1TABE

Structure of the trypsin-binding domain of bowman-birk type protease inhibitor and its interaction with trypsin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of the trypsin-binding domain of Bowman-Birk type protease inhibitor and its interaction with trypsin.
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1990-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tabE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tabE02
4CR5A 1QL7A 4FUJA 1MZAA 4ZHMU 1YPEH 4X2WA 1JIMA 3LPRA 4BANB 3KL6A 3SJOA 4DCDA 1GBDA 2O8WA 1QY6A 1GBBA 2VH6A 1GI3A 1YPJH 1MAXA 3K6ZA 4BTTB 1ANEA 1G2LA 1SGTA 1AD8H 4Y11E 4AB8A 3A82A 3BEIB 2PTNA 2XBWA 1P04A 2FX6A 1EATA 2Z9LA 1O3BA 1ZHPA 4UONA 6GCHG 4AGJA 1GDNA 1AGJA 3BIUH 1SGPE 2ZDNA 1O2PA 1RTLA 4B2AA 1ZHRA 3LDXH 3A8DA 2O8TA 4H4FA 4YLUA 3BEUA 3GY5A 4I32A 3FAOA 3S7HB 1KLIH 2ZGHA 5BPEA 2GD4B 1DUEA 1ESAA 1GI8B 1ELBA 3VGCB 1J14A 4FUEA 2ZFPH 2TGDA 1GHAG 4IC5A 1AWFH 3ZVAA 1OX1A 4ISLA 2UWLA 1V2PT 4K5ZA 5F8XA 2UUJB 5EOKA 1P9SA 1DDJA 4DJZB 1O2MA 1TQ7B 1Z8JB 1NFUA 1CBWB 1OWHA 4AORA 4CRFA 1FDPA 3O8CA 3TLOA 3LGYA 1SGNE 5TCCA 1NFWA 1V2TT 1O5GH 1MKXH 5GCHG 1HAXB 1O3GA 4XDEA 3SJKA 3SUEA 3MU1A 1TRYA 5EG4A 2AFQB 4ZHLU 2VIWA 4CRDA 1IHSH 1ZGVA 3ZVDA 1L1GA 1SQOA 2J2UA 3BTME 3RXEA 3UNRA 1YPLH 1JWTA 1GVLA 1OYQA 3AVZA 1GI2A 3PYHA 1O3AA 3ATWA 3UTUH 3U1IB 2LNCA 1O31A 4YT7H 1W2KH 1P9UA 1UTQA 3BTEE 1B0EA 1KXEA 1V2UT 2ZF0H 2ZU3A 3DA9B 3BF6H 1CQQA 1XUHA 4Q2KA 1A7SA 3U98H 2VVCA 3GCNA 4O97A 1MAYA 5FXLA 3V3MA 5TJXA 3IWMA 3ZZCA 1B7XB 3MFJA 1LPKB 1ETSH 4TWYA 2D26C 4ZKNU 4JMYA 1TBRH 1AY6H 5C5NA 2FOBA 4UFEH 1OS8A 2ZCLP 3A80A 1GJBB 2CJIA 5EODA 1UTNA 2QA9E 1V2OT 5HYOA 2GT7A 3M36A 3P92A 5T6DA 2P8OB 4AG1A 1GBCA 1ZMLA 2ESTE 3I77A 1O3FA 1ABIH 1GWAA 1KXCA 2TBSA 3MNCA 1Y5UT 2WV4A 3PMAB 4CH8B 2XCNA 2WYJA 5LPRA 3QDZB 4XBDA 5ESTE 1UVSH 2P16A 3GICB 1G30B 1SG8B 4M7GA 1GJ4H 2R3YA 1TX6A 3U8RH 7GCHF 4ZAEA 4HI3A 3EA8A 3GY6A 3Q77A 3RXDA 5AFZH 2NWNA 4WVPE 3ZZ3A 1ETRH 1Z71A 2FOFA 3D65E 4TPYA 1GI5A 1P2JA 1PYTC 4ZKRU 3SZNA 3ODDA 1K2I1 1XXDA 1NRQH 4AYYB 3SU1A 3MYWA 3KIDU 1AO5A 1AUTC 2SNWA 3SV7A 1UTKA 2SGDE 1HLTH 2FZZA 2ZDVH 3P95A 2A5KA 3AW1A 3CENA 5FPYA 3MU0A 3M5NA 1LDTT 3UR6A 1KXAA 1EZXC 1LPZB 2OC8A 4B73A 1GMHG 1IOEA 1GBEA 1LTOA 3ZZ6A 1G3DA 4RN6A 2F9NA 3T29A 7KMEH 3S9CA 5FBIA 2FI4E 3SJIA 3MH4A 5L2YH 1LVMA 1YPHC 3GCHB 1EP6A 1IQNA 2BDAA 1ESTA 4X2XA 3RXPA 1D3DB 4ZXXH 1SLUB 1NRRH 2J92A 1INCA 2BOHB 4FVDA 1GHZA 3DT0H 4BAQB 1BBRH 2W26A 3M7TA 3MNBA 4NGAH 1QFKH 1PQAA 2GP9B 1P8VC 2OBOA 2SGQE 4K3JA 4Y8XA 2BLWA 3KQBA 4Y79A 3E16B 5K7RA 2ZEBA 1UK3A 4WMFA 2R9PA 1ZRKA 5A0BA 2WPMS 4HGCA 3BG4B 3SV2H 2FODA 1MBMA 2BD4A 2F83A 4AX9H 1HFDA 1NC6A 3SGQE 1Y3XA 3ZZ9A 3SNBA 1QIXB 1XVMA 4A5TS 2ODPA 1EKBB 2FTLE 5AFYH 3G01A 4FUDA 4IW4E 2ANKH 2HPQH 4D8NA 5ABWA 2WYGA 4DIIH 1K21H 1C5WB 2H5CA 3ZYEA 1TGBA 3GCTG 5E0JA 4ABEA 1HPGA 1GI0A 1ZJDA 2C8WB 3M61U 3MNXA 3QK1A 3DD2H 1SHHB 1C5VA 1C2MA 4A1VA 1O2WA 3LGUA 3RLWH 1VJAU 1A0LA 3A7TA 2FX4A 1C5YB 5EW1H 1UJ1A 4JK5A 3SNEA 5DGJA 1JMOH 1MH0A 1ORFA 4I8LA 1Y5BT 4CRBA 2CF9H 3TVJB 1BB0B 4WMEA 1S0RA 4XOJA 1W7GH 2G55A 1O5EH 2LPRA 3E3TA 3TGJE 1ZRBA 1SGQE 1BHXF 1EZUC 1DPOA 1ZPCA 2OC1A 4MQAA 3BSQA 1CHGA 2HNTC 2JH5D 2VVVA 3MHWU 3RMNH 2ZFSA 3MU4A 1ZJKA 3VXFH 4OGYA 1PPEE 3PO1B 1H8DH 1HAVB 1O2JA 1EZSC 2V6NA 1BRUP 1UMAH 5EQQA 3UWIA 3P8OA 1AFQB 3KQEA 2GMTB 3QZRA 4ABFA 1FN8A 2WINI 2A31A 3BG4C 3ESTA 4JZEH 2C8XB 3VPKA 5FAHA 2PGBB 2ZDAH 2VH0A 1SLVB 4X1NU 4FU7A 2Z3EA 5CHAB 3PMHB 1HAIH 2EI8A 3ATMA 2QXJA 1EB1H 1GCDA 1TWXB 1O2TA 3JZ1B 3AASA 3ATKA 3BTTE 1GGDB 3DFLA 3LH3A 2ZGBH 2FDAA 4ABGA 2PSYA 1YYY1 1V2RT 4D76A 5L30H 1OP0A 1TOCB 3KQDA 2AGIX 2OCVB 5EPNA 2J34A 5C67A 4TPIZ 4DT7B 2O8LA 1W10U 1EPTC 3RXCA 1HUTH 4VGCB 1DLKB 3M5MA 1SPJA 4XBCA 4D7FA 2AERH 3MTYA 4IN2A 1ESBA 4E7NA 1TOMH 1W14U 4MDSA 2ZHQH 2QC2A 4CBOA 2GCHG 4JZ1A 1N8OB 3L3TA 1RFNA 2BZ6H 2RDLA 4TYDA 3EYDA 2SGFE 1AMHA 4H6TA 1VCQA 3M3TA 1VGCC 3ZYDA 1C5NH 1KXDA 5DKMA 4ZUHA 1GHBG 1TYNA 1G3EA 1TNHA 1C5XB 1Z1JA 1IQGA 3NUMA 1DM4B 2P3UB 2A5IA 1NS3A 4GAWA 4LOYH 3T62A 1UVPA 3UWJH 1XKBC 2ANMH 2TGAA 4SGBE 1QTFA 1TMUH 5LGOA 2FTMA 1MTNB 1SLXB 3PMJA 4I8GA 3MU5A 3LU9B 1Y3VA 1T8LA 3T25A 2NU0E 2BDGA 2HLCA 1XUGA 1C5LH 1GCTB 1UK4A 4MPVA 2GVFA 1GPZA 1A3EH 1E0FD 1F0UA 2H9HA 3HKIB 2ZZUH 1V6DA 5DJ7A 4B2BA 1BJUA 1MKWK 2W7UA 1MQ6A 3A84A 1HJAC 1C5QA 1P2KA 9ESTA 2M5TA 3GY3A 5FCRA 3Q76A 2OBQA 2C8YB 1TMBH 1C2IA 2CHAC 1L2EA 3SU4A 4OS6A 5C3NA 4CHAC 1K28D 1RTKA 2Y80A 4GLYA 2PHBA 1H4WA 4R8TB 3RMOH 4UFFH 3BTGE 4Q80A 1C2DA 1F7ZA 1HAYB 2H9TH 1UTLM 3RU4T 1BT7A 2ZHEH 3M3VA 5HMAA 4NSVA 3VEQB 1SQAA 2V35A 5A8XA 1EPTA 1QRXA 2F9BH 1P3CA 1N8OC 6CHAC 5DP4A 4X2VA 1OKXA 3GDSA 1SL3A 3EGKH 5A8ZA 2FLRH 1O2HA 1S0QA 5F03A 1GI4A 2DE9A 4DOQA 1K1MA 1HV7A 2VWNA 3A8BA 1HAGE 1FJSA 1RGQA 2XRCA 4I8HA 2A45B 3AAUA 1A3BH 5C1XA 4NA8A 2GCTC 3TJOA 2B0FA 5G4BA 1K9OE 4YZUA 1XUIA 1JBUH 1TPSA 1C2HA 2IN2A 2ZWLH 4KTCA 2NU3E 4H6SB 3OY6U 3RDZA 1P02A 4NA9H 1LQDB 1NRPH 1O35A 1NPMA 2TGPZ 2XBVA 1D6RA 2ZIQH 3SBKA 2P93A 1SSXA 1X7AC 4UEHH 3A85A 4F49A 1LVBA 1FXYA 3E0PB 3K6YA 4B71A 3UIRA 1DY9A 4INHA 1THPB 2F9VA 3F9FA 1THSH 3VXEH 2Y7XA 1TNKA 1IQLA 1BTHH 4IC6A 5E2PA 3SI3H 1YPGH 4D9QA 1AN1E 3ZZAA 4WF8A 2Y82A 1O2NA 2B8OH 1UO6A 3SV8A 3OU0A 3MO3A 3GY7A 4X8VH 2PR3A 4ZKSU 3U8OH 1ZPBA 2C93B 2DUCA 4YOJA 3UNQA 5C1UA 1VCPA 5FBEA 2BLQA 3T27A 1YPMH 1O2SA 3C1KA 3QWCH 1Z6JH 3TH2H 1WYKA 1C1VH 1K1NA 3P17H 1LCYA 1HBTH 4WH6A 1ZOMA 3P8GA 4Y0ZE 5JB8S 3UPEA 1F0RA 3LGWA 1Y5AT 2GTBA 5EQRA 3V0XA 2BVRH 1O3CA 1MUEB 2Z94A 3NXPA 2AIPA 2EA3A 3A7ZA 1D3TB 2OQUA 3SUDA 3P6ZB 3PMBB 4MNVA 1YF4A 3LIWA 4KKDA 1BBRE 1DICA 3H5CB 3DFJA 2A0QB 3O8RA 2G4TA 2TPIZ 8KME2 1ANBA 1TX7A 2CGAA 1HNEE 1N6XA 1V2MT 5DP7A 4A6LA 3AAVA 4X8SH 1KTTB 1O2GH 1W7XH 3RXAA 4ZH8A 2XBYA 1L4DA 3LGVA 1GJ8B 1WV7H 5JBAS 1A2CH 3A87A 3KQCA 5FCKA 6GCHF 1T32A 1K1LA 4CRCA 3SQEE 1OWEA 3B8JA 3BTHE 3VFEA 2WPJS 2GZ7A 4UDWH 3SJ8A 4E7RG 5K0HA 2K1QA 2NU2E 1VITF 2A4QA 1PPHE 1OOKB 2VIOA 3RXRA 2Z6BD 1TLDA 2PKAA 1OWDA 5EXMA 1IQHA 3A7WA 1K1IA 1S83A 1W0ZU 3HGPA 3GY2A 4LZ1H 1GHAF 1FY4A 1O2OA 2FOEA 4DG4A 1MMJN 1DITH 3RXKA 4IN1A 1CT4E 2BXUH 4BXWA 5J4SA 1CE5A 1P3EA 1GHVH 2Z9GA 2CF8H 3RU4E 1BMLA 4J2YB 1TE0A 3ZVGA 3A7VA 2ZC9H 1IQEA 1O2RA 1V2LT 2SGPE 2XC5A 1AKSA 1MTVA 2CN0H 4XE4A 5GCHF 1NN6A 2HRVA 3OX7U 1EAXA 2Y5HA 1BTWA 3UFAA 5TCAA 3A89A 1VZQH 1FIWA 1P10A 2G81E 1WAYB 2W5EA 4AN7A 2ILNA 2AS9A 5JB9S 2JKHA 3S9BA 1FQ3A 4YLQH 5IYTA 3QLPH 1C1PA 5T3HA 2QY0B 1EZQA 1SGCA 2BMGB 3R0FA 2A1DB 1FY5A 3E0NB 1BZXE 1ANCA 1G2MA 4AOQA 3M3SA 4KP0A 3SO3A 3STIA 1C2JA 2CMYA 4Y76A 1FAXA 2ANWA 5C1YA 2ZFRH 2JH0D 1TRMA 3MO6A 2VWMA 3GYLB 1SOZA 1Y3UA 2HNTE 1UTJA 1DOJA 1SGEE 1BBRK 1ELFA 1G3CA 2BD2A 4ABJA 1FMGA 1LPGB 2Y6TA 4HFPB 4NWLA 4X1RU 1BTPA 2PUXB 4Y6DA 3EDXB 2F91A 1G3BA 2V0BA 5DP9A 4TY7A 2FXRA 4O03A 2BXTH 4CR9A 1XX9A 2G8TA 5HXFA 4WWYA 1MU8B 1SBWA 1ZTLA 3F6UH 1TGNA 2GV7A 1FN6A 3Q3KA 3LGIA 1B5GH 5CMXH 3A83A 3VB3A 2Y81A 1PQ5A 1KDQA 1TX8A 3TNTA 3SV6A 5C2ZA 2GV6A 1SGFA 1LKAA 1SVPA 4Q7ZA 3A7YA 4KGAA 3MMGA 5FPTA 1NFYA 3U69H 1HAOH 3Q3YA 2RCEA 2ZTZA 1IQIA 1RIWC 1GBTA 3SW2B 4NIWA 1C2EA 1TONA 2UUFB 3VB6A 1PYTD 1FY1A 1THRH 1O34A 1NRSH 5CE1A 3RLYH 2HWLB 1CHOF 1SGFG 3TGKE 1JIRA 1FY3A 3ELAH 3T28A 1IQJA 2ZG0H 3SU5A 1V2NT 2TRMA 2ZDLA 1P2IA 1OWKA 1TNJA 3I78A 3GY4A 2DE8A 2JETC 1GJ6A 4JZFH 4PROA 1T4VH 1GMHF 5DG6A 4IMQA 2PTCE 3F68H 2ZFTA 1EAWA 2BDYA 3DUXH 3P8NA 5GPIB 5C20A 3URCA 5A0AE 1PPFE 1QB6A 8LPRA 4DVAU 1KTSB 3RXOA 3OSYA 3ZVBA 1V2VT 2OLGA 1Z8GA 2I6QA 3BTFE 4A7IB 4E06H 3NWUA 2STAE 3D49H 2BDHA 1EQ9A 4YOGA 1TGCA 1E38B 5IDKA 4D7GA 4K8BA 4Z6AH 1HYLA 5PTPA 4TY6A 3PTBA 4FUFA 5C5OA 2VIQA 3RXSA 1MD7A 4X6PA 1F5RA 4IS5A 2Z9KA 3TH3H 5AHGH 1LHGH 2B7DH 2Z7FE 2PLXA 1GL1A 3RU4D 1MZDA 5EQSA 1O3KA 1QJ6B 1F0TA 1GVKB 1H9HE 2VB0A 2P94A 1QJ1B 2ANYA 1KIGH 1TNGA 1EPTB 4BAKB 1GJ7B 3TK5A 3Q00A 4YM9A 3GCTF 4K8YA 2G52A 1S5SA 1NFXA 1V2WT 1E36B 1TABE 2VGCC 1GG6C 1EP5A 1O0DH 3B23B 4XBBA 4ABBA 4JYVH 3UQVA 2ALVA 4AB9A 3IITA 1TQ0B 1NY22 2O8UA 1GI1A 3MOCA 3ZVFA 1RRKA 1H9IE 2BYAX 2WUBA 4BAHB 1WSSH 3KN2A 1V2JT 1CT2E 1VGCB 1LHFH 1P09A 3FANA 1HAPH 1TMTH 1UVTH 3ZVCA 1V2ST 2UWPA 2HPPH 1AU8A 1GMCF 4AZ2B 2QGRA 1KLTA 1YCPM 4B76A 1L4ZA 2Z9JA 2BQWB 3MU8A 4KELA 4A1TA 3SGAE 4O3UA 2PKSC 1O2UA 1T7CA 3NZIA 1S84A 4KTUA 4OGXA 1TGTA 4GHTA 4FU9A 1LVYA 1YCPK 4X6OA 3RM2H 5T6GA 1O3IA 9LPRA 2GX4A 1EJMA 2BLVA 1B0FA 2ZFQH 2FP7B 3SUFA 2FOMB 2ZGJA 1SQTA 3TPIZ 1QURH 1OWJA 4Q7XA 2GZ9A 1HJAB 2HOBA 3ZZ7A 2ALPA 4NIXA 4KTSA 3CS7A 1DY8A 2Z9IA 2CHAB 1G9IE 1ARBA 2BB4A 2FESH 4FUGA 1IAUA 2FOGA 4ABHA 4CHAB 2FLBH 2ZDMA 1V3XA 2UWOA 1L1NA 2IOTA 2W3IA 2ZU4A 2VIPA 7ESTE 3LGTA 1GJAB 1Q3XA 1W12U 1PFXC 1DWBH 1HIAA 1WU1A 1KLJH 2P3TB 3W95A 2AGGX 5EPYA 1C9PA 1O3LA 3LONA 3ZV9A 1WTHD 3E90B 6CHAB 3L33A 4CRAA 4ZKOU 1C1NA 5A0CA 1QRZA 2XC0A 2QXGA 2KAIA 1A5IA 4UFDH 2A5AA 4X0WU 3E91A 4D9RA 2XW9A 3WY8A 4I8JA 1ZSKA 4CREA 3K2UA 2AEIH 3RXLA 2GCHF 1NTPA 3EA9A 1SGYE 4WY3A 1GDUA 3VB7A 5J4QA 1C2KA 1FPCH 1YCPH 1BMNH 1Y8TA 2GCTB 4GHQA 3S9AA 1T4UH 4GCHF 5FX6A 3RXMA 3PM3A 4MPWA 2EC9H 1SGRE 2H1UA 2GT8A 2PKAB 1C5UA 2H6MA 2BD8A 5EW2H 1GHBF 2EI7A 4X8TH 3QGNB 2ZHDA 2OC0A 3FZZA 4E05H 4AGKA 4Y7AA 4I8KA 1C5TA 4I31A 1ZZZA 2VIDA 2VNTA 3ZZ8A 2BD3A 1HGTH 5L6NH 1MTUA 3ATLA 2ZPRA 8ESTE 3SGBE 3UNSA 1OPHB 1EXFA 2FWWA 1MBQA 1GBHA 4X2YA 1P03A 2JH6D 4Y10E 1O5BB 1DWEH 2ODQA 1AKSB 2EEKA 1Q31A 1CA0C 3KF2A 3LOXA 1DS2E 3U9AH 4NIYA 1J8AA 1VR1H 2AMDA 2FPZA 1JRSA 3O8DA 4IMZA 3MNSA 1GI6A 4MPXA 1BOQA 1C1MA 1DANH 3H7TA 3SU3A 3UUZA 3LC5A 4K2YA 2FYQA 1GBFA 3BTKE 1JOUB 1NRNH 1TA6A 2BY8X 1J17T 4NA7A 1W0YH 1C2GA 2HVXA 1P06A 1O3MA 1RXPA 3RM0H 1TBZH 1P11E 4K69A 3KNXA 4NWKA 4U2WA 3RMLH 2QCYA 1P01A 3M5LA 2ULLA 1TFXA 1Y3YA 2BY5X 1KY9A 2FI5E 5F8ZA 1QBOA 5A2MH 2R0LA 4DGJA 1KYNA 1GVZA 3EAJA 1C1SA 2BM2A 1QNJA 1J16A 1Z6EA 3SHCH 3VB4A 3QTOH 2A2QH 3VB5A 2XNIA 1C1RA 4OS4A 2G5VA 2BLOA 2G51A 2A7CA 5HM9A 2PSXA 4ZROA 2PV9B 4UD9H 1L0ZA 3SI4H 2BD9A 5E2OA 2Q6GA 1YLDA 1YM0A 4NFFA 1LHCH 1EASA 1D4PB 3M7UA 1AWHB 1NT1A 4XFQA 1H1BA 4FVBA 1FPHH 1DXWA 2VWOA 2A2XH 1O39A 1V2KT 3BV9B 1IQKA 1DXPA 2ZTXA 1P2MA 2I6SA 3EQ0H 2WPIS 4RKJB 3QUMP 2BQ6B 3PLBA 5B6OA 5LH8A 1ABJH 1VITH 1AVWA 1BTXA 2FS9A 4MLFB 1OP2A 2PWXA 1KDQB 1F92A 1AI8H 2OTVA 1F5LA 1WUNH 4K1TA 1O5AB 5L2ZH 1XVOA 5HM2A 1ZPZA 3CP7A 5JPMH 1P2NA 1TB6H 1S85A 4NZLA 4BTUB 3ITIA 3TGIE 1EJNA 2FS8A 2V3HH 1LKBA 1OXGA 2P59A 1AVGH 2WPKS 3PWBA 5GXPA 1EB2A 2CV3A 1WQSA 1AB9C 4O3TA 3RXFA 4X1QU 1QHRB 2ZHFH 1GMDF 1AHTH 2FMJA 2QIQA 1GBAA 3QO6A 4A1XA 4BAMB 1LQEA 3UREA 1AZZA 2H2ZA 1DE7H 8GCHG 3URDA 3FFGA 2B5TB 1C5MD 4F4OC 3ZVEA 1TNIA 2ZPSA 1PQ8A 3GDUA 2BD7A 2ZCHP 2ZECA 1HXFH 4LZ4B 2UUYA 3TNSA 3QGJA 1CGIE 1Y3WA 1QCPA 2PUQH 2A4GA 3PROA 1UCYK 1EAIA 1BMAA 4MG3A 2Y7ZA 3D23A 3MO9A 1A61H 1E35B 2QV1A 4CRGA 2AMPA 1O2KA 2D8WA 1GBIA 2WUCA 1BQYA 4ZMAH 1WTGH 3ZV8A 1O3NA 1YBWA 4Y0YE 4LK4A 2D2DA 1K1JA 1K1PA 1YPHE 5DO4H 1BRBE 1AIXH 2SFAA 2Z3CA 5JYIA 2C3SA 4NCYA 3TH4H 4O9VA 1MTWA 3A8AA 2ZNKH 1FLEE 2P3FH 2G4UA 2G00A 3AW0A 1CGJE 1ELCA 1UHBA 4YTAA 5AVDA 4GSOA 3TJUA 1Y59T 3RUOA 3HGNA 1SB1H 1PQ7A 2OXSA 1G36A 2NU4E 1ZR0A 2ODYB 1SFQB 1VITG 3BTWE 6LPRA 1YC0A 2ZA5A 1M9UA 1BHXB 1DUAA 2C90B 3MH7A 3ZZDA 3LJOA 2ASUB 1SMFE 1ELTA 1IHTH 1BTZA 2STBE 1GI7B 4YOIA 2HALA 1DWDH 1YLCA 4WH8A 1ANDA 4CH2B 3UOUA 1QA0A 2AH4X 1RIWB 4ISNA 2RA0A 1UVUH 1ZTJA 2RA3A 5GWZA 1O5DH 2ZQ1A 1AVXA 4FUCA 1EUFA 2XWAA 3KGPA 3FVFB 4Y71A 4BOHA 1MCVA 1UCYH 1HAZB 1TPAE 3SU2A 1T8NA 3PWCA 1OSSA 1ETTH 1P2QA 1C5ZB 4MNWA 4BTIB 2GDEH 1YGCH 1EOLA 1UTOA 2JETB 4K1SA 4QT8C 1MCTA 3SU6A 4FU8A 1LHDH 3LH1A 1GJCB 1TRNA 1C1QA 4NIVA 3QZQA 4R0IA 2ZFFH 1AZ8A 3LC3A 3SUGA 3I29A 1QL8A 2FIRH 2BX4A 1PPBH 4MTBA 2OD3B 4B2CA 4U32A 1EAUA 4GPGA 1C5RA 5E0GA 5FHTA 1CVWH 2BZAA 4BXSA 1ZMNA 3RMMH 3NPSA 2GZ8A 1TAWA 1V2QT 1IQFA 2THFB 1C1OA 2YNAA 3TK9A 4B75A 2A7JA 2ZO3H 2J38A 1CU1A 1QQUA 2GKVE 1P0SH 2OC7A 4ISOA 5A09A 7GCHG 1O37A 3SORA 3HPTB 1O2YA 1SLWB 2AGEX 4J1YA 1D3PB 3PLKA 1C2FA 5JBTA 4U30A 2ZGCA 4ZHAA 3VGCC 3ZZ4A 3OYPA 3PV4A 4X6NA 1T8MA 1T8OA 1O36A 1JRTA 1HIAB 1ELAA 2BQ7B 1P05A 2D1JA 1GBKA 2PW8H 3HKJB 1CBWC 4IBLH 4YO9A 1DSTA 3TU7H 1S81A 3SNDA 1KXFA 3M37A 1DSUA 1W8BH 4DURA 2R3UA 4WXIA 3ZZ5A 1ELVA 4AFUA 2FO9A 2WV5A 3RXGA 1BRAA 2VVUA 1EOJA 2VGCB 4OS2A 1GG6B 2KAIB 1UTMA 1YPKH 3HATH 1GL0E 4I33A 1DWCH 3BTDE 2O9QA 1CHOG 4X8UH 5DPAA 4FUIA 4ASHA 4A92A 3MH5A 2ZU5A 3OTJE 1IQMA 4JCNA 3GISB 2ZQ2A 4NSYA 4NG9H 1A1RA 1G37A 1GHYH 2H9EH 1J9CH 3ODFA 1A0JA 2BX3A 4DIHH 2FM2A 1K22H 1ZSJA 1O3JA 2CXVA 1SFIA 1RJXB 1RS0A 1F5KU 4GVUA 1XUJA 1E34B 1OYTH 3W94A 3L6PA 1NO9H 2PKSB 5E8EH 5I25A 1WOFA 1Z8IB 3E6PH 2NU1E 3Q3XA 1K1OA 1OWIA 3GDVA 1O32A 3RXQA 2VINA 2QYIA 1HDTH 4K60A 5H4IB 2B9LA 1S82A 2BOKA 2XYAA 3A86A 2ZKSA 4WJG2 1ZGIA 4AFSA 1FAKH 2P8OC 1HXEH 1TPPA 3M35A 1O2LA 3TITA 4Y7BA 3QTVH 1OP8A 4BAOB 1EX3A 1PPZA 2R0KA 1YP9A 2J4IA 4MNXA 1CO7E 2XTTB 2PFEA 1TIOA 1C2LA 4GUXA 4JZDH 3P70B 2ZU1A 1D9IA 4WXVA 2A32A 3RXJA 4JK6A 5DP8A 5GDSH 1DFPA 2QAAA 1C5OH 1LMWB 1HJ8A 1XXFA 3T5FH 1O3DA 1BMMH 2GGVB 4MVNA 4ZXYH 1XUFA 1N6YA 3EA7A 5HGGA 1CA8B 2A4RA 3SN8A 1HB0B 1HRTH 4BNRA 2VJ1A 2BVXH 2OP9A 2ZP0H 1ACBE 1O2XA 3FP8E 3GYMA 5EU8A 2ZTYA 1NESE 1O2VA 1GJ5H 4DW2U 1AQ7A 2ZCKP 1SGDE 2BTCE 2H5DA 4Z0KA 1FI8A 2F9UA 4I7YH 1GBLA 2XC4A 5I46H 2C4FH 3TJVA 1KSNA 1NZQH 1QR3E 3NK8A 4H42U 3UOPA 3UQOA 4MNYA 1Z8RA 1WQVH 1QQ4A 1SC8U 3A88A 2W7SA 1FUJA 4UFGH 4ABDA 1GDQA 5EXLA 1W13U 3MI4A 1O5CB 1S6FA 4AFZA 4OS1A 2WPHS 1QGFA 1GMCG 3HK3B 3GCHC 2F3CE 1O3HA 1C4U2 1DT2A 1C5SA 2YNBA 3TJNA 4SGAE 3K65B 2QF3A 1VCWA 3K9XB 1GJDB 1P2OA 2BDBA 1MD8A 4B74A 3RXIA 5DP6A 1ZTKA 3BG8A 2P95A 2BD5A 1AUJA 3A7XA 4Y8YA 5GJ4B 4CBNA 1TALA 4K1EA 4X6MA 5DP3A 1BJVA 3D62A 4IGDA 1FV9A 1QBVH 2ZPQA 4U01A 3RC6A 2QN5T 3MWIU 1AE5A 1L1JA 3F9HA 3RC5A 1ZSLA 1GHXH 4JYTA 1UK2A 1D3QB 1BCUH 2FYRA 1SGIB 2PGQB 1SHYA 2WPLS 1QA7A 1T31A 3JZ2B 1ELGA 1P12E 2TGTA 5F8TA 3QN7A 1KXBA 2A4OA 1CA0B 5E0HA 1O2QA 5LPEA 1O2ZA 4B1TA 1C1WH 4OS7A 1HCGA 1QJ7B 3T26A 3O8BA 1QB9A 4Q7YA 2ZI2H 1BTYA 1TNLA 5A8YA 1FIZA 3SNCA 2FI3E 1XUKA 3BN9A 1MQ5A 3F9EA 1C4V2 3TK6A 1C9TA 1N1LA 2XBXA 3RP2A 3PTNA 2VWLA 2Y5FA 1VJ9U 2TIOA 3RXBA 1A46H 1O3PB 1LHEH 3N7OA 5LPFA 3IG6B 3S7KB 4AYVB 2HGTH 4OS5A 3U1JB 3SOSA 3B9FH 3S0NA 2V3OH 4TWWA 1C1TA 5JBCS 2AIQA 2F9PA 4JYUH 5DP5A 2BY7X 3OY5U 1ZMJA 4FUHA 2Y5GA 1H9LB 1XKAC 3LJJA 1J15A 3NCLA 3U8TH 2AMQA 2C8ZB 3SHAH 1CSOE 1HAHH 7LPRA 4YT6H 2RG3A 4FUBA 1UHBB 2BHGA 3FP6E 3UR9A 4ISHH 3GY8A 3V13A 3NKKA 2F9OA 4GCHG 2W3KA 4ABIA 1SOTA 2FOCA 1WCZA 1HJ9A 3RXHA 3E1XB 1GJ9B 3A8CA 2SGEE 2A7HA 3KCGH 3PO1C 2ZDKA 1MTSA 1F2SE 1AFQC 2GMTC 4LXBH 1P57B 1A0HB 5EXNA 3RXUA 1AFEH 5AF9H 1W3CA 2GDDA 1BUIA 2Z3DA 2ZHWH 1DLEA 1LVOA 4DY7B 2OINA 2XWBI 1A5HA 1BA8B 1DVAH 2J95A 5CHAC 2BY9X 1QBNA 2HNTF 2QXHA 3S69A 4NZQA 5FX5A 4YESB 1BDAA 1TBQH 2QF0A 1E37B 4ESTE 2Q1JA 1TGSZ 1GBJA 4JZIA 3SV9A 3F1SB 1AB9B 1NM6A 3PB1E 1NU7B 1BTUA 1XM1A 3STJA 1PJPA 4X1SU 1GGDC 3QX5H 3ZZBA 1W11U 1O3EA 2SNVA 1FONA 2IJOB 2YOLA 5DK1A 3RXVA 2O8MA 1ZYOA 3BIVH 3A81A 5ESBA 1UCYE 2BDIA 3RC4A 1DX5M 1Z7KA 2OUAA 1O33A 1SR5C 3M5OA 5JDUB 2BVSH 1Z1IA 1CGHA 4VGCC 2VIVA 1LO6A 1XMNB 2QXIA 3ENSB 4INLA 5EGMA 1FNIA 2XXLA 1H8IH 2IPHA 2R2MB 6ESTA 1JXPA 1RD3B 3LT3A 4ISIH 4AFQA 4INKA 1ID5H 2AYWA 1BRCE 3PLPA 1ARCA 1RTFB 1GBMA 3KHVA 1A4WH 3MH6A 3V7TA 5ETXA 1PPCE 4THNH 3EE0B 3GCOA 4X1PU 1GI9B 4RKOB 1WBGB 5JBBS 3FP7E 5F6MA 2J9NA 3BEFB 3C27B 3FZDA 3LKWA 3T2NA 5FPSA 1EJAA 1C1UH 2R2WU 3R3GB 3F9GA 3H7OA 1C4Y2 1NU9A 5SGAE 4FXGH 1A5GH 2UUKB 1G32B 1F0SA 5GIBA 1D6WA 2FOHA 3SU0A 1BIOA 3CS0A 3P8FA 3GOVB 1MU6B 1ZLRA 1BITA 2SGAA 1MTNC 1UVOA 1CT0E 1FZZA 2XCFA 3SQHE 2BDCA 2ZGXH 5BRRE 4UE7H 3UY9A 1O2IA 1ELEE 1GHWH 1HAVA 3SJ9A 1MKWH 3BTQE 1GCTC 1QB1A 2J94A 1AE8H 1NROH 5T6FA 4RSPA 1YKTA 2VU8E 4XSKU 1TA2A 2G5NA 1S6HA 1C5PA 3E8LA 1ELDE 1Q2WA 4HZHA 3KEEA 4MPUA 1GMDG 1U6QA 1O38A 1O5FH 4HTCH 2BY6X 1QRWA 1UTPA 2EI6A 1O3OA 3TIUA 4ABAA 1TPOA 3DHKH 1SI5H 2Q6DA 3ATIA 1O30A 3M7QA 3HK6B 3V12A 2Q6FA 2ZU2A 1FY8E 2OQ5A 4NFEA 4Y8ZA 1QL9A 8GCHF 3SNAA 1MKXK 3RXTA 1PPGE 2FOAA 4AG2A 2FEQH 4WMDA 1ZHMA
chains in the Genus database with same CATH superfamily
4CR5A 1QL7A 4FUJA 1MZAA 4ZHMU 1YPEH 4X2WA 1JIMA 3LPRA 4BANB 3KL6A 3SJOA 4DCDA 1GBDA 2O8WA 1QY6A 1GBBA 2VH6A 1GI3A 1YPJH 1MAXA 3K6ZA 4ACAA 4BTTB 1ANEA 1G2LA 1SGTA 1AD8H 3EE7A 4Y11E 4AB8A 3A82A 3BEIB 2PTNA 2XBWA 1P04A 2FX6A 1EATA 2F4LA 2Z9LA 1O3BA 1ZHPA 4UONA 6GCHG 4AGJA 1GDNA 1AGJA 3BIUH 1SGPE 2ZDNA 1O2PA 1RTLA 4B2AA 1ZHRA 3F2HA 3LDXH 3A8DA 2O8TA 4H4FA 4YLUA 3BEUA 3GY5A 4I32A 3FAOA 4DT4A 1KLIH 3S7HB 2ZGHA 4FOUC 5BPEA 2VBCA 2GD4B 1DUEA 1ESAA 1GI8B 1ELBA 3VGCB 1J14A 4FUEA 2KZ4A 2ZFPH 2TGDA 3N7EA 1GHAG 4IC5A 1AWFH 3ZVAA 1OX1A 4ISLA 2UWLA 1V2PT 4K5ZA 2RFKC 5F8XA 2UUJB 5EOKA 1P9SA 1DDJA 4DJZB 1O2MA 1TQ7B 1Z8JB 1NFUA 1CBWB 1OWHA 4AORA 4CRFA 1FDPA 3O8CA 3TLOA 3LGYA 1SGNE 5TCCA 1NFWA 1V2TT 1O5GH 1MKXH 5GCHG 1HAXB 1O3GA 4XDEA 3SJKA 3SUEA 3MU1A 1TRYA 5EG4A 2AFQB 4ZHLU 2VIWA 4CRDA 1IHSH 1ZGVA 3ZVDA 1L1GA 1SQOA 2J2UA 3BTME 3RXEA 3UNRA 1YPLH 1JWTA 1GVLA 1OYQA 3AVZA 1GI2A 3PYHA 1O3AA 2QF5A 3ATWA 3UTUH 3U1IB 2LNCA 1O31A 4YT7H 1W2KH 1P9UA 1UTQA 2F43B 1B0EA 1KXEA 1V2UT 2ZF0H 2ZU3A 3BTEE 3DA9B 1UW7A 3BF6H 1CQQA 1XUHA 4Q2KA 2YMSC 1A7SA 3U98H 2VVCA 3GCNA 4O97A 1MAYA 5FXLA 3V3MA 5TJXA 3IWMA 3ZZCA 1B7XB 3MFJA 1LPKB 1ETSH 4TWYA 2D26C 4ZKNU 4JMYA 2CK3D 1TBRH 1AY6H 5C5NA 2FOBA 4TT3D 4UFEH 1OS8A 2ZCLP 3A80A 1GJBB 2CJIA 5EODA 1UTNA 2QA9E 1V2OT 5HYOA 2GT7A 3M36A 3P92A 5T6DA 2P8OB 4AG1A 1GBCA 1ZMLA 2ESTE 4Q63A 3I77A 1O3FA 1ABIH 1GWAA 1KXCA 2TBSA 3MNCA 2IJD1 1Y5UT 2WV4A 3PMAB 4CH8B 2XCNA 2WYJA 5LPRA 3QDZB 4XBDA 5ESTE 1UVSH 2P16A 3GICB 1G30B 1SG8B 4M7GA 1GJ4H 2R3YA 1TX6A 3U8RH 7GCHF 4ZAEA 4HI3A 3EA8A 3GY6A 3Q77A 3RXDA 5AFZH 2NWNA 4WVPE 3ZZ3A 1ETRH 1Z71A 2FOFA 3D65E 4TPYA 1GI5A 1P2JA 1PYTC 4ZKRU 3SZNA 3ODDA 1K2I1 1XXDA 1NRQH 4AYYB 3SU1A 3MYWA 3KIDU 1AO5A 1AUTC 2SNWA 3SV7A 1UTKA 2SGDE 1HLTH 2FZZA 2ZDVH 3P95A 2A5KA 3AW1A 3CENA 3FOAA 5FPYA 3MU0A 3M5NA 1LDTT 5HKKD 3UR6A 1KXAA 1EZXC 1LPZB 2OC8A 4B73A 1GMHG 1IOEA 1GBEA 1LTOA 3ZZ6A 2KCOA 1G3DA 4RN6A 2F9NA 3T29A 7KMEH 3S9CA 5FBIA 2FI4E 3SJIA 3MH4A 5L2YH 1LVMA 1YPHC 3GCHB 1EP6A 1IQNA 2BDAA 1ESTA 4X2XA 3SYJA 3RXPA 1D3DB 4ZXXH 1SLUB 1NRRH 2J92A 1INCA 2BOHB 4FVDA 1GHZA 3DT0H 4BAQB 1BBRH 2W26A 3M7TA 3MNBA 4NGAH 1QFKH 1PQAA 2GP9B 1P8VC 2OBOA 2SGQE 4K3JA 4Y8XA 2BLWA 3KQBA 4Y79A 3E16B 2HVYB 5K7RA 2ZEBA 1UK3A 4WMFA 2R9PA 1ZRKA 5A0BA 2WPMS 4HGCA 3BG4B 3SV2H 2FODA 1MBMA 2BD4A 2F83A 2EQNA 4AX9H 1HFDA 1NC6A 3SGQE 1Y3XA 3ZZ9A 3SNBA 1QIXB 1XVMA 4A5TS 2ODPA 1EKBB 2FTLE 5AFYH 3G01A 4FUDA 3WW7A 4IW4E 2ANKH 2HPQH 4D8NA 5ABWA 2WYGA 4DIIH 1K21H 1C5WB 2H5CA 3ZYEA 1TGBA 3GCTG 5E0JA 4ABEA 1HPGA 1GI0A 1ZJDA 2C8WB 3M61U 3MNXA 3QK1A 3DD2H 1SHHB 1C5VA 1C2MA 3H09A 4A1VA 1O2WA 3FO8D 3LGUA 3RLWH 1VJAU 1A0LA 2K0QA 3A7TA 2FX4A 1C5YB 5EW1H 1UJ1A 4JK5A 3SNEA 5DGJA 1JMOH 1MH0A 1ORFA 4I8LA 1Y5BT 4CRBA 2CF9H 3TVJB 1BB0B 4WMEA 1S0RA 4XOJA 1W7GH 2G55A 1O5EH 2LPRA 3E3TA 3TGJE 1ZRBA 1SGQE 1BHXF 1EZUC 1DPOA 1ZPCA 2KCAA 2OC1A 4MQAA 3BSQA 1CHGA 2HNTC 2JH5D 2VVVA 3MHWU 3RMNH 2ZFSA 2L74A 3MU4A 1ZJKA 3VXFH 4OGYA 1PPEE 2LP6A 3PO1B 3ZIAD 1H8DH 1HAVB 1O2JA 1EZSC 2V6NA 1BRUP 1UMAH 2XOKD 5EQQA 3UWIA 3P8OA 1AFQB 3KQEA 2GMTB 3QZRA 4ABFA 4FETA 1FN8A 2WINI 2A31A 3BG4C 3ESTA 4JZEH 2C8XB 3VPKA 5FAHA 2PGBB 2ZDAH 2VH0A 1SLVB 4X1NU 4FU7A 2Z3EA 5CHAB 3PMHB 1HAIH 2EI8A 3ATMA 2QXJA 1EB1H 1GCDA 1TWXB 1O2TA 3JZ1B 3AASA 3ATKA 3BTTE 1GGDB 3DFLA 3LH3A 2ZGBH 2FDAA 4ABGA 2PSYA 1YYY1 1V2RT 4D76A 5L30H 3F0OA 1OP0A 1TOCB 3KQDA 2AGIX 4RI0A 2OCVB 5EPNA 2KR7A 2J34A 5C67A 4TPIZ 4DT7B 2O8LA 1W10U 1EPTC 3RXCA 1HUTH 4VGCB 1DLKB 3M5MA 1SPJA 2PP6A 4XBCA 4D7FA 2AERH 3MTYA 4IN2A 1ESBA 5C17A 4E7NA 2JJ2D 1TOMH 1W14U 4MDSA 2ZHQH 2QC2A 4CBOA 2GCHG 4JZ1A 1N8OB 3L3TA 1RFNA 2BZ6H 2RDLA 4TYDA 3EYDA 2SGFE 1AMHA 4H6TA 1VCQA 3M3TA 1VGCC 3ZYDA 1C5NH 1KXDA 5DKMA 4ZUHA 1GHBG 4ACBA 1TYNA 1G3EA 3PV2A 1TNHA 1C5XB 1Z1JA 1IQGA 3NUMA 1DM4B 2P3UB 2A5IA 1NS3A 4GAWA 4LOYH 3T62A 4TSFD 1OHHD 1UVPA 3UWJH 1XKBC 2ANMH 2TGAA 4SGBE 1QTFA 2J5UA 1TMUH 5LGOA 2FTMA 1MTNB 1SLXB 3PMJA 4I8GA 3MU5A 3LU9B 1Y3VA 1T8LA 3T25A 2AHME 2NU0E 2BDGA 2HLCA 1XUGA 1C5LH 1GCTB 1UK4A 4MPVA 2GVFA 1GPZA 1A3EH 1E0FD 1F0UA 5C94A 2H9HA 3HKIB 2ZZUH 1V6DA 5DJ7A 3F2GA 4B2BA 1BJUA 1MKWK 2W7UA 1MQ6A 3A84A 1E1RD 1HJAC 1C5QA 1P2KA 2WSSD 9ESTA 2M5TA 3GY3A 5FCRA 3Q76A 2OBQA 2C8YB 1TMBH 1C2IA 2CHAC 1L2EA 3SU4A 2QF4A 3CNRA 4OS6A 5C3NA 4CHAC 1K28D 1RTKA 2Y80A 4GLYA 1YY3A 2PHBA 1H4WA 4R8TB 3RMOH 4UFFH 3BTGE 4Q80A 1C2DA 1F7ZA 1HAYB 2H9TH 1UTLM 2WHXA 3RU4T 1BT7A 2ZHEH 3M3VA 5HMAA 4NSVA 3VEQB 1SQAA 2V35A 5A8XA 1EPTA 1QRXA 2F9BH 3OEHD 2EY4C 1P3CA 1N8OC 3DCLA 6CHAC 5DP4A 4X2VA 1OKXA 3GDSA 1SL3A 3EGKH 5A8ZA 2FLRH 1O2HA 1S0QA 5F03A 1GI4A 2DE9A 4DOQA 1K1MA 1HV7A 2VWNA 3A8BA 1HAGE 1FJSA 1RGQA 2XRCA 4I8HA 2A45B 3AAUA 1A3BH 5C1XA 4NA8A 2GCTC 3TJOA 2B0FA 5G4BA 1K9OE 4YZUA 1XUIA 1JBUH 1TPSA 1C2HA 2IN2A 2ZWLH 4KTCA 2NU3E 4H6SB 3OY6U 3RDZA 1P02A 4NA9H 1LQDB 1NRPH 1O35A 1NPMA 2TGPZ 2XBVA 1D6RA 4ASUD 2ZIQH 3SBKA 2P93A 1SSXA 1X7AC 4P00A 4UEHH 3A85A 4F49A 1LVBA 1FXYA 3E0PB 3K6YA 4B71A 5B6LA 3UIRA 1DY9A 4INHA 1THPB 2F9VA 3F9FA 1THSH 3VXEH 2Y7XA 1TNKA 1IQLA 1BTHH 4IC6A 5E2PA 3SI3H 1YPGH 4D9QA 1AN1E 3ZZAA 4WF8A 2Y82A 1O2NA 2B8OH 1UO6A 3SV8A 3OU0A 3MO3A 3GY7A 4X8VH 2PR3A 4ZKSU 3U8OH 1ZPBA 2C93B 2DUCA 4YOJA 3UNQA 5C1UA 1VCPA 5FBEA 2BLQA 3T27A 1YPMH 1O2SA 3C1KA 3QWCH 1Z6JH 3TH2H 1WYKA 1C1VH 1K1NA 3SZEA 3P17H 2K8IA 1LCYA 1HBTH 4WH6A 1ZOMA 3P8GA 4Y0ZE 2YMSB 3UPEA 5JB8S 1KMHB 1F0RA 3LGWA 2QE7D 1Y5AT 2GTBA 5EQRA 3V0XA 2BVRH 1O3CA 1MUEB 2Z94A 3NXPA 2AIPA 2EA3A 3A7ZA 1D3TB 2OQUA 4XRNA 3P6ZB 3SUDA 3PMBB 4MNVA 1YF4A 3LIWA 4KKDA 1BBRE 1DICA 3H5CB 3DFJA 2A0QB 3O8RA 2G4TA 2TPIZ 8KME2 1ANBA 1TX7A 2CGAA 1HNEE 1N6XA 1V2MT 5DP7A 4A6LA 1E1QD 3AAVA 4X8SH 1KTTB 1O2GH 1W7XH 3RXAA 4ZH8A 2XBYA 1L4DA 3LGVA 1GJ8B 1WV7H 5JBAS 1A2CH 3A87A 3KQCA 5FCKA 6GCHF 1T32A 1K1LA 4M9FA 2V3MA 4CRCA 3SQEE 1OWEA 3B8JA 3BTHE 3VFEA 3N7DA 2WPJS 2GZ7A 4UDWH 3SJ8A 4E7RG 3PV5A 5K0HA 2K1QA 2NU2E 1VITF 2A4QA 1PPHE 1OOKB 2VIOA 3RXRA 2Z6BD 1TLDA 2PKAA 1OWDA 5EXMA 4Q4LA 1IQHA 3A7WA 1K1IA 1S83A 1W0ZU 3HGPA 3GY2A 4LZ1H 2L6OA 1GHAF 1FY4A 1O2OA 2FOEA 4DG4A 1MMJN 1DITH 3RXKA 3OEED 4IN1A 1CT4E 2BXUH 4BXWA 5J4SA 3AK5A 1CE5A 1P3EA 1GHVH 2Z9GA 2CF8H 3RU4E 1BMLA 4J2YB 1TE0A 3ZVGA 3A7VA 2ZC9H 1IQEA 1O2RA 1V2LT 2SGPE 2XC5A 1AKSA 3FKSD 1MTVA 2CN0H 4XE4A 5GCHF 1NN6A 2HRVA 3OX7U 1EAXA 2Y5HA 1BTWA 3UFAA 5TCAA 3A89A 1VZQH 1FIWA 1H8ED 1P10A 2G81E 1WAYB 2W5EA 4AN7A 2ILNA 2AS9A 5JB9S 4XD7D 2JKHA 3S9BA 1FQ3A 4YLQH 5IYTA 3QLPH 1C1PA 5T3HA 4HG6A 2QY0B 1EZQA 1SGCA 1EFRD 2BMGB 3R0FA 2A1DB 3U28C 1FY5A 3E0NB 2YMSD 1BZXE 1ANCA 1G2MA 5HIZA 3M3SA 4KP0A 4RT0A 4AOQA 1S6LA 3SO3A 3PRBA 1C2JA 3STIA 2CMYA 4Y76A 1FAXA 2ANWA 5C1YA 2ZFRH 2JH0D 1TRMA 3MO6A 2VWMA 3GYLB 1SOZA 1Y3UA 2HNTE 1UTJA 1DOJA 1SGEE 1BBRK 1ELFA 1G3CA 2BD2A 4ABJA 1FMGA 1LPGB 2Y6TA 4HFPB 4NWLA 4X1RU 1BTPA 2PUXB 4Y6DA 3EDXB 2F91A 1G3BA 2V0BA 5DP9A 4TY7A 2FXRA 4O03A 2BXTH 4CR9A 1XX9A 2G8TA 5HXFA 4WWYA 1MU8B 1SBWA 1ZTLA 3F6UH 1TGNA 2GV7A 1FN6A 3Q3KA 3LGIA 1B5GH 5CMXH 3A83A 3VB3A 2Y81A 1PQ5A 1KDQA 1TX8A 3TNTA 3SV6A 5CDFE 5C2ZA 2GV6A 1SGFA 1LKAA 1SVPA 4Q7ZA 3A7YA 4KGAA 3MMGA 5FPTA 1NFYA 3U69H 1HAOH 3Q3YA 2RCEA 2ZTZA 3FN8A 1IQIA 1RIWC 1GBTA 1NBME 3SW2B 4NIWA 1C2EA 1TONA 2UUFB 3VB6A 1PYTD 1FY1A 1THRH 1O34A 1NRSH 5CE1A 3RLYH 2HWLB 3KYFA 1CHOF 1SGFG 3TGKE 3DSOA 1JIRA 1FY3A 3ELAH 3T28A 1IQJA 2ZG0H 3SU5A 1V2NT 2TRMA 2ZDLA 1P2IA 1OWKA 1TNJA 3I78A 3GY4A 2DE8A 2JETC 1GJ6A 4JZFH 4PROA 1T4VH 1GMHF 5DG6A 4IMQA 2PTCE 3F68H 3NRLA 2ZFTA 1EAWA 2BDYA 3DUXH 3P8NA 5GPIB 5C20A 3URCA 5A0AE 1PPFE 1QB6A 8LPRA 4DVAU 1KTSB 3RXOA 3OSYA 3ZVBA 1V2VT 2OLGA 1Z8GA 3MQKC 2I6QA 3BTFE 4A7IB 4E06H 3NWUA 2STAE 3D49H 2IPQX 2BDHA 5DN6D 1EQ9A 4YOGA 1TGCA 1E38B 5IDKA 4D7GA 4K8BA 4Z6AH 1HYLA 5PTPA 4TY6A 3PTBA 4FUFA 3VG8A 1BMFD 5C5OA 2VIQA 3RXSA 1MD7A 4X6PA 1F5RA 4IS5A 2Z9KA 3TH3H 5AHGH 1LHGH 2B7DH 2Z7FE 2PLXA 1GL1A 3RU4D 1MZDA 5EQSA 3WWBA 4YXWD 1O3KA 1QJ6B 1F0TA 1GVKB 1H9HE 2VB0A 2P94A 1QJ1B 2ANYA 1KIGH 1TNGA 1EPTB 4BAKB 1GJ7B 3TK5A 3Q00A 4YM9A 3GCTF 4K8YA 2G52A 5C0TA 1S5SA 5EJ1A 1NFXA 1V2WT 1E36B 2XNDD 2LELA 1TABE 2VGCC 1GG6C 1EP5A 1O0DH 3B23B 4XBBA 4ABBA 4JYVH 3UQVA 2ALVA 4AB9A 3IITA 1TQ0B 1NY22 2O8UA 1GI1A 3MOCA 3ZVFA 1RRKA 1H9IE 2BYAX 2WUBA 4BAHB 1WSSH 3KN2A 1V2JT 1CT2E 1VGCB 1LHFH 1P09A 2W6JD 3FANA 1HAPH 1TMTH 1UVTH 3ZVCA 1V2ST 2UWPA 2HPPH 1AU8A 1GMCF 4AZ2B 2QGRA 1KLTA 1YCPM 2HLDD 4B76A 1L4ZA 2Z9JA 2BQWB 3MU8A 4KELA 4A1TA 3SGAE 4O3UA 2PKSC 1O2UA 1T7CA 3NZIA 1S84A 4KTUA 5GNDA 4OGXA 1TGTA 4GHTA 4FU9A 1LVYA 3KYGA 1YCPK 4X6OA 3RM2H 5T6GA 1O3IA 9LPRA 2GX4A 1EJMA 2BLVA 1B0FA 2ZFQH 2FP7B 3SUFA 2FOMB 2ZGJA 1SQTA 3TPIZ 4RT1A 1QURH 1OWJA 4Q7XA 2GZ9A 1HJAB 2HOBA 3ZZ7A 2ALPA 4NIXA 4KTSA 3CS7A 1DY8A 2Z9IA 1NBMD 2CHAB 1G9IE 1ARBA 2BB4A 2FESH 4FUGA 1IAUA 2FOGA 4ABHA 4CHAB 2FLBH 2ZDMA 1V3XA 2UWOA 1L1NA 5C0UA 2IOTA 2W3IA 2ZU4A 2VIPA 7ESTE 3LGTA 1GJAB 1Q3XA 1W12U 1PFXC 1DWBH 1HIAA 1WU1A 1KLJH 2P3TB 3W95A 2AGGX 5EPYA 1C9PA 1O3LA 3LONA 3ZV9A 1WTHD 3E90B 6CHAB 3L33A 4CRAA 4ZKOU 1C1NA 5A0CA 5EIYA 1QRZA 2XC0A 2QXGA 2KAIA 1A5IA 4UFDH 2A5AA 4X0WU 3E91A 4D9RA 2XW9A 5EJZA 4I8JA 3WY8A 1ZSKA 4CREA 3K2UA 2OK5A 2AEIH 3RXLA 2GCHF 1NTPA 3EA9A 1SGYE 4WY3A 1GDUA 2WZQA 3VB7A 4F55A 1C2KA 2WPDD 5J4QA 1FPCH 1YCPH 1BMNH 1Y8TA 2GCTB 4GHQA 3S9AA 1T4UH 4GCHF 5FX6A 3RXMA 3PM3A 4MPWA 2EC9H 1SGRE 2H1UA 2GT8A 2PKAB 1C5UA 2H6MA 2BD8A 5EW2H 1GHBF 2EI7A 4X8TH 3QGNB 2ZHDA 2OC0A 3FZZA 4E05H 4AGKA 4Y7AA 4I8KA 1C5TA 4I31A 1ZZZA 2VIDA 2VNTA 3ZZ8A 2BD3A 1HGTH 5L6NH 1MTUA 3ATLA 2ZPRA 8ESTE 3SGBE 3UNSA 1OPHB 1EXFA 2FWWA 1MBQA 1GBHA 4X2YA 1P03A 2JH6D 4Y10E 1O5BB 1DWEH 2ODQA 1AKSB 2EEKA 1Q31A 1CA0C 2KX4A 3KF2A 3LOXA 1DS2E 3U9AH 4NIYA 1J8AA 1VR1H 2AMDA 2FPZA 1JRSA 3O8DA 4IMZA 3W1EA 3MNSA 1GI6A 4MPXA 1BOQA 1C1MA 1DANH 3H7TA 3SU3A 3UUZA 3LC5A 4K2YA 2FYQA 1GBFA 3BTKE 1JOUB 1NRNH 1TA6A 2BY8X 1J17T 4NA7A 1W0YH 1C2GA 2HVXA 4AC9A 1P06A 1O3MA 1RXPA 3RM0H 1TBZH 1P11E 4K69A 3KNXA 4NWKA 4U2WA 3RMLH 2QCYA 1P01A 3M5LA 2ULLA 1TFXA 1Y3YA 2BY5X 1KY9A 2FI5E 2JJ1D 5F8ZA 1QBOA 5A2MH 2R0LA 4DGJA 1KYNA 1GVZA 3EAJA 1C1SA 2BM2A 1QNJA 1J16A 1Z6EA 1K0HA 3SHCH 3VB4A 3QTOH 2A2QH 3VB5A 2XNIA 1C1RA 4OS4A 2G5VA 2BLOA 2G51A 3OTPA 2A7CA 5HM9A 2PSXA 4ZROA 3F3BA 2PV9B 4UD9H 1L0ZA 3SI4H 2BD9A 5E2OA 2Q6GA 1YLDA 1YM0A 4NFFA 1LHCH 1EASA 1D4PB 3M7UA 1AWHB 1NT1A 4XFQA 1H1BA 4FVBA 1FPHH 1DXWA 2VWOA 2A2XH 1O39A 1V2KT 3BV9B 1IQKA 1DXPA 2ZTXA 1P2MA 2I6SA 3EQ0H 2WPIS 4RKJB 5HIYA 3QUMP 2BQ6B 3PLBA 5B6OA 5LH8A 1ABJH 1VITH 1AVWA 1BTXA 2FS9A 4MLFB 1OP2A 2PWXA 1KDQB 4I86A 2KFWA 1F92A 1AI8H 1F5LA 2OTVA 1WUNH 4K1TA 1O5AB 5L2ZH 1XVOA 5HM2A 1ZPZA 3CP7A 5JPMH 1P2NA 1TB6H 1S85A 4NZLA 4BTUB 3ITIA 3TGIE 1EJNA 2FS8A 2V3HH 1LKBA 1OXGA 2P59A 1AVGH 2WPKS 3PWBA 5GXPA 1EB2A 2CV3A 1WQSA 1AB9C 4O3TA 3RXFA 4X1QU 1QHRB 2ZHFH 1MABB 1GMDF 1AHTH 2FMJA 1COWD 2QIQA 1GBAA 3QO6A 4A1XA 4BAMB 1LQEA 3UREA 1AZZA 2H2ZA 1DE7H 8GCHG 3URDA 3FFGA 2B5TB 1C5MD 4F4OC 3ZVEA 1TNIA 2ZPSA 1PQ8A 3GDUA 2BD7A 2ZCHP 2ZECA 1HXFH 4LZ4B 2UUYA 3GS9A 3TNSA 3QGJA 1CGIE 1Y3WA 1QCPA 2PUQH 2A4GA 3PROA 1UCYK 1EAIA 1BMAA 4MG3A 2Y7ZA 3D23A 3MO9A 1A61H 1E35B 2QV1A 4CRGA 2AMPA 1O2KA 2D8WA 1GBIA 2J98A 2WUCA 1BQYA 4ZMAH 1WTGH 3ZV8A 1O3NA 1YBWA 4Y0YE 1QZ8A 4LK4A 2D2DA 1K1JA 3OE7D 1K1PA 1YPHE 3OFND 5DO4H 1BRBE 4F48B 1AIXH 2SFAA 2Z3CA 5JYIA 2C3SA 4NCYA 3TH4H 4O9VA 1MTWA 3A8AA 2ZNKH 1FLEE 2P3FH 2G4UA 2G00A 3AW0A 1CGJE 1ELCA 1YLNA 1UHBA 4YTAA 5AVDA 4GSOA 3TJUA 1Y59T 3RUOA 2JDID 3HGNA 1SB1H 1PQ7A 2OXSA 1G36A 2NU4E 1ZR0A 2ODYB 1SFQB 1VITG 4ZCNA 3BTWE 5EJLA 6LPRA 1YC0A 2ZA5A 1M9UA 1BHXB 1DUAA 2C90B 3MH7A 3ZZDA 3LJOA 2ASUB 1SMFE 1ELTA 1IHTH 3KQ5A 1BTZA 2STBE 1GI7B 4YOIA 2HALA 4B6FA 1DWDH 1YLCA 4WH8A 1ANDA 4CH2B 3UOUA 1QA0A 2AH4X 1RIWB 4ISNA 2RA0A 1UVUH 1ZTJA 2RA3A 5GWZA 1O5DH 2ZQ1A 1AVXA 4FUCA 1EUFA 2XWAA 3KGPA 3FVFB 4Y71A 3DSGA 4BOHA 1MCVA 1UCYH 1HAZB 1TPAE 3SU2A 1T8NA 3PWCA 1OSSA 1ETTH 1P2QA 1C5ZB 4MNWA 4BTIB 2GDEH 1YGCH 1EOLA 1UTOA 2JETB 4K1SA 4QT8C 1MCTA 3SU6A 4FU8A 5KGOA 1LHDH 3LH1A 1GJCB 1TRNA 1C1QA 4NIVA 3QZQA 4R0IA 2ZFFH 1AZ8A 3LC3A 3SUGA 1SQRA 3I29A 1QL8A 2FIRH 2BX4A 1PPBH 2RDEA 4MTBA 2OD3B 4B2CA 4U32A 1EAUA 4GPGA 1C5RA 5E0GA 5FHTA 1CVWH 2BZAA 4BXSA 2J97A 1ZMNA 3RMMH 3NPSA 2GZ8A 1TAWA 1V2QT 1IQFA 2THFB 1C1OA 2YNAA 3TK9A 4B75A 2A7JA 2ZO3H 2J38A 1CU1A 1QQUA 2GKVE 1P0SH 2OC7A 4ISOA 1W0JD 5A09A 7GCHG 1O37A 3SORA 3HPTB 1O2YA 1SLWB 2AGEX 4J1YA 1D3PB 3PLKA 1C2FA 5JBTA 4U30A 2ZGCA 4ZHAA 3VGCC 3ZZ4A 3OYPA 3PV4A 4X6NA 1T8MA 1T8OA 1O36A 1JRTA 1HIAB 1ELAA 3F2FA 2BQ7B 1P05A 2D1JA 1GBKA 2PW8H 3HKJB 1CBWC 4IBLH 4YO9A 1DSTA 3TU7H 1S81A 3SNDA 1KXFA 3M37A 1DSUA 1W8BH 4DURA 2R3UA 4WXIA 3ZZ5A 1ELVA 5T1VA 4AFUA 2FO9A 2WV5A 3RXGA 2KCPA 1BRAA 2VVUA 1EOJA 2VGCB 4OS2A 1GG6B 2KAIB 1UTMA 1YPKH 3HATH 1GL0E 4I33A 1DWCH 3BTDE 2O9QA 1CHOG 4X8UH 5DPAA 4FUIA 4ASHA 4A92A 3MH5A 2ZU5A 3OTJE 1IQMA 4JCNA 3GISB 2ZQ2A 4NSYA 4NG9H 1A1RA 1G37A 1GHYH 3UB0A 2H9EH 1J9CH 3ODFA 1A0JA 2BX3A 4DIHH 2FM2A 1K22H 1ZSJA 1O3JA 2W6ID 4OM9A 2CXVA 1SFIA 1RJXB 1RS0A 1F5KU 4GVUA 1XUJA 1E34B 1OYTH 3W94A 3L6PA 1NO9H 2PKSB 5E8EH 5I25A 1WOFA 1Z8IB 3E6PH 2NU1E 3Q3XA 1K1OA 1OWIA 3GDVA 1O32A 3RXQA 2VINA 2QYIA 1HDTH 4K60A 5H4IB 2B9LA 1S82A 2BOKA 2XYAA 3A86A 2ZKSA 4WJG2 1ZGIA 4AFSA 1WXRA 1FAKH 2P8OC 1HXEH 1TPPA 3M35A 1O2LA 3TITA 4Y7BA 3QTVH 1OP8A 4BAOB 1EX3A 1PPZA 2R0KA 1YP9A 1VKYA 2J4IA 4MNXA 1CO7E 2XTTB 2PFEA 1TIOA 1C2LA 4GUXA 4JZDH 3P70B 2ZU1A 1D9IA 4WXVA 2A32A 3RXJA 4JK6A 5DP8A 5GDSH 1DFPA 2QAAA 1C5OH 1LMWB 1HJ8A 1XXFA 1WDIA 3T5FH 1O3DA 1BMMH 2GGVB 4MVNA 4ZXYH 1XUFA 1N6YA 3EA7A 5HGGA 1CA8B 2A4RA 3SN8A 1HB0B 1HRTH 4BNRA 2VJ1A 2BVXH 2OP9A 2ZP0H 1ACBE 1O2XA 3DSPA 3FP8E 3GYMA 5EU8A 2ZTYA 1NESE 1O2VA 1GJ5H 4DW2U 1AQ7A 2ZCKP 1SGDE 2BTCE 2H5DA 4Z0KA 1FI8A 2F9UA 4I7YH 1GBLA 2XC4A 5I46H 5KECA 2C4FH 3TJVA 1KSNA 1NZQH 1QR3E 3NK8A 4H42U 3UOPA 3UQOA 4MNYA 1Z8RA 1WQVH 1QQ4A 1SC8U 3A88A 2W7SA 1FUJA 4UFGH 4ABDA 1GDQA 5EXLA 1W13U 3MI4A 1O5CB 1S6FA 4AFZA 4OS1A 2WPHS 1QGFA 1GMCG 3HK3B 3GCHC 2F3CE 1O3HA 1C4U2 1DT2A 1C5SA 2YNBA 3TJNA 4SGAE 3K65B 2QF3A 1VCWA 3K9XB 1GJDB 1P2OA 2BDBA 1MD8A 4B74A 3RXIA 5DP6A 1ZTKA 3BG8A 2P95A 4Z1MD 2BD5A 1AUJA 3A7XA 4Y8YA 5GJ4B 4CBNA 1TALA 4K1EA 4X6MA 5DP3A 1BJVA 3D62A 4IGDA 1FV9A 1QBVH 2ZPQA 4U01A 3RC6A 2QN5T 3MWIU 1AE5A 1L1JA 5F53A 3F9HA 1SKYE 3RC5A 3OAAD 1ZSLA 2M2AA 1GHXH 1E79D 4JYTA 1UK2A 1D3QB 1BCUH 2FYRA 1SGIB 2PGQB 2JIZD 1SHYA 2WPLS 1QA7A 1T31A 3JZ2B 1ELGA 1P12E 2TGTA 5F8TA 3QN7A 3F0PA 1KXBA 2A4OA 1CA0B 5E0HA 1O2QA 5LPEA 1O2ZA 4B1TA 1C1WH 4OS7A 1HCGA 1QJ7B 3T26A 3O8BA 1QB9A 4Q7YA 2ZI2H 1BTYA 1TNLA 5A8YA 1FIZA 3SNCA 2FI3E 1XUKA 3BN9A 1MQ5A 3F9EA 1C4V2 1YWUA 3TK6A 1C9TA 1N1LA 2XBXA 3RP2A 3PTNA 2VWLA 2Y5FA 1VJ9U 2TIOA 3RXBA 1A46H 1O3PB 1LHEH 3N7OA 5LPFA 3IG6B 3S7KB 2J98B 4AYVB 2HGTH 4OS5A 3U1JB 3SOSA 3B9FH 3S0NA 2V3OH 4TWWA 1C1TA 5JBCS 2AIQA 2F9PA 4JYUH 5DP5A 2BY7X 3OY5U 1ZMJA 4FUHA 2Y5GA 1H9LB 1XKAC 3LJJA 1J15A 3NCLA 3U8TH 2AMQA 2C8ZB 2KM0A 1CSOE 1HAHH 3SHAH 4YT6H 3UAIC 7LPRA 2RG3A 5DSFA 4FUBA 1UHBB 2BHGA 2V7QD 3FP6E 3UR9A 4ISHH 5IK2D 3GY8A 3V13A 3NKKA 2F9OA 4GCHG 2W3KA 4ABIA 1SOTA 2FOCA 1WCZA 1HJ9A 3RXHA 3E1XB 1GJ9B 3A8CA 2SGEE 2A7HA 3KCGH 3PO1C 2ZDKA 1MTSA 1F2SE 1AFQC 2GMTC 4LXBH 3WWFA 1P57B 1A0HB 5EXNA 3RXUA 1AFEH 5AF9H 1W3CA 2GDDA 1BUIA 2Z3DA 2ZHWH 1DLEA 1LVOA 4DY7B 2OINA 2XWBI 1A5HA 1BA8B 1DVAH 2J95A 5CHAC 2BY9X 1QBNA 2HNTF 2QXHA 3S69A 4NZQA 5FX5A 4YESB 1BDAA 1TBQH 2QF0A 1E37B 4ESTE 2Q1JA 1TGSZ 1GBJA 4JZIA 3SV9A 3F1SB 1AB9B 1NM6A 3PB1E 1NU7B 1BTUA 1XM1A 2WV9A 3STJA 1PJPA 4X1SU 1GGDC 3QX5H 3ZZBA 1W11U 1O3EA 2SNVA 1FONA 2IJOB 2YOLA 5DK1A 3RXVA 2O8MA 1ZYOA 3BIVH 3A81A 5ESBA 1UCYE 2BDIA 3RC4A 1DX5M 1Z7KA 2OUAA 1O33A 1SR5C 3M5OA 5JDUB 2BVSH 1Z1IA 1CGHA 4VGCC 2VIVA 1LO6A 1XMNB 2QXIA 3ENSB 4INLA 5EGMA 1FNIA 5KEDA 2XXLA 1H8IH 2IPHA 2R2MB 6ESTA 1JXPA 1RD3B 3LT3A 5CHBA 4ISIH 4AFQA 4INKA 1ID5H 2AYWA 1BRCE 3PLPA 1ARCA 1RTFB 1GBMA 3KHVA 1A4WH 3MH6A 3V7TA 5ETXA 1PPCE 4THNH 3EE0B 3GCOA 4X1PU 1GI9B 4RKOB 1WBGB 5JBBS 3FP7E 5F6MA 2J9NA 3PRDA 3BEFB 3C27B 3FZDA 3LKWA 3T2NA 5FPSA 1EJAA 1C1UH 2R2WU 3R3GB 3F9GA 3H7OA 1C4Y2 1NU9A 5SGAE 4FXGH 1A5GH 2UUKB 1G32B 1F0SA 5GIBA 1D6WA 2FOHA 3SU0A 1BIOA 3CS0A 3P8FA 3GOVB 1MU6B 1ZLRA 1BITA 2SGAA 1MTNC 1UVOA 1CT0E 1FZZA 2XCFA 3SQHE 2BDCA 2ZGXH 4P02A 5BRRE 4UE7H 3UY9A 1H8HD 1O2IA 1ELEE 1GHWH 1HAVA 3SJ9A 2GJGA 1MKWH 3BTQE 1FX0B 1GCTC 1QB1A 3N99A 2J94A 1AE8H 1NROH 5T6FA 4RSPA 1YKTA 2VU8E 4XSKU 1TA2A 2G5NA 1S6HA 1C5PA 3E8LA 1ELDE 1Q2WA 4HZHA 3KEEA 5FL7D 4MPUA 1GMDG 1U6QA 1O38A 1O5FH 4HTCH 2BY6X 1QRWA 1W0KD 1UTPA 2EI6A 1O3OA 4B6EA 2KCYA 3TIUA 4ABAA 1TPOA 3DHKH 1SI5H 2Q6DA 3ATIA 1O30A 3M7QA 3HK6B 3V12A 2Q6FA 2ZU2A 1FY8E 2OQ5A 4NFEA 4Y8ZA 1QL9A 8GCHF 3SNAA 1MKXK 3RXTA 1PPGE 2FOAA 4AG2A 2FEQH 4WMDA 1ZHMA
chains in the Genus database with same CATH topology
4CR5A 1QL7A 4FUJA 1MZAA 4ZHMU 1YPEH 4X2WA 1JIMA 3LPRA 4BANB 3KL6A 3SJOA 4DCDA 1GBDA 2O8WA 1QY6A 1GBBA 2VH6A 1GI3A 1YPJH 1MAXA 3K6ZA 4BTTB 1ANEA 1G2LA 1SGTA 1AD8H 4Y11E 4AB8A 3A82A 3BEIB 2PTNA 2XBWA 1P04A 2FX6A 1EATA 2Z9LA 1O3BA 1ZHPA 4UONA 6GCHG 4AGJA 1GDNA 1AGJA 3BIUH 1SGPE 2ZDNA 1O2PA 1RTLA 4B2AA 1ZHRA 3LDXH 3A8DA 2O8TA 4H4FA 4YLUA 3BEUA 3GY5A 4I32A 3FAOA 3S7HB 1KLIH 2ZGHA 5BPEA 2GD4B 1DUEA 1ESAA 1GI8B 1ELBA 3VGCB 1J14A 4FUEA 2ZFPH 2TGDA 1GHAG 4IC5A 1AWFH 3ZVAA 1OX1A 4ISLA 2UWLA 1V2PT 4K5ZA 5F8XA 2UUJB 5EOKA 1P9SA 1DDJA 4DJZB 1O2MA 1TQ7B 1Z8JB 1NFUA 1CBWB 1OWHA 4AORA 4CRFA 1FDPA 3O8CA 3TLOA 3LGYA 1SGNE 5TCCA 1NFWA 1V2TT 1O5GH 1MKXH 5GCHG 1HAXB 1O3GA 4XDEA 3SJKA 3SUEA 3MU1A 1TRYA 5EG4A 2AFQB 4ZHLU 2VIWA 4CRDA 1IHSH 1ZGVA 3ZVDA 1L1GA 1SQOA 2J2UA 3BTME 3RXEA 3UNRA 1YPLH 1JWTA 1GVLA 1OYQA 3AVZA 1GI2A 3PYHA 1O3AA 3ATWA 3UTUH 3U1IB 2LNCA 1O31A 4YT7H 1W2KH 1P9UA 1UTQA 3BTEE 1B0EA 1KXEA 1V2UT 2ZF0H 2ZU3A 3DA9B 3BF6H 1CQQA 1XUHA 4Q2KA 1A7SA 3U98H 2VVCA 3GCNA 4O97A 1MAYA 5FXLA 3V3MA 5TJXA 3IWMA 3ZZCA 1B7XB 3MFJA 1LPKB 1ETSH 4TWYA 2D26C 4ZKNU 4JMYA 1TBRH 1AY6H 5C5NA 2FOBA 4UFEH 1OS8A 2ZCLP 3A80A 1GJBB 2CJIA 5EODA 1UTNA 2QA9E 1V2OT 5HYOA 2GT7A 3M36A 3P92A 5T6DA 2P8OB 4AG1A 1GBCA 1ZMLA 2ESTE 3I77A 1O3FA 1ABIH 1GWAA 1KXCA 2TBSA 3MNCA 1Y5UT 2WV4A 3PMAB 4CH8B 2XCNA 2WYJA 5LPRA 3QDZB 4XBDA 5ESTE 1UVSH 2P16A 3GICB 1G30B 1SG8B 4M7GA 1GJ4H 2R3YA 1TX6A 3U8RH 7GCHF 4ZAEA 4HI3A 3EA8A 3GY6A 3Q77A 3RXDA 5AFZH 2NWNA 4WVPE 3ZZ3A 1ETRH 1Z71A 2FOFA 3D65E 4TPYA 1GI5A 1P2JA 1PYTC 4ZKRU 3SZNA 3ODDA 1K2I1 1XXDA 1NRQH 4AYYB 3SU1A 3MYWA 3KIDU 1AO5A 1AUTC 2SNWA 3SV7A 1UTKA 2SGDE 1HLTH 2FZZA 2ZDVH 3P95A 2A5KA 3AW1A 3CENA 5FPYA 3MU0A 3M5NA 1LDTT 3UR6A 1KXAA 1EZXC 1LPZB 2OC8A 4B73A 1GMHG 1IOEA 1GBEA 1LTOA 3ZZ6A 1G3DA 4RN6A 2F9NA 3T29A 7KMEH 3S9CA 5FBIA 2FI4E 3SJIA 3MH4A 5L2YH 1LVMA 1YPHC 3GCHB 1EP6A 1IQNA 2BDAA 1ESTA 4X2XA 3RXPA 1D3DB 4ZXXH 1SLUB 1NRRH 2J92A 1INCA 2BOHB 4FVDA 1GHZA 3DT0H 4BAQB 1BBRH 2W26A 3M7TA 3MNBA 4NGAH 1QFKH 1PQAA 2GP9B 1P8VC 2OBOA 2SGQE 4K3JA 4Y8XA 2BLWA 3KQBA 4Y79A 3E16B 5K7RA 2ZEBA 1UK3A 4WMFA 2R9PA 1ZRKA 5A0BA 2WPMS 4HGCA 3BG4B 3SV2H 2FODA 1MBMA 2BD4A 2F83A 4AX9H 1HFDA 1NC6A 3SGQE 1Y3XA 3ZZ9A 3SNBA 1QIXB 1XVMA 4A5TS 2ODPA 1EKBB 2FTLE 5AFYH 3G01A 4FUDA 4IW4E 2ANKH 2HPQH 4D8NA 5ABWA 2WYGA 4DIIH 1K21H 1C5WB 2H5CA 3ZYEA 1TGBA 3GCTG 5E0JA 4ABEA 1HPGA 1GI0A 1ZJDA 2C8WB 3M61U 3MNXA 3QK1A 3DD2H 1SHHB 1C5VA 1C2MA 4A1VA 1O2WA 3LGUA 3RLWH 1VJAU 1A0LA 3A7TA 2FX4A 1C5YB 5EW1H 1UJ1A 4JK5A 3SNEA 5DGJA 1JMOH 1MH0A 1ORFA 4I8LA 1Y5BT 4CRBA 2CF9H 3TVJB 1BB0B 4WMEA 1S0RA 4XOJA 1W7GH 2G55A 1O5EH 2LPRA 3E3TA 3TGJE 1ZRBA 1SGQE 1BHXF 1EZUC 1DPOA 1ZPCA 2OC1A 4MQAA 3BSQA 1CHGA 2HNTC 2JH5D 2VVVA 3MHWU 3RMNH 2ZFSA 3MU4A 1ZJKA 3VXFH 4OGYA 1PPEE 3PO1B 1H8DH 1HAVB 1O2JA 1EZSC 2V6NA 1BRUP 1UMAH 5EQQA 3UWIA 3P8OA 1AFQB 3KQEA 2GMTB 3QZRA 4ABFA 1FN8A 2WINI 2A31A 3BG4C 3ESTA 4JZEH 2C8XB 3VPKA 5FAHA 2PGBB 2ZDAH 2VH0A 1SLVB 4X1NU 4FU7A 2Z3EA 5CHAB 3PMHB 1HAIH 2EI8A 3ATMA 2QXJA 1EB1H 1GCDA 1TWXB 1O2TA 3JZ1B 3AASA 3ATKA 3BTTE 1GGDB 3DFLA 3LH3A 2ZGBH 2FDAA 4ABGA 2PSYA 1YYY1 1V2RT 4D76A 5L30H 1OP0A 1TOCB 3KQDA 2AGIX 2OCVB 5EPNA 2J34A 5C67A 4TPIZ 4DT7B 2O8LA 1W10U 1EPTC 3RXCA 1HUTH 4VGCB 1DLKB 3M5MA 1SPJA 4XBCA 4D7FA 2AERH 3MTYA 4IN2A 1ESBA 4E7NA 1TOMH 1W14U 4MDSA 2ZHQH 2QC2A 4CBOA 2GCHG 4JZ1A 1N8OB 3L3TA 1RFNA 2BZ6H 2RDLA 4TYDA 3EYDA 2SGFE 1AMHA 4H6TA 1VCQA 3M3TA 1VGCC 3ZYDA 1C5NH 1KXDA 5DKMA 4ZUHA 1GHBG 1TYNA 1G3EA 1TNHA 1C5XB 1Z1JA 1IQGA 3NUMA 1DM4B 2P3UB 2A5IA 1NS3A 4GAWA 4LOYH 3T62A 1UVPA 3UWJH 1XKBC 2ANMH 2TGAA 4SGBE 1QTFA 1TMUH 5LGOA 2FTMA 1MTNB 1SLXB 3PMJA 4I8GA 3MU5A 3LU9B 1Y3VA 1T8LA 3T25A 2NU0E 2BDGA 2HLCA 1XUGA 1C5LH 1GCTB 1UK4A 4MPVA 2GVFA 1GPZA 1A3EH 1E0FD 1F0UA 2H9HA 3HKIB 2ZZUH 1V6DA 5DJ7A 4B2BA 1BJUA 1MKWK 2W7UA 1MQ6A 3A84A 1HJAC 1C5QA 1P2KA 9ESTA 2M5TA 3GY3A 5FCRA 3Q76A 2OBQA 2C8YB 1TMBH 1C2IA 2CHAC 1L2EA 3SU4A 4OS6A 5C3NA 4CHAC 1K28D 1RTKA 2Y80A 4GLYA 2PHBA 1H4WA 4R8TB 3RMOH 4UFFH 3BTGE 4Q80A 1C2DA 1F7ZA 1HAYB 2H9TH 1UTLM 3RU4T 1BT7A 2ZHEH 3M3VA 5HMAA 4NSVA 3VEQB 1SQAA 2V35A 5A8XA 1EPTA 1QRXA 2F9BH 1P3CA 1N8OC 6CHAC 5DP4A 4X2VA 1OKXA 3GDSA 1SL3A 3EGKH 5A8ZA 2FLRH 1O2HA 1S0QA 5F03A 1GI4A 2DE9A 4DOQA 1K1MA 1HV7A 2VWNA 3A8BA 1HAGE 1FJSA 1RGQA 2XRCA 4I8HA 2A45B 3AAUA 1A3BH 5C1XA 4NA8A 2GCTC 3TJOA 2B0FA 5G4BA 1K9OE 4YZUA 1XUIA 1JBUH 1TPSA 1C2HA 2IN2A 2ZWLH 4KTCA 2NU3E 4H6SB 3OY6U 3RDZA 1P02A 4NA9H 1LQDB 1NRPH 1O35A 1NPMA 2TGPZ 2XBVA 1D6RA 2ZIQH 3SBKA 2P93A 1SSXA 1X7AC 4UEHH 3A85A 4F49A 1LVBA 1FXYA 3E0PB 3K6YA 4B71A 3UIRA 1DY9A 4INHA 1THPB 2F9VA 3F9FA 1THSH 3VXEH 2Y7XA 1TNKA 1IQLA 1BTHH 4IC6A 5E2PA 3SI3H 1YPGH 4D9QA 1AN1E 3ZZAA 4WF8A 2Y82A 1O2NA 2B8OH 1UO6A 3SV8A 3OU0A 3MO3A 3GY7A 4X8VH 2PR3A 4ZKSU 3U8OH 1ZPBA 2C93B 2DUCA 4YOJA 3UNQA 5C1UA 1VCPA 5FBEA 2BLQA 3T27A 1YPMH 1O2SA 3C1KA 3QWCH 1Z6JH 3TH2H 1WYKA 1C1VH 1K1NA 3P17H 1LCYA 1HBTH 4WH6A 1ZOMA 3P8GA 4Y0ZE 5JB8S 3UPEA 1F0RA 3LGWA 1Y5AT 2GTBA 5EQRA 3V0XA 2BVRH 1O3CA 1MUEB 2Z94A 3NXPA 2AIPA 2EA3A 3A7ZA 1D3TB 2OQUA 3SUDA 3P6ZB 3PMBB 4MNVA 1YF4A 3LIWA 4KKDA 1BBRE 1DICA 3H5CB 3DFJA 2A0QB 3O8RA 2G4TA 2TPIZ 8KME2 1ANBA 1TX7A 2CGAA 1HNEE 1N6XA 1V2MT 5DP7A 4A6LA 3AAVA 4X8SH 1KTTB 1O2GH 1W7XH 3RXAA 4ZH8A 2XBYA 1L4DA 3LGVA 1GJ8B 1WV7H 5JBAS 1A2CH 3A87A 3KQCA 5FCKA 6GCHF 1T32A 1K1LA 4CRCA 3SQEE 1OWEA 3B8JA 3BTHE 3VFEA 2WPJS 2GZ7A 4UDWH 3SJ8A 4E7RG 5K0HA 2K1QA 2NU2E 1VITF 2A4QA 1PPHE 1OOKB 2VIOA 3RXRA 2Z6BD 1TLDA 2PKAA 1OWDA 5EXMA 1IQHA 3A7WA 1K1IA 1S83A 1W0ZU 3HGPA 3GY2A 4LZ1H 1GHAF 1FY4A 1O2OA 2FOEA 4DG4A 1MMJN 1DITH 3RXKA 4IN1A 1CT4E 2BXUH 4BXWA 5J4SA 1CE5A 1P3EA 1GHVH 2Z9GA 2CF8H 3RU4E 1BMLA 4J2YB 1TE0A 3ZVGA 3A7VA 2ZC9H 1IQEA 1O2RA 1V2LT 2SGPE 2XC5A 1AKSA 1MTVA 2CN0H 4XE4A 5GCHF 1NN6A 2HRVA 3OX7U 1EAXA 2Y5HA 1BTWA 3UFAA 5TCAA 3A89A 1VZQH 1FIWA 1P10A 2G81E 1WAYB 2W5EA 4AN7A 2ILNA 2AS9A 5JB9S 2JKHA 3S9BA 1FQ3A 4YLQH 5IYTA 3QLPH 1C1PA 5T3HA 2QY0B 1EZQA 1SGCA 2BMGB 3R0FA 2A1DB 1FY5A 3E0NB 1BZXE 1ANCA 1G2MA 4AOQA 3M3SA 4KP0A 3SO3A 3STIA 1C2JA 2CMYA 4Y76A 1FAXA 2ANWA 5C1YA 2ZFRH 2JH0D 1TRMA 3MO6A 2VWMA 3GYLB 1SOZA 1Y3UA 2HNTE 1UTJA 1DOJA 1SGEE 1BBRK 1ELFA 1G3CA 2BD2A 4ABJA 1FMGA 1LPGB 2Y6TA 4HFPB 4NWLA 4X1RU 1BTPA 2PUXB 4Y6DA 3EDXB 2F91A 1G3BA 2V0BA 5DP9A 4TY7A 2FXRA 4O03A 2BXTH 4CR9A 1XX9A 2G8TA 5HXFA 4WWYA 1MU8B 1SBWA 1ZTLA 3F6UH 1TGNA 2GV7A 1FN6A 3Q3KA 3LGIA 1B5GH 5CMXH 3A83A 3VB3A 2Y81A 1PQ5A 1KDQA 1TX8A 3TNTA 3SV6A 5C2ZA 2GV6A 1SGFA 1LKAA 1SVPA 4Q7ZA 3A7YA 4KGAA 3MMGA 5FPTA 1NFYA 3U69H 1HAOH 3Q3YA 2RCEA 2ZTZA 1IQIA 1RIWC 1GBTA 3SW2B 4NIWA 1C2EA 1TONA 2UUFB 3VB6A 1PYTD 1FY1A 1THRH 1O34A 1NRSH 5CE1A 3RLYH 2HWLB 1CHOF 1SGFG 3TGKE 1JIRA 1FY3A 3ELAH 3T28A 1IQJA 2ZG0H 3SU5A 1V2NT 2TRMA 2ZDLA 1P2IA 1OWKA 1TNJA 3I78A 3GY4A 2DE8A 2JETC 1GJ6A 4JZFH 4PROA 1T4VH 1GMHF 5DG6A 4IMQA 2PTCE 3F68H 2ZFTA 1EAWA 2BDYA 3DUXH 3P8NA 5GPIB 5C20A 3URCA 5A0AE 1PPFE 1QB6A 8LPRA 4DVAU 1KTSB 3RXOA 3OSYA 3ZVBA 1V2VT 2OLGA 1Z8GA 2I6QA 3BTFE 4A7IB 4E06H 3NWUA 2STAE 3D49H 2BDHA 1EQ9A 4YOGA 1TGCA 1E38B 5IDKA 4D7GA 4K8BA 4Z6AH 1HYLA 5PTPA 4TY6A 3PTBA 4FUFA 5C5OA 2VIQA 3RXSA 1MD7A 4X6PA 1F5RA 4IS5A 2Z9KA 3TH3H 5AHGH 1LHGH 2B7DH 2Z7FE 2PLXA 1GL1A 3RU4D 1MZDA 5EQSA 1O3KA 1QJ6B 1F0TA 1GVKB 1H9HE 2VB0A 2P94A 1QJ1B 2ANYA 1KIGH 1TNGA 1EPTB 4BAKB 1GJ7B 3TK5A 3Q00A 4YM9A 3GCTF 4K8YA 2G52A 1S5SA 1NFXA 1V2WT 1E36B 1TABE 2VGCC 1GG6C 1EP5A 1O0DH 3B23B 4XBBA 4ABBA 4JYVH 3UQVA 2ALVA 4AB9A 3IITA 1TQ0B 1NY22 2O8UA 1GI1A 3MOCA 3ZVFA 1RRKA 1H9IE 2BYAX 2WUBA 4BAHB 1WSSH 3KN2A 1V2JT 1CT2E 1VGCB 1LHFH 1P09A 3FANA 1HAPH 1TMTH 1UVTH 3ZVCA 1V2ST 2UWPA 2HPPH 1AU8A 1GMCF 4AZ2B 2QGRA 1KLTA 1YCPM 4B76A 1L4ZA 2Z9JA 2BQWB 3MU8A 4KELA 4A1TA 3SGAE 4O3UA 2PKSC 1O2UA 1T7CA 3NZIA 1S84A 4KTUA 4OGXA 1TGTA 4GHTA 4FU9A 1LVYA 1YCPK 4X6OA 3RM2H 5T6GA 1O3IA 9LPRA 2GX4A 1EJMA 2BLVA 1B0FA 2ZFQH 2FP7B 3SUFA 2FOMB 2ZGJA 1SQTA 3TPIZ 1