4CRWB 2XA2A 4ZZ0A 2VKTA 4M99A 2UZAA 1SVIA 4NZ9A 3AINA 1UPTA 3CLHA 4FEEA 4PR0A 4A2PA 4EQZA 3WIOA 1QVVA 2MMCA 3ESAA 1DV1A 2FYTA 3JSXA 3OM9A 4WK6A 2VCEA 4FYKA 5CX1A 4GW3A 4DCGA 3K20A 3NAMA 2QZ9A 2BI7A 4M8NE 1BX3A 3B3AA 4B83A 4QNMA 2X2EA 1ZPDA 3IC5A 5IBPA 3V8VA 3WADA 1MVOA 2D00A 2UYYA 3P9QA 1M1NA 4JEIA 3ZHRA 2CNOA 1T9KA 3T41A 2MU1A 1QLWA 5JXHA 2BHNA 4IXDA 3CEJA 2JG3A 1DFGA 4YO8A 3CT4A 3OLVA 3U9LA 1TGVA 4TVOA 4XSHA 4BQNA 2D1TA 4Y6PA 4P5EA 3TL6A 1IY8A 2BRUC 4GI5A 4IOMA 3U3ZA 4KBGA 1EDOA 1Z39A 4JASB 3CEAA 1P4SA 2AEJA 1D1SA 2XBMA 2C4KA 2ZTHA 1GYQA 1GCUA 2WW8A 5HW0A 3BXOA 4GPTA 4BMYA 1RHRA 2FSVC 1XXLA 2O05A 3OTIA 4KV9A 4Z53A 3SSAA 4M0CA 5AK0A 1XWWA 1KETA 2TS1A 1D8TA 2BF7A 1KRHA 3IURA 4G81A 1NVFA 5HCIA 4DRXB 4WN3A 4QRHA 3NBKA 2BM1A 1JA9A 3CPEA 4DWWA 2HMTA 1UXKA 4QXAA 3U7HB 3DCIA 1ZVJA 3L0IB 2EIXA 3EGDB 3Q2IA 3BYZA 4QG7A 3OH8A 5F3RA 4N49A 4NCBA 1XKLA 5FWYB 3O94A 4Q21A 3P1JA 4BFYA 2O9JA 5E1BA 2HMWA 3OU2A 2WQ6A 1IVNA 4AZSA 3HVRA 1Z7WA 2G83A 2W6MA 3I37X 5K0CA 1LLCA 3GLHE 2FN8A 1IMJA 1JH8A 3OESA 3DOIA 3A3PA 3MRTA 4X90A 3E84A 4RE6A 2OYRA 3RVQA 1F6BA 1XTZA 4NNJA 5AXDA 1WUIS 1WW2A 5FA6A 1BHSA 4IPTA 4RTRA 3PDHA 4OCZA 2VQSA 4WKCA 4EG0A 1LQUA 5K20A 3L40A 5KOJA 2R48A 1GZVA 3IT3A 1KQNA 1CVLA 5IH7A 5KX5B 1NIJA 3LKVA 3IUNA 3MBOA 4KO3S 5JS6A 4AI6A 4ZDJA 4KGZA 4MH0R 2CNLA 2JI7A 2VF5X 1N6OA 4XFJA 2IWRA 3WGZA 2DLCX 4RABA 3M4XA 4ACBA 4K26A 4XIYA 1VMEA 1V3VA 1FVFA 4F3CA 2IHKA 2JIMA 3JTEA 4M6WB 1AUVA 2WR8A 4BMPB 4CCYB 1HMYA 3FWZA 4F0JA 4ISBA 4NZMA 4NCAA 4ZO8A 1QF7A 1W0JA 1QAMA 2H63A 2YVQA 3PNBA 4M88A 1EGVB 2XYGA 4M1KA 5TVKA 3LRTA 5AXAA 3WWZA 1NRJB 4NBTA 5T5QA 1A5BB 4YJ3B 5HRCA 3WA7A 5JJKA 2R1TA 2L0XA 3BE8A 3J81k 3GJYA 1PWYE 4AJEA 3OIGA 1V11A 5FD8A 4ZVNA 3BTUA 1TM1E 2JIZD 2QUAA 2TRSB 4A8TA 4BKMA 4LDZA 2ACKA 3DZ8A 1HOTA 3SZGA 3U4IA 4Z0TA 3WV4A 4O2AF 1TKRA 2HJWA 4LZNA 1VG8A 1RZUA 2JGNA 4RWZA 2R1VA 4LCEA 1EK6A 1CBUA 2VJCA 3B9QA 1UFRA 2O0MA 3BA1A 1FF9A 4L8VA 1QP8A 2HA6A 1VHJA 2A5DA 4W63A 4OK5A 1TQHA 5FRDA 3KLBA 2V55B 1F1JA 1I14A 2GEJA 3K16A 1BTOA 1MBZA 2HJSA 3O47A 5JMTA 2OQRA 1JV2B 4K1XA 1YIAA 2HDNB 2QQ5A 1VFPA 3I09A 5H02A 5MDHA 2WFAA 4ESOA 4J9VA 3AB3A 1ISPA 1B8OA 2YRFA 2JAWA 3PC6A 1NQAO 4HPWA 2JGMA 5EJ2A 5KYXB 5DJ5A 4A91A 1BEUB 3A04A 4KODA 1FXWA 1QNFA 1NY6A 3WI7A 1W88B 1J0DA 3VXKA 5AVSA 1A4RA 1FYDA 4L9SA 3BMCA 3E82A 4HRXA 3H1FA 2BCEA 2C4TA 1M83A 3ASUA 3FOCA 3OCUA 5DB4A 5I5GA 4ZVTA 3K71B 3NHYA 5FOVA 4DA0A 2V3CC 2WD7A 3SOPA 3UZUA 4D3XA 4ZVOA 3D6HA 4N3BA 2RARA 121PA 1MJGM 2Q9UA 3OTWA 4A03A 1NW6A 3N2GB 3C5WP 4BLTA 1RXYA 2F8TA 3PUYA 1K3TA 3PBKA 4YMWA 3ACCA 4ZT6A 3KXPA 3STWA 5EXTA 5IEBA 1S2GA 2IOYA 3AXSA 2Q6OA 3LUCA 2GFHA 4ZU6X 2GXQA 5EA2A 3DZBA 5FLKA 2GBCA 2IYVA 5IN4A 5H5JA 1DG3A 1CJKC 4IDDA 2X4LA 4IFEA 4N0PA 5F1YA 3WBJA 1T6XA 1GGMA 2FR0A 4QBIA 4XXHA 4B3TB 4CG1A 1GPDG 5DT9A 2I8CA 3FTNA 1T1GA 2DQSA 4FMCF 3FF4A 2B8NA 4IDPA 1IN5A 3RTAA 4JJEA 2F3PA 5B1HA 3UGQA 2V6GA 4K9KA 1AIPA 3D8HA 1OYWA 3ZZUA 5LIPA 2N46A 2HDOA 1YSCA 3NH9A 4XIFA 2ICAA 4U9UA 1CUEA 1BJRE 1CQIB 1GQFA 1H85A 1X1CA 3ETNA 2V4ZA 2FN9A 3F1KA 4AN1A 3RD5A 1DFIA 4PLGA 5EGSA 1N5DA 3CINA 3T5GA 1KL7A 2ZIVB 3EC1A 3BJZA 1UKAA 4QASA 5IKMA 1ZESA 2P0AA 3VOBA 4IHJA 3HCNA 4WKPA 3MT7A 3AG6A 3RIMA 2EJTA 1XVVA 3EQ6A 4M87A 2WJIA 2Q1YA 3SKXA 4OLAA 1EGMB 3DTYA 2LD4A 3UMSA 5I45A 2XB6A 3ZE1B 1HTTA 3K96A 1OZGA 4C1NA 4Q12A 4C4ZA 2D7DA 3CR7A 2O8NA 4H1UA 3OO0A 4WKNA 5BN3B 5ALGA 3S70A 4DZRA 1E3IA 4GMXA 4UJ5A 2NU6B 1LD3A 2HCJB 3SIWA 4RDXA 4CFSA 1VA4A 1Y8RB 3L9WA 1AF7A 2A35A 2DF8A 3DMRA 3PQDA 4IIEA 2HF2A 2V45A 1SKYE 1UCFA 2DKOA 4HNUA 1HH4A 2ONJA 2VHXA 2QY9A 3KELA 1IB6A 2B0JA 2XNDA 3HGMA 4BO5A 2NADA 4DBVO 1EA7A 3LPLA 3GL9A 3N5CA 3EHEA 3CNBA 3G7UA 2HEGA 2KLHA 1A1VA 2PSDA 4XUGB 3V34A 4WERA 3IUPA 1E3EA 2Z2ZA 2R66A 4B5LA 1YZLA 4XDGA 4CQLB 5CFMA 2HA4A 4QHTA 1X7XB 2GBLC 4XOIA 3RIHA 4BV8A 5C1DA 4CLOB 3DONA 2CD9A 5DK6A 1S89A 3HCAA 3JU3A 1UKBA 4K6KA 4LX8A 5EE0A 5LQRA 1I24A 1IZ9A 2H5JA 4UD6A 1CR6A 1WMBA 1WM1A 4LXUA 5FOUA 4AX4A 1VMKA 2FDXA 1G8GA 4QGFA 5FNVF 1SHUX 3UJ3X 5B4UA 3OFJA 5KO2A 2A0WA 4YRDA 1EM6A 2XXAB 3L41A 7MHTA 3G5AA 4NCXA 1OGJA 1UJMA 4OOEA 3DXZA 5A05A 5HJ5A 3MHTA 6LDHA 4Q7QA 3TLGA 2VJNA 2PRKA 3TZEA 1Q83A 1U2QA 1PJLA 3A2MA 4KPFC 3ZDEA 4DUGA 4H31A 4ALMA 4MUYA 4UNRA 3SR0A 4MA0A 1QHHB 3AMVA 5A0VA 4J0KA 4X8HA 1L5MA 4D9HA 3RGGA 1JEYA 1T8YA 2F8MA 2QRHA 2YW9A 2EL9A 3CR3C 4DCOA 4ML3A 1U3FA 1I2BA 5AWFC 4ECAA 3Q15C 5BVGA 4E1VA 1EQUA 4BFSA 2W0MA 5L51A 1CIJA 1MX5A 1USUA 2DFPA 4PC6A 2VYQA 3DL0A 4C0WA 2AFHA 1RCTE 2FW8A 4F4UA 4HO1X 1MB3A 3B3GA 4IIJA 3PQCA 3MXTA 1M2VA 2XADA 4MUMA 3LUGA 1N5RA 2F1RA 1WCIB 3KQWA 1SUPA 2ZZNA 4XGNA 1TA4A 1K6JA 3KCQA 4AMBA 2M9MA 5LU8A 1L8OA 4CL2A 4CU5A 1XTPA 3EGVA 4D5EA 4HEA6 7YASA 2HIHA 3SDBA 3G8BA 3GXBA 1E63A 1W0KA 5I47A 3RYCA 1WZ2A 5BYJA 3TZ6A 3R77A 4RA6A 4G9BA 4E7PA 4D7AA 5IBCA 2C99A 3KVRA 5DYNA 2Q3LA 3ASZA 3PIDA 1Y8CA 2ZPAA 2EF0A 3IQEA 4UCXA 2W8BB 4TQGA 3RASA 1EVZA 2CNKA 1FMLA 1SXGA 3GLKA 2YJ5A 2XBLA 4RFLA 3DSRA 2P9EA 4X95A 2NNLD 4K88A 2PZMA 1DWQA 4IS2A 3T7JA 5EHIA 2FB9A 2BDEA 1X1TA 3KDAA 4ND2A 3D3WB 5EOVA 5G4LA 2NVBA 3DNFA 5WRFA 1LPSA 3UANA 1FRZA 4E4TA 1UJBA 2V0CA 1QPGA 4KP7A 1JKJB 2P41A 2YQZA 1ZUNA 3O4FA 4QNNA 3UOGA 5HQ3B 1OAKA 1S01A 5E2BA 1HYHA 3ZY2A 2OM2A 2ZQYA 1LVUA 1NVEA 2IYRA 2X77A 2XGGA 1AZTA 3CS3A 3DKKA 3DMPA 2EVWX 2QSJA 3FMPB 3LNCA 2WTMA 1CP2A 4UHFA 4QTTB 4X1IB 5EZQA 4CDMA 1CD5A 1O0CA 3W9YA 5CRIA 3LC7O 1G41A 2ECFA 5FI0B 3PQ7A 4NONA 3CF4A 3UHOA 4Y2PA 3UA3A 1PD1A 5KKNB 3NVMB 1MO4A 3A2NA 3GGPA 3CXUA 4O4HB 4C3VA 3ETEA 4MI1A 1YE3A 521PA 2LKDA 2XGSA 2R96A 4TYMA 4DILA 1TT5A 4ZQBA 2IIVA 2Q7OE 3ZK8A 5H83A 4FYHA 5D00A 3PA8A 3T7IA 4RHTA 5GJCA 3GLIA 1IM8A 1YQWA 1QZUA 2FK8A 4QQKA 3CNHA 3EWNA 1XPUA 3P9IA 3GJ6A 1JR2A 4I0WB 4TKVB 1F38A 3ZE7A 1P17A 2YNMC 4AB1A 4JXJA 3JD1A 3L0YA 2QLMA 1ZHFA 4FEAA 4TXMA 3ZHSA 2XNHA 2DULA 1NN3A 4LC1A 4XB1A 3SAJA 3UF0A 1RQXA 2ZB3A 1FPQA 3L92A 3CUTA 4PAMA 2JA2A 1E3JA 3WWOA 1OSNA 3AU8A 3R3HA 2RGBA 2WY2D 2BFWA 1JTEA 3N8IA 3EGIA 2ZKLA 3FFXA 2ANCA 1XF9A 3HB5X 1ORWA 3RFUA 3UMBA 4JLJA 2QT1A 1U4NA 4EM6A 1GDDA 3MHPA 3ZKWA 1UXJA 2XRYA 3MQ4A 1T25A 2FSIA 3TQIA 1XR3A 4QODA 3D5QA 3HRHA 2WM8A 5HFNA 1EXNA 4QGSA 4F4CA 4YJ2A 4FWTA 2PUDA 3T61A 5ITVA 2Z08A 4ZCQA 3C98A 3A1CA 1JWLA 5LQJA 2YOFA 3I04A 3C85A 3AF1A 5FL7A 2ZJ1A 4JQYA 5L45A 1U1EA 2Q6TA 3GZNA 2HQRA 3IPYA 5CR9A 1JBKA 1J0BA 4PTZA 2FETA 4ND8B 5EPUA 3ZGNA 1EFUA 4QXMA 1B0UA 2IE8A 4EG4A 4O5AA 4NI5A 4NYJQ 5JZ9A 4GH5A 1F0NA 2MMGA 4P3PA 4XRGA 5IVKA 2C3PA 4DYHA 3BB4A 3GLSA 4JNCA 3GJRA 3TFWA 5H4GA 1AK9A 2WB4A 2PQMA 3ZC3A 1MV5A 4G8CA 4IYRA 1CZKA 3KNZA 2JLAA 2LVBA 3EFOB 5CAEA 2WIJA 3THWB 2YV2A 1FU7A 2OQVA 3ZUPA 3RAEC 4BB9A 2I8LA 5EZYA 5KNCH 5LD2C 2VZLA 5J5VA 2A5JA 2FPGA 1UPCA 2YVLA 4V3BA 2BFDB 3OE5A 1S2NA 1UKZA 1EUDA 3PWKA 1XRMA 1H5UA 1NAHA 2VA9A 1PT8A 2SCUA 2WFZA 3QVUA 2YN2A 4MJLA 4LQLA 5C1OA 1OLUB 4MS4A 4YWHA 1NYLA 5KSOA 1KMCA 1J23A 4JR1A 1XHFA 4FCTA 4WXYB 4KUGA 2GPNA 1ZH6A 3RG2A 4OAOA 3AV0B 4NQRA 1G1MA 1JU9A 3JAWB 1T36A 3QWAA 4OHOA 3SPXA 4EHFA 5SZHB 2INGX 2OZKA 5TY0A 4E09A 3OOEA 4E5NA 1T8UA 1RKBA 1C3XA 3T7TA 2NW6A 4M7PA 4IAOA 2PMCA 1QHGA 2I2WA 3W2FA 4PG7A 4XGKA 4Q4JA 3COWA 4JX9A 3A1DA 4ER6A 2W2XA 3DDSA 1WUJS 1TUIA 4YH1A 3I5MA 1I7LA 2A57A 3L07A 4Q7LA 1OIXA 1E6KA 1Y7LA 3W9UA 4CM9A 1CR0A 1T5SA 1WB6A 1L3BA 2DR3A 4FNOA 1O9HA 2VSOA 1N3BA 1U1IA 2ID9A 3INTA 4HX5A 3UVEA 3V7UA 1T24A 2DLDA 5D01A 4A82A 4BMNA 2Q07A 4CEIA 1VI5A 4WESA 2WUWE 2IOHA 2X22A 4P4TA 4L16A 3FOFC 5KC9A 1U5AA 2WMYA 3TW6A 3MBIA 1ECBA 4YUWA 4CTJA 1EFPA 2NUBA 3FHLA 5J5CA 2IYQA 1ESEA 2PGAA 1U3DA 4BCBA 4W7SA 4KO4S 1SU7A 2Z6UA 1A7KA 3GZTB 4Q1FA 4RTLA 3H2GA 1P5ZB 1HE2A 3LDAA 4BX2A 1NOIA 1LUAA 1Y9DA 1Z6YA 2OFWA 3AERB 2PMDA 4J94A 3MTBA 3UK6A 1FQOA 2J3EA 2AR0A 2M1XA 1BXRA 2VRNA 3VR5D 2WIFA 3DDNA 1P75A 2GCIA 1HE3A 2GNPA 2RAFA 2RBKA 4LRQA 2X76A 3WRWA 1G7TA 1XI2A 4B81A 3O3NB 4A0RA 4JWTA 1EAYA 4YACA 5AK5A 5ERGB 2D8AA 2DWPA 3WLHA 2A5FA 2BPOA 5IG2A 2ILVA 3EIUA 4QTUB 1S8FA 3OAAA 3A26A 4RVHA 1DLJA 5THXA 3BFXA 4DSAA 1BCRA 4EUKA 3D81A 4HI0E 4W7HA 4RLQA 4MQBA 2QX4A 3U09A 1PFKA 3PHGA 2FPIA 2ID4A 4IMPA 2NGRA 4MRMB 1ZGCA 4RDIA 4UEQA 3TW8B 5A3RA 1KHHA 3R5KA 1I3OA 1G98A 4UFNA 1GCIA 1DXHA 3LDUA 4JEUA 5HILA 3Q7TA 5HGXA 4CR7A 2BP7B 1Y7IA 4LVCA 3TL2A 4CYMA 2XDYA 1T91A 5KJCA 3ASVA 3MWEB 1C1HA 3S7ZA 1KC3A 4UU7A 4JU8A 4OI2A 3ZWQA 2C00A 5KYWA 1DJMA 2EDCA 1SURA 1XRJA 2Z04A 3CRVA 3N5KA 1W1UA 1P3DA 2BUAA 4A0FA 1Z38A 2JAUA 4K2AA 3ANLA 5ALMA 1YRBA 2AF3C 1DOHA 3W5IA 5ELXA 4LJLA 1KNQA 2R11A 1QYRA 2QSYA 4NBRA 2IUYA 3P7MA 5FR1A 4I1OA 1CDEA 1P5HA 4IW3B 1GO2A 2HNKA 1G5IA 4M0UA 4Z2AA 1XZBA 1ZVMA 2BZ0A 1EQ2A 2GPSA 2ZJBA 2XA1A 1PO7A 3DC2A 4UZSA 5F7JA 2QG4A 4A0HA 4CIYA 3SZMA 2UZ4A 4O29A 4QOFA 2B61A 2RH8A 4CNBA 5L4NA 3U19A 3E35A 1QOZA 2E4YA 1N77A 4LJ4A 1N1MA 2ZIFA 3FDIA 4G9EA 1OZAA 3DT8A 3INRA 1XTIA 3PV0A 4P4NA 4DHEA 3IYLW 2QLFA 1NJFA 1NVTA 3TVDA 1G8FA 2HCFA 2RGAA 5DEIA 1SUCA 3FVTA 2FW1A 2XE7A 3EQ2A 2GO7A 2R8ZA 1VLLA 2WUFA 4UJ3A 3AHJA 3M9WA 5BQ5A 3W5JA 2IH4A 2PRYA 1QVZA 3EBOA 3L7KA 4UTOA 1ZVKA 3IVXA 4UZEA 3QI7A 3ROMA 5BMVF 3QYAA 4ZYWA 2DR0A 4E2YA 6Q21A 1YS1X 2P3LA 4GT1A 4AVYA 1YI1A 1FP6A 1VQ1A 1ZMOA 2GILA 3DF9A 3OTGA 4FYPA 5KYVA 4DZTA 2CGEA 3VZSA 2VYCA 3VO9A 5KJ1A 4U7DA 1VKOA 4KYVA 4HLDA 5ESWA 5BSKA 3DMNA 3BIOA 2ZRBA 1N2ZA 3O3OB 1GL7A 4OA8A 1IN7A 2C3MA 2YIMA 4PCAA 3WWCA 3H6KA 5K6RA 2ZR8A 3DZHA 3EE6A 1L1RA 3GJ0A 4AY2A 5DYIA 1WVMA 4BIMA 4DLNA 3AF3A 4DMUB 1H6BA 5JSZA 1UM9B 5LBTA 4QOHA 3H19A 4JC8A 3WHKA 3LKDA 1ZX1A 5ICSA 1RAFA 3DA8A 3ROTA 3KM0A 5TLSA 3Q98A 2VTBA 4BKUA 5I7HA 4NDAA 1X19A 5FO0A 2FQYA 1O96B 3GLFE 2HT1A 2GZSA 2KJQA 3UTCA 4FNAA 4S0XA 2XR1A 1NHGA 4DDUA 1AKEA 1M76A 5CB4F 2QJFA 2YH2A 1F9AA 3KB2A 3SGLA 3WICA 4CUKA 4B76A 3HS3A 4FP9A 2YC4C 3LIIA 4ZO9A 3TJMA 1RWKA 2Q2WA 1Z18A 3IMFA 2WG2A 2JK0A 4H17A 4K1LA 3U3OA 1KJJA 1S6YA 2GFQA 4WXHA 3A4TA 4TRJA 1JEEA 1PGQA 4GPD1 2X7HA 2G06A 2XOEA 1EGHA 4WDRA 5CTAA 1BHJA 4CCWA 4DAEA 1VJTA 1JHRA 3W7BA 3PFHA 1EVIA 3KJQA 1Z26A 3LHDA 3ZBUA 2BR5A 1SKMA 3V8RA 4G0QA 1KFCB 3E5RA 3OG9A 3F2VA 1APBA 3OCWA 2O8FA 3DWEX 3MUOA 3ZZNA 4MR8B 3W8DA 2E3JA 2VDWA 2Q41A 2HI0A 3CKLA 1FDRA 4LA4A 2F1IA 2FK7A 3ZJYA 1G6KA 3BXFA 1W1IA 3LUJA 4OQLA 3PYMA 2P2SA 3O4GA 3DM9B 3WZLA 1K92A 1E3WA 3Q6NA 3UJ6A 1V48A 1Q0LA 2GOYA 2E0IA 4JL8A 2GN6A 2I7TA 5CLJA 3DB1A 2EQ5A 4MLCA 2FSHA 2V74B 3DEKA 3T1QA 2PPLA 1V26A 1WOYA 3KHSA 3OZ7A 4ZRNA 2R7AA 1U02A 2ODBA 4NMMA 5IJXA 1QYDA 2FPLA 2OGUA 4CFYA 3RYIA 1R00A 3JASB 3RT7A 1CKEA 2CUTA 2BKUA 4RKQA 2YZ2A 9LDTA 3U40A 4WRRA 2ZJOA 1NVKA 4G3XA 3QEMB 4OG2A 4POOA 5EINA 3OJFA 1EFRA 1NM5A 1IHPA 5AKYA 1FU4A 3GQBB 4E5DA 4DDWA 3R7WB 5I01A 2ASEA 2XQJA 1DOZA 2F2TA 1G8YA 3DPSA 3OKPA 2WA2A 3FN4A 4PZZA 1XJWA 4B75A 4EGQA 5FBLB 1SCIA 1ZMTA 4KXVA 3WRVA 4XB6B 1EE9A 4I5DA 1SOUA 3JQBA 3WGQA 2Y1DA 1DO0A 3TG2A 5C0OE 3ANXA 3PDIA 4LFCB 1S0UA 1UKEA 4DLBA 5CYPA 2IFTA 3K2BA 2NAPA 4O3FA 1IEWA 3CLRD 4F11A 1NKTA 5ER9A 1V1MA 3LSTA 4I4LA 4F2HA 2I7XA 1L7XA 4ZK2A 4EUFA 1VIMA 2O2GA 4FKZA 1K3FA 1DRVA 4LC9A 4LX0A 4MV3A 4MYDA 4TKUB 5KDLA 5TQ0B 3DWGA 3O9VA 2H0AA 3SC2A 4F96A 2I2FA 1PYDA 1Y48E 4QDKA 2B34A 3HP7A 5AR1A 4E13A 1RPZA 1XL0A 1RT9A 1K6MA 1QO0A 3FFWA 4GXTA 4L0DA 2O2JA 4MWSA 1EM8B 4RZQA 4QX6A 5F35A 3WVNA 1E2MA 2Z5LA 1U9CA 3Q3IA 2NPFA 2LR0A 2OFFA 3MBKA 4TS3A 3RRXA 5AIBA 1PL7A 4BMSA 3MD0A 4X71A 4DDMA 2CHQA 3OZIA 4MVCA 4CLRB 3KQVA 4CLXA 3MJSA 3H84A 4IDFA 1A4IA 2BEWB 1E7YA 1ST2A 3EGEA 4N5DA 4J1NA 4F97A 1F4LA 1KY4A 5E9WA 1XKQA 4QA9A 2NO9A 1ZGGA 2JFWA 4XFKA 3TZBA 1N57A 4KR7A 2ZRKA 1C8VB 1Y34E 2E87A 3GWZA 3UWMA 1ZCFA 3K4HA 1Y4AE 1H1LA 1KE1A 4YFVA 1IH8A 2AFRA 3W6ZA 1L7NA 4HWOA 4B31A 2QAJA 4MW1A 1GVHA 1H6AA 1N0VC 1KFKB 5HKKD 3I5AA 4GQAA 3MS7A 3WZ2A 3AUSA 1FUIA 3TR0A 5C53B 4KQ9A 4OJTA 3DFMA 4FCCA 1DWOA 1S4QA 4KAXA 3QXXA 5K8JB 5L6LB 2IPMA 3ZX4A 1A9YA 3NDIA 3BGDA 1O6GA 1X3LA 2WWRA 5JG7A 3KBBA 3CLTD 1YXMA 2WF7A 2XXJA 5JNLA 3PUHA 3D6UA 5HZHA 4MKZA 2C5EA 1V9SA 3AKCA 1YQUA 2BEJA 3CWCA 4ON9A 4EW6A 3RF7A 3M2PA 1ZM4A 3P4YA 3ZWOA 5CB6A 1UBOS 2I3ZA 4L4XA 3F0TA 3TIFA 3P4XA 4MVJH 1TQDA 1S1CA 2OT3B 3WGYA 1HLDA 2XMDA 2WBLC 5HHTA 1XNRB 1Q3HA 4IIHA 3QK7A 4UFOA 2VHJA 1BWRA 2ISSD 3MGAA 3TRDA 3GI1A 2BSQA 2FFBA 3K0FB 3SS8A 1NBMA 1U2GC 2GCGA 2XQIA 3H87A 3RQSA 4KBYA 3V42A 4EHJA 4G56A 1TO6A 2HZ7A 2IP2A 4EX6A 4JZKA 1WVGA 2P2DA 2Y66A 2ZTMA 4FNGA 5CA0A 1WLYA 1OX5A 2CBZA 3Q87B 4IDNA 5KCMA 3SEFA 4CQMD 4LBYA 2C5FA 2AW5A 3GGCA 2VRBA 3QFSA 1ETHA 1MH9A 1OD6A 3C6BA 1D7AA 4FFWA 4S1OA 4Q4CA 3SYKA 4ZAZA 1J33A 3NHBA 3ZHOA 2GKOA 3AR2A 5YASA 4TZTA 2ZJZA 3L7LA 2HH9A 3WLFA 2JIBA 3C97A 3G2NA 1GUAA 1P29A 2XZTA 2ZIUB 2Q21A 3GN1A 3GT4A 2LPMA 3UWKA 5GMOA 4QVGA 4B2IA 1HDRA 2I0FA 5LXTF 4FMDF 5FOWA 1POXA 3O8OA 2PMEA 3ZG6A 3GH3A 1ZCJA 5DXJA 1KJ8A 4DDTA 1F2TB 1U8UA 1E9BA 3OPYA 3B1JA 4K87A 4Y2YA 5JC8A 2X5NA 1ABFA 4HRVA 4KWCA 4KI0A 3DOUA 3JAKA 4TTPA 4NZNA 2J1LA 5GAJA 2IV2X 3QPVA 1P33A 2J9RA 4PSDA 1UINA 5B53A 3UMGA 4R1UA 4AS1A 1EJ2A 4DM4A 4BN4A 2O06A 3O21A 3NG1A 1CNFA 4K9LA 4R5HA 2G5CA 1T2UA 2O8DA 4CQNA 2D1QA 2VT2A 3OZRA 3LVQE 4FHEA 4IIFA 1JA1A 5H0IA 5JY6A 1XEXB 3WLLA 4IJMA 4P4GA 2APJA 2HXSA 3I9V1 4K9QA 1B3RA 3WL6A 1E2UA 3GGDA 1EG2A 5J2TB 2ETXA 2QV0A 3A37A 4TT3A 3H5VA 4UBMA 3CEHA 3UHAA 3W8FA 2REOA 4EB0A 3CZQA 4Z3OA 3G0DA 4QBGB 2GGSA 3LV8A 3GOHA 4MCJA 3DT9A 1CUCA 4BZZA 3KLOA 1J1UA 3HE3A 3M6MD 3H3XA 3CUYA 5DWVA 5G0TA 3UHPA 1ZEMA 3VAAA 3TQOA 4LDJA 3ZGZA 4ROTA 2QGNA 1SQ5A 2H52A 2AN1A 2XZPA 3EJWA 3G0BA 3IHKA 3JALB 3M3HA 3PFKA 3VR2D 1K66A 4UQPA 4HDNB 2FSPA 3HBMA 3IQFA 5MF6A 1EFVA 3TMYA 2FXVA 3LH5A 1O9GA 1VBMA 4S2UA 4Y7CA 5T6MA 1G2PA 5D1HA 3TLAA 3PJRA 1E2KA 2D3TA 3K8QA 5AW3A 4YRJA 2WE7A 3LVRE 5FAKA 1J8FA 3K2QA 4B4VA 2I4NA 1D6MA 2QD3A 4K6MA 5G0UA 4L1KA 2WWGA 3PZRA 5K0SA 4BY9E 2OL4A 2O8CB 1QWOA 3PQ2A 4OATA 4G36A 3PUWA 3QWFA 5CVVA 3CKKA 1K4KA 4M9CA 1IXYA 2QY6A 5T6BA 2VF7A 5DGXA 4CTKA 3H2BA 4FDMA 2JH8A 2FEWB 1RP1A 3WP0A 4PAGA 3DV9A 1I3MA 2PUWA 2IYXA 1OFUA 4U7PB 3OD5A 1PWXA 2HHJA 4CM6A 4HC4A 4UVDA 2P40A 4LRTB 2W8ZA 5LBIA 1JHZA 1KSFX 3J7TA 1JQEA 4HKTA 2BUBA 3U48A 3SDSA 4BFWA 7ADHA 1GPYA 3ZQJA 3WWDA 4RORA 1SNYA 1Z83A 2V54A 3HWSA 3V32A 4CQMB 5KYUA 5AFSA 5C51B 3DDZX 1U7WA 2CL5A 2QM0A 3DBVO 3HL0A 2GM4A 4MQ6A 1IBMB 2YV5A 3AY6A 5EVJA 3LXUX 4UCWA 4W5RA 3ZHXA 1WQ1R 2D2FA 2B1RA 1TD1A 1CUZA 4YI3A 1X0XA 4ZIRA 1NW5A 3T5DA 4RK5A 1CZOA 1RM0A 1SOWA 3FUXA 3FYDA 4O4JB 3QUQA 5LP6C 2FOLA 2WLTA 1WPXA 5EIOA 2ZBQA 4LXTA 4ALJA 1L3CA 4NHEA 4I9UA 4J0HA 1R8JA 2G40A 3NETA 4I14A 5I6DA 2QR3A 1SD2A 3DP7A 2BWJA 3RYHB 2P9JA 3LG2A 1HOXA 1W4LA 4L15A 1OFTA 1DAGA 2G1KA 3MTEA 2XAAA 4UPVA 1ECJA 4G8DA 3PRKE 2GNAA 4HX9A 3PGVA 1S8OA 1VIYA 2LBPA 1YRQA 1OYOA 2QRVB 4QUGA 3SE7A 3HO1A 3HCRA 3LF1A 5CJ2A 3S99A 3JQPA 1FFGA 1E2PA 2E89A 2ZE7A 3ND5A 5E0KB 4YONB 5LOVB 5IKXA 4RW0A 1ZD3A 2OCDA 4L51A 2RHOA 5NULA 4NL4H 4ZJYA 2WDZA 2IV7A 3D6MA 3HJRA 3ZWYA 3HKEB 2CKDA 3N2ZB 2TMGA 3AC0A 5TEWA 3ONDA 5L3SA 3UK0A 5LUAA 2PH7A 1FDVA 3IELA 3SQNA 4BL5A 5D3KA 1DSSG 3IPCA 4ZYUA 3ZVRA 2YN4A 4L0CA 2OCAA 1KO5A 3O93A 4JBGA 2VRWA 4LNUB 1B8UA 5EXPA 4UNPA 2I6FA 1PJQA 2W2OA 1DBIA 2CUNA 4Z4IA 1B1AA 1RJ9B 3WHIA 2ZDGA 1P1IA 1C7ZA 2L82A 1SCJA 2OZLB 4KLRA 3T34A 1XRPA 1Y4SA 3H8JA 4OP3A 4XVUA 4NCHA 1N8SA 5DISB 1JGTA 1P0QA 2VPWA 3E18A 3KSRA 3AJ9A 3LT1A 4LNAA 4V2IA 2EEPA 3JWIA 5AM0A 2VWQA 1YQGA 1FDUA 4OYYA 4OBEA 2R1UA 4EPVA 2G17A 1HPLA 1SZJG 3LX8A 4HQFA 1UP4A 4M8KA 4BMZA 3NUQA 1X7WA 4QU8A 2DMRA 5E8JA 3VSCA 2H0QA 5KWSA 5IT0A 1AUPA 3U56A 3K6JA 4IJ5A 2WG1A 3K4PA 1E99A 5F2EA 1JWAB 2C7VA 5IUJC 2RGUA 3E9YA 3GJ8A 5G53C 5CD9A 3T5AA 4LN1A 2CYAA 1HNZB 2YIDA 2QPOA 3BCHA 2WSYB 5CX1B 3BTVA 1C41A 2UKDA 4G6ZA 4OAPA 4GDFA 1G9TA 4HQNA 4OHRA 2JC3A 1KDPA 2Z2YA 4MRPA 1VKZA 1R6DA 3FJOA 3PWTA 1GTL1 3IDFA 4LG1A 4ENPA 4BCDA 2R6JA 1ATZA 2NTJA 3S4YA 4OU5A 3EGXA 1V4VA 2WF5A 3DJYA 4FSDA 4LVOA 4UATA 3SLKA 4LF9B 5FL3A 5IX8A 4LOJA 3T95A 3IPXA 5KINB 3NUGA 5I3ZA 3U5ZB 4JGIA 5BURA 3G7SA 4YV7A 2ONYA 2AMVA 4OK6A 5JSFA 4OBBA 4EUNA 5BUSA 3DPUA 3X0DA 1FNSA 4IIYA 3I9KA 4KXFB 4XLLA 4YRSA 1XCOA 5J3JA 2Z98A 1M0WA 2D7CA 5ICFA 4ACAA 4H16A 2ZUDA 3SR4A 2HLPA 1KYTA 2C5AA 2ID7A 2QVYX 3B85A 2IBSA 1L1QA 1F06A 1IB0A 3JQ9C 1TIBA 3MPOA 5DGHA 1FQKA 2GZ1A 3PX2A 1V7QA 4M7WA 3QPDA 4JS0A 4E5YA 3DTNA 2JCYA 4MULA 4QUDA 1X7YA 4YCSA 4NXMB 3HCDA 1D2GA 2KPOA 5JJLA 3HJHA 1L4LA 3JYOA 4MQUA 2GRAA 5AVJA 2YR0A 3GFPA 1GTRA 3GX1A 3UQZA 4KV7A 2WF6A 2FX5A 1YQ9A 1RYFA 4B7CA 1JDZA 4D79A 5HIKA 1XU9A 1YHZA 2FMKA 3WQQA 2WJGA 1DKUA 4OJQA 1TYCA 2DPYA 2EJWA 2EATA 1GYRA 1CTQA 4GMDA 4QFBA 4X85A 2AL7A 1MORA 3QHQA 3PJGA 4ZAXA 2E48A 3R3YA 4DQVA 4DF3A 1YI8A 3TB4A 4CLDA 4EUSA 1QGUB 3RRMA 5ES4B 3P2EA 2EJVA 3AFHA 4RTMA 1R12A 1ZNWA 3KQQA 3NHLA 4AKGA 3EWIA 2DTEA 1Y7PA 1IK4A 1LBEA 1BQ3A 3A28A 4JBXA 3UT0A 1I6LA 4BNNA 2AXPA 3AP3A 4DS3A 2A0XA 2W6JA 2FLWA 3W1WA 3JR3A 1A82A 3V8NA 1JI3A 3UO8B 4DT1A 1FLVA 2GQ0A 2AD1A 2PG3A 1MB2A 2GD6A 3UJPA 3M89A 2P5SA 1NBHA 2OMKA 3L1UA 4HUJA 3K9GA 4HDOB 5B7QA 1PQ4A 3IQDB 4FBMA 1Q3TA 3FFBA 1AKTA 2ZRMA 1U90A 1Q21A 2YHIA 3FVQA 4GOND 4RKFA 3B5IA 3ZGYA 1SBQA 1SVOA 1E6WA 5LCXA 4NE9A 4CF5A 3HR4A 4EWLA 3SG0A 3DUFA 4TXLA 1DAEA 2WWIA 3S1AA 2Q4RA 2J9YB 1N2OA 3DKIA 4CF4A 4LOAA 3QTTA 3A6JA 3A7DA 3IODA 1NW7A 1AZSC 1YGPA 3Q0EA 3U31A 4DQ0A 2PNFA 3HA5A 3OQVA 4WFIA 2F1HA 1IN4A 3ROEA 16PKA 4CVNA 4F8EA 1ULBA 5E9AA 4AJPA 4BPRA 4KI7A 1L7OA 1PR1A 4L50A 2FCRA 2IPNA 3HN6A 2PZBA 3PYXA 1D07A 4M98A 2XNDD 3NP7A 3ZDAA 1Q7TA 1UKYA 1B74A 3KBOA 4MW0A 4EARA 2JAPA 1QKKA 2JI9A 2QQ0A 1G20A 2R8PA 3OM0A 1Y3FE 4M86A 4PHFA 3SFZA 1Z0UA 4FZRA 4C7XA 1C30B 4QFMA 2AKYA 4D9IA 1TK3A 1DX9A 1OY1A 5AQEA 4BC1A 1UOOA 1XOIA 1PSZA 3I2HA 4BUJA 1KDZA 5BOSA 5DCYA 3S0JA 4I50B 1ENOA 1QZZA 3DMTC 3KTAB 4FGSA 5A4KA 3CTPA 1Z6PA 2XEXA 4LCJA 1I2MA 1TW2A 5GONA 1SBTA 3OU7A 4Q9JA 1P7CA 5B2EA 2XKBA 1XAIA 4DJAA 4S1TA 4H6WA 3S55A 3WQRA 2JKZA 3OQPA 4IGFA 3W2HA 1THMA 2I3DA 2O7RA 4JSTA 4LAFA 1NV8A 5EYPA 1ACLA 3AEZA 1DZ3A 4RIHA 4RD6A 3A9WA 5JRZA 4MJXA 3TL3A 4HS4A 4RHFA 3N8HA 2XB8A 2F6RA 1V16A 3L5OA 4HK4A 5DBHX 4WTOA 4Z9XA 3LT2A 1TLTA 2P9BA 4XQCA 5EAIA 3ER8A 4CI9A 4EO9A 2JCXA 5D1NA 2ZJ8A 4EITA 1A7JA 3WHLA 1Z12A 2Q1SA 3E9QA 4KNWA 1JIVA 4POAA 4CM3A 3E2IA 2B2XA 3FDZA 2QL7A 3KAPA 1QGED 4N4AA 3W3AA 5M2QA 1KEVA 3E9RA 1K75A 2GK4A 4K9DA 4B82A 1YHNA 3EZ6A 3O3CA 4ZT3A 4IH1A 3GG9A 3B1ZA 4GR4A 2Y92A 1NXPA 1Z13A 4X93A 2QHXA 2CHFA 1GFWA 4WGGA 3WBFA 4LPKA 5KMGA 1FX1A 4Y2QA 3DF7A 3GFOA 1GR0A 4URWR 3RIXA 2QTVB 2YOHA 5DM70 4O2BA 3TSYA 4PGMA 3OZUA 1ND5A 1TQ6A 5KVAA 1HL7A 1M2EA 1W0KD 1Z25A 1AS3A 1ZUHA 2CYBA 3UWDA 4TYWA 4DC9A 2GAFA 5C7YA 1MJ5A 1RXEA 1NIPA 1H9AA 2Z2XA 1WQ3A 3U4AA 1X7ZA 2QRQA 1YVPA 1BQ4A 1MOSA 4S3MA 3P26A 1W9HA 4E4YA 1YE5A 5C5IA 5JYDA 4CGZA 2OWEA 1ISRA 1JHAA 1G38A 1NJGA 2BFFB 2R5FA 4BRWA 3P2JA 3UKJA 1T4MA 5KTRA 3D5EA 1IMOA 2G77B 4MIKA 4K9PA 2OV4A 1P0CA 2O0JA 4BB0A 4D9CA 2HV8A 4P7BA 3H11B 2KS6A 3QX9A 1UBKS 4FFMA 1Y5IA 2W2KA 2VRCD 2ZUWA 1N5KA 4MICA 2NUTA 1F3LA 2ZFUA 1XKTA 1ZJ6A 3BSFA 3H0KA 4KPUB 4EKNB 3WAGA 4J8PA 2R84A 4G1UC 3M5WA 4L6AA 4RFSB 2JLRA 3GJ3A 1AB5A 2H4WA 2RK6A 3GIDA 3H4VA 1OKKA 2REQB 1SC9A 3W9BA 2PYDA 3AUUA 3SKVA 1T0IA 1E2QA 3FR7A 1L4YA 3W4JA 4YQEA 1C1XA 5JWRA 5KTYA 1LI5A 3VA7A 1T0BA 2W42A 1PFQA 4MPJA 4WKOA 1KEEB 3OMWA 3C0KA 4JB8A 2ZBDA 3KVYA 3OIFA 1GV1A 2BEKA 1LVHA 1J20A 4DEYA 4OX9B 2VJLA 3AFOA 4WY5A 5TT0A 1J0AA 2AS0A 2DPGA 3CKMA 2HWYA 4RNDB 4TKLA 1N3YA 2P91A 2DJ5A 1NZJA 4HEHA 1CUDA 1OQAA 3PNKA 4K9OA 5A06A 1PKXA 1DTWA 1YZVA 2MT9A 3KOUA 4LXYA 5LNK1 4NAUA 4D1YA 1VPEA 4DCNA 4L2IB 1H3FA 4XYBA 4KR9A 3CX7A 3U4GA 2JIOA 5LWQA 1E79A 1AURA 2NVWA 3VR4H 4ZEXA 3KAQA 2Z57A 5JDIA 3V80A 3G3EA 2W2NA 4Q1DA 1D09A 1ZDMA 2AOTA 2XB4A 4JB0A 3C8HA 2AK2A 3ZE0B 2ZE8A 3FETA 5K01A 1GFSA 3BT7A 1PGJA 2AN9A 3DKVA 2OBYA 4UEOA 1JEYB 2QTTA 3TIGA 1JEOA 5G1OA 3NYIA 4GO1A 5HGJA 2JEZA 1C50A 4OMFG 3AILA 4V0LA 2IKSA 3WGJA 1XB2A 2JGFA 4GR9A 4K9SA 2IDMA 1EAMA 2KQUA 2D5CA 3PQ6A 3RK0A 3WL4A 4MQEA 4L6IA 1MX9A 1MDFA 5BSRA 2FMFA 5IDWA 2C95A 3QX8A 1KMHB 3G8YA 1NI5A 5DKFA 1DC6A 3ZE6A 2C7PA 3GLVA 4XWOA 3I8XA 3GB9A 4XW2A 2G88A 3NM5A 4JT2A 1RWXA 3IMCA 1J1IA 2LDBA 1NLFA 4AAYA 1G55A 1XC7A 4L8YA 3RH0A 2RAVA 1FSFA 1FNCA 1QKJA 1VG9B 1I5RA 3QKSA 4ZODA 3O1IC 1ZOOA 2P79A 3EZ7A 1S7CA 3MJRA 1TVEA 2Z3WA 3NWPA 4HD8A 2FX2A 4IWXA 4RA6B 4UXIA 4UDXX 1PFUA 1IHUA 2BC9A 3PFGA 4J0GA 5A9SA 1R5JA 1VSTA 3QXJA 1CR2A 4C08A 3FZGA 1YR6A 3DGFC 4GMKA 4E51A 3UG7A 1QO9A 3EVGA 1KK3A 3F46A 4B79A 2VP3A 4EFKA 2HIAA 1I0ZA 3FFTA 3LOUA 3X1YA 4BJ3A 1XTQA 5A3QA 4EQ6A 4E03A 4EYQA 1D7OA 4UASA 4LY0A 3PKZA 2O8EA 1NVVR 1XK7A 4QJBA 1EEHA 3V2IA 2A0UA 1TK9A 1NI4B 4GX0A 2QN7A 4FS8A 4U3JA 3TVTA 2GDZA 1KEZA 1OH5A 4RCVA 1T8SA 2OXRA 1MRZA 4KACA 5JC1A 5KSYA 3EXIA 1NX6A 1KVUA 2VSNA 4P0QB 2GCOB 4AMZA 3K70D 3I76A 1CY4A 1ZUNB 2O2YA 2CLKB 1DKRA 3PQ4A 3M4YA 2JHGA 1YR7A 3VJRA 1XMIA 4IIUA 4GU5A 2C3YA 3PXAA 4RA9A 2VUIB 5A5EA 1UZLA 2V6IA 3OE7D 4HLNA 2X1HA 5DN6A 4O4HF 2A7XA 3SYNA 2HMAA 2I1VB 1DBSA 3OUUA 2PWPA 3H3JA 3I2IA 4TTIA 3ECAA 4D3FA 2ZWPA 3NWJA 3F4LA 1KYQA 1Q0HA 3K0AB 2M2IA 2P2LA 1PJTA 4HMQA 1XCPA 2X86A 1Z4IA 4UEKA 2NO7A 1EFHA 2I33A 4N0DA 1UC9A 4GOOD 1KZ9A 2PLRA 2V1XA 3E9MA 4RLHA 4D4KA 3O8CA 4BEBA 3HKCA 4YT5A 3U44A 4GZ5A 3JQAD 4YV0A 1K89A 4QQ8A 4CL8A 4JR0A 2HRQA 2QTLA 3PWSA 2WNIA 3H2ZA 1RI4A 2ECOA 2PZAA 5DNEA 1N1EA 2IHYA 3LT4A 1V3UA 2YZNA 3WDMA 2XOKA 2H31A 5EMHA 4RH3A 4LJ9A 5BSVA 5JQWA 1ZP6A 2R0QC 5HIAA 4MHSA 3ND6A 4FXOA 1WB9A 2DQ4A 1QO7A 3VR1A 3G49A 2I6GA 4JT9A 5COAA 5LMZA 3C3EA 1GUZA 2J9FB 3D8BA 4X8LA 1GA6A 4L07A 1DQRA 4X20B 4X45A 4MEJA 4YI5A 5DCWA 1MXHA 2GF2A 3DAPA 3JW8A 4OKIA 5BQOA 3R6GA 4IH4A 1GQOA 2I6TA 4YJ2B 3M2TA 3ESXA 3NKFA 3GLIE 1K27A 1GQQA 1Z4MA 4CCSA 4Q4AA 1Y1SA 3KKPA 4YUYA 3RAJA 5EJ8A 1N0WA 1R7RA 3A2KA 3STUA 3NDBB 3KO8A 5CCXA 3EEFA 4M36A 1KSGA 1ZIDA 4WA8A 1RU3A 5ALOA 5C34B 1XVLA 2O6HA 4NFSA 1KJNA 2LV8A 5KJEA 1Q7CA 3L6CA 4YRBA 5CCBA 4W5TA 3HB9A 4Z4CA 3ZLJA 2J3QA 2CE2X 5K4AA 4BVFA 3RJMA 4DPMA 3UPDA 1XZLA 2GMWA 3TLXA 1P6UA 3X1ZA 5K3SA 5M34A 2YJ4A 2J3JA 2YJZA 4KQFA 1JHUA 4DBLC 3ZVMA 2CFOA 3K8YA 3G2PA 4BPBA 3DDHA 3KTDA 2RGRA 1R0SA 1V4NA 3NKLA 3IQIX 3O4JA 4S35A 3TNDA 2XDQB 3X3HA 5DHTA 1Z0SA 2BHRA 3WWEA 1V6SA 3WBKA 1FEZA 3B1VA 3DNPA 5G3ZA 3TXXA 1XNQB 3UJ8A 2BF4A 1O8BA 2FFHA 2AUTA 4GSLA 4I9NA 1I4EB 5BV8A 3DBHB 1DBWA 3OIVA 2QORA 2XCUA 4KDRA 4YP7A 4Q9AA 3ZWKA 1ZM7A 4D81A 5AW2A 1EUDB 3F5DA 2WT8A 3G2QA 3FCOA 4DM7A 3K70B 2QLJA 4MS4B 3LIPA 1ZWKA 5DIZA 2IY8A 3ZHYA 4PR3A 4C5CA 5EZ6B 4M0KA 2JIDA 1SVSA 2ZR9A 3GT0A 2ONZA 3AFNA 2FSGA 3VPCA 3DDCA 4Y2GA 2X6QA 4F4IA 4LI0A 4C7OA 3VAYA 4J6EA 3A1TA 3P4UA 2JLUA 2ZXFA 4KEAA 5D86A 4DA4A 3U7FB 4ZV9A 3FNRA 4D4JA 4IEFB 2PGJA 4S24A 1J8VA 2WKQA 1PJCA 2EZTA 2CMDA 4JDPA 4MKIA 3UTDA 3B1KA 2DKNA 1R88A 3O3MB 3B51X 4Q4JB 1SPXA 4NMLA 1MV8A 1TJ4A 4A6PA 5FH9A 3LBYA 3HUTA 3MQFA 1RC8A 4DIKA 1DUSA 2I7VA 4DB2A 4BO8A 3NT5A 4HDAA 1G0OA 4YHBA 5KTKA 3UH1A 4RKRA 2PGNA 3KL2A 3CUEF 2EIHA 5F5NA 4GSYA 3JQAB 3AEQB 1FDSA 1YDGA 3D0KA 4XFDA 4EPYA 4ZHQB 4WESB 1Z75A 3ORHA 3F98A 4KN9S 5BYBA 3VI3B 4HV4A 1LTHR 5A7FA 4V1CB 1CQZA 1FTWA 5DTMA 3WWPA 4YAFA 2WTXA 1OFHA 2VUUA 1GAWA 2VH1A 3BWBA 2OCPA 4WXRA 2AYZA 4RHUA 5HKOA 2EWWA 1FOEB 4KN6A 3AL3A 4JUAA 4YR9A 2D1YA 4I1IA 4FU0A 3Q3EA 2LKCA 2ORIA 2WMNB 1V9LA 3EFBA 2XUJA 3ESYA 3UQYS 3OLQA 5IYZA 5JHHB 2B35A 4KH1A 4UOEA 4YQFA 1B6RA 3QNUA 1CFJA 2YIJA 1GTVA 3GMDA 3AR7A 4PC7A 2QX6A 4HR7A 1SBIA 4R7GA 5ECWA 3OJCA 4GNRA 4DLZA 1BXRB 4II2A 2Y1OA 5E95A 1FVHA 1MEOA 4B47A 1DAFA 1IBKB 1AXEA 2VPYA 1F2VA 1X6VA 3H5RA 4ITRC 4WZAA 4WN9B 3P0EA 4WQMA 4Q0MA 4N3AA 5IJ0A 5H81A 2PHZA 4OQNA 1XA4A 3QI2A 2BRUA 2GXAA 4GKJB 4TUYF 5IVDA 2O2SA 4HADA 5AOVA 2RSLA 4ZYLA 3AI7A 5DSZA 1BCRB 4XQ0A 2VPIA 1E3QA 4RGVA 5DHAA 1G6OA 2HQSA 3FGZA 3WKEA 5AVYA 4JXZA 1ULSA 1VI2A 2ZANA 4KK4A 5KVVA 3C3JA 2JFYA 2XTAA 2I1QA 5JZVA 2FSVA 5LWHA 3C5CA 3DV0A 2ZROA 2IPAB 4R3NA 2C7OA 3QQ5A 5AOCA 1JAHA 2I67A 3AI3A 3FOBA 1NJ5A 4C4TA 2C2WA 3CW9A 4DG5A 4L72A 3LFTA 4C0AC 1W2GA 5AKKA 3UCXA 4OLBA 1IG0A 3B7PA 3DWFA 4OQYA 4RY9A 5AHWA 4BLUA 2Q5CA 1IXZA 1KDYA 4BKPA 4FB5A 1GHTA 4N03A 2B3DA 3QSGA 3OJ0A 4QDXA 4J03A 3TJRA 4LYYA 3ASYA 4PEVA 4FBGA 2V65A 4RCZA 2NQ2C 4GX1A 2XQGA 2G6BA 2O07A 1RW4A 1XRNA 5M7EA 4L4RA 2OHGA 1KDVA 2H8GA 4HDMA 1C9KA 1DEOA 4LRXA 4CKBA 3JY6A 3SX2A 4DNOA 1JVBA 5HTOA 1DEHA 2ZBGA 4UE3S 1SN7A 1OJLA 2C2YA 3IP8A 2AH5A 1LC3A 4AQDA 2YMMA