1TA4A

Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound arsenate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
371
structure length
357
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Structural basis for discrimination between oxyanion substrates or inhibitors in aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 113
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ta4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ta4A01
4HX5A 1FMCA 4WLFA 4BNHA 1EVZA 4AJOA 4Q3BA 3WJAA 3BAZA 5BNFA 5HRUA 2O23A 4NMHA 2D1YA 4NJMB 3KOUA 4D0RA 2WM3A 5BSFA 1UZNA 1ZJZA 4RGBA 4TRJA 4HNHA 5AYVA 1PJ3A 4FIZA 3SJUA 2PA3A 1JAXA 2YV1A 3PIIA 5KIAA 3W6ZA 5AXBA 4HXYA 5I8WA 2B36A 4RVUA 2FPGA 1KOLA 5IF3A 2D4AA 2DUWA 2J3KA 1KEUA 3JSAA 3I6IA 5ICSA 2GYYA 2XF8A 4GH5A 4OQZA 2QG4A 3Q0EA 3IP3A 3DHYA 1BVUA 3LQFA 3PDUA 3TPCA 4PZDA 1R0LA 1U5AA 3ANMA 4ZQGA 4XQ9A 4M55A 4YR9A 2OUIA 4HP8A 1WAMA 1YB5A 2YZ7A 5DOZA 1E7QA 3FR7A 4LVCA 4JJFA 1HTBA 5JBIA 1YBMA 3JQAB 3QWIA 4QO7A 4B8ZA 5A4DA 1HE5A 2UUPA 3DOOA 1A5ZA 4GBJA 3PHIA 2C2YA 5KNLA 3NJ4A 3OJFA 3OICA 1FF9A 2D2IA 1DB3A 4I5GA 3QWFA 4R1UA 3VTFA 4IDGA 2BMAA 3ON5A 1E1LA 2WE8A 1V35A 5DP2A 3I83A 1VSVA 1LDEA 4L76A 1ZK1A 3WMWA 2NM0A 3SLGA 1U7TA 2Z5LA 4WGGA 2CD9A 5L45A 2C20A 2O3QA 5L4SA 3T7EA 5TX7A 2PKQP 5MDHA 2EW8A 2PGDA 3NDJA 3KO8A 3T7CA 4NK4A 3ENNA 3H9GA 3NDRA 1P33A 4LVUA 3VPHA 4O59O 3DBLB 4GSLA 5U4QA 4WOJA 3B1KA 2JCXA 2IZZA 4IQ8A 1CQIA 4W6ZA 4XEHA 1BDBA 2O7QA 1WMAA 2VTDA 4XJSA 4NJMA 3U4CA 3M6IA 3VC7A 5AXDA 1B3BA 2D0IA 1MG5A 3QVTA 4IDCA 4QUKA 2GERA 2P9EA 1T2EA 2B0JA 3GZNA 4YB8A 1H6AA 5DOVA 1Q2XA 4OKNA 1M6HA 2YYYA 4XQGA 2OFPA 3OJ0A 4O63O 1NHWA 3SEFA 3EK2A 3ASUA 1E6UA 3D64A 2J5RA 3PYXA 1HYEA 2ZTUA 4M49A 1R6DA 4JGBA 4YRDA 1ENPA 1Q1NA 2OBYA 5C7OO 4HV4A 5DBIA 2CFCA 1SEVA 1ZVMA 2FP4A 5CDGA 1GR0A 2NVUB 3WFIA 3LF1A 4RQTA 2WWRA 1V3UA 4L74A 3JQAA 1GTMA 1V3VA 2P68A 3HG7A 4RDHA 4IS3A 2C7GA 2QZZA 5T6BA 5LCXA 3LF2A 1EE2A 1PJ4A 3QVSA 4M1QA 3O38A 5GZ1A 2GN8A 3QWHA 1T1SA 2DTDA 3F46A 3FRJA 3RUAA 2WMDA 3FNGA 1PQWA 1BGVA 4PLTA 2AQKA 5COQA 4II2A 1P1IA 5I9NA 4JN6B 3GGOA 4RLHA 5ICMA 3GNTA 3K2BA 3WIEA 3JD4A 4AJJA 4MP8A 4GX5A 4XYMA 5C37A 3GEGA 4JP3A 1HSOA 5L51A 5DZSA 4LSWA 1W73A 4J6FA 1DJQA 3RASA 1E3LA 1P44A 2JCVA 3DBLA 3U3XA 3PRJA 2A9FA 4AJPA 2DTXA 1UAYA 5EERA 3WS7A 3OBBA 4N18A 3PEFA 4MINA 4MIOA 5A9SB 1TT7A 1OC4A 2C7VA 1JTVA 3INTA 3FHLA 3HSKA 2P4QA 4PZCA 3AOGA 3IAHA 1ZXLA 4H15A 1PL8A 3ZU3A 3VPXA 1DFGA 5H83A 2R2GA 2P4HX 2BI7A 2E49A 1E1MA 4GLOA 3P2YA 5KJCA 3GR6A 4MVJM 3OEYA 4YBZA 4H7PA 2X7HA 1ZNQO 5TGDA 2GCGA 4KWIA 3UGKA 5LDHA 1Z73A 3JQ7B 4PVDA 4YA6A 4NBVA 2NVUA 4AFNA 2HRZA 1P0CA 4OHUA 4YT4A 2O4CA 1VL0A 3MJ4A 3VKUA 2I5PO 3C1OA 2CDCA 5JDIA 3PQFA 1YDEA 2I67A 2D8AA 5JE8A 1K5HA 1ZFNA 5KWEA 1P74A 5JDCA 3KYBA 3H2SA 5B1YA 5F3RA 3WSWA 1XLTA 2XXJA 4XYEA 4ND1A 2G82A 2C2XA 1NAHA 2LDBA 4BB5A 2DLDA 2GF2A 3FWZA 2HSDA 4R1SA 1RYDA 3E18A 5JPIA 4YAEA 4A73A 4R1TA 4N5LA 3L9XA 4J1NA 1GU7A 1F0YA 5DBGA 4ZICA 4D0SA 3PJDA 4PG5A 3HJAA 2O2YA 1YB1A 3VPGA 3ZHBA 1H94A 1OFGA 1ZBQA 4PLVA 2D5CA 3C3XA 5A9SA 4FBGA 1C0PA 2EGHA 3I1JA 2ZB8A 1VJTA 2VHWA 4XGNA 2HJSA 2AXQA 1WZIA 5U1PA 4TZKA 4MOWA 2OL4A 4KP7A 9LDTA 2PGJA 1NP3A 3S2FA 1PJQA 4AICA 4OJNA 4BS9A 3WIDA 4Z0PA 3ZWVA 1E3EA 2R00C 1HDZA 4FGSA 5KJ1A 4MO2A 2VYVD 1KETA 3JQ7A 3ZWOA 1ADBA 1EUDA 2OP1A 5JS6A 4BMSA 4WUVA 1ZZEA 3GFBA 4HFRA 4YRAA 3D3WB 3MTGA 2VNSA 1YBAA 4CM3A 4BNMA 4Q3CA 4O5OA 3HUDA 3MTJA 1FDUA 1PS8A 5F5LA 3D4OA 4L9RA 4CQMB 1PEDA 4YVFA 3NT5A 1I3LA 3F5QA 4HUJA 1HSZA 4PVCA 1H5QA 4RPHA 4S3MA 2FOIA 1M67A 4L4XA 5ILGA 2DKNA 3CH6A 6LDHA 3E1KA 4FOOA 1SOWA 2GSDA 5JCJA 1MB4A 4R1NA 4CM9D 4UEKA 4NH4A 3PJGA 4XR9A 1WPQA 5CHEA 3FNFA 3PK0A 4BNTA 2JL1A 2G0TA 4BKPA 3OQ1A 4DLBA 4E5YA 3JQ6A 3DAFA 1B0AA 5G2OA 4CMEA 1LU9A 2X9GA 3FR8A 4EJMA 5K6AA 3CUKA 4DWVA 1PSDA 5CP8A 1EQ2A 1S7CA 2V6MA 4XRGA 4I5FA 1DRUA 1NNUA 2W2KB 2VHXA 3NRCA 1CF2O 3CZRA 4EYEA 1O95A 2J8ZA 3GHYA 2Y05A 4FOSA 2XPCA 5IXSA 1LQUA 1B8UA 3SBOA 1ENZA 3PFFA 4PIVA 1Y5RA 4CMKA 3OFSA 2AE2A 2J3IA 1JVSA 2E4AA 1UJMA 1KVSA 4GLLA 1B14A 2OZPA 4CODB 1NHGA 1R0KA 4Q3NA 3WXBA 4DQXA 1GADO 1OZAA 4PLZA 5KVQA 4ALJA 1E7SA 4ITUA 5ES3A 1JWAB 3W4JA 3CEAA 4DQVA 4CPDA 2O3SA 3H9JA 1G0OA 3F1LA 1ISIA 3STHA 4LCEA 1DC6A 1ML3A 3G3EA 4AVYA 3AOEA 4CQMA 5L53A 2DM6A 2V6BA 4ZJUA 1SPXA 1M2WA 3KRTA 4JNKA 3TL3A 4DA9A 3HZZA 1YJQA 3S2IA 4DC1A 4J4TA 2E37A 5L4NA 3V8BA 1SEPA 5CDUA 3E8XA 4JJIA 2J3HA 3JQGB 4EI2A 4H3VA 2PV7A 2VQ3A 4LK3A 4A0SA 1KEPA 4JXKA 1Z45A 2VHVA 4MVJE 9LDBA 3DMYA 3G49A 1GFSA 1NWHA 3PDJA 4AG3A 3B1FA 5A04A 2RBEA 4B7CA 3ZHZA 1DBVO 1A7KA 3ZWPA 4HWKA 2HU2A 3O03A 1DC3A 4U6QA 5G0VA 4YYZA 4MJLA 1NQ5A 2AQIA 2X1HA 2QX7A 2W2KA 3ROPA 3CSDA 1EK5A 4AJNA 4IINA 1PGOA 1XDWA 3KXDA 4FFLA 4U8GA 4D44A 2ZCUA 2HDHA 4Y8VA 2EEZA 3VVCA 2EKLA 2OP0A 3H7AA 1N8KA 1ISMA 4GGOA 4CM1A 1LSJA 3AFNA 5JFOA 3B70A 1DRVA 2GNAA 1ADFA 2YDYA 4CM5A 3JQCA 4DBVO 4OIMA 1UDAA 4E4YA 1EZ4A 3AU9A 4BNZA 3D5QA 3FPLA 3A28A 2GD1O 1DIBA 1H93A 4IQGA 3I9KA 4Q39A 3SC4A 2X0NA 3VZSA 3BZUA 4P4NA 3INGA 5ILOA 1VSUA 1NVGA 1LRLA 2H1SA 5T64A 4GAEA 4B79A 4CLEA 2O7SA 4R3WA 4WK6A 1GUFA 4K9DA 3WYCA 3NAQA 1YL7A 5KJ6A 2IZ0A 4BB6A 1RKXA 3VZQA 1MXHA 2B35A 4RPJA 1A27A 3L4SO 4EEZA 1U3TA 4ZRMA 2FWMX 5JYAA 1D8AA 1NFFA 1O5IA 3GA0A 1I33A 2X6TA 1N7GA 1MC5A 5L9AA 2G17A 2VZ0A 2DFVA 3ZDFA 3JQGA 2G76A 1VC2A 4CLHA 1HWYA 1HLPA 3A14A 4LSMA 4K6CA 3DONA 4LN1A 5F1OA 2QZ9A 2QW8A 3WNVA 1U28A 4CV1A 3PFWO 4UREA 1E7YA 5TQVA 3DXFA 3GRKA 5L4LA 5B4VA 3I9JA 4BKRA 2Y1GA 2NU8A 4EUEA 3KM0A 2CNBA 2Q3EA 4JX8A 1DHRA 3TWOA 4YQYA 4WLVA 3C8MA 1H9AA 1AE1A 3CE6A 1EVYA 3BHJA 3D5TA 5KKCA 4AJHA 2Q45A 4XYBA 4YT2A 1O94A 1PGJA 3FCOA 3AUSA 1T24A 2VN8A 2X0JA 1ZH8A 3E03A 5IDQA 2Y0EA 5TS3A 4UUPA 5FFFA 3SX2A 1YVEI 3GRPA 1I5RA 5HWSA 1WNTA 1X7HA 1GAEO 3DZHA 1TI7A 4BNFA 2P9GA 4B8WA 2YY7A 4BNWA 4DMMA 3E5RA 3SJ7A 4WCFC 2JHGA 2OO5A 2EIHA 1UDCA 3QLJA 2B5VA 3K2EA 4HFMA 3BTVA 2HO5A 3KEOA 2VOJA 1NYTA 3HDYA 1K6IA 4FR5A 4C7JA 4F45A 3CMCO 5GMOA 2HUNA 4F3YA 3DL2A 3BHMA 5IDWA 1HYHA 1WDKA 3ZV5A 5ITWA 3DZGA 4U6SA 4Z9FA 4WOKA 3GHHA 1PTJA 1RM4A 3ZU5A 2AHRA 3RC1A 1A4UA 4PGFA 4AJ1A 2VYND 1Q0HA 2I65A 3EY4A 4UUOA 4IZHA 1I0ZA 4MVJF 1HDCA 3NT4A 3AK4A 2FSVA 4LGVA 3K8ZA 3SLKA 4G2NA 2Y1FA 4ZA2A 1PQPA 1NX6A 4YAJA 4I1IA 3GF4A 4WNCA 4BNXA 3TDKA 3LU1A 1HRDA 1DPGA 4J9UE 5G4LA 1Y8QB 3UW3A 5FF9A 4KMSA 4MP3A 3ZNNA 4R3NA 3PLRA 4WKGA 4NFSA 2Q49A 1KYQA 2Q2QA 4XZ3A 4BIIA 4Y6PA 3DMTC 2WE7A 1N7HA 4BGIA 4I9HA 1B3RA 2P5UA 4NI5A 8ADHA 1DXYA 3T4XA 3VVBA 1C1DB 4J43A 3U4HA 3CZMA 4EUHA 2W2LD 1LDBA 3EZYA 2NTNA 1EFKA 4E32A 1U3WA 3C7DB 2AA3A 2HKIA 3ETEA 3E5MA 1YRLA 3BTUA 3IKTA 2V7PA 4Z6KA 2B4TO 1V0JA 3W8FA 3P5SA 3ZWAA 3JQ8B 4BMNA 3F3SA 3OQBA 1XR3A 3NGXA 4K26A 2P5YA 1YBVA 4OXNA 4HFNA 1JKIA 2D3TA 1HE2A 4YT5A 3EAGA 3WG9A 3FBTA 4IIVA 4Z9YA 4JP2A 5U9CA 3E48A 3RUIA 4JIGA 3ZWBA 4XGIA 4QFDA 1PJ2A 1ISJA 1C0LA 4RLSA 1EBUA 1U8XX 2AEMA 5JC1A 3E9QA 3GDFA 1O0SA 3WTCA 1ZO8A 3ZHXA 3S8MA 4IDDA 4N7RA 4RVFA 3JQFC 3BHIA 5IZ4A 1HDOA 2PH5A 5CEEA 2Y66A 3WBBA 2TMGA 2X8LA 3GNQA 4FSHA 5TIIA 2HQ1A 1FDVA 1HDXA 3GAFA 2I3GA 3I3OA 3PWKA 3RJ5A 3D3EA 4BV9A 3H4VA 4UVEA 4ALNA 1DO8A 2XOXA 1Y8QA 3GEDA 1JW9B 3LK7A 4FC6A 2X9NA 3HDJA 1GEGA 3ROKA 3WGOA 3NTQA 3L77A 1P1HA 5BR7A 1YXMA 1BMDA 1I2ZA 2DU8A 3K73O 2VWGA 1YE3A 2FR0A 3LYLA 4CQLB 1PZHA 2RHRA 4CJXA 1EEHA 5EIOA 5I7VA 2J6IA 1Z75A 3NDIA 5EQDA 1ONNA 1LXCA 4YJHB 5JW6A 3WB9A 1C1DA 4TVOA 5M6DA 4E2XA 5IDYA 3GMDA 3U4IA 4ONEA 2PH3A 3UAGA 4XQEA 4CV0A 5T8KA 3JD1A 3AY6A 3H8VA 5EINA 2C5EA 1UR5A 3GGPA 4NJOA 3VPSA 1N1GA 1P31A 3MJTA 2Y1CA 3GLQA 1DSSG 4DPKA 1PJSA 1PS0A 1YQGA 3CINA 2Y68A 3I6QA 3WLEA 3ZV6A 4P4LA 3UOGA 3LLVA 2Z1MA 5G0UA 1BVRA 3PLNA 1KIFA 3B20A 4YJDA 5JSFA 3K30A 3WGIA 1PJTA 3IP1A 2VOEA 3OSUA 4XRRA 4GX2A 3HQ4O 1R4MB 3ZN2A 5CDSA 4D7AA 4BVAA 2AG5A 1H0KA 2O3UA 2OORA 4KTVE 2DBRA 3ZV3A 1LDGA 1A4IA 1R12A 3D7LA 2JFHA 3C24A 3VTZA 4I5EA 2GLXA 3DDNA 2UUOA 5A9RA 1D3AA 3VAZA 3FD8A 2I76A 1H6DA 3WQRA 3HADA 4GSKA 1ULUA 3AI3A 4GI2A 5F5NA 2NLOA 1K3TA 1PX0A 5H81A 4NBRA 2VCYA 1PL7A 1VL8A 3K5PA 3PHLA 1XSEA 4M89A 5BNTA 2O2SA 4BHTA 2J5KA 4L8VA 4YJFB 1ZK4A 3V1YA 1SCUA 2C54A 1PGNA 2VHZA 2X23A 4CQLA 4KUHA 3JQBC 2LDXA 3ZWNA 4DYVA 3F4LA 4E30A 3MOGA 3GFGA 1XQ1A 2OMEA 4YJHA 4AJKA 4B4UA 3JD0A 4L73A 1VKNA 4R54A 1JWBB 3CTMA 1XIVA 3ROMA 6ADHA 1P1KA 5KJFA 4R4JA 5TRTA 3E9NA 1ZIDA 2IYPA 3ITKA 5DCYA 3PPIA 3PWSA 4YCAA 5CEJA 3G1TA 1M6WA 1JKJA 1BXZA 1GD1O 2VUUA 2Q1TA 1B8PA 1GQQA 5A5EA 1ZSYA 3ZI0A 3GH3A 4L75A 1C3VA 2EERA 3OECA 4UEJA 3BMNB 1VM6A 1AXGA 4UVDA 5F1PA 3BA1A 1CIVA 3RBVA 1E6WA 1M76A 1WW8A 1R4MA 4UEOA 1MUUA 1KBZA 4E5NA 1VLLA 1Z82A 3BMQB 5IN4A 3W4IA 3LVFO 3QY9A 2I9PA 1YWGO 3I23A 4OSPA 3WWZA 2ZB3A 4TZTA 2NADA 4J1TA 3T4EA 2WJPA 2POQX 4GX1A 2PWZA 4J7CA 4W9NC 4DYDA 4HKTA 2EP5A 4A7PA 4ND3A 1ISGA 3BMOB 4KOAA 2Z95A 5L3ZA 1WLYA 2B83A 1UXHA 1F8GA 4UUMA 3WGYA 5TLSA 3IJRA 4RV9A 4Y98A 4DUPA 3OHSX 3EVTA 1DLJA 3I9MA 3NYWA 4NK5A 1U4SA 2H5LA 4YJFA 3D0OA 1IHXA 4BO8A 5C7LO 4BNVA 4RF5A 5B4TA 5G0SA 2BHLA 2QRLA 1Y9EA 5CPBA 1EQUA 3OJEA 1QKIA 4BKQA 5IJZA 4ZN6A 1LSUA 3EVNA 1ADGA 3AI1A 3DBHB 1E5QA 3BXXA 4BGEA 4M87A 4JK3A 4BUCA 2VRCD 5EN4A 3OP4A 4MDHA 5IZCC 2QYTA 3H3JA 1IL0A 4KUGA 4NQZA 1M66A 2F00A 1LNQA 1ZSNA 2EHDA 1P1FA 3I4FA 3EUWA 1ZMOA 2W8ZA 4DXHA 1GL3A 3TN7A 2VHYA 2GASA 2YW9A 3H65A 3Q6IA 3DZFA 3BMNA 3GPIA 1P0FA 3GC6A 1O8CA 3HNPA 1HE3A 1JQBA 4YAKA 1O6ZA 3LC7O 3BMQA 1GYRA 1PU2A 1N2SA 1E7MA 2IEBA 1IHYA 4ESOA 1PL6A 4P38A 1F06A 5TNXA 3JYLA 4RPLA 3U5TA 4IDFA 3TQHA 2SCUA 1PWZA 3BMOA 2CVZA 1LBEA 2AE1A 2DC1A 1NTOA 2F1KA 4J1QA 2E6UX 4EJ6A 4L0QA 3E6AA 1ENOA 4GWKA 1HZJA 1F12A 2CDBA 4U0JA 2QQ5A 1X14A 4TQGA 3I9LA 4NR0A 2YV3A 2UDPA 3WQQA 4PRLA 1X7DA 1QORA 2FRDA 4OL9A 4XD2A 2JAHA 3MWDB 3X2EA 3LT4A 1UXJA 1E3SA 3DZKA 4BO6A 2YUTA 2HCTA 1MP0A 3IMFA 4MVJG 3ICCA 3U9LA 4OKIA 4BOYA 3OIGA 4CMAA 3DBHA 4GPD1 3IUPA 3C1AA 3WYBA 1IULA 5FYDA 2HLPA 4BNKA 2CSUA 3GDOA 4AJ4A 3MJEA 3PJEA 3ULKA 4E31A 1CEQA 1BXKA 4IY1A 2YQ4A 4D43A 3RC9A 3UF0A 3BMCB 3IIEA 4RF4A 4FB5A 3IL2A 4Y9DA 1ZW1A 1P1RA 3R3JA 1NPTO 4OM8A 1MFZA 4IMPA 3RUFA 4CM4B 4EUFA 1U3UA 3WGGA 1NXQA 3IQDB 4RORA 4DTIA 2NU7A 5G4KB 1JDJA 2Q1WA 1NM5A 1U2GA 3KB6A 2JJYA 1E3WB 2CDAA 4GWGA 4NFHA 1HDGO 2B37A 1O9BA 1VJ1A 5KTKA 4A03A 1XWFA 2PK3A 1Q7BA 4AL4A 4W7IA 4CMCA 1RM3A 3V5NA 2PD4A 4L4RA 3UH1A 2AQHA 3H9EO 4R51A 2FR8A 1G6KA 2XAAA 1WDMA 4J9VA 3AW9A 4WEOA 1E3IA 1Q7CA 3L6DA 5A03A 3HB4X 5DCWA 5DULA 4O0LA 5C5IA 3GY0A 2PKQO 2BFMA 2NUAA 4XIYA 4FCCA 4J49A 1QYDA 4RPGA 5I8ZA 4U5QA 1N92A 4NNJA 3PXXA 4O1MA 1I01A 3AUAA 4Z9XA 4G81A 1HT0A 3JV7A 4CMBA 2R00A 2Y67A 3L9WA 4CL8A 4OOFA 4XYGA 4A10A 3UUWA 1KC1A 2WD8A 1A71A 2I3AA 2YHUA 4XB1A 2WTBA 1A72A 5COBA 2EG9A 2A35A 2BFPA 3DOJA 3B1JA 2UVDA 4E12A 1R0SA 3PJFA 1KVUA 3KLMX 3K6JA 1NFRA 3RAJA 1ZEJA 1H9BA 4D45A 2BGLA 5I7SA 3BMCA 3D4NA 3ONFA 3L6OO 2PNFA 2C59A 3HFGA 2PR2A 2EJVA 1ONPA 3EYWA 5A3VA 3G17A 2IYOA 3CMMA 3W8EA 4CM4A 4TWRA 2HMSA 1DC5A 1BXGB 1FDSA 5G4KA 3FTNA 1ONOA 4HY3A 3ZWWA 1E3WA 3OETA 2ILTA 4GMGA 1JA9A 3I4CA 3UCEA 3NT2A 3MOIA 5IFLA 4QEDA 1AN9A 1IZ0A 1RM0A 3FNEA 3UCXA 1CDOA 2HK8A 2PZJA 3D3WA 1I30A 1QP8A 3LDHA 2HMVA 1U9JA 3INRA 4F6LA 4XX0A 3TFOA 2P91A 1E1NA 2GZ1A 2WSBA 5EMHA 1DRWA 1EVIA 1VRWA 4UVGA 1E6EA 3PZBA 4E5PA 1B8VA 1LDNA 3ROQA 5BSHA 1I3KA 4A5OA 4J7XA 4K6FA 5KOIA 1A9YA 4JLWA 5FEUA 3ZU2A 3LC1O 3VOSA 2YJZA 3HN7A 3DZJA 3KEQA 1JKFA 3R0IA 1GY8A 2WEKA 4CR7A 4M54A 3P19A 4BO3A 4XA8A 4FPXA 3UVEA 4NDNE 4IDAA 4BNJA 2EJWA 3DAPA 3ASVA 3ENKA 4IMRA 5IAAA 4ILKA 4EZBA 3WBFA 4Y6RA 2GRAA 1XYGA 1DAPA 3RUHA 4IJVA 3RWBA 1LLDA 2EF1A 3ZH2A 4TRRA 1J4AA 5TSDA 3RIHA 3TZHA 2DBQA 3BTOA 4J16A 2JD2A 2ZATA 3MCVA 3WX0A 2FN7A 2HK9A 4NBTA 5JY1A 3PYLA 4XCVA 4DBZA 5HBRA 4E13A 1QR6A 4OSOA 3GQVA 1P77A 1I2BA 1BXGA 4E21A 1YJ8A 4FN4A 1IPFA 4EJ0A 4DL9A 3WOHA 1E5LA 4RVSA 3DR3A 4M86A 4CLXA 1IY8A 4L4SA 3K92A 1NWCA 1ENYA 2W90A 1G1AA 1C14A 4RVDA 3RI3A 3W8DA 1YB4A 2VT3A 4Q9NA 4U0KA 2DBZA 3L4BC 4GKBA 4R69A 1SAYA 4I08A 3PHJA 4LCJA 4R68A 2ZTMA 3QIVA 4R01A 3NX4A 5JCXA 2JD0A 1J6UA 1BWSA 2VYVA 1UP6A 2WD7B 3WMXA 2B69A 4RL6A 4B3HA 3RC7A 4TRMA 3JQ9C 4A2CA 5B12A 4RJTA 3NTRA 1GZ3A 2O4UX 5C3MA 4PZEA 4FFPA 3N7UA 4XR4A 4ZQFA 1OI7A 5T73A 1BTOA 1LSSA 4QQRA 4TSKA 4U7WA 4FFNA 3DC2A 3PP8A 4GMFA 1ISHA 3BYZA 1LRKA 3ZW8A 1K2WA 1IOLA 4E33A 3KYDB 1XG5A 4DREA 2O3TA 1KVRA 1R4NB 2IE0A 1UUFA 2WYVA 1XELA 3VDQA 2V6FA 2W98A 2XXBA 3DBRB 2TMDA 4IBOA 3TZKA 4DQUA 1PZEA 2Y99A 1NFQA 1VPDA 4CM9A 1O89A 2IODA 1A7AA 3EC7A 1XHLA 4WCFB 1F8FA 4IQ0A 5HS6A 3X2FA 5JNLA 4DIFA 3TSCA 5JLAA 4GKVA 3RROA 3H9UA 5COAA 1CJCA 3V2UA 1CQJA 4R5MA 1E1KA 1NPYA 2BFOA 2JAPA 3A4VA 5MGBA 4XB2A 1HXHA 3DOCA 2IRWA 2X9VA 2CUKA 3GGGA 1X7GA 2Y0CA 3RKUA 4QECA 5GZ3A 5KVCA 2PTGA 4E3ZA 3AM3A 2UV8A 4BQPA 1RPNA 1GV0A 5L95A 1EDOA 2EGGA 5F21A 4J1SA 1YO6A 3DZBA 4DVJA 4MVJH 1XEAA 4B4OA 2AMFA 2GUGA 1IB6A 2HMUA 1CWUA 4RF3A 5ER9A 1JLLA 2PLAA 2BLLA 3MEQA 4NHEA 3DWFA 1BW9B 4S1VA 1NQOA 4PG7A 1HF3A 3PHGA 2VUSA 4B4WA 2AW5A 1EUCA 2WD7A 4EDFA 1A9ZA 2X86A 3FI9A 3JQEA 4IJWA 4DLLA 5BSGA 3VH2A 3OA2A 1SB8A 2BRUA 3H6KA 4MVJI 1LLCA 1RJWA 4FFMA 3O9ZA 4CV3A 2Y1DA 5JO0A 5JAMA 1E77A 3KYDA 2BFAA 3CXRA 1T1RA 1UXGA 1R4NA 3I5MA 3G79A 4WPGA 1H2HA 1LTHR 3GN1A 4ZHSA 2CMDA 3EHEA 1T2DA 3RU7A 4A27A 3VDRA 5EQFA 2BKAA 5I7EA 3H3FA 2VWQA 4OYRA 3PHHA 4B3IA 2AQ8A 3Q11A 3M2TA 4IPTA 3RUCA 2GDZA 4WCFA 4KZPA 1J5PA 4I9UA 1HKUA 1NVMB 1C1XB 2HJRA 2NU6A 1RWBA 4NZ9A 4EBFA 3SC6A 3TZCA 3IJPA 3NJ8A 1DFHA 1MC4A 5CAEA 2PD6A 2Q4EA 1AUPA 1SB9A 4FGWA 4FS3A 4C4OA 1EE9A 1BRMA 1YS4A 1AHIA 3DQPA 5CG1A 5L40A 1GV1A 4W82A 3QVOA 4LMPA 1PJLA 2V65A 3ZWXA 2O50A 4LISA 3DTYA 5A9TA 4BGVA 1GUZA 4NIMA 4DC0A 1E0DA 1KY5A 1W6UA 4J4BA 1CYDA 3U09A 2ZQYA 3WR5A 5J23A 3ZNQA 1Z7BA 1BW9A 3OM9A 3QHAA 1T2CA 1T25A 1YOVB 4N5MA 1LC0A 4J91A 3Q2IA 1J49A 1U2DA 4HNGA 3GT0A 5AOVA 7ADHA 4J0FA 3KVOA 3PGJA 2GZ3A 3L07A 1PR3A 2YHIB 1G0NA 3MJCA 4K28A 4BL5A 2QIOA 4G5HA 2O48X 2FHSA 3NTOA 2GGSA 3OQ6A 3QSGA 3VHRA 3DMTA 1SZJG 4OOEA 5B4UA 2FR1A 3FWNA 1X1EA 3UICA 2EKPA 3OF2A 1V6AA 1YONA 3FTPA 4PLYA 5A02A 1MG0A 4DRYA 3O26A 1T4BA 4R16A 1XA0A 1PQUA 2EKQA 3ZW9A 5A05A 3RUEA 1LLUA 5ITVA 1V8BA 5C7IO 3OH8A 1YQDA 4EGFA 3N58A 1C1XA 1KY4A 2PFGA 4FJ1A 4XGKA 5DT9A 3H5AA 1J0XO 4F6CA 1UP4A 4PFJA 2ZTVA 3RUDA 1ZCJA 3OJLA 5T57A 4BKOA 3JQAD 2J3JA 3JD2A 2FPPA 1PR9A 1CRWG 2D5AA 2NV6A 4FJ2A 2Y1OA 3GVXA 5DF1A 1KEWA 3HN2A 1S6YA 2IXAA 1FK8A 1KC3A 1ID1A 3WJ7A 1YDWA 2NVBA 3AWDA 4KUEA 1W8DA 4NPCA 4BNNA 5DCUA 2ZJ0A 2AG8A 3EDMA 3W6UA 1I10A 5JC8A 2A92A 1YOVA 1EFLA 3W1VA 4CLOB 2CF5A 4FDAA 4IDBA 3DHNA 3KLPX 1D1SA 4YXFA 5T67A 4W7HA 3C7AA 2EV9A 3KV3O 3JQ8A 5BT9A 2ZYAA 3WWYA 3QE3A 3RQSA 2YHIA 4IZIA 4Z3KA 1GPDG 4R9RA 1YL6A 4OO3A 4EEXA 3Q9UA 4IGEA 1LEHA 2NSDA 1RM5A 4MKZA 4UVIA 3ANNA 3WICA 2C07A 4DLAA 1TB4A 1Y7TA 4XKJA 3D1LA 3QVXA 5ER6A 4TROA 3WQSB 3DEYX 1NPDA 2QRJA 2H6EA 3KTDA 2G1UA 1AGNA 1OMOA 3E9MA 1I36A 1L7DA 4KQXA 4BGUA 2JFFA 4QXMA 4R41A 4CM7A 5I9LA 2GZ2A 3GZNB 3ANLA 5AXAA 2VYNA 1LUAA 4PG4A 2J5QA 4RZIA 4WASA 4Q3DA 4D3SA 3OJOA 3PYMA 4D46A 4MPDA 4BO2A 2X0IA 3AUUA 4YAIA 4WLNA 2DVMA 4AJEA 4XDYA 1E7RA 4E0BA 1K89A 3PTZA 2BGKA 3AUTA 4CR6A 3GOHA 4CUJA 3DHEA 1AHHA 3ZNOA 3ICPA 1DOHA 3HHPA 5I7FA 3F4BA 4YEDA 3FSRA 3R3SA 4CLRB 1M75A 4QO8A 4CUKA 2DT5A 3R6DA 4IJUA 4RPKA 3RSHA 4CMJA 4NG5A 2DPGA 3ZU4A 4X54A 4WE3A 3GMSA 4OMUA 1FDTA 3OEWA 4CLOA 4TRNA 1ZK3A 3AY3A 2G5CA 4KWHA 5I9MA 1OBFO 1LX6A 4ALKA 4PG8A 3H2ZA 3PVZA 3TJRA 2W2LA 1F14A 3KSDO 1WZEA 2FMUA 4WECA 4YRBA 2R6JA 3QW2A 5JYEA 2AEFA 2GN6A 5CG2A 3PQDA 1GCOA 3JQBA 2BI8A 2IEDA 3O8QB 3PIDA 4PN3A 3CIFA 1XQ6A 1PZFA 2DFDA 1NQTA 3HFSA 2YFHA 3VZPA 3WGTA 5CFZA 3P7MA 1CERA 5JY6A 1UH5A 4PLFA 5L7WA 4I9NA 5DBFA 3ETGA 3UCFA 1NQAO 1DAOA 1LLQA 3DZIA 2B4QA 4IDEA 1VL6A 3IC5A 1XGKA 3EMKA 3ADOA 2BD0A 3KSZO 5KJEA 1QLHA 3JQDA 2ZYDA 3M1AA 5DP1A 2OOSA 3A06A 3HDHA 1BG6A 1LI4A 4JBIA 3TOXA 3VH3A 4FFOA 3Q1LA 1HDYA 2CY0A 3RFVA 4OQYA 3WGQA 4A26A 2FZWA 4F46A 4CLRA 5ENVA 3LLSA 3KUXA 4GX0A 1Y8RB 5B37A 4MVJD 3GPDG 3WTBA 5HA5A 1IPEA 3PI7A 4W9NA 4CM6A 3IDSA 4PLHA 5JCJD 4Q3AA 1R37A 4BMVA 3ONEA 1MLDA 2E48A 3R1IA 1BDMA 3AU8A 1DIRA 4P8RA 3GZ4A 1PIWA 4MIYA 1DHTA 2UAGA 4NFYA 3S2EA 3V2HA 1QMGA 3N74A 3JTMA 5F1KA 3I9NA 3A1NA 1VJ0A 3GNSA 3I52A 4JCOA 3WNQA 1ORRA 4CR8A 5G0TA 3GVHA 1NVTA 4KQWA 5JAIA 4ALIA 3EZLA 4BKUA 1DC4A 1PS9A 2GPTA 1U8FO 3O8QA 4Z0TA 3JYOA 4G65A 2Y1EA 2X22A 4ZQBA 5ENDA 3KBOA 4EW6A 2QHXA 3E82A 1FXSA 1F17A 1VE9A 2IZ1A 2NTJA 1ZXBA 3JYPA 2ZKLA 3EGOA 4YPOA 1EMDA 5IZCA 1AXEA 5IXYA 3OIDA 5TT0A 1EDZA 2NQTA 2X5KO 2Q2WA 4YJGB 5JDIC 3F9IA 3I9OA 4MVJP 2OBNA 2DTEA 4RZHA 1YKFA 2HMTA 3QA9A 5JDCC 1MGOA 1QV7A 3C7CB 4PRKA 2JCYA 1D4FA 5AQ1A 2QRKA 3GK3A 8LDHA 1EK6A 2NNLD 4YWJA 2CZCA 1KERA 4FC7A 2BELA 4RDIA 1SBYA 3RFXA 3KHUA 4OAQA 4QTZA 1C0KA 1NASA 2E82A 3GUCA 4ZVVA 1Z7EA 4YAGA 4CQMD 1Y1PA 2Q2VA 1KEVA 1X15A 4O6VA 1Y8RA 5J9GA 2RH4A 3RU9A 4E5KA 1YGYA 5EJ2A 1LC3A 3GUYA 3WFJA 4KTTE 1I24A 1OOEA 2NQ8A 2ZB4A 1UXIA 4UVHA 3MZ0A 2JFGA 4B7XA 3COSA 1EBFA 2VTEA 3ITDA 1I3NA 1B7GO 3VH4A 3GG9A 2EWMA 1JN0A 4I8XA 5TJHA 1GCUA 1T26A 3ORFA 1E3JA 1Z74A 4Y6SA 4YACA 5TC4A 5HM8A 4E6PA 1HZZA 1PJBA 1GPJA 1QRRA 3H5RA 3LZ6A 1UAGA 1ZEMA 4E5MA 4RCVA 3DO5A 3F6YA 4IIUA 1I3MA 2A4KA 2GN9A 3GDGA 4PCVA 3ZWMA 3OA0A 5TF4A 3AM4A 3VPFA 3MWEB 2VT2A 3TRIA 4NBWA 5AXCA 1DLIA 3AM5A 3V2GA 4YJGA 1IUKA 3KSUA 5CDTA 2VZ8A 3VZRA 1DEHA 2P9CA 3LC2O 5GZ6A 5FI3A 4OXYA 4ZRNA 2EW2A 2WDZA 1SC6A 1XCBA 1GQ2A 3QQPA 4JBGA 3V1TC 4CV2A 4MKXA 2YFQA 2X5OA 3GN2A 5JYDA 2NACA 3GVIA 3DBVO 2FSSA 4PLCA 4IM7A 2BGMA 1MA0A 3AJRA 3SVTA 4II3A 2OXIA 1ADCA 2DBVO 3K9QO 3QP9A 1V3TA 3ZHYA 5A5FA 5KVSA 1BSVA 1U7HA 3C85A 3FBGA 4KDFA 3LT1A 1P1JA 3RJ9A 1NR1A 3EW7A 4MP6A 1EUZA 4CMEC 4HADA 1MFPA 1QSGA 2ZIZA 3GAZA 3RBZA 5K6AC 2RAFA 2Y0DA 1LQTA 2AEJA 2VNAA 2QYSA 4MVJA 1HL3A 5JMWA 2O3RA 1QLJA 1DDOA 4IXWA 1K6XA 5A3JA 5L7TA 3NEPX 1B26A 3M1LA 2Q1SA 1Y5MA 3M2PA 4C7KA 3Q3CA 1ARZA 2VRCA 1X1TA 3IUSA 2YDXA 3UFXA 3CPSA 5TT1A 2DPHA 2CVOA 3DFZA 4CL3A 3B6ZA 2C29D 2X4GA 5CDYA 3GEMA 4GVLA 3NUGA 4MKRA 3TL2A 2P2SA 3MJVA 2NVWA 1K6JA 1N5DA 3ZWYA 4ZU3A 1P3DA 1YH3A 2X58A 4WLUA 3RBXA 1QYCA 1X13A 3LSYA 3WDSA 3ABIA 1ZSVA 2ZK7A 3HB5X 3QV1A 3UKOA 1YL5A 1QYWA 3TF5A 4LW8A 3TZ6A 5G0WA 3AOEC 3DFUA 2ZB7A 5EL0A 4W99A 3JD3A 4BV8A 5EPOA 4BNIA 4GQAA 5AVOA 3WGZA 1UXKA 1Q0QA 2Y93A 4ND2A 3TZQA 4ND4A 1OC2A 1P9LA 4NBUA 1WWKA 5JAQA 4QSMA 2DAPA 3FNHA 1EVJA 2VUTA 3RKRA 3UXYA 1L1FA 4K1LA 4RVGA 2NWQA 2VWPA 4ND5A 2OGUA 2RHCA 3GVCA 4J90A 2PZKA 1LRJA 3H9QA 4B4VA 1HETA 3Q2KA 1WMBA 1ZK0A 5LC1A 5IN5A 1U1IA 1I2CA 3HDQA 3Q9NA 3PZRA 4UAGA 1U3VA 2VRBA 2HK7A 1L7EA 1DFIA 4BO4A 3IS3A 4YQZA 3O4RA 2X0RA 1T2AA 4LRSB 1JVBA 5TJ9A 1KS9A 2NU9A 2EXXA 1UDBA 1U5CA 2W4QA 2CF6A 3FF4A 4AJ2A 3QWBA 4ZQEA 1VI2A 2JD1A 4IGFA 3BIOA 1W0CA 4E2YA 2UYYA 3MJSA 5DN9A 4KDEA 1P45A 1QYVA 4BQRA 4XDZA 1X0VA 4FQ8A 4WCDA 1NBOA 5IDXA 4CMHA 4XYLA 1NAIA 3C1TA 3PQEA 3TOZA 4IJKA 3F1KA 4BNLA 4JJGA 1VKOA 3LT2A 1T2FA 2IXBA 2DUUA 3ZNPA 3G0OA 2I99A 3ETDA 3DAGA 1TVEA 4NU5A 1GYQA 2Z1NA 1PGPA 1WDLA 4QT0A 4W4TA 2V6GA 3SXPA 4N54A 3K31A 4WEQA 3RCBA 4DPLA 4HFJA 1SO8A 1LA2A 1GEEA 1RYEA 1UZLA 4N5NA 3U0BA 5HTOA 4CM8B 5K0ZA 4BNYA 1QXSA 4FW8A 1WXDA 4PLPA 3AY7A 1LJ8A 4XQCA 2ZJ1A 3JYQA 4CMIB 4MIEA 5JXWA 1LDMA 2PD3A 2C82A 4GGPA 3S2GA 1IZ9A 4IS2A 1IE3A 3L4BA 4JROA 3OIFA 4ZGWA 1UZMA 2RH8A 3DTTA 4E2ZA 3DB2A 5L7YA 3ZZNA 4D41A 3ZWCA 2Q50A 4BO5A 5JAZA 1TT5B 1UP7A 3K96A 2H9IA 4D42A 2HRBA 4P22A 2H63A 3VKVA 3JQ9A 5JMPA 3AI2A 5H82A 1GUYA 5ADHA 1GZ4A 3U49A 1W4ZA 4QX6A 3CKYA 1R16A 1R66A 2VZ9A 4HBGA 4PLWA 5K9ZA 2EP7A 5FI5A 5BQFA 3WLFA 2OHXA 1JAYA 1ISFA 1SNYA 4AJIA 3ZGYA 5FWNA 1HEUA 5THKA 4CLDA 3QJ5A 5THQA 4LRTB 1T4DA 3BTSA 4WLOA 3RFTA 4INAA 4LMRA 1JU9A 3U62A 1NR7A 4RF2A 1H6BA 1V9LA 2FZEA 4NU6A 2ZQZA 3A9WA 3KETA 1LSOA 1TA4A 1GDHA 1TLTA 4BO9A 1PGQA 3U4DA 3QWAA 1PJCA 2YV2A 1QV6A 4FD3A 3WSVA 3F47A 4BO1A 4CM8A 4ZQHA 1HDRA 4E2WA 3ST7A 4JQCA 5CEFA 1DIGA 1QG6A 2Q46A 1Y6JA 4XWYA 1B16A 3AFMA 1D7OA 2PKRA 4CMIA 1XU7A 5BNIA 1U4OA 1YQXA 3L0DA 1ZKMA 1X0XA 3DBRA 3P2OA 2GN4A 4BO7A 1KVTA 2ZTLA 2I6TA 4EITA 3WYEA 5A1TA 2YQ5A 4WLEA 2A94A 1TT5A 3UN1A 1IYZA 4J2HA 4Q3EA 1GQYA 5KKAA 3FPCA 3WGHA 2GR9A 4D3FA 4PLGA 3KYCB 4Y67A 3HE3A 5DDIP 1ZK2A 4AJLA 1WP4A 4ALLA 3S55A 4CUZA 3G1UA 3PWZA 4FFRA 3RC2A 1CETA 1ULSA 2RIRA 4ZD6A 1N9GB 1TXGA 4XJTA 2PGLA 1B2LA 5KCZA 4B7UA 3RVDA 1XU9A 4J7UA 1DIHA 1HYGA 1QYXA 2C0CA 2CVQA 4TKLA 4OXKA 4YDRA 3JYNA 3ONDA 1K0UA 1WVGA 3GG2A 3W4KA 4ROSA 3LT0A 3OMLA 1OAAA 4J3FA 2B4RO 2DQ4A 3IOYA 4IUYA 4FJ0A 1GZ6A 4J4HA 2FPIA 3L6EA 7MDHA 2D59A 2BF7A 2GO1A 4UUNA 3F5SA 2I66A 3VH1A 4RO0A 2NTVA 4M8SA 3V1UA 1BHSA 1PWXA 4TKMA 5JO9A 4D3DA 1XKQA 4DIOA 1Q7GA 2JKVA 3NV9A 4GL4A 4YTEA 5BSEA 4H16A 1Z6ZA 3D4PA 1Y81A 1I32A 2HAEA 4OGWA 5GY7A 5EESA 1D1TA 1E92A 1H2BA 2ZYGA 3NGLA 4IXTA 4TVBA 1DIAA 3ZV4A 3QVWA 4BO0A 5HS4A 1B15A 1GYPA 3TNLA 4DPMA 4URFA 4WNIA 2Q99A 4GVXA 5LDGA 4DIBA 1ZJYA 3IKVA 4QFCA 5IG2A 4JBHA 4WJZA 3ADPA 4ALMA 3GVPA 1MXFA 1HLDA 3PGXA 3KYCA 2PY6A 2JHFA 4J2OA 3JCZA 3UHAA 3QRWA 3H5NA 2PZMA 1ZUD1 1HE4A 1TEHA 1N9GA 1Q0LA 2Q1UA 2BH9A 1KVQA 1FDWA 4DMLA 4BNUA 1ZMTA 2O3JA 1DJNA 1MX3A 3HWRA 1E7WA 2ZCVA 4BNGA 1C0IA 2RCYA 4P4GA 3TFQA 1FJHA 2Q4BA 3ZCXA 3S1LA 4UULA 2WYUA 3FN4A 5DNAA 1Y9AA 2VWHA 5JYFA 4R5HA 5A06A 3KZVA 4OH1A 1SMKA 2C5AA 2X5JO 4CMGA 3JQFA 1N1EA 5T8KC 3RD5A 1I8TA 4Z0HO 1R15A 5CPFA 1MV8A 2WYWA 4TMFA 5KVVA 4R9SA 2PZLA 4PG6A 4RVHA 4D79A 5T5QA 2HMWA 1SOVA 2FY8A 4Z3DA 2B5WA 4ID9A 4DGSA 1LDYA 2Q22A 4I5DA 4YT8A 1H6CA 4XIJA 4B3JA 3NKLA 4RQUA 2IDZA 1PZGA 2ET6A 4J0EA
chains in the Genus database with same CATH superfamily
1IZZA 2DHEA 2Z3ZA 3FCXA 4N0DA 4S1PA 3O8NA 3PFNA 1V8OA 1I1QB 2EZ4A 2E4VA 4Q3BA 2G72A 3BAZA 3QVJA 4M9QA 2AI2A 2O23A 3HWWA 2NVOA 4NMHA 4WBNB 2XECA 4V3CA 1QZUA 1IB0A 3DEZA 2O8BB 1CQPA 4G1MB 4TRJA 3NORA 4WN3A 4MS1A 4TX1A 3AF6A 2XGGA 1E59A 3MTIA 2G67A 5FT9A 4MRSA 3PPXA 4HGPA 3KKKA 2OQVA 2IY9A 2DFPA 3H8SA 4B31A 4TUYA 2G83A 4ZI2A 5ISMA 1Z6PA 4LYDA 3MERA 3NALA 4URVR 2GZHA 4MYHA 3LGSA 3NHFA 3GCWA 4OXRA 4F21A 4H1UA 2XCTB 3DHYA 3AMVA 4YR9A 4PZDA 2FGKA 2BHRA 3ANMA 2WY2D 2OUIA 1H0SA 4AROA 2Q4RA 1YB5A 4CEIB 3IBGA 3KUUA 2BEVA 4OHYA 1EWQA 2WSYB 2OV3A 4MRMB 1M34A 3JQAB 3QWIA 4U7GA 4DCOA 5E9JA 4EG6A 2UUPA 3FH0A 4QJBA 3W5IA 3G6KA 5H59A 1ODCA 3TLZA 1NRIA 4GRDA 1WMEA 2XLCA 2O05A 2IP4A 4LDQA 3OJFA 3OICA 1FF9A 1XEWY 2LPMA 2QM0A 4DAEA 4DEXA 4DJAA 2HDWA 4JI2B 3U4MA 1GXSB 2PXHA 3RODA 2BMAA 2FPMA 3B5EA 3ON5A 1NUAA 2HZBA 2HYDA 2WE8A 4H3HB 4V0OA 5FUYA 1JUDA 1G9TA 2O1EA 1UXOA 4M1OA 5CA1F 1YFZA 1ZK1A 2V7QA 1AU9A 3WMWA 4DDHA 4S1TA 1U7TA 4NZYA 2Z5LA 4DDWA 5EP4A 4AUEA 4AD8A 1CJUC 1OXKB 2XGOA 1IAQA 3DFIA 3PC7A 4CG1A 3D6NB 3NCHA 4HWOA 1OREA 3KO8A 4NK4A 5LA6F 3H9GA 3HJCA 5DNDA 2BMFA 2GK4A 4WOJA 2HDNB 2XUGA 3LBYA 1UBFA 3QJYA 3AFGA 4HEJA 4R8RA 1CQIA 1M2HA 2BFWA 4J8PA 2O7QA 4UZSA 4JVOA 3K70B 3KUKA 2VTDA 2I2FA 1ZCFA 4NJMA 4QELA 1KI2A 4GMKA 2ZDGA 4C7OB 5AHXA 2Q41A 4E7PA 5D87A 4FI3C 4JDUA 5DGDA 2CK3D 3ICWA 5LKAA 4ZO7A 2HREA 1FNBA 4YB8A 3D1VA 1Q2XA 2P40A 3WK9A 1KORA 5K0BA 2OFPA 4TWZA 4O63O 4IVQA 1MHPA 3EK2A 3DOFA 2M6LA 1E6UA 4QPZA 1RHKA 3D8BA 1HYEA 1JSXA 3K8OE 5JRZA 1BKYA 4YRDA 3MHPA 1ENPA 5JBNA 3A1CA 4V1CA 1Q1NA 3O5AA 1RBZA 4PO1A 5A3SA 4I0WB 3JYHA 4CIXA 1GR0A 5HVNA 2JK0A 2F90A 4RULA 4RQTA 3RGWS 3TTXA 1O7JA 1V3UA 1VXOA 2B98A 2HLDD 4L74A 1GTMA 3DWGA 3HG7A 4N5DA 5ALHA 2QZZA 3KZOA 3UC5A 3GLIE 5LCXA 3B6MA 3LF2A 3S6JA 1G20B 1PJ4A 3WWEA 8MHTA 2J9FB 3MFYA 3OQPA 3KD2A 3L01A 4KFUA 4NU0A 3PC8A 2PRZA 1T1SA 5AW2A 2C88A 3FRJA 4QNRA 5FR1A 2WMDA 4KAAA 4LOIA 4YAFA 3GIWA 4PLTA 3QPAA 5H9WA 3K32A 2AOTB 4JN6B 2C4MA 2ZP1A 3GGOA 1NW4A 2FK8A 1W0JA 4RLHA 3W1EA 3WRYC 4DDTA 2WTMA 2YINC 3KQQA 3MWJA 4GOJA 2HD4A 3JD4A 4S35A 4EKIA 1U9CA 5LYJB 2GWHA 3T3NA 2V5UA 3LUFA 8GPBA 3DMFA 4O4LF 2BKUA 2UU9B 2PX2A 1DJQA 1UJ6A 4NS4A 2H4HA 5KWVA 1I5OA 1E3LA 1JP7A 3P9RA 2IYRA 3LYUA 4P80A 4A23A 5C9ZA 4LF8B 1FP4A 3PEEA 1CHNA 2FWPA 3GJ5A 2PVPA 5EZQA 5BV7A 1DV1A 5EERA 4DANA 4IIFA 4FB4A 1S2IA 2CLHB 1K06A 3MM4A 3QF4B 5AHOA 2EFEB 5KYTA 4D9BA 2V9ZA 3EFBA 2R3SA 3INTA 3HSKA 1EJ2A 2I2WA 4PYMA 2PS9A 4EJ2A 2HEGA 2OE2A 4EG1A 2WF9A 4LHWA 2VUIB 5H83A 3TD2A 1W2WB 2C3OA 3WJ2A 1SVKA 2WSLA 2P4HX 2E49A 2JGKA 3F6PA 2OB2A 3HCRA 1E1MA 3OZCA 4GLOA 3P2YA 1PTKA 2FRDC 4ZCQA 5KJCA 5BR4A 3UGKA 4KWIA 1Z73A 1VP3A 3JQ7B 3QKRB 2IUYA 1EUDB 1B76A 4P08A 2A7QA 4YA6A 4PQYA 2O2DA 1PR5A 1MQAA 4HX2A 4U2KA 3L0ZA 1OV4A 1P0CA 1W9HA 4HDMA 2W6ZA 1Y6RA 1GL9B 3FETA 1XALA 1ZH2A 4WQMA 4REQA 2Z83A 3QFHA 2WZBA 5JDIA 2I67A 3WIBA 1GLVA 3E3OA 3S27A 2C9MA 1AG9A 1ZFNA 2ISQA 5KWEA 2CLFB 2AW3A 5IT9A 4PQFA 1NVAA 1P74A 1UJNA 1Z0KA 1Z25A 2K5UA 4BMPB 3KYBA 4IKPA 5PGMA 5F3RA 3COYA 3IHTA 2QQ0A 2ORVA 3P2JA 5EIBD 1O4VA 3QYJA 1NAHA 2REQA 4JX9A 2GF2A 2HSDA 2Z5FA 3PQ5A 1C3OB 3FGOA 3G2IA 4YAEA 1Z38A 4EHJA 2VDJA 4KGZA 1G19A 1WIWA 1GLNA 2B9EA 3C3DA 1W25A 3MT9A 4OUDB 4EA6A 4F38A 2BE9A 1SG9A 4R1TA 2CL0X 3FAZA 5HQ3A 2CHFA 3L9XA 4Z4GA 3UMVA 1GU7A 3TW0A 3SDBA 4H17A 4DSNA 1WDWB 3S8YA 1OX6A 3AF4A 5JI2E 4ZICA 3KSMA 2GBFA 2GH1A 1PYGA 3PJDA 2JKZA 3ZXYA 2O1WA 3T4PA 2QD1A 4UBKA 1OFGA 1MCZA 3ZD7A 1Q1EA 4MQEA 2D5CA 1M5TA 1QX4A 1S7GA 1L8LA 1ZOLA 4FBGA 3VTAA 4GWLA 5A9SA 3UGJA 2RARA 2WUGA 3O8OA 1OROA 3PXAA 4UFOA 4YRLA 2J6BA 3A9VA 2WJVA 1LV8A 3OPQA 4ENUA 2NO9A 3W9UA 1O1YA 3M6UA 4P2BA 4M9UA 4R1PA 5EEHA 1WBJB 1N2XA 2B8TA 2GTPA 5JAUA 2OL4A 4C14A 3K4PA 2MSCB 1PV1A 3SFVA 2D2XA 2PUAA 4I6JA 1NP3A 4BMYA 4RPCA 3VHXB 4P1ZA 4JLSA 1E3EA 4FGSA 1A4XA 3R7DA 1BYUA 1DUVG 4PZ9A 1ODTC 2CLDX 5ESDA 5FNVF 1OW3B 1SQ6A 5JS6A 2QZSA 4OJQA 5J40A 4BMSA 4WUVA 3EC1A 1TW2A 4HFRA 2SHKA 3D6UA 3IULA 4RXMA 4C1NA 2GKOA 4YBRA 4CM3A 2IYLD 1L4KA 3TV1A 2PEYA 4M9RA 4Q3CA 4BNMA 4O5OA 1DQSA 2C5BA 2QN6A 3G8BA 5GAJA 1QQ7A 1Q5PA 4BN0A 3A2KA 2YIJA 3B9BA 4CQMB 3ID6C 1XTUA 3N0RA 1NBMD 3AR5A 5ITSA 1FA9A 1FVXA 4A16A 1Z68A 2ZI5A 3ELBA 3QVGA 2FE1A 3UAWA 4ABTA 2R5WA 3IWDB 1X8JA 1H5QA 1NT2A 4UBOA 2FOIA 3K53A 1M67A 1MNQA 2QMQA 4L4XA 2DKNA 3CH6A 4RA9A 3E1KA 1JHVA 4BJ5A 1DAGA 1SOWA 2GSDA 1QK3A 4CM9D 1RD4A 2KBFA 4JC8A 1YDMA 2VRWA 1IRXA 4XR9A 5CHEA 5JNSA 4I1PA 5AVKA 3GH1A 3D59A 1T5LA 2G0TA 3OPYI 2C7PA 2VS1A 3BL8A 4Y6QA 3OQ1A 3OZEA 4FDUA 3LPAA 4DLBA 2QY6A 4K6MA 3DAFA 5KYXB 5G2OA 2D0DA 1YCDA 3PCRB 4QU9A 1J06A 4TV9A 4LDZA 4D96A 5CLJA 2X9GA 1VPWA 4DIDA 4X1YA 2XQJA 3WOVA 1K9VF 2V6MA 4XRGA 2WFMA 5FD8A 3V7YA 1IHUA 4GP6A 4KIUA 4R05A 1BJKA 1OYYA 2Q4TA 3I2FA 2IBSA 3O8LA 1O95A 4CFSA 1RE1A 1X7ZA 3GHYA 4OLHA 4PZYA 3I73A 4FZ5A 3MWYW 5F35A 2YIVX 2V7XA 1T3LA 1LQUA 1NJGA 2Z2KA 2TYSB 3SBOA 3PFFA 4M38A 5BR8B 2H9YA 1Y1LA 1VYVA 3G2NA 2E21A 3T7TA 3U4GA 4JBXA 2CBGA 4CMKA 4UNPA 2GNPA 1JVSA 2I78A 1UJMA 3NUQA 3G2HA 2FE4A 4GLLA 4HS4A 4OHKA 3SOZA 2O5EA 4DADA 2OZPA 1NHGA 2BCEA 2GEKA 3WXBA 3AG6A 3SR3A 5ALVA 4Y18A 1GADO 1MO3A 3U0VA 3HZHA 1T0IA 3Q4GA 5ALWA 1OZAA 3TRKA 5ED4A 2GEBA 2JGDB 4K05A 1E7SA 1YRYE 4ITUA 1S9HA 3E7XA 1PDVA 2PT7A 3CEAA 3T5BA 5JAOA 3H9JA 1G0OA 4OPMA 4KHZA 3R09A 1JG4A 1DC6A 1JIKA 1A2KC 4RMIA 4AVYA 5L53A 2DM6A 4ZZ2A 1RCUA 2P4UA 1D04A 2V6BA 3BWCA 3L1IA 3A31A 4J16C 5K3AA 4ZJUA 8ABPA 1M2WA 5JJCA 1SC3A 5KWJA 1A50B 3KRTA 4JNKA 1DARA 3C3EA 1APBA 1MORA 3EH1A 4QU5A 1ZA1A 2J30A 1B00A 4RC9A 5IKOA 2ZU0C 1QAQA 3NHAA 1SEPA 1V37A 3SMQA 1MPXA 5JWOA 4BIMA 4MB6A 3FOCA 4I8DA 1WSWA 9LDBA 3DMYA 3G49A 2H4ZA 4MR8B 2A5JA 2RBEA 4DJDC 1SXJA 2RJNA 1PR4A 1TM7E 5ESRA 5DM2A 1DBVO 5FEMA 2RDMA 1A7KA 2VQSA 4QKQA 5EHXA 1SXPA 5DX1A 3DQQA 4UHBA 1YBHA 4N0MA 4DNFA 4MJLA 3VDMA 1NQ5A 1EM6A 1NC1A 3COPA 2QX7A 2W2KA 4ZI3A 3EP3B 1P6XA 4WOCA 5CLLA 1SBTA 2LBPA 1RRMA 2I4OA 3FPAA 2VF2A 3QOFA 1J97A 4DHWA 1FMFA 1ZVQA 3LY5A 1D5CA 3IHWA 4Y8VA 1VJDA 4F5ZA 3JALB 3IEXA 3TMYA 1TKCA 2OP0A 2X2PA 5FPSA 4PF1A 3KJFA 2AT1A 3QV2A 1ZRNA 4X8OA 2AMVA 2HHJA 1ADFA 2YDYA 2GFQA 3OWHA 3UIEA 1YNSA 3JQCA 3EXIA 3ZYZA 1N6KA 1YR6A 4D4KA 4WV3A 5E4YA 4E4YA 3OQIB 4M6WB 1FUYB 3D5QA 3FPLA 5AJXA 2WJZB 1T5DX 4Q39A 4G0WA 4D6PA 2R68A 4P4NA 1B93A 1ZIOA 5ILOA 1NVGA 4AUKA 2H1SA 5T64A 4B5LA 1Y3HA 4W5JA 1EVEA 3HRKA 4A0GA 2ZULA 3MS7A 3QEMB 1JDZA 4F9EA 1YL7A 1V2GA 2BKLA 2XD4A 2GZAA 3FUUA 4BB6A 3U3JA 1TGVA 2BISA 4LYAA 3T7RA 3OO1A 1EK0A 4EUSA 4ZRMA 4KQHA 4N9WA 4GOLD 5C8XA 3T5AA 1O6BA 2EBUA 2FWMX 2GM9A 4RCYA 1RLIA 2HQRA 4BXOB 3JSXA 1NFFA 3GA0A 5IP5A 4QJ3A 1HUQA 1SUEA 3LLMA 1X1BA 1I33A 1MC5A 2G17A 2LW7A 4BTLA 1VC2A 1OFIA 1TK2A 5LQMA 1R9GA 4LOLA 1AO0A 4LSMA 1SZCA 3JQQA 3G2KA 2NPIA 3R7SA 4AT1A 1FX0B 4LN1A 2QZ9A 2K2WA 3KR0A 4X65B 3KLNA 1OA1A 3QKIA 1RXEA 2QM3A 4QYMA 2MYTA 4UXIA 2ZJ6A 3HCPA 4L08A 1VCHA 2PGNA 1NXVA 3INYA 1TC2A 3DXFA 1QQ6A 3HV0A 1DO0A 1F5SA 1ZAKA 2XUPA 2FHPA 3EQ7A 3QU5A 4MQ4A 3FDZA 4TTQA 2Y1GA 1ZWLA 4BKRA 4JL5A 2YVAA 1JIXA 4DN6A 2AZ4A 5AKXA 1V6CA 2OCLA 2Q3EA 1UM8A 1DHRA 1JJVA 2V1XA 3D8NA 3KXLA 4L4UA 2V7VA 4P2GA 3MJFA 4EI8A 3CUVA 2O8CB 3C5CA 4PHHA 1S8OA 1Z6QA 2UZIR 2B78A 4MGHA 4Y0AA 5G53C 5KUTA 1FFCA 1XZEA 4UBJA 1NNLA 1C7FA 1UF9A 4RD1A 5CB8A 3HM2A 1G7SA 2BRUC 1LKZA 4DNPA 1JTFA 5CDHA 1DC8A 3FCOA 5JS8A 2Z6UA 2O07A 2RAUA 1ZH8A 2B1IA 5IDQA 2Y0EA 3VUEA 4UUPA 1VCMA 3CLHA 4G24A 4KJZA 1P9OA 1LI7A 3GRPA 4RHEA 5D51S 5HWSA 1XYVA 5DHPA 5LNK6 4BASA 1V4NA 1X7HA 1Z18A 1Y42X 1ND6A 2RE8A 5CURA 4P3PA 4BNWA 1EFAA 3AKYA 3WLAA 3VSDA 1NXXA 3SJ7A 3RYFA 4QUAA 5DIFA 3PTLA 4P0QB 1MABB 1LPSA 1KH1A 3QLJA 3K2EA 4B33A 3HYCA 5SYAA 3BTVA 5NLLA 1GTVA 3PUJA 1CP3A 2RBKA 3HDYA 1K6IA 2ODTX 5FP0A 3X1YA 5DNCA 3OLCX 4M37A 4UTVA 4XLZA 3VYVA 3V48A 3TVTA 3NANA 5DRTA 2W58A 2GF9A 2WM2A 3BHMA 3SQMA 2HW8A 5C53B 1RAAA 2UUCB 3WLSA 2EARA 4WZZA 1PJ8A 1RKQA 3DZGA 2AFIB 1U7OA 1M0TA 4EG0A 1NF9A 2WHXA 2WPNA 2QVZX 3VO1A 1SHTX 3CUWA 4EPVA 1DI0A 3L6UA 4MV6A 3HUTA 2ZJFA 4FDLA 1R9MA 3NCTA 4IZHA 1M2GA 2O2GA 1G5IA 1I0ZA 3EVBA 4Q24A 2BJHA 1Q0SA 4FHDA 5EZ5A 1QQ5A 5IAGA 5ALSA 2FSVA 5FTLA 2NO0A 3K8ZA 4OQMA 4ZA2A 5F9HA 1PQPA 4KXLA 2KHZA 1EHIA 2HBYA 4PWYA 2PPLA 4BNXA 4WNCA 1XVLA 1PCXA 3RK0A 1XTQA 3T3GA 2M32A 2OENG 1DPGA 2BM8A 4LMAA 1GCIA 2JJMA 2DX7A 3FFXA 1AIPA 1NW5A 3CZPA 3LD9A 3NH6A 4KMSA 4MP3A 1TVKB 4OYHA 4DQDA 3ORQA 4WKGA 2J0UB 1G7CA 5CYPA 2ZQ5A 1YR7A 4NCKA 3H1EA 4LDRA 4P4TA 3BILA 3OKAA 2RCNA 1F7UA 4Y6PA 3GBSA 4AM8A 1U90A 3GRAA 3DMTC 2GARA 3QTBA 4GEGA 4Q05A 3ZDDA 2ZSDA 4MYCA 5E6UB 4J2TA 1DXYA 3T4XA 2EFCB 1MDFA 4JJEA 4ICIA 3VVLA 6ABPA 4RTKA 3HKDB 3U4HA 4BQOA 2W2LD 4R1OA 3EXAA 3B6IA 1TJ3A 3UXEA 4WXMA 3UWOA 3O0DA 4BU0A 4E32A 1Z62A 3PFBA 1EXWA 4AMVA 1FTWA 2AA3A 2HKIA 2P41A 4RZ3A 5CDFE 1SVNA 3E5MA 2RGXA 1UK8A 3TECE 1UMCA 4WK4B 3TD6A 3EC2A 1RP7A 2IIQA 4ZYUA 3ESAA 4MUHA 4OTZA 2FSGA 3W8FA 3ZWAA 1DPFA 3OQBA 2QRVB 4IIJB 3RVLA 2YJGA 1YBVA 4EHKA 1Z2PX 3WKAA 3I62A 1U0OC 5JBQA 3WV5A 1CR1A 2JDIA 4TVKA 5I4IA 2PRIA 4O4HB 3TUZC 1J8MF 4MWGA 1KJIA 2E87A 1RQPA 4IIVA 3VMMA 3H6GA 1FU8A 2VZEA 2XOKD 4BFVA 1QFXA 3RUIA 5D86A 5JQWA 3THXA 4D26A 3I92A 2AH5A 2WIDA 4HB3A 3LT5A 5LLSA 4E07A 1CR2A 1EBUA 2GD0A 4RLSA 1TNDA 2OB1A 1B4DA 1WVMA 3FVTA 3IMGA 5BYAA 3G6WA 2ZAGA 1UYJA 5KYWB 4IDDA 3CRZA 2EGUA 1JJIA 3BHIA 5FWAA 2ZJBA 4JYPA 1HDOA 5IW8A 1U0JA 2Y66A 3U44B 1TFRA 5TIIA 1FMLA 1O2DA 1YACA 2HQ1A 1HDXA 4A8JB 2I3GA 3AI7A 3L4EA 2Y9MB 1GQFA 3OTIA 5F5XA 5C4IA 4UVEA 1V4BA 1Y1RA 1C9KA 3PITA 3GP5A 4J7AA 3RTDA 5C0OE 1IQRA 3LY7A 2Q5FA 1JW9B 4FC6A 4HATA 3DWEX 1RNLA 1CUAA 2CNKA 4FTWA 1X7XB 1A82A 5E2BA 1P1HA 3EIXA 1BMDA 5CT8A 3WKEA 7YASA 2EX4A 4JQSA 1C29B 1FFAA 4CTJA 1AMUA 5D84A 4D3YA 2PSFA 2XWJI 2NUTA 2IVFA 2J6IA 3NDIA 3DJFA 4IF4A 4INJA 4LIPD 1CIPA 1FPQA 2ZSUA 3ELYA 3UA4A 4YJHB 4JKOA 1ZD3A 4Z51A 5G3ZA 5M6DA 3J81k 4Z99A 3AEKA 4HGNA 3GMDA 1A96A 1YZHA 2VBFA 4QBTA 4DMRA 2W9XA 5HR5A 3UAGA 3CO5A 5T8KA 4LDAA 3JD1A 3RYIA 2IK8A 1FTNA 3AY6A 3EA4A 3H8VA 3GGCA 4Y9TA 5ELMA 5HBGA 3B8HA 2Y1CA 1LPAB 1P7WA 3I6QA 3AX6A 1JPNA 4F2DA 1U9IC 5E9WA 3NXSA 2WJ4A 1CG6A 3G13A 3AVTA 3IGFA 3JVVA 5G0UA 1V26A 5I7UA 3PLNA 3QXSA 4IHJA 3MLBA 1E58A 3B20A 3WADA 2FDXA 3K30A 4MGEA 1PJTA 3UJAA 4EAQA 4YCMA 1K5DA 1Q0RA 1W9MA 1GGJA 2VOEA 1IVYA 3OSUA 2PH1A 1GZ7A 1RMQA 2X41A 3HQ4O 1YZFA 1WQ4A 4L02A 4D7AA 1CS0A 1XCJA 2OORA 4KTVE 1RJ9B 3JR7A 4RK7A 3D7LA 3FWHA 4HDRB 4NDAA 3FY4A 4D4LA 1YSCA 5LBTA 3DDNA 2WUEA 2M2IA 3NHZA 5KDLA 2BVNA 3USZA 4Q4CA 2WF6A 4DIEA 3IMCA 3R76A 1E5DA 1EXMA 4TMKA 3WQRA 4GSKA 4E4RA 1N32B 3W6PA 5F5NA 4Q6BA 5F9FA 4NC9A 2GZSA 4Y1RA 1M1YE 4NBRA 5E7QA 4U7DA 1OR8A 4KYIB 4QUHA 1T0UA 1ZRSA 5HYVA 2QR3A 3DVLA 4KLCA 3EDYA 3DDOA 2ATVA 3O8DA 1YRBA 3WLPA 2JGAA 2CSXA 2PIAA 4GRIA 1PR2A 1ZK4A 1SCUA 5C1DA 1H4QA 1R5NA 2C54A 1K75A 2IYTA 2VHZA 2W6QA 4BAUA 3PC2A 1P6QA 3JQBC 1BA3A 1ODSA 4B76A 2DLCX 2HU8A 3G9TA 1VDZA 3FUXA 3IAUA 1NI5A 4RZSA 3B6JA 3JD0A 4HAIA 4L73A 1I79B 4L0DA 1JWBB 4KITB 3I72A 3J81A 4DR5B 1O6FA 5TPWB 1GR1A 4MA5A 1EGQA 5TRTA 3PUKA 2NO5A 3Q1KA 2QT1A 1QYIA 3ITKA 5L3QB 1S3FA 3CN7A 4WFJA 1SZDA 1UOPA 3PPIA 5BSRA 1E1CB 5FI1B 2IU0A 4FYPA 1RYMA 2DY1A 2NW6A 1JKJA 1PVVA 1L5YA 2HRCA 1GD1O 2VUUA 1UPBA 1EG2A 3T38A 1GQQA 5JAPA 2B5OA 4JI7B 1JU4A 2FETA 4C2BA 2IX3A 1C3VA 3TR0A 1A5SB 1Q12A 2CNNA 2DFNA 2GESA 2IXGA 2WLSA 1M6VB 2ONCA 1AXGA 1JHZA 1CIVA 3D6FA 4ES6A 1WZ2A 1NY6A 2C8LA 4L5AA 4UEOA 4C0QC 5FFMA 2VJAA 3I76A 4HQ0A 4XPIA 3GCZA 3Q7SA 5JVDA 2H17A 5H16A 3T9FA 4XOIA 3IYLW 2RGDA 2WVAA 4MV0A 1VLLA 2FEMA 1FRNA 2R1VB 2PWPA 3V7FA 5CIYA 3KB2A 2X3YA 3D6AA 2I9PA 1MJ5A 4WXHA 2Q1XA 2PAAA 3BE4A 4HDSA 4C05A 3T94A 4TZTA 4J1TA 4V0MA 1RAHA 3ELUA 4UPVA 2POQX 3G0IA 2PWZA 4YCBA 4W9NC 4DYDA 3O8RA 2SCUB 1H65A 4ND3A 1ISGA 1VPLA 4KOAA 4PSCA 3W5CA 1G5PA 3ODGA 4UUMA 3KLOA 3HY6A 3IJRA 1E20A 4RV9A 1VGQA 4HO1X 3VNVA 4F96A 3SHOA 4GG1A 1M34E 3LHDA 2DG2A 3L84A 3LPNA 4QEKA 3ZCSA 3DMPA 3CEPB 3I5AA 2OESA 2AB0A 1IHOA 4RM3A 4BNVA 3P4YA 4H1HA 1RBQA 2G9NA 3DEIA 5B4TA 4DA0A 4AY2A 2BHLA 1Y9EA 2ACWA 3RHTA 5CUQA 1YJ5A 5IJZA 1NJ1A 3OX2A 2YWFA 4QOSA 4R9UC 3GRVA 5BOSB 5DSXA 5KINB 1PSWA 3BXXA 2RH9B 4B44A 2DH5A 2WW8A 1I1NA 3DEFA 1SQ0A 1AQYA 3L7AA 3FVWA 1U2PA 5LOVF 1S5PA 5IZCC 4M53A 4FGLA 4JWKA 3O91A 3F7TA 1LNQA 2A9PA 3HA5A 3AUXA 4E88A 1LY1A 1T9CA 1ZMOA 3WLLA 3LBHA 1P62B 2PHZA 3TN7A 2VHYA 3FROA 4TV8F 5M3BA 5FPKA 1G1MA 3Q6IA 3U13A 3DZFA 2ETVA 2QN1A 2V6IA 3C3PA 3GPIA 4L3WA 2IH5A 4DHEA 3EEBA 3F90A 3MAAC 3PNSA 4LOJA 3TTVA 2PZEA 2XEDA 1RXWA 3WBJA 3QJGA 1O6ZA 1MAAA 1R9NA 5ARBA 5EZYF 3SJCA 2G08A 2VFAA 4ESOA 4DC9A 1NQVA 4S05A 4G4IA 5A4MS 2OBMA 1F06A 3M5CA 5ESXA 1WNFA 5A2GA 1F0NA 1M8JA 3PICA 3CO0S 4XUEA 5ICGA 3JATA 3EWAA 3R0JA 3ZIDA 2P3OA 1N5RA 3BMOA 5T4FA 1U0RA 1MOQA 4UQLA 3D3KA 5B3JC 3OJCA 4MUNA 4RKRA 5EKTA 3OQOA 1B73A 3M5WA 5E6RB 5BMVF 4L5BA 5J4LA 4GWKA 1HZJA 2IBMA 4DRXA 1N33B 4FUTA 3I9LA 1E4EA 1J42A 2QUJA 1ZL0A 1JECA 1G18A 1QIGA 2IW3A 1HK7A 2UDPA 2J48A 3DW3X 1W85B 3OG9A 4NQRA 2ONJA 3ZGOA 3ZPXA 4OL9A 4Q34A 1IWPB 3DVAA 3QZUA 1Y89A 4IDOA 1ZKDA 2EHJA 3UK2A 1E3SA 3QLUA 3RK4A 1GPWB 2EKZA 2YRFA 2HCTA 3IMFA 4IYRA 4PIPA 2VP2A 5M29A 2Q9CA 3HCAA 4CMAA 3DBHA 3RWOA 3IUPA 1R0RE 2JLRA 2HLPA 5JSZB 4OY3A 3H1BA 2CLSA 3PUZA 2IP2A 1QHXA 2O52A 4HUTA 2WSIA 5P8WA 3A1DA 3MJEA 2A1TR 2P11A 2VQ6A 3DV0B 5JH7F 2BW0A 1Q1GA 1BXKA 3E22A 4WKBA 4RUKA 3UF0A 3IL2A 2JCBA 4FB5A 4TTTS 4U2CA 3ZKWB 1U9YA 1BJRE 4MRRA 3SSAA 4LCBA 1U5BB 4OB8A 4W8HA 2FN4A 3EEQA 4U2EA 2Q3LA 2B94A 1TK9A 2W2TA 1AM4D 1H9CA 1MFZA 2COUA 2NSLA 4IIYA 3U81A 1ZMXA 5LQKA 1R74A 3IB3A 3IQDB 4RORA 4DTIA 3NFRA 1JDJA 1NM5A 1U2GA 2FFBA 3K16A 3KB6A 5EPEA 3RLFA 3OEED 4BWFB 3OTHA 2YZKA 3VU9A 4GWGA 4NFHA 1HDGO 2HA7A 5KAPA 4HZUB 1XXHA 2WNIA 1A9PA 1O87A 1RSZA 4L7VA 3L1KA 1A95A 1LWOA 1RM3A 3MRXA 3V5NA 4M0EA 4Y1EA 2QKYA 3UH1A 4L4RA 4GFDA 1Z3CA 3KPWA 4R51A 2FR8A 2B7CA 2QPAA 3LQ1A 4MEJA 5GONB 3K8YA 4TMTA 1E3IA 1W34A 5A03A 1JHYA 1ZU4A 3ADKA 1VZ2A 4OGKA 4TXHA 1H2EA 5C5IA 5EIXA 4W6QA 4V0RA 4FCCA 3C5VA 1RQLA 1SHUX 2HBQA 2C3YA 4NNJA 4D92A 4ENVA 1I01A 2I29A 4MCIA 1T9ZA 3I2IA 4G81A 5CVEA 1I7BB 3JV7A 2QLLA 3MWDA 5FTWA 2DHDA 2Q0SA 3X1WA 4CL8A 5F51A 3AR4A 1R9JA 3UXHA 2WJWA 4TTJA 1L3CA 1BEZA 4RFSA 5IK2D 5HRCA 4EGQA 4QHYA 4DIMA 1DAEA 1UANA 1RQRA 2MINB 2WTBA 3A4MA 5B1HA 3T7KA 4F2GA 5COBA 2C7OA 5IJ9B 3I6YA 1SU6A 3KBBA 3B1JA 2KX7A 4KPGA 1R0SA 1XPRA 2OZLB 3M3PA 1KVUA 3OT1B 4G01B 1JHDA 2GJ9A 3K6JA 1NFRA 3KLMX 3MGGA 3O82A 4WY8A 5LZ5A 3C7KA 5I7SA 5F64A 5BQPA 2OYSA 1N6RA 1D09A 3USCS 2PR2A 3HXOA 3GCGA 1RS0A 2EJVA 1ONPA 2NO1A 4DSOA 3TLGA 1QGUA 5KDOA 3ESZA 3G17A 2WZDA 4CM4A 3AIMA 3QFFA 4JBLA 5IC5A 2HMSA 3SS8A 5TARA 1II8B 1GNPA 2WG1A 4C4XA 1ONOA 4HY3A 3NGMA 3CKKA 3K0FB 2PM8A 1CULC 3IMKA 3L3BA 1MQ8B 3OETA 2J7PD 4ZPJA 4GMGA 1JA9A 1QVZA 4HGOA 1CY2A 4ZAYA 3RR2A 1W88B 1O9HA 2ZJYA 1LX7A 2WPDD 3MOIA 5IFLA 3WRWA 4RYDA 1QWOA 1X86B 4H7JA 3PGKA 3UCXA 2HK8A 3A6KA 2WU4A 1YUNA 1JYEA 2G63A 5ARCA 3BL5A 3LDHA 3RJTA 2HMVA 2A0WA 3IPYA 3TQFA 3EVDA 4F6LA 1ZVVA 3MF4A 2W2OA 4G0XA 4KNWA 1E1NA 1FE8A 3T0IA 5TMPA 2JLUA 3PKZA 2WSBA 2FXIA 1DRWA 3TTYA 1EVIA 1EZZA 1VRWA 1WB4A 1RJDA 3CPEA 5LSAA 4M1EA 4ARIA 4TKVB 3AIIA 1VCOA 4ARAA 5J59A 2Y27A 2I6XA 4E5PA 2WWXA 1KPIA 3DT8A 4AZVA 2IZ7A 1KYWA 5ALIA 2R6GA 3CLRD 4K6FA 2PMKA 5EPUA 1CP2A 2VYFA 3ZU2A 3KGDA 4JYMA 3KUCA 3L41A 5IC6A 3X1ZA 3LC1O 3FWPA 1M2FA 3KEQA 1GSOA 5AJTA 4RL4A 5DTMA 3VNQA 3R0IA 3TIVA 2Z2YA 1R5BA 3K1AA 2F3QA 3DGEC 4JOBA 2IIBA 4XA8A 2WG0A 2P2GA 3X1KA 4IDAA 4BNJA 5BQOA 1XZHA 3FSGD 4FI3F 4IMRA 5IAAA 4QFBA 4U9UA 3PXBA 4KPFC 4EZBA 2RBGA 1WB5A 4Y6RA 1NJ8A 4IJVA 4C78A 1U3DA 3BAFA 5GJVC 3ZH2A 1KQ3A 4EECA 5HKKD 1QP7A 3VYSB 2YZNA 1U11A 2NZYA 3CR3C 3E23A 3IUBA 2OLEA 2ZWIA 3OZAA 3RIHA 3SFZA 4JXJA 3RE1A 5A7FA 2OXEA 4JEHA 1UWCA 2ORYA 4MITA 1V8PA 1XDZA 3WX0A 4LPKA 2IYYA 3BH0A 2HK9A 4BLRA 4JU9A 4XCVA 1ZGZA 1BOFA 5CTAA 2QUIA 3SHVA 2ZRJA 3K6RA 3O31A 4FWBA 1OAOC 3I5UA 3IP8A 3LI2A 1KJWA 4HAVA 4N5HX 4OSOA 5HZKA 1BXGA 3VSAA 1W5TA 1EHCA 1YZQA 3MFQA 1K6MA 4MW5A 5TPZD 2CJXA 4JEUA 2WD9A 4GR9A 4YXWD 4YCSA 1PWYE 5KX5A 1UPAA 1E5LA 1KZ1A 3CNHA 2A5DA 4M86A 3TJZA 5EE1A 4D8UA 4NCNA 3UT0A 4CN8A 2R8BA 3PCTA 4NESA 3LVRE 5C4MA 2EZUA 1Z33A 2AUNA 4Q7QA 3OPVA 4KN5A 4Z6KA 1Z8DA 2P0YA 4Q9NA 1C8VB 1HKHA 1NU6A 2DBZA 3L4BC 4U0KA 5HILA 3RTEA 1SAYA 1UC9A 1QFYA 4LHZA 3W6NA 4G0NA 5HCNA 2WZQA 4TGLA 4BEVA 1U1GA 1XPJA 2YJ5A 3QIVA 1TMKA 3NX4A 4MGYR 2JD0A 4QPNA 4R01A 1UP6A 4HNSA 1E9BA 4RL6A 2A1IA 2B3DA 2D13A 4UJ3A 1UMDB 3WYAA 4TRMA 2VI5A 4DLWA 4RJTA 3K0AB 2CXQA 2NN3C 4JAVC 4FFPA 3JY6A 4HJXA 3DGFC 2H00A 3DJYA 3MILA 4KAXA 1OI7A 5T73A 4QQRA 1NG9A 4U7WA 1TEXA 4DW8A 2ZRMA 4FFNA 3OWOA 4CZ2A 3R74A 3PP8A 4RV5A 3FVVA 4G1UC 3VA7A 1Z17A 1UBJS 1M2OA 1XG5A 1JEQA 3LFUA 4M3NA 4E33A 2DSTA 4K8OA 3L7DA 1T13A 1R4NB 2IE0A 3AR2A 1UUFA 3H2GA 5A4JA 4ZXPA 3PEWA 3OE1A 4JOQA 5FBWB 1XELA 4CKBA 1EUQA 3VDQA 1GAQA 2H52A 2H4XA 4DV2B 5D3MB 2W98A 1FQJA 1ZJJA 4AWXA 3PDIB 1PZNA 3MB8A 1ISSA 3SXUA 4D81A 4MX8A 1V1MB 1WXEA 2XDQA 4ZT5A 4AZ3A 4KGVA 1DDIA 2Y99A 1BE1A 4CM9A 3EODA 1XHLA 2QVGA 2Z04A 3ML1A 4IQ0A 4WCFB 4X7BA 5F3WB 1WPXA 2HBRA 4ENQA 5LMZA 4MI3A 4RBNA 4H7KA 4PWZA 5IM4A 5DV9A 4OX9B 1AKYA 2FPOA 1MEJA 2OTCA 3V2UA 4R5MA 3KU1A 1TVMA 4R8LA 3BGIA 4ZO4A 2MWMA 3FOZA 3OZUA 4A4DA 1TX4B 4ECAA 1SXJE 4LZZA 2NXJA 1HY3A 2DGDA 2HI0A 2Q5QA 2ZDQA 3FYTA 2Y0CA 5KNDH 3R75A 1O94C 4CGZA 4NV1A 4MA0A 3NHYA 4XWOA 5GZ3A 1W4CA 4O02B 3AM3A 1NRXA 1SQGA 1RPNA 3CNLA 5IT4A 2X19A 1U98A 3OQNA 5IM5A 2XSZA 5CB4B 2CKMA 4ZJYA 1WUJS 4J1SA 2IQ5A 4DVJA 1X7WB 2ZYRA 2Q29A 4G36A 5DTEA 3TRHA 4B4OA 2OA0A 5TQ2A 4DARA 2HMUA 4P4SA 4JT4A 4OQNA 1AQJA 2D1RA 1BMFD 1EBBA 2R8EA 1K7FB 1CY8A 4IRUB 3QKTA 2VUSA 4B4WA 3RAGA 4II7A 2AW5A 3SPXA 3SNHA 1EUCA 4D6XA 2WD7A 1JI3A 5CH8A 3J7AC 1A9ZA 1J5XA 4H31A 4O4IF 1PR6A 2F3SA 3T0GA 4DLLA 2VBIA 1YQQA 2BE7A 2WKPA 2WZCA 5DHRA 4IOMA 5BSGA 3VH2A 2Y0BA 2YMPA 3O9ZA 4FFMA 2Y1DA 2ECOA 2YTZA 4J07A 2H92A 5JO0A 1O4WA 1U8ZA 3KYDA 4PGMA 4YK7A 4NCAA 3W2FA 3CXRA 1NVEA 1T1RA 3P27A 3I5MA 1S2LA 1QTIA 5TMBA 4HNTA 5EUQB 5AW3A 3GN1A 4ZHSA 2OHGA 3PSHA 3EHEA 1T29A 3NW9A 4ZU6X 1J8DA 2UZ4A 1YA6A 2WLTA 3TD9A 3FLMA 3VDRA 5HJEA 5TGZA 3MMZA 4JWTA 3HKEB 3VKFA 2MJLA 2CNDA 2Q6LA 1WLSA 3PU6A 3WE7A 3BHNA 2AQ8A 5FFNA 3RUCA 5IYZF 4LSZA 2Q3HA 2GDZA 3IP5A 1PG5A 4A8PA 4KBGA 3CUUA 3H6HA 4YJ2F 1M1XB 4KE7A 1NVMB 1C1XB 1IZ8A 3QM1A 2NU6A 4PCLA 3AKEA 4OREX 5DVZA 1QCDA 4BAGA 1WU8A 4CXMA 1E18A 3HXQA 3SHQA 3TZCA 4RFVA 2ZSIA 3F2VA 5CAEA 1H2XA 1IIBA 4FS3A 2EFHB 2W37A 3H75A 2GJ4A 2YXPX 4NAUA 4W1QA 4WT7A 1YS4A 1OX4B 2VHQA 2YC2C 3DOEA 3IE2A 4E7OA 1HDEA 2PU7A 4I55A 4Q4DA 4BZWA 2HA0A 4NCJA 3TW4A 1EP1B 4G1BA 1B6RA 1JQLB 2INGX 4JDPA 1P0PA 2OAP1 2VJKA 4YI5A 4QUBA 3R7NA 4ZCMA 3R9XB 4LISA 4K40A 1KI1A 3GJ7A 1NNEA 3CB4A 3YASA 1GPAA 2V54A 1Z8FA 4ZAGA 1IUPA 2FEXA 2ZJ5A 3L7YA 4MQBA 1OH6A 3IKJA 1W6UA 1CYDA 2P8SA 4ARSA 2ZQYA 1WEKA 5JD5A 3ZNQA 1YHYA 2OKCA 1PT8A 1QTRA 4CEJA 3D81A 4R98A 4ZCSA 1T2CA 1T25A 2HRQA 2RJOA 2QLBA 3HCWA 5K3DA 3LC0A 4J91A 2WWVD 3SP1A 1S01A 3Q2IA 1J49A 3WKBA 4K8RB 3RYCB 1XP5A 4KKXB 3A36A 4F3KA 4CIVA 3BJZA 2FP3A 3IKMB 3PGJA 1UKAA 4DSAA 3QLTA 5CLQA 2Q7OE 4NYMR 2VJMB 4M7OA 4EHDA 2YHIB 2PXAA 1PV2A 2MMCA 4OHZA 4HT3B 1CE8B 2AN4A 2X9LA 2E0IA 3GCXA 2FVXA 4EGCB 3KC2A 3NTOA 5AW8A 5DX8A 5KSWB 2W11A 1ORIA 3SQDA 2O2JA 1N78A 5IBCA 4KE8A 2O8EA 3FTPA 4PLYA 3GLGA 1CUXA 1MG0A 1FMTA 1Y7HA 1WEHA 3O26A 4R16A 4PXAA 1JLHA