1TA4A

Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound arsenate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
371
structure length
357
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for discrimination between oxyanion substrates or inhibitors in aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
molecule keywords Aspartate-semialdehyde dehydrogenase
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 113
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ta4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ta4A01
3K6JA 2QHXA 1WZEA 2DLDA 2YUTA 1WW8A 2BRUA 4K26A 9LDBA 5JYEA 1H94A 3PPIA 5AXAA 3WXBA 1T1RA 4QFDA 1QKIA 3OQBA 4R4JA 3I3OA 4J1TA 4K28A 4OXNA 4ZGWA 3L9XA 5HRUA 1DPGA 1D1TA 4J7XA 4CM7A 5L53A 1XU9A 4BKUA 4ZA2A 1Y5MA 4XB2A 2YV3A 4GSKA 2Y1EA 4O1MA 3OEYA 2Q50A 3ZWYA 2VUSA 4OOEA 2JJYA 4DQXA 4B79A 4MVJF 1NXQA 3LSYA 1K0UA 4OSOA 1ADBA 3D3EA 4IBOA 5JC8A 3MWEB 4FS3A 3T4XA 2R00A 1PGPA 1PJCA 2P9CA 3QP9A 4KWHA 4E30A 2GASA 5JAMA 1N8KA 2VN8A 3BMNB 4CMIB 5I9NA 4CMEC 3OF2A 3ZWBA 1ADCA 2HRBA 3HB4X 1Z73A 4E2ZA 4YT2A 1E1LA 3H65A 1Q7BA 2PY6A 3AUSA 3GC6A 1KERA 1DXYA 1UAYA 3G3EA 3K5PA 3ZH2A 1EDZA 4PLTA 4DIOA 4D3SA 5BSHA 3N74A 1ZBQA 4WCFB 2ZQZA 1HYHA 1PZFA 1C0KA 1DSSG 1LSOA 1LRJA 2C0CA 1DFGA 1E3WB 3FI9A 2BKAA 3AOEA 3IJPA 5TX7A 3JYQA 4O0LA 4YA6A 1H6DA 1PR9A 1HRDA 2HUNA 3FHLA 5BNTA 3WQQA 3DBHA 4MP3A 5CDUA 3G1TA 4CM9D 2GSDA 3KTDA 2QYSA 1T2EA 4XX0A 4GVXA 2Z95A 4NBVA 4YJHB 3WLEA 8ADHA 4BO2A 1RM4A 1ENZA 3I6IA 4NU6A 2J5RA 1PX0A 3D0OA 5G4KA 2GR9A 3U49A 1I10A 1R0SA 4KP7A 2JCVA 1BW9B 2HQ1A 4HFRA 4AJKA 5CDGA 4NDNE 4WEOA 2Q46A 1R12A 4OQYA 4CLOA 1DFHA 2W2KB 1ISHA 5JCXA 1JA9A 5LDGA 1PS9A 2VYNA 4L4RA 1GQQA 1NPTO 3WWYA 2AEJA 1RYDA 2P2SA 2C2XA 2X6TA 3DZBA 3JQAB 4UUOA 5L3ZA 3RKRA 1XDWA 1X13A 2R6JA 5JY1A 4M49A 3OMLA 4E2WA 2X9VA 1E3EA 1HETA 1LBEA 2Z1NA 5HM8A 4XA8A 4I5EA 3WQRA 5IDYA 1L7DA 1HSZA 3KVOA 4D43A 5JAQA 1J0XO 1GD1O 3K2BA 3KV3O 4MVJE 1EQUA 3NJ4A 4CM8B 2Y66A 4DBZA 3UGKA 1K3TA 3DTTA 2Y0DA 1GUYA 2CDBA 4AJOA 5FI5A 1EE2A 1N1GA 1VM6A 2BFMA 4TQGA 3K96A 4E21A 2BD0A 2O3TA 1PJTA 2NACA 5JYAA 1ZXLA 3E48A 3M2PA 3CH6A 5KCZA 3GLQA 4S1VA 4J1SA 4RCVA 3OEWA 1XQ6A 1BVRA 1PWZA 3OETA 2NWQA 2X7HA 4RPLA 5JNLA 1YL6A 3L9WA 3P19A 1A7KA 1KOLA 4FPXA 3GVPA 2WJPA 4AG3A 2GZ2A 3JQ8B 3L77A 1S6YA 3T7CA 4I9HA 2Y0CA 4RF4A 4CLXA 4CMJA 3F5SA 1ADGA 1YBMA 2EGHA 3OIFA 4FB5A 2W2LD 4B4WA 4D79A 1HDGO 2HMSA 1ZKMA 4E5MA 4RF5A 4MINA 3KO8A 1UZMA 4UVEA 1JDJA 3O26A 4OKNA 4XQGA 4A26A 2HMVA 3RI3A 2OP0A 1PQPA 3K30A 4YQYA 1YBVA 1TLTA 3LDHA 3DXFA 4OKIA 3WR5A 1KBZA 1U3UA 1SO8A 3JQ9C 5ENDA 2W8ZA 4GWKA 5CG1A 1H5QA 1E3SA 1H6BA 4E5NA 3ZHBA 1XSEA 3A06A 4D3DA 3RU9A 5K6AA 3DBHB 4KDFA 4OYRA 1YOVA 2DU8A 2CSUA 4Y6PA 1FDWA 1P1KA 4LCEA 4J16A 2HKIA 3F47A 4WLUA 1Q2XA 5KJCA 3SEFA 3UICA 5TSDA 3HE3A 2Q45A 3P2YA 5C5IA 4DPMA 3NJ8A 4E6PA 3WYCA 3VVCA 1PL6A 3JD2A 3Q6IA 2VUUA 2Q22A 4MVJM 3BTUA 1I3LA 3C7AA 3W8EA 1YRLA 1XA0A 1U28A 4HKTA 5AVOA 5F1KA 1LDGA 3LT4A 1OFGA 2B5WA 1KVQA 4LMRA 3FBGA 3ZU3A 5HS4A 5KTKA 2PH3A 1LLQA 4LGVA 2CNBA 3PJDA 1ZJYA 3JD0A 4XCVA 1U4OA 2DKNA 3C3XA 3X2EA 4A73A 4MVJP 1GTMA 1W73A 4BO3A 1DRUA 2Q1WA 3HWRA 3TRIA 2EXXA 3ITKA 1D7OA 2AEMA 3W4KA 4WECA 3B1FA 1M67A 1ZUD1 3VC7A 4WOJA 2VZ9A 3RJ9A 5G2OA 2O48X 2X0RA 1GV1A 4IZHA 4E5YA 1T2CA 3EHEA 4ESOA 1A4IA 3VZSA 4FN4A 3DAPA 3M1AA 1UZNA 4BQPA 1YWGO 1UAGA 1P1JA 1EBUA 2H1SA 1PJ2A 3I9JA 3JQCA 3L07A 1LI4A 3KYCA 4B7XA 4GLLA 3H6KA 1M75A 4ZU3A 1T4BA 5C37A 4W9NC 1I2BA 1VJ1A 3ETDA 3JYNA 5B1YA 4XGKA 4K6FA 3GDOA 4IJVA 1LLDA 5BQFA 2Y68A 1U3WA 4A10A 4BNXA 4R51A 1CQIA 4BMVA 2NTVA 1GPDG 4E3ZA 4Z0TA 4L74A 3RBVA 4CQLA 3BMCA 5BSGA 1BHSA 4BNZA 1GCOA 5DP1A 2D2IA 4AJPA 2IODA 1GR0A 1NPDA 3QHAA 3IUSA 4IMRA 5AQ1A 3GEMA 1XEAA 4FW8A 1EK6A 1ZNQO 3PGJA 3JD3A 3PI7A 3C1OA 4CMGA 3ZNPA 1I36A 1MFPA 1PS8A 3O03A 2ZATA 2EGGA 3EY4A 3G17A 5ADHA 3JQAD 2C20A 3AFNA 3HG7A 5FYDA 1AXGA 4MIOA 1V3VA 4N5NA 4N54A 4A03A 1GEGA 4EBFA 2B69A 1V9LA 2HMUA 1YOVB 2WD8A 4IZIA 2E37A 4BNIA 4F6CA 3TZKA 4M89A 1Z45A 2WWRA 1YBAA 5TC4A 1K6JA 4GLOA 4CMHA 2AQ8A 4TSKA 4OHUA 2J5KA 4GBJA 3MEQA 2P5UA 4CV0A 1H6AA 3GT0A 5JFOA 2DAPA 4XZ3A 5JMPA 1T2FA 2OGUA 4YAKA 2QZ9A 2YDYA 1KVUA 4TKLA 4M8SA 4IDEA 1EMDA 4S3MA 1U9JA 1SB8A 2Y1FA 3TPCA 3EUWA 1EFLA 2FR1A 5BT9A 4GI2A 1B8UA 3VDQA 1O6ZA 3HFSA 3INRA 1YB1A 3HDQA 5DCUA 4DREA 2CZCA 5GZ1A 4H3VA 2D0IA 4HUJA 3LC1O 2Y1OA 3VKUA 2VT3A 3TF5A 1DAPA 3GNTA 4JCOA 3CTMA 4CM9A 2BLLA 4BB6A 4TMFA 2ZB3A 2JFGA 1B7GO 3H8VA 4II2A 3OJOA 3WGTA 2A35A 3WTCA 4GL4A 3WFJA 4D42A 1B26A 3BTSA 2C59A 2NLOA 2WDZA 3FRJA 1K2WA 1P9LA 2Q49A 1NHGA 1PSDA 3D4PA 3PIIA 2YV1A 2J3JA 3AUUA 5L4NA 4I9UA 3VPXA 3UVEA 3WGIA 4CM4A 3K2EA 4ND4A 1VKOA 3RUIA 1RWBA 3CXRA 5TNXA 5C7IO 1ENOA 2VQ3A 5K9ZA 2YFHA 4TROA 5JY6A 1IULA 3GZ4A 3S8MA 1NFQA 1U5AA 4YDRA 2GDZA 3KYCB 3RUEA 4BNMA 1BGVA 2X9NA 2FY8A 3HN7A 3OJFA 4KUEA 5LCXA 3QV1A 4BV9A 3SX2A 3GFGA 2B0JA 2X5KO 1ZSYA 4UUPA 1E7RA 3WB9A 3NX4A 4IGEA 4J9UE 4XIJA 3PK0A 2GN8A 5JDIC 1LSUA 1OC4A 4I8XA 3R3SA 3JQEA 4NPCA 5EMHA 3VDRA 1HT0A 1P1HA 4XJSA 2BFPA 2HMTA 2NU8A 4L75A 3BMCB 5KOIA 2PH5A 2WSBA 1GQYA 4CLEA 1E7QA 4CUZA 3PP8A 2O4CA 4XB1A 4CPDA 3WLFA 1UP7A 4NNJA 5CDTA 2PR2A 3DAFA 1H9BA 2G76A 3NTRA 2ZYAA 4FGSA 4XKJA 1H93A 3DMYA 4EEZA 4R1TA 1U8FO 3B6ZA 1ZO8A 3M6IA 1JWAB 2CD9A 1NVGA 3UAGA 1WWKA 3VPSA 4QO8A 4CV3A 1CERA 3JQBA 4E5KA 3RASA 2PD4A 1G0OA 5HTOA 4YT4A 1ISJA 3Q9UA 4B3JA 5EJ2A 2JAHA 3NKLA 4IQGA 1P1IA 1B14A 2DT5A 4XYGA 1UP6A 3ADPA 5TT0A 4ZRMA 4U0JA 1EZ4A 1G1AA 1LXCA 3GZNA 4M54A 1VLLA 4MDHA 4UUMA 4WCFC 1YH3A 2NVWA 5I9MA 3S2EA 2IEDA 3UUWA 1EVYA 4ND2A 3UF0A 1F8FA 3D5QA 4DVJA 3VZQA 1HL3A 1NM5A 2ET6A 3VPGA 1QYVA 7ADHA 1JQBA 2JKVA 2VZ0A 4CM1A 1K5HA 5THKA 3DR3A 1OAAA 3AI3A 1Z7EA 1Z74A 5CPFA 4FFMA 1ZJZA 3FN4A 1VL8A 3D4NA 4RDIA 5KJ6A 1LSSA 3GRKA 4ONEA 5A5EA 3AI1A 4RGBA 3X2FA 1R66A 1R0KA 1C1DA 1GUZA 1V3UA 2BELA 2AQIA 2E4AA 3OBBA 4PG7A 4G5HA 4LCJA 3WIEA 2HLPA 4GMFA 4J2OA 4YJFA 4E2XA 4JBIA 1EE9A 4ALJA 1DFIA 4FR5A 4J4TA 4BV8A 2G1UA 3HUDA 2Q1TA 3FNHA 4D0SA 3PHIA 4NQZA 5EN4A 1E5LA 2CVOA 2GZ1A 3V1YA 2D8AA 4NHEA 4CM4B 2OP1A 4RVGA 4AJ4A 2D1YA 2RHCA 3H9JA 4FC6A 5EL0A 3E5MA 2J3HA 4GGPA 1LA2A 5CFZA 1D3AA 1DDOA 4IM7A 1LDBA 3GEGA 1M6WA 5EINA 1TXGA 3LT0A 3MCVA 4PN3A 1P31A 1U3TA 1V3TA 2FP4A 3VVBA 3IKTA 3KLPX 2YQ4A 2I9PA 1MG5A 4WJZA 4NR0A 3WGOA 3GMSA 5JO9A 3W6ZA 4U6QA 3RU7A 3Q2KA 1I2ZA 2FN7A 1QLHA 5TQVA 4XR9A 2FRDA 4N18A 5T67A 5DT9A 3HNPA 1B8PA 4N7RA 2RAFA 3BMNA 4XYBA 3DMTA 4KQXA 1NWCA 1E7SA 2E48A 1JN0A 3G1UA 2BGMA 1S7CA 1A4UA 3I4CA 1GZ3A 1EUCA 2DBVO 3AWDA 4QSMA 3BIOA 3BA1A 4O63O 5JSFA 4ZRNA 3GAZA 3EVTA 4HADA 1QORA 1DJQA 1MC4A 3GDGA 2DFDA 2UYYA 1ORRA 4EJMA 4FFRA 2D3TA 1SPXA 3NAQA 3SJ7A 1F14A 2R00C 3PRJA 2CFCA 1GV0A 3WGZA 1YJ8A 4DRYA 3ZWXA 3PVZA 4QX6A 1DIGA 1E92A 1HEUA 2C7VA 2X58A 5JLAA 1Y8RA 2O7SA 4BNWA 4YRBA 3V5NA 3A1NA 5DOZA 3LK7A 1PU2A 3JQFA 3VPHA 1A7AA 4BB5A 2VHXA 1ULUA 3GG9A 5IFLA 1P1RA 1YONA 2NTJA 2H5LA 2YHIB 1I24A 1P0CA 3NT2A 4C4OA 3IP1A 3TN7A 4AJNA 4UVGA 4KUHA 4RO0A 3ENNA 4B7UA 4JBHA 1UDBA 3U3XA 1KS9A 3U62A 1O9BA 1BW9A 2EKPA 1X15A 3AOEC 3CIFA 2I76A 1ONPA 3EDMA 2W2KA 4EUFA 2OL4A 1PL8A 4FGWA 2C82A 1QRRA 2NVBA 1ZVMA 3KYBA 2CF5A 3NTQA 5I7SA 4R3NA 4TZKA 3JQAA 3ZNOA 2NM0A 2Q4BA 2V65A 1LQTA 2YZ7A 5KVCA 4J0EA 4R9RA 1I0ZA 4Q3CA 1WMBA 3H4VA 3MOGA 4TWRA 2DC1A 4X54A 4PFJA 1YS4A 2EW2A 3GUCA 2J3IA 3ROPA 5I8ZA 2UV8A 3JD1A 2DTEA 1C1DB 3HDHA 2O3JA 3FSRA 1DHTA 3ZDFA 3JSAA 3AI2A 4JIGA 3ZI0A 1IE3A 1WDMA 2AA3A 4YJFB 3WYEA 2WE8A 1AHIA 2DBQA 4TRMA 4R41A 1VE9A 4GX2A 3ONFA 3R6DA 4YAGA 4J4HA 4JXKA 1WMAA 4ID9A 3EW7A 1JW9B 4PZEA 5BNIA 4OL9A 2VTEA 3I9NA 5I7VA 3FPLA 2UUOA 1DLJA 1LEHA 4ZQFA 3OIDA 2A9FA 2DUUA 3UXYA 1VKNA 4AL4A 5LC1A 2XPCA 2CDAA 1JU9A 4B7CA 3U5TA 3C8MA 1E3JA 1EFKA 1P0FA 5IZCA 2I6TA 1SMKA 3S2IA 1BXZA 3WNQA 4DQVA 3PQDA 1C0IA 4ALNA 3JQ8A 4PLCA 2GCGA 2GF2A 3QW2A 3NTOA 1T4DA 3PHHA 4DPKA 5COQA 2YDXA 3RFXA 1HDRA 2VHVA 1DIAA 4IUYA 3ZHYA 5JMWA 2VRBA 2OFPA 3PHGA 4I5DA 4JX8A 4IJWA 5A1TA 2O4UX 4A0SA 3VZPA 4YRDA 1NBOA 1LNQA 3PTZA 1L7EA 3I23A 4OXKA 4FFNA 3RUFA 4BNNA 1OC2A 3WJAA 4BNFA 2HAEA 3JQGB 4Y8VA 4CM3A 1UJMA 3LU1A 4WNCA 5F1PA 4BNHA 5HS6A 1HDXA 1LJ8A 3ZU4A 4DPLA 1U2DA 2IYOA 4XYMA 2EG9A 2J5QA 2POQX 3AJRA 1H6CA 2BHLA 4LRTB 1Y8RB 4DUPA 3EK2A 1MX3A 1GQ2A 4CV2A 1RM5A 3RWBA 4DIFA 2GPTA 2OBYA 1VSVA 4B4VA 1T2DA 3JD4A 4HBGA 1HTBA 3BMQA 2PGLA 4P4GA 4DGSA 4NU5A 4CMAA 1QLJA 2X5OA 1TT7A 1VRWA 3QVOA 2NV6A 5A06A 1F8GA 5GY7A 4GMGA 3S1LA 4AJHA 5AYVA 1NNUA 5IN4A 3PEFA 2V7PA 4Z9YA 3VZRA 3SJUA 1C1XB 4U0KA 4E2YA 3T4EA 3MZ0A 1QYWA 4D41A 4R16A 1I01A 5K6AC 4PRKA 3ZGYA 1J6UA 4RPKA 4CR7A 2D4AA 3DHNA 5BNFA 1SOWA 4PLWA 4CM5A 4NH4A 2X0IA 2V6BA 1HF3A 1TEHA 2JHGA 3B1JA 3DONA 4IJUA 1CRWG 3G79A 2WE7A 2B37A 1KY5A 1SB9A 5TGDA 4FJ1A 4TRRA 5ITWA 1UXJA 5H81A 4URFA 2VOJA 1NFRA 4IDBA 6ADHA 1NR1A 2IZ1A 2GN4A 1X0VA 1XR3A 3KEOA 5B4TA 1ULSA 3RKUA 1X0XA 1H9AA 3I4FA 5TRTA 3Q9NA 1SZJG 2D5AA 1ML3A 1CYDA 4GVLA 4YEDA 1P3DA 5DOVA 3R0IA 3GG2A 3AY6A 3IP3A 1Y7TA 1HZJA 1YB5A 3WDSA 1Y8QA 4YCAA 3INGA 1Z82A 3E03A 3LT2A 1ISMA 2AHRA 4HY3A 4R9SA 4MP8A 3OP4A 2J8ZA 3P7MA 2OOSA 1NFFA 4K9DA 3FTPA 4GKVA 4IGFA 4TKMA 4I08A 1M2WA 3F4LA 1O89A 4GX5A 1O0SA 1ZZEA 3ZWPA 3LF2A 1Q0LA 1R4NA 3NGLA 2VYVD 1MP0A 1P33A 5FI3A 4IDCA 1PGJA 1F17A 3Q3CA 3KLMX 1P77A 3ZWWA 1GUFA 3HJAA 3DFZA 2ZB7A 2HJSA 1OMOA 1R6DA 3O8QA 5JXWA 1I32A 4B3HA 3DZIA 3WICA 1UXIA 5T8KA 2BFAA 4NBTA 3P2OA 3TZ6A 1UZLA 5HBRA 4NK4A 5A03A 3PZBA 1NVMB 1MV8A 2ZTVA 3TWOA 3WMXA 3PGXA 4PLHA 5T5QA 3WYBA 1AGNA 3DQPA 3D7LA 1E3LA 2ZIZA 3PQFA 4CL8A 2UDPA 1E0DA 3AOGA 3BMQB 2HMWA 1PZEA 1HSOA 3OQ6A 4KTTE 4WOKA 2JD2A 3UCEA 3ZWAA 1EUZA 2P5YA 2PD6A 3UN1A 3OA0A 1JAXA 3UCFA 1LDMA 4I1IA 2NSDA 1A71A 1U7TA 1F12A 2OMEA 1W0CA 4KWIA 5JYFA 3VTFA 1IZ9A 1FMCA 4A2CA 1PJLA 2PZLA 1Q7GA 5CP8A 1XKQA 1KVRA 3IL2A 1MFZA 1H0KA 3EC7A 1LDEA 5DP2A 3AM4A 2GYYA 3M2TA 2PGDA 1V35A 1KVTA 1WNTA 3HFGA 3ZWNA 4H16A 4MP6A 2B83A 3ADOA 2BI7A 2WEKA 1F06A 4BGUA 3CZRA 4JJFA 4EW6A 4XR4A 4FFPA 4DMLA 2P4QA 2VWQA 4BNKA 4BMNA 4J7CA 2AQHA 4JJIA 5BSFA 2FR8A 4PCVA 3GRPA 2QRKA 1F0YA 3KOUA 4WLEA 5A4DA 1YB4A 3E5RA 1NQAO 1PGQA 1UXKA 3GNQA 3UFXA 2OO5A 2FPGA 1ENPA 2FR0A 4GSLA 3CE6A 5JAZA 2AMFA 1SC6A 5ITVA 4DL9A 1CQJA 4ND3A 5B37A 2PZKA 5L7YA 4PZDA 4MKXA 1X1EA 1G6KA 1Y8QB 5EERA 3MJVA 1DC3A 4WCDA 2R2GA 4G81A 4OXYA 1BMDA 3QWHA 4N5MA 5I7EA 3P5SA 3QLJA 5T57A 1H2HA 5A04A 5A9SA 3DB2A 5IDWA 2CVZA 1G0NA 1HKUA 4XYLA 4W6ZA 4RVFA 2BFOA 3DZGA 4U5QA 3FWZA 4YR9A 4BO6A 1DHRA 3AM3A 3F4BA 3BTVA 5I8WA 1P1FA 1R4NB 3GUYA 2YY7A 4RORA 1R16A 4YAEA 5B12A 3INTA 4L4XA 4NI5A 1XG5A 2WTBA 4LSWA 1B3BA 3L4SO 3FF4A 4LISA 4P4NA 3LLVA 3O8QB 3SVTA 1LX6A 5JC1A 1GZ4A 4R1UA 4CQMA 5ICMA 2JHFA 4R1NA 4EDFA 3WGQA 3D64A 4PLGA 1SOVA 5T6BA 5H82A 3GMDA 4QUKA 4HNHA 3LT1A 2CUKA 5JDCA 1CEQA 4UREA 2IE0A 4D3FA 1DC5A 3SLKA 3ROQA 3IC5A 1WPQA 1GYRA 2W90A 1WDLA 4HWKA 3ZNNA 4OAQA 1NR7A 1LTHR 3GEDA 5GZ3A 4OMUA 1ID1A 1RM0A 1NPYA 4DTIA 5DBFA 5G0UA 4XQ9A 4FOOA 4CMKA 2ZTMA 2QRJA 4BO9A 5TJ9A 3N7UA 2QYTA 5L45A 2QQ5A 2Q99A 2HRZA 3I9LA 4Z0HO 5KKCA 3RQSA 3H2ZA 1PS0A 2GZ3A 3NT4A 2EERA 1GY8A 1CF2O 1MGOA 1Q0HA 5DBIA 1WLYA 2PGJA 5BSEA 3ETEA 4MVJG 4WE3A 3FNGA 3VOSA 2WM3A 3QWIA 3QWBA 3PHLA 2LDXA 2I99A 3JQBC 3OH8A 2F1KA 1IPFA 2Y93A 2X0JA 3TQHA 3GDFA 4Z9XA 4WLVA 2Q1UA 2ZYDA 2C5AA 3GQVA 4NIMA 3Q0EA 3IMFA 4U8GA 2EJVA 5L7WA 2Q2WA 2NU9A 3I9KA 1DAOA 5C7OO 5T64A 3PIDA 4QXMA 2IXAA 4YBZA 3QSGA 3R3JA 3GGOA 1K6XA 3QQPA 5TLSA 1MLDA 1J4AA 2Y1CA 1FDUA 1KC3A 3NDRA 2WYUA 2RH8A 3ZV4A 5DCWA 2VNAA 2PD3A 1ZK0A 1FXSA 3ENKA 3AUTA 4BIIA 3WJ7A 2HK9A 3KYDB 4PRLA 4E33A 1ZK1A 2ZCVA 3CMCO 3FTNA 2QIOA 3TJRA 1Z7BA 5L7TA 1ZMOA 3H3JA 3PLRA 4UEJA 4BO7A 1YXMA 2AG5A 1N9GA 4BO0A 2W4QA 4PLYA 2VRCD 1XU7A 3IJRA 2VT2A 3VH2A 5I9LA 1E7WA 5ER9A 2EKQA 4EEXA 3VH3A 1H2BA 2BH9A 1I3KA 2JFHA 5A9SB 2DPGA 2NVUB 1HLDA 4ZD6A 2SCUA 3HQ4O 1U2GA 2YHUA 4HNGA 3UH1A 3QVSA 5U1PA 2PKQO 3QJ5A 4EJ6A 4MJLA 5G0SA 4XEHA 1A9ZA 4YJDA 5COAA 5JE8A 1Q0QA 4HX5A 4RVHA 4R5HA 4IQ0A 1SNYA 3TDKA 1EQ2A 4WPGA 4LVCA 1KY4A 4TRJA 4CR6A 4GKBA 3DZKA 4RQUA 4YAIA 3LC7O 4A7PA 3PWZA 5JW6A 4ZQGA 4CQMB 4IDDA 1R4MA 4XGNA 3BYZA 1HE2A 1ISIA 1GEEA 1RPNA 3HHPA 4Y9DA 4DYDA 4MVJD 3E1KA 2BI8A 4RPGA 4B8WA 2XXJA 4ROSA 3GPDG 3AY7A 3KSZO 3UCXA 2VZ8A 4WLFA 2C29D 1QV7A 1X1TA 3NEPX 2WD7A 1BVUA 2B35A 2GN6A 4K1LA 1RJWA 2HU2A 3WX0A 3JQ7A 3K92A 1ZIDA 3G49A 3ST7A 1KIFA 4YAJA 4XJTA 4L4SA 3DHYA 4D7AA 3DMTC 1PJSA 7MDHA 3RUCA 2QW8A 3E9QA 5CEJA 4WNIA 2VYVA 4GX1A 1DOHA 1LC0A 1VI2A 2B4QA 4R01A 3K9QO 4H7PA 3LVFO 2YHIA 1EDOA 1KEWA 4BO5A 1KEVA 2VWHA 5ENVA 1NX6A 3GF4A 2FSSA 3GA0A 6LDHA 1E6WA 4G2NA 4WLOA 5DN9A 4OH1A 3EZLA 1DC6A 5K0ZA 1QYCA 4J91A 3KXDA 2FPPA 4MIYA 3LQFA 1ISGA 3RC7A 3JQFC 4C7JA 3L4BA 3RJ5A 4JP2A 5EPOA 3SC4A 1ZCJA 4PLVA 3A9WA 4U6SA 2EP5A 3R1IA 1ONOA 3PJFA 3RUAA 2ILTA 4ZICA 3PWSA 3GR6A 2GRAA 2C54A 1YO6A 4J90A 4LRSB 4DWVA 2DTXA 3FR7A 4OOFA 4NFSA 3IQDB 3OJEA 3RAJA 4HFNA 3EZYA 2ZK7A 2ZJ0A 4E4YA 1XIVA 4DXHA 3ZWOA 4CLHA 1HE5A 4IXWA 1ENYA 4MVJI 4XYEA 3E6AA 3OECA 4UVIA 3OICA 1PJ4A 2QZZA 1N9GB 1O95A 2LDBA 4NG5A 5F3RA 1YE3A 3OM9A 3RFVA 4INAA 1EVJA 3GOHA 2F00A 5AXBA 4WUVA 1OI7A 4BNYA 1E1NA 4RV9A 1MC5A 4JLWA 1IYZA 3AY3A 4NMHA 1OOEA 1AUPA 1NAHA 1ZK4A 3FCOA 3KZVA 5FEUA 2PFGA 3JYOA 4QT0A 4RVDA 3GHYA 4QEDA 3KETA 3K73O 4ITUA 2PK3A 1CETA 4EJ0A 1EBFA 4L0QA 4DLLA 1R4MB 1CDOA 4J43A 4J1QA 5IZCC 4F3YA 1GCUA 3ASUA 4DLAA 4CMCA 4BO1A 1J49A 3RUDA 4AJLA 2BF7A 3GHHA 3NT5A 1AHHA 4J2HA 4FIZA 3PXXA 3JQGA 3ITDA 3VTZA 3TZQA 3PQEA 2WD7B 1HLPA 3ETGA 3F1KA 1GYQA 3JQ7B 2WMDA 4NZ9A 1DEHA 3ZU5A 2DFVA 1I5RA 5AXDA 1N2SA 4AJEA 3OIGA 3SLGA 3F1LA 1YQDA 1RYEA 1MXHA 1Q7CA 3S2FA 3FNFA 2O23A 1ONNA 5KVSA 1B8VA 2X9GA 3UKOA 2HCTA 3F46A 1I3NA 4Q3BA 2FZEA 4W7IA 5U4QA 3U0BA 4YWJA 1T25A 3WOHA 4ZQHA 1ZSVA 2NU7A 2AXQA 3F6YA 2J6IA 4EZBA 2G82A 3ORFA 5JS6A 3TOZA 4FDAA 3WS7A 1C1XA 3LLSA 3DFUA 1LC3A 1J5PA 2I3AA 3ZWMA 1E1KA 3DDNA 4YXFA 5GMOA 4CUKA 4OQZA 1FK8A 4MVJH 2EF1A 1VSUA 4BNVA 3QVWA 4Z3DA 1E6EA 1HDZA 4I5GA 4TVOA 4FJ0A 1GPJA 2C2YA 4PG8A 1KYQA 1M6HA 3MJ4A 4NJOA 3A28A 3PHJA 3TL3A 3JTMA 2AE2A 2OORA 1QXSA 3ZHZA 2IYPA 4UUNA 2X0NA 1Y9EA 5JBIA 1IZ0A 1NQOA 1LLCA 2FMUA 1X7DA 2Y1GA 1UXHA 3F5QA 4Y6RA 3PDUA 5CHEA 3E18A 1E6UA 1DO8A 1C14A 4EI2A 1W8DA 2FHSA 1EEHA 4CODB 1T1SA 3F3SA 4ZHSA 3WGGA 2I3GA 4CQMD 5IJZA 3RC9A 4UEKA 1O5IA 2BGLA 3WBFA 1JAYA 4BNJA 4PGFA 5G4LA 1E7MA 3H9GA 2X86A 2X4GA 4CL3A 4ILKA 4WK6A 3RUHA 1KEUA 2ZB8A 2RBEA 1V6AA 3RVDA 1LDYA 2OHXA 3H7AA 4GX0A 4L76A 3KSUA 2C5EA 3CZMA 1I2CA 3ZHXA 2I5PO 2ZKLA 3KHUA 2H63A 1D4FA 1ZK2A 5J23A 3ULKA 2E49A 5L95A 4UAGA 1PJ3A 3TNLA 3WBBA 1BDBA 1OZAA 4I5FA 4RF2A 1YVEI 3OA2A 1GFSA 1PZGA 3GVXA 4RPHA 4UVHA 3OFSA 1HE4A 5A3JA 5I7FA 5CEFA 3E9MA 4OO3A 4RL6A 2Y67A 2IDZA 1MA0A 1ZEMA 1E77A 4UULA 1GU7A 4Z6KA 1SEPA 4MIEA 5DBGA 4GWGA 3ONDA 3KSDO 2AQKA 3TOXA 2DBZA 3WTBA 1TVEA 3IOYA 1E3IA 5F5LA 3ROKA 1JLLA 1U3VA 5JAIA 3HSKA 1EVZA 3TL2A 4BS9A 5U9CA 2VRCA 3TFQA 2X8LA 3V1UA 3D4OA 1NTOA 3V2HA 5DDIP 3BAZA 4F46A 1EVIA 2C7GA 4MOWA 1GADO 1CWUA 3GNSA 4BGIA 3FBTA 4XD2A 4DIBA 1PQWA 9LDTA 1YL5A 3I5MA 1MXFA 3PFWO 3BTOA 3HN2A 5H83A 5CPBA 1T26A 2JL1A 4JBGA 5TT1A 1Y81A 4UVDA 4I9NA 3PJGA 1E5QA 1DIBA 3Q2IA 4YT8A 4M87A 2P9GA 3PYXA 3E82A 5T8KC 1XLTA 1SCUA 3SC6A 2Y1DA 2PKQP 2QG4A 2ZJ1A 3CSDA 1DLIA 4Q39A 1N7GA 3ZWCA 2C07A 1WXDA 2DVMA 3PYLA 1QR6A 5TJHA 3IUPA 4LN1A 4MVJA 2WYWA 4JJGA 2GLXA 2HO5A 1DB3A 3S55A 3NYWA 1TI7A 3TSCA 2PV7A 5A3VA 4Q3DA 3BMOA 1NYTA 1X14A 2I66A 3BHJA 3GN1A 4FBGA 3BHIA 4KZPA 4PLPA 4GAEA 1HXHA 4AJJA 4E31A 1GAEO 1A9YA 3BZUA 2EKLA 2GGSA 2ZTLA 3WSVA 4WLNA 4LSMA 5DF1A 4ZQEA 1ISFA 5IDQA 3SBOA 1VPDA 4BKRA 1QG6A 2P4HX 3GVCA 1SEVA 2EP7A 2O3UA 3GFBA 4W99A 3DTYA 2G0TA 4JROA 2VOEA 3DBRA 3RIHA 4RVUA 4RJTA 3ANNA 1VL6A 3GY0A 4DBVO 4AJIA 4D44A 4AVYA 3O9ZA 3JQ6A 4ZN6A 1NHWA 3B20A 1ZSNA 4FQ8A 3QA9A 2O3RA 2RCYA 5B4VA 4CLDA 4C7KA 3V2GA 5FF9A 4O6VA 5CAEA 3ZV6A 1LQUA 5A02A 1O8CA 1U8XX 2CY0A 4XRRA 2ZB4A 3IS3A 3RFTA 1P74A 2V6GA 2CDCA 3DC2A 4FFLA 2YQ5A 3DZFA 4E32A 4DC1A 3EMKA 2VCYA 3LZ6A 2O50A 1PJBA 1QV6A 3AW9A 2OZPA 3CEAA 3O38A 3QWAA 1GL3A 4KTVE 1XGKA 2IXBA 4W82A 5HWSA 1BSVA 4YJGA 1RM3A 4J9VA 5LDHA 3DAGA 5FWNA 3LF1A 5M6DA 4XGIA 3DWFA 4WKGA 2CMDA 1UH5A 5KJFA 4CMEA 1M66A 1PZHA 3VKVA 3VH1A 5JYDA 1I33A 1WDKA 1PR3A 3JYPA 4YVFA 4U7WA 5IAAA 1WZIA 1DBVO 4WEQA 3GN2A 1YDEA 2ZTUA 4OJNA 3PFFA 3ANMA 3RBZA 5IXYA 3QE3A 5C3MA 2PLAA 5DNAA 2Q3EA 3NV9A 1HDCA 1I3MA 1W6UA 3GGGA 4P38A 4E12A 4IINA 1M76A 2CF6A 3D1LA 2O7QA 3C7DB 4Z0PA 5TS3A 4RLHA 1NASA 1V8BA 2A4KA 1CIVA 4F6LA 1SBYA 2YW9A 3OHSX 3OJLA 4E5PA 1N1EA 4G65A 4AJ1A 3D5TA 3NRCA 1B2LA 2JD0A 4L73A 4BGEA 1LRLA 4RQTA 3U4DA 3ZV3A 4KDEA 4Y98A 5JDCC 2JAPA 2IZZA 5A9TA 3AUAA 1BXKA 4CV1A 4XRGA 1DIHA 2B4TO 4JK3A 3L6EA 1X7HA 5DCYA 4GQAA 3U4IA 1ARZA 2DM6A 5JPIA 4Q3NA 3BMOB 1PTJA 5CDYA 2Y0EA 2FSVA 1UP4A 4QO7A 5ILGA 5G0VA 4RPJA 1PJQA 3QIVA 5ILOA 3PYMA 4IS2A 3MJSA 2FPIA 1VC2A 4IMPA 4P22A 4BKPA 1FF9A 2X1HA 2PA3A 2RIRA 3ZZNA 2P9EA 2DUWA 4B3IA 5G4KB 2B4RO 4KOAA 3DBLA 4TRNA 3DHEA 3RC1A 1Q1NA 1L1FA 3GH3A 3MJEA 3ABIA 3KEQA 4BUCA 4BKQA 2EEZA 4H15A 2E82A 2V6MA 4CLOB 1AN9A 4IS3A 3DBRB 3OJ0A 5C7LO 2HJRA 4FCCA 4R69A 4QTZA 2B36A 3PLNA 1HYGA 4BO4A 3I52A 1R37A 1IB6A 3KYDA 3KB6A 2GERA 3K8ZA 2H6EA 1R15A 3EYWA 3JQDA 2CVQA 4NFHA 4ZJUA 1E1MA 1WAMA 3FD8A 4PVDA 4A27A 4Z3KA 4NFYA 4QECA 2EW8A 3JCZA 2IZ0A 4EYEA 3A4VA 4QQRA 1B3RA 4ALMA 3DOCA 1O94A 4W4TA 3I9OA 5CEEA 4FOSA 4ALLA 2PTGA 2HDHA 2FZWA 3DZHA 4IDFA 4Q9NA 3H5RA 5AXCA 2NVUA 3WG9A 1QSGA 2YYYA 1UDAA 4JQCA 1T2AA 2GO1A 3V2UA 3VAZA 5L51A 4OIMA 1NQ5A 4MO2A 2EJWA 3M1LA 4AJ2A 4YJGB 4Y67A 3RCBA 1NAIA 1KC1A 5JCJA 1DIRA 2DBRA 4PLZA 4P8RA 4IDGA 1MUUA 4JP3A 1KVSA 1PQUA 1TA4A 4J6FA 1N92A 2BGKA 3ON5A 4OSPA 3RROA 5EQFA 4GPD1 2A94A 1XWFA 4K6CA 3RC2A 1QYXA 1YKFA 2P68A 1EUDA 3UW3A 3ASVA 4EUHA 2O2SA 4PG6A 3V8BA 1LLUA 3CMMA 3ICCA 5ER6A 5CDSA 4IPTA 4DMMA 4MKRA 3I9MA 3ZN2A 3C85A 1IOLA 3JQ9A 4OM8A 4NBRA 2HK7A 1HDOA 1ZXBA 5KJ1A 3VHRA 1NQTA 4DA9A 1EK5A 1AE1A 3H2SA 4J7UA 4D45A 1B0AA 1VJ0A 2WYVA 1B16A 1PL7A 5F21A 1TB4A 4FJ2A 1NVTA 1U5CA 3BXXA 1GZ6A 1VJTA 3ROMA 1LRKA 1OBFO 8LDHA 1D8AA 4ND1A 5L4SA 1BG6A 1N7HA 3MTJA 1BDMA 1XELA 1JVBA 1Y9AA 3UOGA 2UUPA 3E9NA 2GNAA 1NWHA 1UXGA 1I30A 2O2YA 1QYDA 4PG5A 1YQXA 4J1NA 3G0OA 3W1VA 1Y5RA 4F45A 4R3WA 4IY1A 4E13A 3AU9A 3EGOA 3NDIA 4D46A 1FDSA 1LUAA 4II3A 3ZCXA 4YB8A 3DBLB 1YJQA 1A5ZA 3TZHA 1TT5A 3ZW8A 4ZQBA 3DOJA 2XOXA 3NGXA 1HWYA 3GAFA 4PIVA 3TFOA 4R5MA 1BXGA 4JGBA 2XXBA 2EWMA 3A14A 3LYLA 4PLFA 3WFIA 1N5DA 2XAAA 4Z9FA 2PNFA 1DC4A 1IHXA 1XQ1A 3WWZA 3C1AA 2UVDA 1R0LA 3DBVO 1ZW1A 4R1SA 2YFQA 3KBOA 3L4BC 4NK5A 1JTVA 2DPHA 4YYZA 3EAGA 2I67A 3HB5X 4YACA 4LVUA 4Q3EA 4RDHA 3TZCA 2VHZA 2HK8A 2PWZA 1D1SA 1GYPA 4MPDA 5TF4A 2AE1A 2QX7A 4WGGA 3FWNA 3PJEA 4BGVA 1BWSA 5F5NA 3LC2O 4W7HA 2IRWA 3DOOA 4W9NA 1U4SA 4CLRA 3FNEA 2D5CA 3I6QA 3ZW9A 1WP4A 3WGYA 4XIYA 1Z75A 3HADA 3STHA 1DRWA 4FD3A 5KKAA 5COBA 5L4LA 2TMDA 3U4CA 2BMAA 3H5NA 4JNKA 1JKIA 3E8XA 4DQUA 3VH4A 1UDCA 2GUGA 4KUGA 1Z6ZA 1HDYA 2IEBA 1IHYA 3O4RA 2EIHA 1ZEJA 5ES3A 3H9QA 4EITA 5L9AA 2OBNA 2NU6A 4LK3A 4RF3A 1YQGA 4Y6SA 2JFFA 3QVXA 3DO5A 1JVSA 5JO0A 3F9IA 3KUXA 4QFCA 3ZNQA 3U09A 5MGBA 5GZ6A 1LSJA 4PVCA 4XDYA 1SAYA 4WASA 3WSWA 3Q11A 2X23A 3C24A 4NBWA 3Q1LA 3DEYX 4CQLB 3GPIA 3ONEA 1PWXA 1JWBB 4YQZA 5FFFA 4AICA 3MJTA 4A5OA 4ALKA 2O3QA 3I1JA 3WNVA 3L6OO 4BNTA 1UUFA 2B5VA 1HYEA 2AEFA 3WGHA 4YPOA 3HDJA 2VYND 1K89A 1UR5A 4FFOA 3GVIA 1DRVA 1U7HA 2Q2QA 4IIUA 2XF8A 2Z1MA 3GK3A 1C0PA 2VWGA 3NDJA 2AG8A 4DC0A 3GGPA 3MJCA 5DULA 5KNLA 3ZV5A 3COSA 1ZMTA 5IZ4A 1GDHA 3K31A 2O3SA 4TVBA 5MDHA 2NADA 3IDSA 2W2LA 5IN5A 1PIWA 3HZZA 4RVSA 3QRWA 1TT5B 1P45A 3W4IA 4BQRA 3AK4A 1HE3A 3DL2A 3MWDB 1BXGB 4R68A 4BVAA 1ZFNA 1FDTA 4PZCA 2TMGA 3L0DA 1LU9A 2ZCUA 3S2GA 3ZWVA 4B4OA 4NJMA 5HA5A 3JYLA 2VNSA 1AXEA 2VTDA 3DZJA 2UAGA 3KM0A 4RZIA 4UEOA 5KJEA 2I65A 3I83A 4PG4A 4JN6B 2JCXA 4EUEA 4O59O 4NBUA 3BHMA 1NP3A 4J3FA 1QMGA 5ICSA 4KMSA 1YDWA 3C1TA 2OXIA 4BMSA 3PZRA 2PZMA 3D3WA 4FSHA 1B15A 2X22A 5EIOA 4XWYA 5G0TA 1DJNA 1IUKA 2DTDA 3QY9A 3W6UA 1YL7A 4ND5A 2RHRA 5KVQA 2W98A 5T73A 2Q2VA 4YT5A 3AM5A 4LMPA 1C0LA 1KETA 2H9IA 3WMWA 1QP8A 1U1IA 4BKOA 5THQA 2VHYA 1V0JA 5IDXA 4IXTA 3QVTA 1CJCA 3MTGA 1IL0A 4XQCA 4CLRB 1IPEA 5EQDA 5J9GA 5JDIA 2NTNA 2AW5A 1I8TA 2YJZA 2GD1O 3VPFA 4TZTA 3CPSA 2YV2A 1Y6JA 5EESA 4YTEA 1ADFA 5DZSA 1BTOA 5B4UA 3PWKA 4L9RA 1IY8A 2Q1SA 3JV7A 4HP8A 3IKVA 4KQWA 2Q4EA 4BNLA 3V1TC 2ZYGA 4GH5A 2J3KA 2E6UX 1LDNA 2D59A 4CM6A 5IG2A 4Q3AA 3W8FA 1BRMA 2X5JO 3B70A 1HZZA 5A05A 2NNLD 4D0RA 2G17A 1ZH8A 3ZU2A 2Y05A 5KWEA 2ZQYA 3H9UA 5KVVA 3AFMA 3IIEA 5TIIA 1WVGA 4RZHA 3SXPA 1MB4A 3RSHA 4BNGA 1A27A 3WIDA 4CMIA 1FDVA 4BO8A 3RD5A 4ZVVA 4DYVA 4M55A 3WQSB 3RBXA 1P44A 2NUAA 3L6DA 3OSUA 4BHTA 3W8DA 1RKXA 3UHAA 2NQ8A 3MOIA 4M1QA 3NUGA 4HFMA 4J0FA 1Y1PA 3CUKA 4WCFA 4BNUA 4GGOA 2JCYA 2FWMX 3CKYA 3QWFA 4O5OA 3EVNA 4R54A 3IAHA 4CR8A 5IXSA 1VL0A 3PDJA 1E3WA 5F1OA 1PGNA 4CUJA 2HSDA 3AU8A 4CJXA 2EV9A 2PKRA 2VWPA 3N58A 2VUTA 5G0WA 2JD1A 4DLBA 4HV4A 2DQ4A 3B1KA 3U9LA 4E0BA 1JKFA 4IQ8A 2V6FA 2Z5LA 3ICPA 4YJHA 5CG2A 3GZNB 2PZJA 4IDAA 5BR7A 1XHLA 4J49A 2Y99A 1W4ZA 1X7GA 2EHDA 3H9EO 2NQTA 2VHWA 4N5LA 4EGFA 4YRAA 4HFJA 5KIAA 3U4HA 1K6IA 1PGOA 1XYGA 3OQ1A 2P91A 3H3FA 5L40A 4OGWA 1PEDA 4NJMB 2G5CA 3ANLA 1MG0A 3T7EA 5JCJD 3KRTA 4L8VA 4P4LA 4MKZA 4IJKA 4XQEA 2QRLA 1T24A 1XCBA 5A9RA 5AOVA 2OUIA 4LW8A 4B8ZA 5A5FA 1ZK3A 3D3WB 3HDYA 4ALIA 1E7YA 4B4UA 4FC7A 4BL5A 3H5AA 3FPCA 2A92A 2GN9A 4HXYA 4M86A 3CINA 2RH4A 4AFNA 4CM8A 4RLSA 5IF3A 1YGYA 4XDZA 3C7CB 4BOYA 3FR8A 3W4JA 4IIVA 1KEPA 3GVHA 4J4BA 4CMBA 1JKJA 1C3VA 1FJHA 2FOIA 1A72A
chains in the Genus database with same CATH superfamily
3SFVA 1M8KA 2C7RA 1WZEA 3C5HA 4JL6A 2PWPA 1YASA 2YUTA 1U9YA 1WW8A 2BRUA 3ETNA 4K26A 1V16A 1UINA 4RSRA 1IBSA 2BBSA 2WDPA 1H94A 1KZ4A 1FXWA 1XZIA 3B85A 3PPIA 3QUSA 1T1RA 1H1LB 5AXAA 5H80A 1R6TA 4K28A 4OXNA 3NKVA 3QVKA 1DPGA 3DT6A 3KHSA 4GR5A 3SOPA 1NLFA 4ARUA 2SKDA 1Y5MA 4XB2A 2B1QA 2QF7A 3NIBA 3NIDB 5MN4A 2QPTA 4MHOA 3OC0A 4PV7A 3TQFA 3CUSA 3JQQA 4RACA 3VR3A 4BQFA 2JJYA 4X1OA 5DYGA 4V38A 1NXQA 3OKFA 1DUIA 1ZOLA 5SZJA 3ZHOA 3CX8A 4F9TA 2I2AA 1ADBA 2IW3A 4OSOA 3R5HA 4RXUA 2AOUA 4F8JA 4FS3A 4D9NA 1GN9A 5JD3A 3T4XA 1W48A 4I14A 4D4KA 1L5RA 4ER3A 5G1NA 3U7FB 3FYUC 1NBHA 3D6NB 3PFHA 2GFIA 4MQLA 3MFYA 5E9AA 5KTSA 4OB6A 2VN8A 3BMNB 5I9NA 1PHPA 4Z4QA 3MRSA 3ZWBA 4EFLA 4V02A 3NRBA 1E1LA 4L4UA 1AU9A 1KHHA 1BMFD 1CR2A 1QPGA 2FTKE 2HHCA 2PSEA 3MWKA 1L5ZA 3M5PA 3OTGA 4RJKA 5EIWA 5FPHA 4Y9TA 4NJEA 3X0DA 3OQIB 3NC1C 4RLFA 1FSZA 4N7BA 1NJFA 2X9QA 2R6CA 1EWKA 1MX9A 3R24A 3N8IA 1IWPB 1KBOA 1LRJA 2EIXA 1B74A 2C99A 4DABA 4LZZA 4UQOA 1GDTA 3TVDA 3FFTA 4HYQA 4YA6A 1PR9A 3LHFA 1MJFA 2BFEA 3AVWA 4K0KB 5BNTA 2FQQA 3K5HA 3WQQA 2H2AA 4YRQA 4KODA 2PMKA 3G1TA 1NYRA 4GYYA 1NNI1 3Q88A 4NBVA 2QV7A 4LKOA 4MR9A 3QLTA 4LDJA 1ENZA 3I6IA 3NZEA 4Q02A 4BO2A 4PPQA 1GGMA 2J5RA 2V1XA 3IVCA 4OEHA 4E1AA 5FTMA 3U49A 4O8CA 3ZXYA 4Z7NB 1PW7A 3C4QA 5HCNA 2IS6A 1BW9B 4RSMA 2HQ1A 3L84A 3EODA 4BJ5A 2H0AA 5CDGA 3NHKA 2BEWA 4OQYA 1YS7A 1XTZA 1DFHA 4A6XA 2AK3A 4C7XA 4MI3A 2FSVC 5F12A 1JA9A 5LDGA 1PS9A 4JODA 3RWMB 3TRFA 1I14A 3FTEA 1XLWA 2BJWA 1L8XA 1R7RA 3IXLA 5A5DA 1RI2A 1J8MF 2ZJ2A 3I6MA 4O4LA 1RYDA 4UUOA 1USWA 2OV1A 3AM1A 5L3ZA 4Q4LA 3FFXA 2HF2A 3OTOB 1ZMXA 5CVJA 5CFNA 1I79B 2FMXA 2JC3A 1HETA 1K0FA 3LK6A 1LBEA 2Z1NA 4ZOAA 5HM8A 2QQGA 3V00A 2ZZMA 3ICQB 3WQRA 4I5EA 5IDYA 3MRVA 1OTYA 1VE1A 3D2LA 3DR5A 3OVMA 4OFWA 3K2BA 4D43A 1NJ2A 4EKYA 1XJ5A 2RHJA 4BATA 5BSVA 2YJGA 3UGKA 1K3TA 1PR2A 5D51S 2C61A 4LJ9A 4QTTB 1QAQA 4X6XA 2OSBA 4ASUA 1VM6A 1XRJA 3HVHA 3T54A 1OI4A 4TQGA 1JKJB 3K96A 3OZRA 2N3ZA 4X3PA 5AHRA 3ACDA 3B5IA 4WGFA 1G98A 2O3TA 3BCSA 1PJTA 5CNMA 4B80A 4WL0A 2IOHA 2JBAB 4YRJA 1NMSA 4NEQA 3GXOA 2ZJZA 2FPMA 1YJXA 4PNZA 3AEQA 4NYJQ 4ZZ0A 5KCZA 1C9DB 1DQYA 3I12A 5C1OA 2E0IA 4BVHA 2GZMA 4BEBA 1CC1S 3KQOA 5KTRA 1E9FA 1T15A 3KXPA 4LVNA 4DR3B 2R0QC 3IB3A 4HN9A 4JVLA 3Q8KA 4BC1A 4PGHA 1YQUA 3ZHRA 2NWQA 2I78A 5AM1A 4Z53A 4AG3A 3L9WA 3P19A 2ZREA 1Z6XA 3VDMA 2WJPA 2WUFA 3LPMA 3FWYA 3Q7SA 1JHVA 4Q7JB 3OCVA 421PA 1BVHA 2HADA 3KLNA 3BGVA 1YR8A 3QU9A 3AJEA 4IJ6A 4ZKEA 3H0KA 3EW9A 2L17A 3F5SA 1RKQA 1YBMA 3KR9A 3C97A 3QBJA 4WZ6A 5KYXB 3KEFA 4H3KB 4C4RA 1N2IA 3C3CA 2D8MA 2NXEA 4L1KA 3MT8A 1RR6A 4RF5A 4BAGA 4E5MA 1NVUQ 1OLSA 2QLJA 2XZOA 2YRXA 3O7MA 1GA4A 5A3SA 5AIAA 1XNQB 3O26A 3H2YA 4OKNA 3IVXA 1NZDA 2C3UA 4QE3A 1TKRA 3RI3A 1QIJA 3NOVA 4YJ2F 2YH2A 2OP0A 3K30A 2R86A 5KNBD 4YQYA 1YBVA 1RC1A 1C9JA 3OI7A 3L8CA 1Z2OX 1RPAA 2I22A 5FA5A 3RW9A 1ZNXA 3HXOA 3G5TA 1UKAA 3ZWDA 5H3LA 1W4AA 4D25A 3WR5A 3CXUA 5IJ0B 1TU4A 2YWFA 2CLCX 1SO8A 4Y9UA 1QK4A 4GWKA 4CRWB 1H5QA 1E3SA 4EJFA 5JFGA 5I4CA 4QASA 3KL2A 4BLRA 1VHTA 4DMCA 2DP4E 2O2DA 1J5EB 4Q9IA 2DU8A 3NIFB 3VPCA 2CSUA 4WY5A 5AVTA 3UB3A 2JLCA 4EL5A 1I3CA 3N0RA 4LGYA 1H2FA 1PNVA 4NOKA 5CCXA 2D7CA 4D4IA 2QR2A 1CY7A 1TYZA 2JGMA 2XDWA 3L8FA 3LJKA 3P2YA 4EY8A 3P9XA 2L19A 4V3BA 3TKAA 1TVCA 1Z0IA 4U7FA 3GLHE 4B34A 1YRBA 1PL6A 1EA7A 2A9JA 3Q6IA 4PR0A 2B8WA 4D9JA 1Y4UA 1NXPA 4NH0A 4QUIA 5IYZA 5CDHA 5KWIA 2Q21A 3W8EA 4CT0A 3MT0A 3HJTA 4HKTA 2P75A 3F6CA 2CZQA 1GDDA 1K75A 3HCFA 4MR8A 1H69A 4FQ7A 1S2LA 3NBZC 3JYHA 4IR7A 2BTQB 4D4JA 3AR5A 2WJ6A 1PKEA 2B5WA 2BJVA 1SUWA 2QX4A 5F9FA 2YKGA 1DT3A 5IH7A 2V45A 1LLQA 4F85A 4LGVA 1XWWA 4JC5A 3AF4A 1L4LA 5B3JA 2B30A 2MT9A 4OYLA 4C22A 3DZ6B 1DBSA 1DQZA 1QFXA 3P9SA 4P5PA 5EZSA 2PMEA 1Z68A 3X2EA 2QUAA 3IERA 1VKZA 2XODA 1DRUA 3MD9A 1XTQA 2JA2A 1D7OA 2ODEA 2A33A 2H1WA 3D6JA 3IQWA 3P9KA 4WECA 5DLDA 4EPXA 1QGYA 1DTWA 4MYCA 2OYCA 4QG3A 3N2ZB 4US2R 5DO9A 5AK4A 621PA 2J48A 1C1YA 4F5DA 5F4BA 1JYEA 1PZMA 2C83A 1EP3B 2X0RA 1GV1A 3CLVA 4OB7A 1I2MA 1XLUA 4ACAA 1DC7A 4E5YA 1TM3E 3EHEA 1OZ0A 2GCOB 2YMQA 1ORVA 1JNYA 1U0EA 3GJ3A 3VZSA 5EGSA 5JYBA 4RIGA 2PPVA 2OQVA 2JFPA 2NTYC 4QLBA 2IHNA 2CLMB 1RYNA 2GJ9A 1YDGA 1BGXT 4AD8A 1YWGO 2SKCA 2ZJFA 2ZBPA 4N3BA 1PJ2A 1QHFA 1NRWA 1N4AA 2CFSA 4NLLA 2W11A 3L07A 1LI4A 2RE8A 3KYCA 3WWPA 4B7XA 4ENVA 3THWB 4GLLA 3VGPA 1M75A 2EBWA 2FUCA 1KDTA 2Q27A 1WKBA 5DYTA 1ZRSA 3AL2A 4WRRA 1EESA 5CDFA 3PE3A 1L4NA 1LLDA 2Y68A 3IUEA 1OHHA 4Y6LA 1RQ2A 1SUAA 3CRNA 3KR1A 4UHKA 3TIFA 4CFZA 5HZKA 3HC7A 4E3ZA 2GX6A 5A4FS 3RG8A 5JNRA 3RJMA 2ZAYA 3VKFA 3BMCA 5FLKA 2DWUA 4JU9A 3LUAA 1NBMA 2ISCA 2IODA 2ZRLA 4ZEWA 3QEKA 4PO1A 4RLQA 1L7NA 1KSFX 1KAMA 3PQ7A 4PF1A 3WB2A 3DLCA 1XEAA 3DQZA 1J2JA 4MEJA 2P6NA 3PGJA 3QLUC 5J2UF 3C1OA 3Q4GA 2VR1A 5KPDA 2OYSA 1FX1A 3EY4A 3X2SA 4RKEA 4C4AA 1GU0A 1HQDA 3MT9A 3OCZA 4ABYA 2HNAA 5ADHA 3QBTA 4OLAA 3ELBA 1C3OA 3F97A 3HG7A 4JSYA 5KX5A 3C3PA 4N9QA 2P2GA 1V3VA 2XMRA 1FUEA 4RD0A 4N54A 4XQ0A 3WB0A 4A03A 5HHTA 5LJLA 2WD8A 4O8ZA 1W19A 5CTAA 2V4MA 2JA1A 4MLDA 4BAUA 1JHOA 3BERA 1N36B 3A1SA 2G36A 2Q3JA 5TEVA 4AMUA 4F6CA 3W3ZB 3L1IA 3TZEA 4DRXB 5E4JA 1PYGA 1K6JA 3T38A 2AFRA 1U2QA 1E96A 3EFOA 1OH8A 1XZEA 5KYYA 3VPBA 3NKFA 4IUBS 5DIZA 5C51B 2J5KA 2IVFA 3E1SA 5F7JA 4FGZA 3SQLA 3DF7A 3EAFA 1M5UA 4OXXA 1GXSB 3GT0A 3H16A 4KQ6A 3UWSA 3L4JA 2BGNA 1QIHA 2H08A 2GDJA 3L4KA 4JASB 4HL6A 2WJWA 2ECFA 5C35A 2OGTA 4KXLA 1KVUA 4TYMA 1NMZA 2FW9A 1Q20A 4IDEA 4QBGB 3FI0A 4S3MA 1YQQA 1U9JA 5CYGA 2F3SA 5I9IA 3AVUA 2EHJA 4ER0A 3MAJA 1QBGA 1B8UA 2YXBA 5KNBH 1NVVR 4DLYA 3HFSA 3INRA 4Y2XA 3HDQA 3QU7A 2OZVA 3MS7A 4G0MA 5DCUA 4IRMA 5GZ1A 3VKUA 1XP5A 4HNSA 2PTHA 2QPOA 4WDRA 3QEBZ 3TF5A 1RXIA 1DAPA 4MH0R 1LH0A 1EWYA 2DSNA 3VR3D 4TLDA 1V8ZA 3LUKA 5I4KA 1QF7A 2H54A 2BLLA 2OXEA 2ZB3A 2JFGA 1B7GO 3HGQA 4HDRA 2E1RA 5FIUA 3WGTA 4CLXA 4D42A 1PN3A 1AZSC 2JI4A 3K09C 4OHCA 2VNJA 3E53A 4KH1A 1J0DA 4JVOA 2V4ZA 1PG0A 4P93A 1X1SA 1IVNA 3NHFA 4IOMA 1MVNA 2ZS8A 3O2JA 1PSDA 2LNDA 3N0TA 3H84A 4MCJA 3UJPA 4CKEA 4ICIA 3FG9A 4E09A 5JPCA 2BMDA 3AVQA 1QNLA 2X7XA 4XFDA 1UMDA 1VE7A 2ZPTX 4QPNA 3SU8A 3VPXA 2Q3MA 1KI1A 2PYDA 3DXYA 4GXNA 3WGIA 1VKJA 1XKTA 4A2QA 4OREX 2OCIA 3RUIA 1U31A 2VTKA 3ILSA 3PIRA 1Y3HA 5TQ0A 3CPEA 2O52A 4EYQA 2H00A 2BEJA 4M76B 4PYIA 4TROA 5C34B 3GZ4A 4ARBA 2JIMA 3WO0A 4MW0A 3RUEA 4UXJA 2GEUA 3L82B 1F51E 3HN7A 3OJFA 3M9LA 5LCXA 2XUKA 4M8KA 1GG2A 3SC2A 4EATA 1KR5A 3DL7A 5A62A 2X5KO 2XX3A 4UUPA 2VTBA 2CLEB 3GO4A 2A14A 4IGEA 5DNUA 1CYEA 3PK0A 4I8XA 4ZC1A 3GUUA 4UFNA 4GIBA 4RHFA 1QYIA 1QO9A 2QLNA 5EMHA 5KWJA 4NYMR 1U1FA 2FE4A 5EXTA 3K5IA 3L8ZA 2HMTA 2NU8A 2J6BA 3CURA 1FVOA 1B8OA 1FVHA 4IH9A 1RFGE 3FWPA 4INPA 2PM8A 3ND6A 3R4VA 4CUZA 4DZRA 3RT9A 5PNTA 4F3NA 1BWRA 2O4CA 1Z35A 1AO3A 1C8BA 2QRGA 4WXEA 4OH7A 1CPYA 1L7AA 4WOCA 4CPDA 3EVBA 2X8BA 3ESDA 3I2YX 3DVAA 2N47A 4RTSA 1HZZC 3OCWA 2G76A 3NTRA 1Y1RA 2QTLA 2V9CA 4FGSA 1A7UA 3TGWA 4AKTA 1PZNA 4EZIA 1Z6QA 4R1TA 3VO9A 4WA8A 3T61A 4M0EA 1BX1A 2ZSBA 5GOZA 3E5NA 1F1BA 2PDAA 2VATA 3G89A 3NC0C 4H1VA 1GA1A 4WTOA 2GM9A 2PD4A 4Z7JA 3MWLA 2J6CA 4FZ5A 3GELA 4IQGA 2QN1A 2JZCA 3MA0A 3PSAA 1H3NA 3R23A 2BR4A 4DM7A 1JQJC 1AG9A 3ADPA 4E07A 2RGNC 3DEJA 5TT0A 3AHHA 1Z5PA 4HGQA 4ZRMA 5HJEA 3DF9A 1D2AA 1WB4A 1EZ4A 1I1HA 1ZDMA 1WDTA 2HUPA 1VKHA 2W2PA 3CGGA 3LUGA 4LBYA 3G23A 2NSHA 4UUMA 4DSUA 1WEKA 2PT5A 1AKTA 4ND2A 1CS0A 1KGSA 1HQCA 2ON6A 3MSCA 3ZBQA 4H7IA 3DS8A 5K3AA 3G2KA 3M82A 1Z5VA 4CM1A 3DA8A 5THKA 3E22B 4AY3A 2PSSA 4RANA 1JFVA 5A0VA 5CPFA 1Z74A 1FTQA 2HDNB 3FCXA 2IL1A 4UHFA 4TMTA 3RVLA 5B1SA 2I6GA 1SVIA 4GSYA 2ZBVA 1QKKA 4IVRA 3MCWA 4CKYA 1AA9A 2F1RA 5LMNB 1VTKA 3GP8A 4KPUB 2B94A 2XUHA 2AKAB 4JYAB 1USIA 4J0IA 1C1DA 2AD1A 3PEEA 3OMXA 2QB5A 3IOBA 2HCRA 2FQXA 3SHOA 3STYA 3WIEA 2HLPA 2C4KA 4GMFA 2WZDA 2ZUSA 3FOAA 4PPGA 1W5BA 4YJFA 5A6VA 5DLYA 5CBPB 1OI3A 2I6QA 3KAKA 4ALJA 1FEZA 4D56A 4FR5A 1MW9X 1D07A 2X14A 2CXPA 4FHZA 2I3DA 4S2UA 1OXMA 4ETMA 3FZNA 1R1DA 5LZ9A 1OA0A 3OE5A 3ZDCA 2QP4A 3PHIA 2CVOA 1ESDA 1Z7GA 3V1YA 1T5DX 4NHEA 1B00A 1EQAA 1RYHA 3B1YA 2AF3C 1X70A 2VNIA 3MXTA 5JNWA 1U98A 1UEXC 4DDVA 4AJ4A 4EW3A 5E0OA 5F9MA 4XEUA 4UPEA 4PHCA 5LWQA 3QQ5A 3L02A 5E1DA 3PXGA 4GP6A 3ZTTA 4ZK2A 4OUKX 5A4AA 4U2BA 4ZYZA 3CN7A 1D3AA 1CZKA 1DDOA 3HVKA 4IM7A 3GEGA 3NHZA 4X1YB 1M73E 4PBRA 3LT0A 2Z9BA 4JLMA 3T5MA 4EFNA 1OREA 4MQ5A 3CF4G 2BE7A 4X61A 5CB4A 1MVLA 3QPDA 2NO1A 2DECA 4JQSA 2PLFA 3RVKA 5KSWB 4WJZA 5SY4A 4MUAA 3T1TA 2WT4A 1SH7A 3T3GA 8MHTA 5CW2A 5HVNA 2OB2A 5JO9A 2Q4TA 4U6QA 1NMEA 3Q2KA 1G5HA 1J2UA 1I2ZA 5L3SA 5DB4A 5TQVA 4M7WA 5EC8A 3H5TA 4N18A 1Q2UA 4Q24A 1UDWA 1KGDA 4ZK6A 4PFKA 1LI5A 1B8PA 2VP0A 2RAFA 3DMTA 1CVLA 1UANA 4Y2GA 3GLGA 1C3LA 1E7SA 3OTQA 2WVGA 4RMGA 1V2GA 2BGMA 1S7CA 2CFTA 2Z4TA 4KN5A 3V7UA 4YRSA 1BH6A 3VKGA 3SQXA 1X80A 2DF8A 2R8YA 3Q9SA 3BJIC 4QSMA 2WVJA 3LCRA 5SZKB 5EJ7A 2PO5A 3IXMA 4LC0A 3HA2A 1FLNA 2EGUA 1DJQA 3BL8A 4JBNA 1U0SY 3SHTA 4AO7A 2Q5QA 1FNCA 2OCGA 4ITRC 3NAQA 3UC5A 2P4EA 4MW7A 1QWSA 4HEQA 3PRJA 2R00C 1U9IA 2FW0A 2I6SA 2R79A 4EX7A 2JEYA 1KH1A 1TYAE 2DFLA 2AZDA 2ZSIA 2O7SA 4BNWA 2XWBF 4M4SA 4DV6B 1SKQA 1AQUA 3F67A 3LK7A 1Z6TA 2Q5EA 3NBYC 2FMTA 4FDLA 4LJLA 5AIBA 2XGSA 3EQ6A 3VVLA 1F0NA 4FYHA 4FONA 1ULUA 2Q3BA 3P32A 1MOPA 1P1RA 2JFNA 5LUBA 1I24A 5HE9A 4G26A 5H3CA 5KWVA 3BE5A 3KCQA 2R1VB 4KUHA 3EWAA 5KYKA 4RESA 2PKXA 4HH0A 4LEIA 2CCGA 2ZT7A 3QEJA 4RTLA 1ZJ6A 3VQTA 3W9SA 1HRKA 3DWEX 3X43A 2NXJA 2I76A 1ONPA 4KI7A 4LF7B 2AX4A 2WTXA 4HI0E 5CFLA 4F9GA 4EUFA 5T4FA 1NUQA 5P21A 2H1CA 4DCJA 3C3MA 5CM8B 1J99A 3BRWD 2P90A 2DEUA 4LZLA 1HNZB 4HCJA 1TF7A 3HO6A 2NP6A 3VHQA 1XX6A 5KVCA 4J0EA 4QOFA 3CNEA 4R9RA 3MQ4A 4IWXA 1I6WA 3H4VA 3ANTA 4DLTA 2DC1A 4MLPA 3T94A 1TUBB 5LQNA 3KOXA 3ROPA 4YMUA 5I8ZA 2UV8A 3JD1A 3GMTA 1GKUB 1R5OA 2DTEA 2XJ9A 3HDHA 4KK3A 1DHTA 2ZXEA 1ULAA 4MQEA 1TADA 3Q15C 5E8JA 1IE3A 4ZVTA 3WK5A 4EX6A 1QOZA 1Z6YA 4QM6A 3WYEA 5ALKA 2DBQA 4K46A 5IFKA 2ZFUA 4LY3A 2IYVA 1ZCZA 3ONFA 3PR2B 4K8RB 4YFVA 4RVCA 2FSFA 5FHQA 1WABA 4OL9A 3K9FC 1S4MA 5I7VA 2UUOA 1YRAA 1BJTA 3IAS1 4ZQFA 2IP1A 1QHEA 2DUUA 1K68A 4RPIA 4TSFD 4YP7A 1YDMA 1HT1E 3KQYA 2MSEB 3IAM1 4LTMA 1JHMA 4KRGA 4B7CA 3C8MA 1M7BA 2PXAA 2C2BA 2V74B 2YJTD 1TUIA 3FCUB 4UUQA 3LBHA 4XVUA 4I4TB 4C0BA 1WEHA 5CA1A 1RC8A 2O8BA 4DQVA 4O2AB 3EF0A 3PQDA 3ELWA 2A84A 4ALNA 1OFIA 5JZ9A 3LUPA 1E2DA 1LPOA 4BFXA 2RGEA 4PLCA 2JIZA 2GF2A 3I6ZA 1A5TA 3PHHA 1T4DA 5BN5B 3RHTA 4OTZA 3W78A 3L41A 3QMVA 2YDXA 3FKSA 1KI4A 1WOMA 4XI9A 1GSAA 4IUYA 2GBFA 2PSHA 3ZHYA 3Q7IA 1FU8A 1X7XA 2VRBA 5JZSA 3SKXA 1CR6A 2R87A 4I5DA 4JX8A 2O4UX 1TL7C 2PWBA 2BZ0A 1TU0A 4FR2A 1KJIA 5TQ2B 2GVZC 3R9IA 3C3EA 3VZPA 4A0SA 5KQLA 2Z43A 3ISTA 4F4UA 4CU2A 4OHBA 4A8JC 2VHUA 5H3HA 1L7EA 1I7PA 1UBJS 1QB7A 2G9VA 3SFZA 4E14A 3ML1A 2DG2A 3I0ZA 1HPLA 2QXTA 4BNNA 3AC0A 3RS9A 3NONA 1EE1A 3D8UA 2KE5A 5CA0A 4KPEC 4YLEA 4ARVA 4UQLA 1UJMA 2G88A 4U9HS 5DLEA 1GGEA 4Q7EA 4B3SB 4WNCA 3R9XA 4MXDA 1KAEA 4A3SA 1HDXA 3NNSA 1CJUC 1BX3A 2W6NA 2YMMA 4XWTA 2EG9A 5JSKA 2J5QA 2POQX 4OXRA 1H6CA 4LRTB 3MMZA 4HAWA 2XYQA 3SKYA 5CFRA 1Z7WA 4RMJA 1MX3A 1MEOA 5FL3A 3PTLA 1LK7A 3QF4A 1CR1A 1AZLA 2O8DA 1BOOA 1ZH4A 4HBGA 2ZI9A 4YECA 1PJZA 2RD2A 1V9CA 3IT1A 4DGSA 4Q03A 5D5PA 1QLJA 2NU7B 4CMAA 2PUFA 4RTRA 3D59A 4QGHA 4UJ3A 4D9GA 4DJDC 3KVVA 1O6CA 1F8GA 2AKYA 3C15C 5GY7A 3S1LA 4NCIA 3F96A 5AYVA 2D1RA 4HB2A 3W79A 2JJ8A 5BSUA 2FWRA 2R6R1 1I7SB 2VPPA 2QGNA 4E2YA 1ZHFA 1T1IA 3MZ0A 4ZT2A 4ZOLA 4D41A 4R16A 4RIIA 5K6AC 3GJ0A 1CUXA 2FLVA 2GI4A 1Y4DE 4TVSA 3A1CA 4RPKA 1X7ZB 1CUSA 1V8OA 1SCNE 1SOWA 2GLUA 3AQIA 4NH4A 3CO0S 3KPVA 3LP5A 2X0IA 4J16C 2WQ7A 3ZWKA 1I80A 3C5VA 2IV7A 3Q3EA 1OA1A 4IV8A 3RF6A 1CRWG 1GCGA 2AUMA 2HA3A 2HV8A 2PQ0A 2XE8A 4TSRA 3TOCA 4R31A 9GPBA 5JMTA 1T10A 4TRRA 1DOAA 2GXQA 1NQVA 1RQRA 3M4ZA 5ITWA 2I2XB 3GIWA 3K9LA 4WSOA 4XW2A 5B4TA 2O59A 2CMHA 2FPNA 2Y71A 3BX1A 2CDRA 1H0SA 3Q3IA 4D97A 1II8B 2I4RA 4LBWA 1FP4B 2DGDA 1XWIA 3KQTA 5CLIA 1DXQA 2BEVA 3E7XA 4MW5A 5DIFA 1JTEA 4QOIA 5TRTA 4MDYA 3CO5A 2I1QA 3Q9NA 5KU1A 1SZJG 5PGMA 2EL7A 4EIWA 4M9CA 1FFHA 1UJNA 3KFVA 1XTTA 1CYDA 2D5BA 1P3DA 3BVPA 4BJ3A 5DOVA 5J3JA 3IILA 4Q4AA 2ZE5A 3IBTA 3GG2A 1Q0PA 5FWXA 4XVQA 3F6SA 4YP5A 1XMIA 5KBYA 3OUUA 4DXAA 4REQB 1P2SA 2ETVA 4R6XA 1Z5NA 2QK4A 4IFEA 1SOUA 1U65A 1K06A 4B09A 3TSYA 2D5IA 2WTMA 4TV8B 4GOKA 4YDQA 3SVLA 3EGXB 3WMFA 1NFFA 3TBHA 1YI0A 1G3IA 1E6CA 4GKVA 1JUDA 3GFVA 4V2UA 2GFHA 1DE0A 5CFOA 2J08A 5J4YA 1JR3D 4CDMA 3MT7A 1BEEA 1M2WA 5AJTA 1JDUA 1S3FA 5DX0A 3UNXA 4C7MA 5F7OA 3ZWPA 3GGSA 3LF2A 1Q0LA 1SXJC 2O2GA 1OH5A 1MP0A 5GADl 2Z9CA 1PGJA 1AQLA 2ODBA 1CUUA 4TXJA 4W9MC 3T15A 2F6RA 1P77A 2J7KA 5AVQA 4IRXA 1GUFA 1T9HA 2H5IA 3R77A 4QICA 4EKGA 1VGQA 3ZVNA 4X7PA 2AMVA 1I9GA 1R6DA 1WU7A 5IU6A 1I32A 1U4NA 3OUZA 2J0SA 3QVVA 2H1VA 2PE5A 2G1PA 3IWDB 1BHJA 2HTFA 3IOEA 2XDQB 2QJRA 3HXKA 3G8DA 3SC3A 3SQDA 2P67A 4F4IA 4K6MA 4N0DA 2AZ4A 1BDHA 4UMFA 4MI6A 1AMNA 1YTLA 1E79A 3G7SA 2HWWA 1FYEA 4NK4A 1NVMB 1AS0A 2JFXA 2RGBA 2VDPB 2ZTVA 5CT9A 3VJKA 3AZQA 4EMUA 3PUVA 1GNQA 4HDSA 4CF5A 3EPRA 3JZIA 4S12A 1PUJA 3RIGA 1BDJA 2YVAA 3Q9LA 4IILA 5B64A 3PQFA 2HYDA 2ZIZA 4C7OA 4LXUA 2O2IA 1E0DA 3IQIX 3DXXA 1RXUA 3GWGA 1USGA 4X3OA 3OUTA 4KTTE 4B8WA 1DELA 2I87A 1EUZA 2FHPA 2PD6A 1FTSA 3OZEA 3UCEA 3UC9A 3FTDA 3UN1A 3ZKAA 1OGJA 3A32A 3URKA 3SEQA 1X2BA 3EZ2A 2BGWA 3WKBA 1P4RA 2EOAA 1W0CA 4M6WB 3NCTA 4N0PA 3NOOA 5K5EA 5JYFA 1YV9A 5EWMB 2ZBQA 3USES 3FUTA 4TWAA 1KY3A 1ZRNA 3DQQA 5JQGA 1QH1A 5DHUA 3PL5A 5IBRA 2J41A 5CP8A 2XMZA 4J76A 3IL2A 4EFMA 4DCMA 4RENA 1FUIA 2Q6LA 3HBNA 4O8JA 4KIGA 4P08A 2I4TA 2DWOA 4HAYA 1P2UA 4P5DA 1AGRA 3KOOA 3RVSA 1WNTA 1QZXA 4DSZA 4MP6A 4ZDIA 3ADOA 4BVLA 3R20A 1QF9A 2ID4A 2WEKA 1F06A 1JFRA 3CZRA 4JJFA 2FMFA 2P4QA 2VWQA 3OLCX 4YCJA 1XDBA 5E4YA 5EJAA 3SSNA 3UGQA 4BNKA 2XHZA 1JBEA 1JJ7A 2AQHA 1Y3FE 3EXFA 4JJIA 1IZ7A 4TL7A 1EWRA 1XYVA 4C21A 3IESA 1V8PA 4EYKA 3KOUA 4JWTA 4WLEA 4XSHA 5F51A 5A4DA 4FEAA 5EGNA 5JATA 2GZAA 2Q29A 4X85A 2ODNA 2H92A 1EJ2A 4MW9A 3QBDA 3KE8A 2B61A 1EWVA 3R7SA 4G0UA 3LWDA 2FI1A 3TW6A 1T0HB 2WHPB 3IRVA 3CE6A 3GUVA 2QSZA 3PDIB 4I1VA 3AEUA 4C43A 5JAZA 1W87A 4XASA 4I3FA 5LOVB 4H7DA 2MSNA 5L7YA 4J3NA 4S0ZA 1X1EA 1Y8QB 3ESYA 1BOFA 2HRCA 4FCTA 4BFCA 3OLVA 5DU2A 2CZGA 4F91B 2BHRA 4N5MA 2QWXA 3TNJA 3P5SA 4PYQA 1KJ8A 3OZAA 3L7JA 1H2HA 5LL6P 4FILA 1TZCA 4ZJZA 2F1JA 3DB2A 1TMGE 2CVZA 5LQMA 2ADMA 3M3HA 3KZMA 3OTWA 4CKCB 3FWZA 1EWQA 4BDTA 2GM3A 1Z4PX 3F4BA 1R4NB 3GUYA 4WCVA 2OV2A 4PSKA 4L4XA 4G67A 2W83A 3UJ8A 3F8WA 5DX8A 1Z5OA 3WLPA 4XX1A 3L7BA 3L4SO 2VHJA 3LMKA 3OURA 1GGFA 1IHUA 3IBGA 3SDSA 3BFXA 5AHWA 3T12A 4NXMB 2AS0A 3THXB 5ICMA 3L49A 2JHFA 5FOQA 3IMEA 3VYSB 3HPRA 4AX4A 2FN9A 3ZCTA 1W29A 2V59A 1R6XA 2FXIA 4OXIA 3LT1A 2WJJA 3WLOA 2FUG6 4HNAA 5JDCA 4OLBA 3FPFA 2R62A 4PRYA 3OOEA 4OAQA 1SXJE 4BFYA 5GZ3A 1L7OA 4D0GA 1T43A 3LCJA 4I99A 1RM0A 3TM5A 3MJHA 4MI9A 2R6GA 4IYJA 3N2GB 1XHEA 1G1MA 3DZ7B 3SD7A 4FOOA 3L1VA 4QHYA 1NBEA 1B0ZA 2A9OA 2AX3A 2C5SA 2QRJA 1QQAA 1G5QA 3KXIA 5HZHA 3N7UA 3TTSA 4ZGGA 3LGXA 3T1OA 3FPBA 3R74A 3GXBA 2Q99A 3DKRA 3TSOA 3N8NA 2X3UA 2AOXA 4X9XA 4C1NA 3IAEA 4X8OA 5KKCA 4B6RA 4JP1A 2I8LA 1WM1A 2AUTA 5DBIA 5JECA 1WLYA 3ZXIA 2AI2A 1NX9A 1NR5A 5BSEA 4IIJF 1NW4A 4RUKA 3TD9A 4WE3A 3U26A 2MR5A 4BNDB 4DKXA 4LJ6A 3L40A 3OH8A 5DK6A 3GRRA 3LPLA 1D2HA 1Q57A 3TQHA 4B17A 4FWBA 5SYMA 2FX2A 3WB1A 2ZYDA 4AROA 3VJMA 4E4RA 2E2WA 2WIGA 1G18A 4YR7A 4V39A 1PBTA 3JZAA 5AUPB 2NU9A 3I9KA 2XUOA 4PO9A 2VQEB 4WY8A 3ZCRA 3LHSA 3L8EA 2F8MA 5ALIA 3E4DA 4HWTA 5LA6A 1U63A 1KI8A 3GPCA 2J1LA 1OWPA 3YASA 3DMFA 1ADYA 4C87A 1J4AA 4BKMA 4KO4S 1AC5A 1KC3A 1LJLA 1DQSA 4ZAYA 3FKSD 3GT4A 4CEHA 2VNAA 4LMBA 2FWNA 4YONB 1EFRA 4NBKA 4BIIA 4LXXA 3WJ7A 1U04A 3DGEC 4DWOA 1X74A 1ZN9A 2QMEA 4NYJR 5AI0A 4E33A 4F3KA 3UFXB 1XPOA 2POCA 3RS3A 3CMCO 3TJRA 5B6PA 1Z7BA 1K63A 5ADVA 3ZCPA 1ZMOA 2WUDA 2UKDA 2CL0X 4P0PB 1CQJB 4K9NA 5FWYA 3PTAA 3PG5A 3OCXA 7MHTA 1LTKA 2W4QA 3RS5A 4PLYA 1D2EA 4BLOA 4BRUA 4J3JA 3IJRA 2IYWA 1GARA 2DWQA 1RDFA 5KSZA 5I9LA 2B2XA 2ZETA 1EWTA 4GM1A 2EZ4A 1I3KA 3DYIA 5G41A 2ZTSA 1I6MA 4UAUA 4G97A 2NVUB 2JIPA 1NRXA 1U2GA 1Z4QA 2HPVA 4OI4A 2DQSA 4EG8A 4WY2A 5DTQA 5IEBA 3PC8A 3N9IA 4XEHA 5KOJA 2HQRA 5COAA 4ZO6A 5BMVA 4TS9A 4KXWA 1WMSA 4HX5A 4RVHA 2PS9A 5LQSA 2ZU6A 4UBOA 4I5IA 2ISQA 3ZZ0A 3PT5A 1VLJA 4YCDA 3KC2A 2C5BA 4R0MA 3QTLA 4JMPA 5F76A 2CLLB 5AKKA 2FF7A 2R1ZA 4LMAA 4RQUA 3V7FA 3LC7O 4V0LA 4PANA 4ZQGA 2E21A 2WWTA 1R4MA 1E2LA 5IJXA 4RAQA 3AV3A 4B43A 1ZR2A 4Y9DA 4HAOA 4MVJD 4ZU6X 2DERA 2BI8A 2AYZA 4RKQA 2XXJA 4KAXA 4R3UC 1E66A 3HPQA 3UCXA 4O5AA 3CUTA 1N6RA 4CF3A 4WLFA 3TYXA 2B98A 3LE8A 4URUR 1N5IA 2BUBA 5ALQA 1V5FA 2XUQA 4M8IA 2XDAA 3I6YA 3LTNC 3RTDA 3KUUA 3GBPA 3JQ7A 1SBZA 3K92A 3QH4A 3G49A 3ZS8A 1FSSA 3ST7A 1KIFA 2IOFA 3WNZA 3DSRA 1G20B 3UMMA 3DV0A 3O0TA 4XJTA 4I9FA 5ALMA 5HJ7A 3DHYA 4ZO7A 3DZ8A 4C14A 1PJSA 3RUCA 2QW8A 5FFNA 4CEJA 3FIUA 3QMPA 4P83A 1OSNA 2YN4A 2G7MC 3IO5A 3TEFA 3AVVA 3VSCA 3BRQA 1X3LA 1L5HB 2XQFA 4I50B 2PU7A 1VI2A 4UCWA 1PVVA 4R01A 4JLUA 3K9QO 1WLSA 4MV7A 6NULA 1W8IA 1KEWA 4FK8A 5LP6B 3ZOZA 2ZKIA 1GNSA 4TZ0A 1E2HA 3O4VA 3GF4A 4MAMA 2N42A 4HQFA 4ZDWA 2I55A 4U00A 1LGYA 4ZV9A 1DZ3A 4P7FA 1ULTA 4OH1A 2ZJOA 4QUEA 3BSWA 4J91A 4UHBA 3KXDA 2FPPA 4HTFA 1Y63A 1KK3A 3LX5A 1QWOA 4YCMA 3M81A 3CVJA 1EVEA 3SHFA 1FZQA 2OWEA 3L4BA 5E95A 4LY0A 5GP1A 3K0EA 4FYXA 1ZCJA 1UFRA 1ZWKA 1G8JA 1EJ6A 4UU1A 2C92A 2EP5A 1FS6A 1ONOA 1Z37A 1RYBA 4L28A 2ILTA 2MJLA 1X38A 4JI8B 1JQ5A 1QK3A 4MB2A 3VYRB 2W37A 1RAIA 2FX3A 1M5TA 3COYA 4ZHQB 4U63A 4P2BA 2B21A 3BFKA 4J90A 5KC9A 4LRSB 4RV5A 5JAOA 3TRDA 2DTXA 1QTNA 3FR7A 4Q19A 2QPAA 4NFSA 4RW0A 2RHHA 3GYGA 4CW7A 3K6SA 2X41A 4RK6A 4DXHA 1F8UA 2IOQA 3JALB 1HE5A 1M9NA 3U4QB 4HDKA 3ISVA 1S01A 4XYEA 4UVIA 3IP7A 4KU4A 1M8FA 1UJ6A 3EDOA 4B83A 4TV9A 2QZZA 4URVR 5C32A 3FTFA 2LDBA 5EP3A 1M6VA 4DQLA 4CDRA 2WB4A 2OVFA 3W2TA 4XLTA 1EVJA 2VHTA 3V80A 2OCLA 3BAFA 2F00A 2OQIA 4WX2B 9ATCA 2O0LA 3HR7A 3RH0A 4E4TA 3JS5A 4C04A 1R9NA 3KQUA 1CIJA 2FQYA 2FWPA 4H3SA 3KCNA 3HKEA 4WA7A 4WKOA 4RV9A 2GK6A 1IYZA 5JWHA 2GJ8A 3TIGA 1LB1B 1KMHA 2WMOB 1NAHA 5IKEA 2K6GA 3FCOA 4C7BA 3BULA 3KZVA 1XZMA 3K71B 1RZRA 4QT0A 3KJHA 4RVDA 5TV2A 5JJKA 2CMGA 2NO5A 3ID6C 4BUZA 1JT2A 1JKMA 2GLTA 3G9TA 2WM8A 1A76A 3C7TA 3N8KA 5BN1A 3PPWA 4FOTA 4MKHA 4N76A 4KHPB 1WJGA 4ZCQA 3TLCA 4OYYA 2Q6TA 1MC1A 4NENB 1CDOA 4J43A 1UADA 4BTEA 4AU1A 4F3YA 1GCUA 1MBZA 3LBNA 4CMCA 1NXWA 2VUIB 1WQ3A 3QGMA 4PW0A 1FFAA 4KL8S 4YP6A 1W4BA 2BF7A 4UOEA 3DHVA 3SOZA 1Z38A 1U7OA 3T5CA 2WZCA 5CIWA 3JQGA 4KJZA 3RR2A 4BX3A 3IV7A 5T3YA 5HPYB 2QRUA 2Q6VA 3SWWA 2IPAB 3H2JA 2Y4OA 2WAYA 2Y8EA 3IO3A 4V0NA 4WESA 1DEHA 3ZE6A 2IT1A 2CNWA 5KOHB 5LXTB 5AXDA 5ECGC 3CWZA 3OIGA 1T5OA 1YQDA 2I54A 3A6HA 1UMCA 1NUTA 3U6KA 4CG0A 4UZEA 4YBRA 3S2FA 4MI1A 4C5AA 3GCZA 1ONNA 5M2QA 3IA2A 3U4GA 2FK7A 2QRVA 1G4UR 2X9GA 1IY1A 1JJBA 1I3NA 2XZDA 2FZEA 2J9FB 3AL3A 1NJSA 4UHDA 1T25A 5CU7A 4BZZA 4F93B 4OHPA 2P3LA 2OO3A 2AXQA 2ATEA 2A9RA 3A11A 3MGBA 4ZVSA 3GLFE 5EEGA 2ZI7A 2AG1A 4OX9Y 1QK5A 1YZKA 4NMMA 3UJAA 2RK6A 4R2LA 3HA5A 5JS6A 5K7SA 1G64A 3SY8A 2R8PA 4H1WA 4MUJA 3KK0A 1GU1A 3AUYA 3K1AA 1JXAA 1IG3A 1W85B 4OQZA 1IK6A 5EAIA 4ZEXA 1QVWA 1W96A 1Z0UA 4MVJH 3IV6A 1ZCFA 4WZAB 2Q4RA 4ZVMA 1FFYA 1HO3A 1UOQA 5LU9A 4I5GA 2R6FA 3FJOA 4NNPA 3C16C 4Q4JB 3OCYA 2C2YA 1M6HA 2F4NA 3E35A 4LWZA 1BD4A 2CNNA