1TAEA

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
QPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase, NAD-dependent
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 104
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1taeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1taeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1taeA02
3GDEA 5LMUB 4DV2B 1IBMB 1P8LA 4B3SB 2UXCB 2CFMA 4PZ7A 4JI8B 4DUZB 5BR8B 4LH7A 4JI1B 4NXNB 1HNZB 4UCTA 1TAEA 4UCOA 3PN1A 4DV7B 1FJGB 1X9NA 1HNXB 3TY5A 4AQYB 4EQ5A 3UQ8A 4LF9B 1XMQB 4UCVA 3SGIA 4DUYB 4DR1B 4JI0B 1FVIA 4LH6A 4DR6B 5D1OB 3S24A 3TY8A 4JI7B 4CC5A 1CKNB 2UU9B 1P16A 4DV6B 1J5EB 3KYHC 2HVSA 5IWAB 4DR7B 4GKKB 4CC6A 1CKMA 3NBZB 3BAAA 1N34B 1VS0A 4TOIA 5D1OA 2UUAB 2HVQA 1I94B 2ZM6B 1IBKB 2HIXA 4DV5B 4GLXA 1CKNA 4DR3B 4DV0B 2HHHB 4UCUA 2F4VB 4JI2B 3L2PA 2E5LB 1B04A 3NC0B 3JSNA 3W1BA 1XK5A 4LF5B 3T1HB 3NBYB 1HR0B 4LFAB 4DRFA 1XNQB 4X66B 4DV1B 1N36B 4JYAB 3TY9A 3BA9A 4UCRA 4NXMB 4JV5B 4EFBA 2VQFB 4X62B 1XMOB 3BA8A 3OTOB 4PZ8A 1XNRB 1IBLB 5FPRA 3W1GA 1S68A 2Q2TA 3T1YB 4JI5B 4LF7B 1N33B 4JI6B 4E6NA 2OWOA 4EEQA 4UFZA 4KHPB 1A0IA 4UCSA 1CKOA 2UXDB 3VNNA 2UUCB 4X64B 2VUGA 4EFEA 3QWUA 2UUBB 5FPOA 4YHHB 1XDNA 2Q2UA 4B3MB 1V9PA 4DV3B 2HIVA 4B3TB 4DR4B 3W5OA 4B3RB 1TA8A 4PZ6A 3RTXA 1N32B 2HVRA 2VQEB 5D1PA 3RR5A 4DV4B 3GJXB 4LFCB 1DGSA 4DR2B 5LMNB 3BABA 3GB8B 1HNWB 5DISC 3JSLA 4YY3B 4LFBB 4LF6B 4LF4B 4OX9B 4DR5B 4K0KB 4JI4B 2UXBB 4GKJB 1ZAUA 4X65B 4LF8B 4JI3B
chains in the Genus database with same CATH superfamily
4J9RA 3KREA 1VAJA 3CVZA 4WBNF 5LL6b 5IYBG 4L8JA 4FLXA 5BR8B 3RGZA 4O3SA 1N48A 2ZDHA 5EBMC 1HNZB 3LNMB 2HG5C 4UVCA 1M4UA 3OR7C 4ZQIA 4PI0A 2WLLA 1XMOO 1DAAA 1PPJH 2KG7B 4RUFA 2XAFA 3K08A 4O81A 2CW8A 5IYDG 4LF9B 2ZDIC 2EINB 5CBHA 2JGDA 1WCMA 1IVSA 4JI0B 4J9PA 1BQ0A 4O86A 2AGOA 3UZBA 5DECA 1AVMA 2E3CA 3OW2U 3JZ6A 5KT7A 3CEBA 3VQVA 4CC5A 4A3JG 5DM6V 3CPWU 5B5EZ 4H37A 5BPFA 4X88A 1QR9A 2CTQA 3Q8QB 4ECWA 2RMKB 2A3QA 2DWEC 2L35A 5KHHA 2IP4A 1K4DC 1GM8A 4O2AA 2HVQA 4Q45A 1Z2PX 2GLTA 4DR2H 5LMNH 1IBLH 4WF9V 2W6OA 4HNUA 1DIKA 4RB2C 4DV0B 4K8ZA 3QO7A 4OX9H 4LP8A 1I3QA 3JZFA 2A7WA 2Y4TA 5KFJA 2RDCA 2QM8A 2XASA 4B08A 3KALA 4ZHQF 1GN6A 3AK3A 1SRYA 3X2QC 3T5JA 2AXTZ 5EDWA 3CCLV 3RAQA 5KFKA 4LF8O 1P49A 4ED1A 1I5XA 2Y48A 4X66B 4A2BA 3RFRA 4PDLA 3STLC 1GH6A 4TQDA 1AI7A 4FM9A 4G3IA 4EKWA 3OTOB 4NXNO 4NTYA 1XNRB 1IBLB 3CC2V 4NTXA 5FNVA 1S68A 1F23A 3AG7A 2ITCC 3G6XA 3JAMN 2B63A 4NTWA 5KA5A 5I5UA 4KHPB 3ABTA 3U0ZA 1XMQO 4UCSA 4J42A 2UXDB 4I4TB 4Q0YA 4PELA 3CD6V 5K1XA 3C3TA 4O3OA 4RB3C 5BWVA 4TWKA 1G8MA 3TK1A 3FYEB 3CXCU 5C8YF 4FFRA 1J5EO 3CRCA 3V6KA 1GGOA 4GKKO 2UUAH 1YTFB 1FXKA 2BQUA 1IBKH 4DV5H 1DGSA 3GB8B 2CDYA 1HNWB 3E83A 2UVWA 4OXSA 4ICGA 1FXVA 5LA6F 3CCVV 4O4LB 2CKZB 2IU0A 1XUQA 2NU7B 1KKCA 3OAAG 4PA4A 2YWVA 5B1BC 3QZ7A 2HKOA 3HXLA 4FM2A 1KJ8A 3OD4A 5BY1A 4NXMH 3KHRA 2A79B 1BGWA 4DV1O 4ECQA 4JYAO 3WB1A 3MHHC 4ZOLA 1YHQV 1I50A 5JQGA 5FR9A 4F50A 2LW1A 1O9HA 5L1IA 2P4VA 1S5HC 2R92G 5F2VO 4LF7O 4DR6B 2PI5A 2W71A 4OPAA 2QKAA 3LSQA 2K9PA 3RT3C 3HT5A 3PW5A 5IY5C 4O2BA 2UUBH 4X64O 5KX5B 1AP6A 1K4CC 1V55B 1J95A 3UKMA 4MVMA 3HB9A 3F5WC 5LP6C 4FLZA 2Z04A 4ECXA 3WWHA 3MR6A 1F4MA 4DR4O 5KFLA 3GTMA 4MTXA 4LFCH 2XD4A 2P06A 4GLXA 5BWXA 2BTQA 1RM1B 4G28B 1WCMG 5FD6A 2CNUA 3MFIA 2IMWP 1UC9A 2YC0A 4TQRA 4GKJH 1ZSPA 4ASUG 4IYHA 1S0MA 5C93A 2PI4A 2FMLA 3HKDA 3VPBA 2P90A 4YB8B 4B3SO 3TY9A 4RAZA 4O4HF 4X1IB 4ZI7B 1A32A 5HFMA 2Q4PA 4UUGA 4TV8A 1FJGH 3HOYG 1HNXH 2W57A 3T4DA 3L4JA 2R8JA 3DSQA 1EN5A 3ZRWB 5CB4A 4O7RA 4YIOA 3JRWA 1KJQA 1ZQ7A 4MVQA 2Q7GA 3RYCA 2UVUA 2DWCA 2Q9LA 4YP3A 5GONB 2O57A 4D6TH 2EJ3A 1OCZC 2WLKA 1JCHA 2EZOA 2UU9O 4JI8H 1V9PA 5EZYB 2X7RB 2ZR2A 4MVSA 4PWQA 1SERA 1UNNC 4F4XA 4A93G 1W96A 2J6SA 3ZHSA 2H3OA 1R3LC 3ZN0A 1FS0G 4DL7A 4DV4B 2W9CA 3F7VC 1S5JA 3V4SA 1TUBB 3IAYA 1XREA 3E8BA 2W6QA 2GUZB 5DGIA 2HGXA 1G1XB 1G2WA 2AHZA 2GSMB 4EEYA 2ZINA 1QR8A 2EINC 5LXTF 3LDEA 5FLXN 1EKFA 2QWRB 2JK5C 3AG2B 1P8LA 4M0JA 4F6RA 3BJYA 4O4IA 3RB6A 4JI8B 4LBEC 3QQMA 4DUZB 4GC6A 2GTSA 4DXWA 3N40P 2H94A 4FU0A 2HHFB 1M93A 2NVXA 4BIUA 3H1KH 2UVVA 3JAKA 1QBZA 3TETA 2ZXWB 3G67A 3FDSA 1M5IA 1VQ4V 1OHHG 1N33H 5KT2A 3G6EV 1S0OA 2R6FA 3OGIB 1DV2A 3ZMZA 1VEWA 4JI6O 2WLJA 2QM4A 3UCSC 4MA5A 5J2TF 1CKNB 4YHHH 2BQRA 1ZL8A 4CE5A 4DW1A 3WNZA 3T1CA 3ZJZA 4DV3H 4EYIB 2JDIG 1Q6UA 2VQEH 3ZHUA 1N32O 2WAQA 3OFNG 3DGEA 2Y0SE 1SQQH 2VPSA 4W4LA 4I0XA 2D2CB 3LUTB 1VQ5V 2DIKA 3FAVA 4J9KA 4O3PA 4IHJB 1L0NH 4YAJB 3AG1B 3NGDA 4J9QA 4QJFB 3K3WA 1BCCH 1Y6XA 4U7OA 1V54B 2ZIMA 2FE3A 4MTFA 2QB5A 2QYZA 1Y4MA 3VA7A 4R8CA 3H1IH 3CCEV 5KMGA 1DK1A 5KUKA 2VQFB 5KFPA 3D3QA 4X62B 4DV7H 5BXZA 5JH7A 3K0DA 1EYZA 5FPRA 1GK9A 4AQYH 5DMXA 4U3FH 2NUAB 2Q2TA 4X1YB 2RF4A 1VQ8V 5IE9A 2CGOA 1JX4A 4GUNA 4NYKA 5BWTA 2JJ1G 3ZHVA 3WWIA 3WU2Z 1SQGA 3E2EA 2YZGA 2FLNA 5JVDA 4JI4H 1MMMA 3RGBA 3NR7A 4DV6H 2RGRA 1IBMH 3E8HA 5IWAH 3HOVG 5I5VA 1VQLV 4EGJA 3ETGA 1TWHA 4DR7O 3GIPA 4A3LG 1MABG 5J2UA 4YBZB 4DL5A 1JA8A 4WBNA 5KHKA 2JVDA 3FB7C 3H20A 2XUMA 3BFRA 1AILA 4JI4B 3JARB 4F6EA 2N04A 4N21A 3LDCA 1Z2NX 2DPIA 4QWBA 2NU9B 2QR4A 5LMUB 3J80W 1IBMB 1XNQH 3AW8A 5FNVF 4RU9A 5I5WA 2K1EA 1M90W 2QWNB 3GTKA 4MTOA 2EIJB 1HP8A 2HJWA 3ML0A 3RYFB 1V55C 3CEIA 1B3QA 4E2LA 4DAAA 1YF2A 2FKXA 3CS5A 2HHHH 4WFHA 2Q68A 2VA3A 4TM5A 2Q0AA 1FAFA 4Z1VA 4R7RA 3K3PA 4PA9A 3HKBB 2PF4E 3ETHA 1WPBA 1EN4A 1NTMH 1RM1C 1KC7A 2R93G 2JA7A 3MD0A 1I0HA 2XNDG 2ZE7A 4UV8A 3K5MA 1KJJA 4JPRA 2Q8VA 4XDJA 1N36H 2N74A 4YR2A 3WWJA 1QU7A 4TV9B 2R82A 4B3TO 4YAKB 1NH2D 3JALB 2CE4A 1KKDA 4MAMA 1P7GA 3DAAA 4DR3B 4FGRA 2HHHB 4QWAA 2VUMA 2F4VB 3SPIA 3ZX6A 1GRJA 1S0VA 3J7AU 3PZPA 3I12A 2YDEA 4UV9A 1RSOB 4JUZA 2F1MA 2XOKG 5CMUA 5E25A 1H2GA 3DC5A 4X65H 4QIWE 4YIPA 2GQRA 2UXBO 4ZOLF 4O7NA 3WO1A 1MSDA 2CTWA 5JQGF 1XILA 1XI1A 3FMAA 1N36B 4O4JB 2OTLV 2JEXA 4JI1H 4X1KB 4JV5B 2M7WA 4MV3A 5I5SA 2IH3C 5BR8O 3GTGA 1WPXA 5LOVF 3K3VA 5I5YA 1HNZO 3SPHA 4FM1A 2E2IA 4FPPA 1HWYA 1JKJB 1PD3A 4ED7A 2BTOA 4O82A 4O2BF 4E6NA 3MWMA 4LF9O 4I9WA 4DR5H 2Q7EA 4JI0O 3HKEB 1YIJV 2KSWA 1PK8A 2UUCB 2WLMA 3GIIA 5C5JA 3JD2A 3LP8A 5FD5A 5A9GA 2ABJA 1ZETA 3N6RA 3HOUG 1NZ6A 1KUQA 1WA8A 4U3JB 3CRAA 2NN4A 5C4XG 3DF7A 4O4LA 3ETDA 3H4DA 4HNAB 4B3RB 3AG2C 4IT5A 5D1PA 4YJ2F 2ZJTA 3R9RA 4JYYA 3V6JA 3RYIA 1Z5WA 3P32A 2Y4RA 1Q3EA 5KT4A 2W6ZA 2FYUH 2ASDA 4DV0O 4DR5B 2YW2A 2ZXWC 5CBFA 1BZKA 2R7ZA 3U55A 3JCUZ 3T54A 5JVLA 3U11A 2Y0IA 4JV0A 3EVKA 2R7KA 4BY1G 1HR0H 2FP4B 4LFAH 4TV8F 4P30A 2CFMA 1IYDA 5DN6G 5D5PA 4X66O 4MV6A 4MV1A 3IN5A 2HR3A 3CRMA 4IWYA 2AHYA 5EYPB 2X6BA 5I60A 1KJ9A 4FFNA 1ZTEA 3U54A 1I94H 4NLGA 4TUYB 3OTOO 4O7SA 1XNRO 4QIWF 3CC7V 2HVKC 2QTOA 2PYJA 4CH4A 2HP8A 3E8FA 3CRRA 4JI2O 4KHPO 1FXHA 4QE9A 2UXDO 5IJ9B 3ORRA 4J9NA 1BE3H 1SS3A 3PR5B 2CQYA 1A9XA 1A0GA 5GTHZ 2CNQA 1AR1B 2QK4A 4ZBMA 3AG1C 3K5HA 3TIGA 4NZMA 1SESA 3CHXA 1CKMA 1Q8IA 1SQXH 3F8NA 1OCOB 3LNNA 3GV7B 5D1OA 1V54C 4WD3A 2FK3A 1I94B 2ARHA 1F4NA 3CB2A 2EJRA 1Y1VG 2R8GA 4LF6H 4I55A 5KHIA 3RBZA 3RB3A 1PL0A 2ZGIA 3IC9A 2E5LB 1HNWO 5I47A 1VQMV 1RJRA 3J7AK 4X1IA 2OLSA 1R3KC 2GPSA 4XYMB 1TVKB 4H33A 1JQ0A 1NVPD 1Y74A 4DV2H 3DTUB 1C3OA 2WPDG 3OUSA 3ZRWA 1IXBA 3BA9A 4Q8FA 4XDKA 1K5QA 4ED0A 1MZFA 5GONA 2VPQA 2V9WA 1ZHQA 3BCCH 3AEIA 1EUCB 4IWXA 4RUEA 4HYKA 4MSWC 3ZMVA 2XAHA 1CKOA 1W2BU 4YY3O 5IYBO 3O65A 4A3KG 3KCYA 4DR6O 1WJZA 4EFEA 2B1GA 1Q5OA 5DG8A 5KFNA 2I8CA 4WFFA 4F4YA 1YJNV 1JLLB 2YRWA 2GUZA 3MR2A 2I87A 5L3CA 3RJ0A 1MZEA 1H8HG 1URFA 4ECUA 1KB9F 3A8TA 4U7CA 1PL4A 4YQWA 3RR5A 2EX3A 2COJA 3I5DA 4C5BA 4CH3A 4JAUA 1VQ7V 1B6SA 4ZKIA 5LYJF 4ECRA 5IJ0B 1I1LA 1SQPH 1PKXA 2EIJC 2HJFC 2P6JA 3H01A 3T9BA 4DR1H 4DIMA 1YEWA 2ITDC 4BAYA 1YDXA 1E4GT 4LF5H 4DUYO 2FMAA 2R9AA 3H0GA 4MTEA 2CGNA 1E4EB 3T1HH 1GM7A 4BW5A 2HGSA 1JFFA 3KKYA 2WAMA 1WRVA 1IOWA 2NU8B 4HYOA 1YSCA 3OMNB 3VMMA 5J2TA 1QNMA 4PD4F 4P9OA 4AI8A 1GTOA 2A9HA 2FJZA 2G38A 4HNTA 2YL2A 3R5XA 2ZQMA 3SGIA 4DR1B 4DQNA 5IT9W 1H2LA 1MG1A 1W0JG 5K3WA 2R92A 4FLTA 1WP8A 3DXRB 3JYCA 2PTMA 1P16A 1CPYA 4J0MA 5J2UF 4Q44A 2HVSA 4NVPA 4EB6B 3HKZE 3M9MB 5C1OA 2F43G 4X9QA 1A3GA 4IGGA 2ZM6B 1NH2B 4FFBB 4TT3G 1THZA 1ZUQA 3STZC 1AB3A 1Q6IA 3GVMA 4DV4O 5KFMA 4IIJB 2RQ6A 3K04A 1OZ0A 3ZMUA 4LFBH 1TUEB 1SKVA 4L87A 4UB8Z 5H9CA 3SJBC 2W6NA 1EUDB 2F93B 3OGCC 5KAFZ 5EC1C 1VF6C 4LNUA 4WFGA 3VQYA 5H80A 3IJ4A 2R8HA 1I08A 3OHBA 1BGYH 4DUZO 1F51A 2EILB 2QTSA 1M7JA 2NR5A 3GTJA 4P9PA 3QO8A 3T2MA 3V4ZA 3E86A 1BXRA 5KG5A 4Q6GA 4GX1A 3ZMTA 5GTIZ 3MWDA 3ZIAG 2XAJA 2DN9A 4B7EA 2EBOA 3E22A 4QGPA 5KG7A 3FFQA 4JI7H 2R87A 1GMGA 4MV4A 2XAQA 3KHHA 2W9BB 4JI3O 2VWKA 5EWGA 2DE0X 1I2LA 5DGBA 3TXQA 1KJIA 2XGPA 3ABMB 5CR5A 3W7SA 2AW9A 5CA0B 4EBCA 4J7KA 3MAQA 4DR2B 5LMNB 1IX9A 2ZE5A 3APQA 4X89A 4O3NA 3BPZA 2Y0SA 4OX9B 2XCAA 1RK5A 3SJAC 1CEZA 3OT7A 3SNOA 3Q4HA 3LSSA 1SQVH 1WN7A 4RNMA 1GO3E 4IR1A 3MDSA 3P3PA 2XAGA 4GX0A 2VOBA 3V6HA 1DTOA 1AROP 1SZTA 2YICA 4N23A 2OCCB 3FKIG 1WR2A 2QSAA 2VQFO 2L6LA 4A2AA 3BQ2A 1R73A 4X62O 1D2DA 1X9NA 3T1YH 2V5AA 1W93A 1VIBA 1OCOC 2IM9A 4I9QA 5L3DA 3A0HZ 5EBWC 2FB9A 4IZOA 4ED8A 2ODTX 3RN4A 4M7EA 2EULA 3OM3B 3ORQA 4O4LF 3H0GG 3CX5F 4I7HA 4TVIA 3RGXA 2PBZA 3H3VH 1D5AA 2X5RA 4B3MH 2XCPA 4ED2A 3JATB 3N43B 2RDJA 5KS8A 1RSOA 5JJNB 2W0XA 4F4ZA 3S3WA 2UUAB 3LULA 1UJWB 3HOZG 2V1DA 1O9GA 3LDDA 2HIXA 5B1AB 1IBKB 1E79G 4DV5B 5LA6B 1H2KA 5EIBC 3NUAA 4L1KA 2NU6B 4QWCA 4JI5H 4LF4H 3ETQA 4K0KH 3RYHA 4YR3A 3D8CA 3GIQA 3JSNA 5LOVA 5BMVB 5KT6A 2ZDIA 3HBLA 3LQSA 1K34A 3AK1A 1M9NA 3UT5A 3KAJA 4ABMA 2UXCH 3EXAA 3N2GB 2FLPA 3K5NA 2Z3YA 5LMUO 5KX5F 1VF6A 4NXMB 2XTAA 1JXLA 1KYOF 2NNUA 1JVMA 4I50B 4GLWA 3HKEA 4K35A 2Q69A 3WB0A 3HKCA 4RB1A 1N4CA 5KFUA 2OH2A 2DJVA 2PN1A 3IC7A 2ATKC 4K3AA 2Y69B 3TEKA 1K97A 2LP7A 2COIA 1EKVA 4NZNA 5JJJB 3J80N 4JI5B 3R66A 4EYHB 1FFXB 4MV9A 1GO3F 4LWSB 5KFDA 4RZRA 1RYRA 1S5LZ 4YJ2A 5DLFA 3G8CA 5DQHA 4FS2A 2JEIA 3VQXA 1I6UA 3N2KB 2Z02A 2UUBB 1OWTA 2HIVA 1N34H 3G6VA 4I55F 4PZ6A 3LMLA 1WP7A 3ZMSA 4O83A 1VQNV 3DC6A 3GJXB 4U7NA 4LFCB 3Q8RB 1GSHA 5KFYA 4HBNA 2YCHA 3FYIB 4DR3O 1VBGA 4E4TA 3T7AA 1XL4A 2F4VO 1EFRG 2O03A 2DPJA 4J10A 2Y0PA 2DLNA 4TQFA 4GKJB 3U10A 3SJCC 4RO2A 2YZMA 4RB0A 4QIWA 4TUYA 3PW4A 4GT1A 3SYOA 1SETA 4J11A 5GONF 5B3SC 3T4ZA 4M9UA 4RCNA 5CA1B 4MT8A 4BIZA 4LC1A 2ASLA 4XDLA 4UCTA 4QW9A 3RB0A 1W59A 1XMOH 3H1HH 2WLHA 5ITZA 1K73W 4JV5O 1FJGB 2MK3A 3ETJA 1HNXB 1YJWV 5EWEA 4R6ZA 2XC9A 4KFMA 4D7TA 4CZZA 2IJHA 2CH7B 3SPCA 1FKAO 2R7MA 4PDVA 5KG0A 3TY8A 1D5NA 2R93A 2UUCO 3TXSA 4YJ3B 5K2MA 1VQOV 2WTFA 4O7TA 1UFIA 4KUMA 4B7KA 3CCUV 5DAAA 1V51A 5KFHA 4TOIA 1TVKA 1SZXA 1RK6A 2JA5G 1TGOA 3ASNB 1H2SB 2ZIOA 3W7WA 1Y76A 4B3RO 2W70A 3SPJA 2FL4A 4YR0A 2VRZA 3BVOA 2W6PA 4WFAV 2EILC 2YEVB 1AI4A 3MR5A 4H13B 5JQWA 1I2KA 1H8EG 3JRXA 4LF8H 4DR5O 1EBOA 3N44B 1BNCA 2HVJC 2WLNA 5F9LA 2ADPA 4U6PA 1K83A 4DRFA 3GTPA 2OIGA 3L74H 4NXNH 1K92A 2GPWA 4DRXA 4LCUC 2B5UA 4PZ8A 3GILA 1R6KA 5LP6A 1E1RG 5IYCO 3PW0A 3ABMC 1XMQH 1N33B 1US6A 2W6JG 2OT5A 1A0IA 4ECVA 3O9OA 3CE2A 3MR3A 4PV1B 4DK0A 5LYJA 3RWRD 3N41B 4MVUA 4RZQA 3CCMV 5LBQA 3SI8A 1J5EH 2X6AA 5IJ0A 5FPOA 4YHHB 5T14A 4GKKH 3B4SA 2XIGA 4DV3B 2P5OA 2WLIA 3OHAA 1WNSA 1TA8A 2VQEB 2ZD9A 5FJ8G 1IOVA 3DTFA 4ED3A 1VF5B 1IURA 2UXNA 1KMIZ 1S03G 2ETNA 3SYQA 1N0NA 3PFFA 2OCCC 3U9SA 4AILC 3FB5C 1K9MW 2E5LO 4JASA 2GBOA 2WLLB 4X20A 1B33N 3OUFA 4DV1H 3WFVA 3ZCCA 4JYAH 3N27A 3JD3A 3SYPA 2DWDC 5HV6A 2Q5ZA 1QHTA 4DL3A 4CMDA 4IRKA 1P84F 3PN1A 4DV7B 5BYAA 2N05A 1VBHA 4BWSC 2RGVA 1EZJA 2QM7A 4AQYB 2E2HA 2BOCC 4LF7H 4I5SA 3AG3B 2QWPB 4HNVA 2AU0A 3GV5B 5B1AC 4O2AB 4X64H 3ABLB 5IYCG 5L3FA 2AZ0A 1H38A 4DV6B 3JAWB 3TQ1A 2KG7A 4FK5C 1OCRB 5CBGA 5IWAB 1L8DA 2AGPA 2A0LA 4DR4H 3AK2A 2W6MA 2XGQA 3T5KA 3ZBHA 4BBRG 2PMZE 2DQ3A 3N6XA 2ZE6A 3BRCA 4ECTA 3T5LA 4UB6Z 3QVNA 3CCJV 3JASB 2JS3A 4K6NA 2QDOA 1Z2OX 1AUVA 1Y1VA 2LFRA 1XOUA 1K1SA 3GV8B 3NC0B 1XK5A 2Y69C 2JS5A 3F7YC 3H1LH 2EJ2A 1JJ2U 2V4QA 4QPJA 2KB1A 5FNVB 1NS1A 3P30A 4B3SH 1BHAA 3MWEA 2E75B 1XNQB 1H2MA 2C22A 4NYEA 5KFBA 1XBLA 4JZ2A 5EC2C 5KFOA 4G2KA 3OMIB 5KAIZ 3G6YA 3W7TA 1CQIB 1NJIW 2R7NA 1XL6A 2BE3A 2X6CA 3RW0A 2J6TA 4KXRA 5KT3A 3PVXA 4EEQA 1NTZH 5BZBA 2B1IA 1FXKB 3NXSA 3JD1A 3G6BA 3JD4A 3T9DA 3L9DA 3HKZA 5IT9N 3KXYT 4O4JF 2QKCA 3PJSK 1FPOA 1BQZA 4I4TA 1QVGU 4FZ1A 2R9RB 2R86A 2WYOA 2ZM6O 5B1NA 4JTDB 2AQ4A 4MA0A 4ZOLB 4BR6A 3ASOB 5JQGB 4BWAA 4X65B 1WB7A 5A2QW 5DQGA 5KFCA 3UFXB 3VOUA 4ECZA 2CTPA 2HEPA 4IYIA 3VQWA 3GQCA 4JI1B 3QF7A 4FLVA 3VPCA 5KFXA 2JEFA 2R72A 3PR4A 1X4TA 4QWEA 5DEDA 3CJHB 2BOBC 2Z5UA 3GWKC 4O2BB 1IDSA 5CA3A 3T9FA 3KHLA 1SCUB 5DGHA 4A5UB 3K5LA 4CKEA 4C5CA 3ASNC 3L71H 1H2NA 4GX5A 1SF9A 1KU9A 2C2AA 4J9OA 2P22C 4XBFA 2AGAA 3RVYA 4R7CA 3TIIA 2BCCH 1XHXA 3G71V 2OYQA 1QVFU 2BTQB 2HDKA 1VQPV 1JX9A 4Q8EA 1BSMA 1QQCA 3B2EE 4EG0A 4CC6A 1Q90D 3G8DA 2W7OA 5CE8A 1N32H 3OUZA 5BWRA 4CKCA 5KFRA 1KD1W 3FB8C 5FL7G 1GKFA 3HKDB 1BS3A 2W6IG 4OPHA 4UCUA 5KX5A 5BWUA 2F95B 1AN7A 1IBLO 3JD0A 5LMNO 4DR2O 2J9GA 4TUYF 3L2PA 2YZNA 2W7PA 4I50A 4OX9O 3MFHA 4TV8B 3UYYA 2IW5A 4O7LA 1WSCA 1EZVH 2EJ7A 3ZRVA 2RJZA 2WE6A 4BXXG 5EOYA 2W0FC 2W8LA 3NBYB 1HR0B 4LFAB 3RVZA 1KQSU 5CB4B 1CS0A 4LWSA 4UCRA 3OSPA 1A48A 3RYCB 5B66Z 1GN3A 1KECA 3N8DA 1NR7A 1N56A 1YCIA 1ZX3A 4A3DG 2V59A 3J81W 1T5EA 2JA8G 2LO1A 3SPGA 4JZGA 1OV9A 5KKNB 4ZI7A 2M6YA 1OBDA 2W9CB 3RIZA 3QWUA 3Q8PB 4QE7A 2YUAA 1M0WA 3I4MG 4DR7H 2AZ2A 3IG0A 4JTAB 3LWBA 5H2FZ 2UXXA 4QNHB 5AG2A 4JV2A 1LR1A 3I55V 4Z1MG 2UUAO 4O4IB 5DISC 1IBKO 4DV5O 2YYAA 4LF6B 4AHCA 2CTRA 5IP9G 5EZYA 5KG1A 2M05A 2OCHA 2EIKB 3FKSG 4DL4A 5B1OA 3JAKB 2YU9A 4MTGA 2JEGA 3AG3C 1T94A 2IJIA 4DV2B 4ME6A 5L9XA 4PJ0Z 4MW8A 4IL6Z 1TUBA 5LP6F 3ABLC 5KG2A 3T9AA 1Q81W 1JDEA 1PM9A 4QPKA 2LQTA 2CH7A 5H6QA 2Q0OC 1GLVA 4NXMO 3KG2A 1OCRC 1JIHA 1JDBB 4FE2A 1RPOA 4EBEA 3FKIA 4ECSA 1ZL8B 3GIJA 5KHGA 5E1AC 4EQ5A 3RAXA 2HLDG 4A3MG 2YIAA 1SEIA 1JPXA 3IGAC 5DQIA 3ZRXA 4WFEA 3RV3A 4LH6A 2QEXV 2BQ3A 2HHFA 1Z5VA 4FMTA 5KFIA 4EBDA 1ORQC 1COWG 3B8NA 1E4FT 4JV1A 1UPGA 2GDSA 3SYAA 1S10A 2LFSA 4I0XB 3KYHC 1N0JA 2P67A 4NKGB 3K5IA 3L70H 2UUBO 4B3TH 3FAVB 3Q8SB 4IRDA 5KUMA 2F23A 3NBZB 5KFVA 3ABKB 2C2RA 1TWAA 4PDMA 3G4SV 1S72V 5KLVH 1CKNA 1YVWA 3EPGA 4LFCO 3CXHF 5KMGB 2PYLA 2ZE8A 5LGUA 3K57A 2ZNIA 1W0KG 2UXBH 3ICXA 3UZOA 5CN0A 1MOFA 2QF7A 4LF5B 2WB1A 5JH7B 4YXWG 5L3BA 2HG8A 3T1HB 3ABUA 4GKJO 3GIKA 4ECYA 1N8RW 2B9ZA 5C1PA 2V58A 5BR8H 1FXKC 3EFFK 1OCCB 5KG3A 4K8XA 5IYZB 1HNZH 5JWPA 1NKDA 5JVDB 1AJQA 2DOSA 3ZEDA 1GSOA 4IHJA 3ZHQA 1X59A 4H44B 2JGUA 4CH5A 4QJFA 3R23A 1KEEA 1FJGO 3KCXA 4LF9H 2IA6A 1KC8W 4JI0H 1HNXO 4ETSA 4FFMA 4IIJF 3AG4B 3M4IA 2FK2A 5J2UB 3CCSV 3HO8A 2YS6A 2WA4A 5C3EG 5DG9A 2DZDA 2GHYA 3D36C 4WBNB 4PDBA 3A0RA 5HNEA 1R6TA 2JEUA 1G6UA 4LR3A 4X1YA 3ASOC 1IYEA 2FPPB 4MV8A 1L0LH 3T9CA 3W5OA 1P7BA 5JUMA 1Q86W 1B06A 4JI8O 2ZDGA 3RBDA 3TINA 1CP9A 1JMKC 4DV0H 4LSXA 5LL6Y 3C3SA 4LFBB 4O7YA 4LSAA 3ZN1A 2IBZH 4ED6A 1VQKV 3SYCA 3E35A 3OMAB 4X66H 3GB7C 5KT5A 2YS8A 1BJTA 4CHIA 1TAEA 1EHIA 3OTOH 4O3RA 3JARA 3I4NG 1XNRH 3M9NB 2Z0AA 3OSNA 4AYBE 5CA0F 1LUVA 2VQDA 4O7ZA 3WG7B 1YJ9V 3JAWA 4APMA 3TJTA 2JA6A 4J80A 5L3GA 4UCVA 4JI2H 2ATLA 1EN6A 4ZHQB 1KBLA 4GC7A 4KHPH 1N33O 2UXDH 3S24A 4F4WA 3RYFA 4JI7B 3RFCA 1ULZA 3JASA 2CK3G 2JEJA 4I4TF 4C5AA 5KFEA 1ZWIC 4YHHO 4O7VA 2LGQA 5GW7A 4DV3O 3HKBA 2DMXA 2BSKB 5LHIA 4DLKA 2JA5A 2DYSB 2COGA 3Q1KA 5L1KA 2VQEO 1HNWH 3G80A 2F66C 4J9SA 1K7DA 2CAZC 3OTFA 4JI2B 2PUSA 4C2MA 1EKPA 4XZ3B 1I7FA 1Y1WG 4EGQA 4FBTA 4RAYA 1K5SA 1S9FA 4TV9A 5J9PC 2YIBA 2ALZA 2C2DA 5C8YB 3JALA 3ETEA 3OR6C 2YXYA 3K0GA 1Q6HA 4EFBA 2VS0A 3JZIA 3BA8A 1O75A 2XCLA 4RQFA 1SFOA 3QG5A 1VQ6V 3APOA 4DV7O 3T1YB 1WA8B 3H40A 4R8UB 4Q20A 4YY3H 4MVRA 2IU3A 4AQYO 1Y14B 4O4JA 3H9VA 4FLWA 2A1HA 4DR6H 1VP7A 4X1KA 2SCUB 4MV7A 1I7NA 3RYIB 1KBHA 5BMVF 5KFZA 1V4YA 4JI4O 4XYLB 1NVPB 1I7LA 4DL6A 2Q2UA 1ENVA 2EIKC 4B3MB 1S77D 4DV6O 3D36A 4OGQB 2QA4V 4IR9A 2NVYA 1IBMO 4PDRA 5IWAO 1T36A 2VR1A 2ZDQA 2PY5A 2HVRA 1M57B 2PMZA 1QLEB 3B40A 4I50F 3B09A 5EBLC 1BHBA 1JR9A 4YY3B 1FYJA 4DUYH 3RF2A 3CYOA 4LF4B 1BMFG 4U3JA 4K0KB 3CMAV 3CQZA 4HNAA 4Q4DA 3CJHA 3BY6A 4FJCC 3L4KA 4KL1A 2UXCB 2EIMB 3C90A 4PA7A 4DO2A 2OIEA 1B6RA 1XNQO 2YIBD 2QWOB 4FFLA 2ODMA 2JRIA 1EZ1A 4UCOA 2QKSA 3GWOA 1RYSA 2DQ0A 4ZI7F 4TQSA 4A3CG 3WB2A 2FLLA 1AP5A 4BBSG 4CMFA 3ABKC 3A2FA 4DUYB 3P3NA 4MW3A 3GIDA 5HBRB 5DLGA 1OJHA 1U97A 3ZHTA 1RJPA 2HHHO 1BL8A 1OBGA 2WB1E 5D1OB 3TQTA 3VBBA 2NLJC 1Y66A 2DYRB 5EYPA 5HFLA 1XEQA 3L73H 4WCEV 3OUUA 3SDLA 4GZRB 2C35B 1GM9A 4G27B 3RV4A 1VF7A 4HR7A 4I55B 3M9OB 4KP4A 2UVRA 4O4HB 2MW2B 2IBKA 1SQBH 1N34B 1TWGA 3M7MX 1N36O 1VS0A 5CA1F 2MCTA 5EZYF 4DV4H 1SYXB 3N42B 1Y74B 2V4DA 3W7XA 1OCCC 5IJ9A 4F4LA 2JA6G 2R85A 2QGNA 3UO3A 1GSAA 4A3BG 2FPIB 5KFAA 1B04A 1SA0B 5KFQA 3AG4C 4X65O 3CCRV 4FFPA 2Q6AA 4DUZH 4YJ3F 2FK1A 4DL2A 4RUCA 3ZS8C 1K1QA 2C28A 4FS1A 1R9TA 3PW2A 3CC4V 1XMOB 4E4EA 4JI1O 2WA3A 4UVBA 3W1GA 3MHSC 2CUGA 1BT8A 1K3EA 5A2QN 2X0LA 5DGAA 2B63G 5FLMG 4UFZA 1NTKH 1Y67A 2ZCEA 2R84A 1WLEA 5LXTB 1SC5B 3OEHG 1I5YA 5BWWA 5DG7A 4JI3H 1ZHSA 1U96A 3QO5A 5LHHA 1MA1A 1KP3A 2ZNJA 2OTJV 3FX7A 1M56B 2A06H 3OEEG 3PO3G 2H8PC 2CNVA 4UXNA 2V4RA 5L3EA 3TW7A 1TWFA 1JFFB 1PP9H 2ADQB 2KSDA 5TISZ 2RCVA 4FBUA 2JIZG 5J2TB 2YZLA 3WG7C 3K03A 3M99B 3BG5A 4CS2A 1DLBA 2FPGB 4LF8B 4JI3B 1RJQA 1YXBA 4IHJF 3GLKA 3JAMW 2YI9A 5BYBA 4PZ7A 4CS3A 1PX2A 4UVAA 2IH1C 1HR0O 4LFAO 4J9YB 2VWJA 1WH2A 2VQFH 2RDIA 2R9IA 4NXNB 4X62H 2YRXA 4NZOA 3KAKA 4HQ6A 4DYLA 4BW9A 5K1PA 1R3JC 1E4EA 3TY5A 4FVMA 2XT9A 3AYHB 2Q73A 3RBEA 2LGWA 3R65A 1HDJA 3UQ8A 1XMQB 2Y4UA 1I94O 3W7UA 1VMGA 1WB8A 2W9AA 2DYSC 3R5FA 3FD9A 3CSWA 2JJ2G 1K8AW 4O3QA 2WSSG 1YI2V 5I5XA 1VARA 3MJFA 2DABA 3RB4A 5L1JA 2ZKOA 5KFTA 3S3XA 1AI5A 3SR2C 2PGGA 1XHZA 1J5EB 1CE8A 2EJ0A 1KP2A 2JGDB 1R6NA 1F7YA 3OE7G 4GKKB 5EIBD 5H5NA 5KG4A 4Y8VB 4RQEA 3J81N 4D7SA 1NBMG 5KG6A 4C7UA 4HZ3A 3DXRA 2R7LA 4LNUB 1G4YB 1AR5A 1QCEA 3CCQV 1ET0A 1AR4A 3F5TA 4EB6A 3PW7A 5IYZA 4WFBV 4LF6O 2ASJA 2R8IA 3CWBH 4O7WA 1Q82W 5LMUH 1PNLA 4O2AF 1Q7YW 2CW7A 1DF5A 4FFBA 3U0GA 2CZGA 3HR0A 1XQ8A 4IIJA 4DV1B 4X8AA 1DF4A 4DV2O 4JYAB 1VQ9V 1ZLZA 5LGTA 3GTQA 4J41A 4J7JA 3GTOA 3K9SA 3E22B 4IRCA 1S97A 4JAVA 2IJJA 1M1KW 2D3OW 2HJDA 4XX0B 1NQTA 3PO2G 4LF7B 2OWOA 1M57C 1QLEC 3AX6A 1B6QA 4DW0A 4PHZA 4TSFG 4X64B 2R70A 2VUGA 1RP3B 1AJPA 2XHBA 1MZBA 1GN2A 2Q7HA 3K5OA 5IDJA 4LMYA 4DR4B 1Q43A 2ZT9B 2DAAA 4FLUA 3Q4HB 3RTXA 2EIMC 1SQFA 1M6VA 4J7ZA 3T9EA 4DR3H 2KKWA 4TV9F 3H4BA 2F4VH 3EYYA 4CS4A 2W9BA 4A3EG 1PV0A 3TGUH 5LHGA 1S76D 4DR1O 4NB5A 5CA0A 3K06A 1M0TA 2P4KA 4LF5O 3K9AA 2UU9H 5JCOC 4B3SB 1VKZA 3T1HO 2YXHA 4ZHQA 2DYRC 5L1LA 4LH7A 4JV5H 4MVOA 4PBCA 3IFXA 4CKBA 4BY7G 2KQXA 1MSWD 1ROPA 1QLNA 1NI8A 4HAMA 4J9MA 3D3IA 2FKLA 1IXMA 3QTCA 4JF3A 4PA6A 5CM0A 1FKAH 1FVIA 3K58A 4QWDA 4MVZA 2UUCH 1JJOA 1NR1A 2BSKA 3BACA 1PNMA 1FFTB 2UU9B 4P2ZA 4MS2A 3THOA 2HFEC 2QWQB 3RYHB 5LOVB 4B3RH 4NR1A 2DW4A 1JOYA 4ZIBA 5FLXW 1KT8A 3UT5B 3KHGA 2W8KA 5C8YA 2VA2A 2YS7A 3WO0A 1UC8A 1LNQA 5CAEB 4JI6H 2YI8A 3JATA 3A0BZ 4LFBO 1E1QG 3TW6A 1AJNA 2FB5A 3E89A 3HKCB 4PI2A 1EM1A 5EWFA 3UO2A 2BR0A 1L2ZA 3K79A 5LA6A 3K59A 1KUTA 4IAJA 4R8UA 3DTGA 4YJ2B 3GIMA 3TCUA 5BMVA 3HPLC 3JCZA 5EK0A 3U9TA 4FFKA 5KFGA 2YSUB 4A3FG 3QZ8A 1M56C 4AYBA 3X2QB 3GTLA 3N2GA 5IP7G 4JI6B 1HW7A 4FLYA 3EHBB 2C00A 5D8DA 3L72H 3VNNA 3BEHA 2V7QG 4GYCB 3QFFA 1C30A 1IZ3A 4JI7O 4RNNA 3LSUA 1FFXA 3H1JH 5KFSA 1S3JA 2PZSA 1NT2B 2RN9A 5CB4F 1YTFD 1N32B 2WAQE 1FD9A 1NU1H 1GN4A 2E74B 5F9NA 3BABA 4J9LA 1Z2GA 2ZR3A 3N2KA 4W4KA 1P4RA 2E5LH 3HOWG 5ITZB 4RUAA 2R8KA 3R5HA 1XDCA 2QJ1A 4FM0A 3Q2OA 3GDEA 4CH6A 5BPHA 5KFFA 4A3GG 3CMEV 3C0FB 3BQ0A 2E76B 2EIYA 5JCOA 4GX2A 5LGNA 3EPIA 4JGSA 5C44G 1WAZA 4GCZA 2GV9A 4O4HA 3E8GA 4F6RB 1I1KA 1GYFA 3T1YO 4FZ0A 4JAAA 5B1BB 4O4IF 5CA1A 2I80A 1L1FA 2LJ2A 2JA7G 1Y76B 3UM7A 1RFYA 3SE7A 5KA6A 1CQJB 4RAIA 4Q4CA 4QW8A 2PVPA 3M8AA 3HB3B 1LUWA 4DR7B 3E5NA 2C2EA 2QE7G 4RNOA 1AI6A 4B3MO 2EZPA 2FTKA 3BAAA 4HN2A 1SA0A 4R50A 4RWUA 4CBCA 2VUMG 4MTDA 3B77A 2WWWA 4YJ3A 5E79Z 2YIDA 5IY5B 2GTAA 2GQSA 5H6RA 3W1BA 4DRXB 4JI5O 4LF4O 1KTAA 1Y1WA 2P7TC 5D5QA 4UUJC 4K0KO 5I5TA 3FB6C 5LP6B 2ILMA 3RUPA 3L75H 1R3IC 2YXLA 4JXUA 3VOTA 1YITV 1CXZB 1I1MA 5IYDO 3B8MA 2UXCO 3ZRSA 2YEVA 1R1BA 5LXTA 3KZIZ 5LYJB 1T3NA 1TWCA 2IJKA 3BQ1A 3ZHRA 2J6UA 2P0AA 4H0LB 1GAXA 3BHPA 4DK1A 3SJQC 2WLIB 1S0NA 2Q67A 1PNKA 4PA3A 5JJEB 5KHJA 3T5HA 3CRQA 3T99A 4JYCA 1AUXA 3VPDA 1DV1A 5JH7F 2AGQA 4O84A 2RNBA 3KTMA 1XDNA 4WHXA 4Q43A 2Q7DA 4BIOA 1K33A 4I7ZB 4B3TB 2HGWA 4QSHA 3I56V 3QNEA 5IYZF 1YZBA 1RPRA 5KFWA 3HOXG 5JVDF 2ZM6H 1N34O 4X20B 4JYBA 4A3IG 4FIPC 4FFOA 3JSLA 2LW7A 4Z2WA 2X0SA 4J9ZB 2R7ZG 4JTCB 5B3SB 1MNGA 1OCZB 3CSXA 2UXBB 2WDTA 1ZAUA 3CP1A
chains in the Genus database with same CATH topology
4X20A 3L4KA 1HR0H 4LFAH 4KL1A 2UXCB 4DV1H 2CFMA 3CVZA 5LL6b 4JYAH 4L8JA 4FLXA 5BR8B 3RGZA 5D5PA 2YIBD 1QHTA 1HNZB 4UCOA 5EYPB 3PN1A 4DV7B 1M4UA 4BWSC 4PI0A 1I94H 4TUYB 2RGVA 4AQYB 3WB2A 2CW8A 4LF7H 4LF9B 4DUYB 3A2FA 2PYJA 4CH4A 4JI0B 5D1OB 4O2AB 4X64H 5EYPA 2E3CA 3VQVA 5IJ9B 4CC5A 1VF7A 4DV6B 3JAWB 4I55B 4O4HB 5IWAB 1L8DA 4DR4H 3CHXA 1CKMA 1Q8IA 3F8NA 3LNNA 1N34B 5KHHA 3M7MX 1VS0A 5D1OA 3BRCA 2MCTA 3N6XA 4O2AA 4DV4H 1SYXB 3N42B 2V4DA 2HVQA 1Z2PX 1I94B 4DR2H 5LMNH 1IBLH 3JASB 3CB2A 5IJ9A 4RB2C 4DV0B 1Z2OX 4K8ZA 4LF6H 4I55A 5KHIA 4OX9H 2E5LB 1B04A 3NC0B 4X1IA 4B08A 3KALA 3J7AK 1XK5A 2JS5A 1TVKB 1SA0B 5FNVB 4DV2H 4B3SH 1P49A 1XNQB 4X66B 4DUZH 4A2BA 3RFRA 3BA9A 4TQDA 3ZS8C 4FM9A 1XMOB 3OTOB 1XNRB 1IBLB 5GONA 3W1GA 5FNVA 1S68A 1ZHQA 4EEQA 4UFZA 4KHPB 3U0ZA 2ZCEA 4UCSA 1CKOA 5LXTB 2UXDB 4I4TB 4Q0YA 5K1XA 4JI3H 4EFEA 1Q5OA 4RB3C 1ZHSA 3RJ0A 2ZNJA 3KXYT 2UUAH 3RR5A 2EX3A 4I4TA 1IBKH 4CH3A 4DV5H 1JFFB 1DGSA 3GB8B 5IJ0B 1HNWB 2WYOA 4DR1H 1YEWA 4O4LB 5J2TB 1E4GT 4ZOLB 4LF5H 4CS2A 5JQGB 4BWAA 4X65B 2R9AA 4LF8B 4MTEA 4JI3B 3T1HH 5A2QW 2HGSA 1JFFA 3JAMW 2YI9A 4PZ7A 4CS3A 3HXLA 4FM2A 2HEPA 3VQWA 4NXMH 2VWJA 1WH2A 4JI1B 1BGWA 2VQFH 3QF7A 4NXNB 5J2TA 4X62H 4FLVA 3WB1A 4ZOLA 3KAKA 2R72A 5JQGA 1X4TA 4BW9A 5K1PA 4O2BB 3TY5A 4FVMA 1O9HA 3UQ8A 1XMQB 3SGIA 4DR1B 3K5LA 5IT9W 4DR6B 4FLTA 1KU9A 2P22C 3SR2C 1XHXA 2PTMA 2PGGA 4O2BA 1XHZA 2BTQB 5KX5B 1J5EB 2OYQA 1P16A 4J0MA 2HVSA 4NVPA 4EB6B 1QQCA 4GKKB 3B2EE 5EIBD 4CC6A 5LP6C 1N32H 4D7SA 4FLZA 4LFCH 2ZM6B 4LNUB 4FFBB 3HKDB 4GLXA 4LFBH 4IIJB 2RQ6A 2BTQA 4UCUA 5KX5A 2F95B 1AN7A 5FD6A 3L2PA 1SKVA 4EB6A 5IYZA 4I50A 3SJBC 4GKJH 2F93B 4TV8B 2WE6A 2RJZA 5LMUH 5EOYA 2CW7A 4LNUA 4FFBA 3NBYB 3HKDA 1HR0B 4LFAB 1XQ8A 4IIJA 4DV1B 3VQYA 5CB4B 4JYAB 3TY9A 4RAZA 4UCRA 3E22B 4X1IB 4ZI7B 3RYCB 4TV8A 1FJGH 1HNXH 2W57A 3L4JA 4LF7B 3DSQA 4Q6GA 2OWOA 3J81W 1T5EA 5CB4A 4PHZA 3E22A 4ZI7A 2Q7GA 3FFQA 3RYCA 4X64B 4JI7H 2R70A 2VUGA 5GONB 3RIZA 3QWUA 2XHBA 1M0WA 1MZBA 4DR7H 2VWKA 2Q7HA 3K5OA 3IG0A 1V9PA 5EZYB 4JI8H 4LMYA 4DR4B 1Q43A 4FLUA 5CA0B 3RTXA 1SQFA 4DV4B 3MAQA 4DR3H 4DR2B 5LMNB 2KKWA 1S5JA 1TUBB 4O4IB 3IAYA 2F4VH 5DISC 3EYYA 3BPZA 4CS4A 4LF6B 4AHCA 4OX9B 5EZYA 3SJAC 2ZINA 5CA0A 3JAKB 1WN7A 1M0TA 2UU9H 5JCOC 4DV2B 1P8LA 4B3SB 4F6RA 1TUBA 4O4IA 4ZHQA 4JI8B 4DUZB 4LH7A 3N40P 4JV5H 2VOBA 1M93A 4A2AA 3JAKA 1X9NA 3T1YH 1M5IA 5KHGA 4EQ5A 1N33H 2YIAA 2IM9A 4I9QA 1FKAH 3QTCA 1SEIA 1FVIA 3K58A 4LH6A 2UUCH 1JJOA 2QM4A 4M7EA 1Z5VA 4I7HA 1CKNB 1E4FT 3RGXA 2UU9B 4YHHH 1D5AA 4B3MH 3KYHC 4DV3H 3JATB 3THOA 3N43B 3RYHB 4B3TH 5LOVB 1RSOA 4B3RH 3NBZB 5JJNB 2VQEH 2UUBH 4ZIBA 2UUAB 5FLXW 3UT5B 1O9GA 2HIXA 1IBKB 5C8YA 4DV5B 5LA6B 1CKNA 5EIBC 2VPSA 4JI5H 5KMGB 2PYLA 4JI6H 2YI8A 4LF4H 3ETQA 3JATA 3K57A 4K0KH 3RYHA 3JSNA 5LOVA 3HKCB 4IHJB 3ICXA 5BMVB 2ZNIA 2UXBH 4PI2A 4LF5B 5JH7B 3UT5A 3T1HB 3KAJA 1L2ZA 2UXCH 2FE3A 2ZIMA 3N2GB 5LA6A 3K59A 4IAJA 3K5NA 5BR8H 5KMGA 4K8XA 4NXMB 4YJ2B 5IYZB 1HNZH 3ZEDA 5JVDB 4I50B 2VQFB 4RB1A 3HKEA 3WB0A 3HKCA 4IHJA 5BMVA 4X62B 4DV7H 5JH7A 5FPRA 2JGUA 4CH5A 4AQYH 2Q2TA 4X1YB 4LF9H 5JJJB 3N2GA 4JI5B 4JI0H 4JI6B 1FFXB 1HW7A 4MV9A 4FLYA 4ETSA 3M4IA 4YJ2A 1SQGA 3VNNA 5JVDA 4JI4H 5J2UB 3RGBA 4WBNB 3VQXA 4DV6H 4GYCB 2RGRA 4PDBA 1I6UA 3N2KB 1IBMH 1G6UA 4LR3A 2UUBB 5IWAH 4X1YA 1FFXA 2HIVA 2PZSA 3W5OA 1N34H 1NT2B 4PZ6A 1N32B 3LMLA 5J2UA 3GJXB 4LFCB 1JMKC 4WBNA 3BABA 4DV0H 4LSXA 5KHKA 2JVDA 3N2KA 4HBNA 4LFBB 3H20A 2E5LH 2YCHA 4LSAA 2O03A 4JI4B 3JARB 5ITZB 4TQFA 4GKJB 1Z2NX 3U10A 3SJCC 2QJ1A 4RB0A 4FM0A 4TUYA 3GDEA 5LMUB 3J80W 1IBMB 1XNQH 4CH6A 4X66H 1BJTA 3C0FB 5CA1B 5JCOA 4UCTA 1TAEA 1XMOH 3OTOH 3JARA 5ITZA 1XNRH 3RYFB 1FJGB 1HNXB 4APMA 3JAWA 2HHHH 1GYFA 4F6RB 2GV9A 4O4HA 4UCVA 4JI2H 4ZHQB 4KHPH 2Q0AA 4D7TA 4R7RA 5CA1A 2UXDH 3HKBB 3S24A 1WPBA 3TY8A 3RYFA 4JI7B 3JASA 4YJ3B 3K5MA 4DR7B 1N36H 3BAAA 4TV9B 3HKBA 1TVKA 4TOIA 1SA0A 1TGOA 1H2SB 2ZIOA 3JALB 4MTDA 1HNWH 2F66C 4DR3B 2HHHB 4YJ3A 2CAZC 3OTFA 2F4VB 4JI2B 2PUSA 1I7FA 3W1BA 4DRXB 2F1MA 4RAYA 4X65H 4LF8H 4TV9A 5D5QA 2YIBA 3N44B 5LP6B 5C8YB 3JALA 2YXLA 4DRFA 1XI1A 3FMAA 1N36B 4O4JB 4JI1H 4NXNH 4X1KB 4EFBA 4JV5B 5LXTA 4DRXA 5LYJB 3BA8A 4PZ8A 1O75A 3K3VA 5LP6A 4FM1A 3QG5A 3T1YB 1XMQH 1N33B 4YY3H 2BTOA 3BHPA 4DK1A 4E6NA 3MWMA 4O4JA 4FLWA 1A0IA 4DR6H 4DR5H 5JJEB 5KHJA 4X1KA 2Q7EA 2KSWA 3HKEB 4MV7A 2UUCB 4DK0A 5LYJA 3RWRD 3RYIB 3N41B 5FD5A 4RZQA 1J5EH 5IJ0A 5FPOA 4YHHB 1XDNA 2Q2UA 4B3MB 4GKKH 4U3JB 2XIGA 4DV3B 2P5OA 3DF7A 4O4LA 4B3TB 4HNAB 1WNSA 4B3RB 1TA8A 2PY5A 2HVRA 2VQEB 5D1PA 2ZJTA 2ZM6H 3RYIA 4X20B 1Z5WA 1Q3EA 1KMIZ 3JSLA 1S03G 4YY3B 4DUYH 3RF2A 4LF4B 4U3JA 4DR5B 4K0KB 4AILC 4HNAA 3CSXA 2UXBB 2WDTA 1ZAUA 3U11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDE A;  5LMU B;  4DV2 B;  1IBM B;  1P8L A;  4B3S B;  2UXC B;  2CFM A;  4PZ7 A;  4JI8 B;  4DUZ B;  5BR8 B;  4LH7 A;  4JI1 B;  4NXN B;  1HNZ B;  4UCT A;  1TAE A;  4UCO A;  3PN1 A;  4DV7 B;  1FJG B;  1X9N A;  1HNX B;  3TY5 A;  4AQY B;  4EQ5 A;  3UQ8 A;  4LF9 B;  1XMQ B;  4UCV A;  3SGI A;  4DUY B;  4DR1 B;  4JI0 B;  1FVI A;  4LH6 A;  4DR6 B;  5D1O B;  3S24 A;  3TY8 A;  4JI7 B;  4CC5 A;  1CKN B;  2UU9 B;  1P16 A;  4DV6 B;  1J5E B;  3KYH C;  2HVS A;  5IWA B;  4DR7 B;  4GKK B;  4CC6 A;  1CKM A;  3NBZ B;  3BAA A;  1N34 B;  1VS0 A;  4TOI A;  5D1O A;  2UUA B;  2HVQ A;  1I94 B;  2ZM6 B;  1IBK B;  2HIX A;  4DV5 B;  4GLX A;  1CKN A;  4DR3 B;  4DV0 B;  2HHH B;  4UCU A;  2F4V B;  4JI2 B;  3L2P A;  2E5L B;  1B04 A;  3NC0 B;  3JSN A;  3W1B A;  1XK5 A;  4LF5 B;  3T1H B;  3NBY B;  1HR0 B;  4LFA B;  4DRF A;  1XNQ B;  4X66 B;  4DV1 B;  1N36 B;  4JYA B;  3TY9 A;  3BA9 A;  4UCR A;  4NXM B;  4JV5 B;  4EFB A;  2VQF B;  4X62 B;  1XMO B;  3BA8 A;  3OTO B;  4PZ8 A;  1XNR B;  1IBL B;  5FPR A;  3W1G A;  1S68 A;  2Q2T A;  3T1Y B;  4JI5 B;  4LF7 B;  1N33 B;  4JI6 B;  4E6N A;  2OWO A;  4EEQ A;  4UFZ A;  4KHP B;  1A0I A;  4UCS A;  1CKO A;  2UXD B;  3VNN A;  2UUC B;  4X64 B;  2VUG A;  4EFE A;  3QWU A;  2UUB B;  5FPO A;  4YHH B;  1XDN A;  2Q2U A;  4B3M B;  1V9P A;  4DV3 B;  2HIV A;  4B3T B;  4DR4 B;  3W5O A;  4B3R B;  1TA8 A;  4PZ6 A;  3RTX A;  1N32 B;  2HVR A;  2VQE B;  5D1P A;  3RR5 A;  4DV4 B;  3GJX B;  4LFC B;  1DGS A;  4DR2 B;  5LMN B;  3BAB A;  3GB8 B;  1HNW B;  5DIS C;  3JSL A;  4YY3 B;  4LFB B;  4LF6 B;  4LF4 B;  4OX9 B;  4DR5 B;  4K0K B;  4JI4 B;  2UXB B;  4GKJ B;  1ZAU A;  4X65 B;  4LF8 B;  4JI3 B; 
#chains in the Genus database with same CATH topology
 4J9R A;  3KRE A;  1VAJ A;  3CVZ A;  4WBN F;  5LL6 b;  5IYB G;  4L8J A;  4FLX A;  5BR8 B;  3RGZ A;  4O3S A;  1N48 A;  2ZDH A;  5EBM C;  1HNZ B;  3LNM B;  2HG5 C;  4UVC A;  1M4U A;  3OR7 C;  4ZQI A;  4PI0 A;  2WLL A;  1XMO O;  1DAA A;  1PPJ H;  2KG7 B;  4RUF A;  2XAF A;  3K08 A;  4O81 A;  2CW8 A;  5IYD G;  4LF9 B;  2ZDI C;  2EIN B;  5CBH A;  2JGD A;  1WCM A;  1IVS A;  4JI0 B;  4J9P A;  1BQ0 A;  4O86 A;  2AGO A;  3UZB A;  5DEC A;  1AVM A;  2E3C A;  3OW2 U;  3JZ6 A;  5KT7 A;  3CEB A;  3VQV A;  4CC5 A;  4A3J G;  5DM6 V;  3CPW U;  5B5E Z;  4H37 A;  5BPF A;  4X88 A;  1QR9 A;  2CTQ A;  3Q8Q B;  4ECW A;  2RMK B;  2A3Q A;  2DWE C;  2L35 A;  5KHH A;  2IP4 A;  1K4D C;  1GM8 A;  4O2A A;  2HVQ A;  4Q45 A;  1Z2P X;  2GLT A;  4DR2 H;  5LMN H;  1IBL H;  4WF9 V;  2W6O A;  4HNU A;  1DIK A;  4RB2 C;  4DV0 B;  4K8Z A;  3QO7 A;  4OX9 H;  4LP8 A;  1I3Q A;  3JZF A;  2A7W A;  2Y4T A;  5KFJ A;  2RDC A;  2QM8 A;  2XAS A;  4B08 A;  3KAL A;  4ZHQ F;  1GN6 A;  3AK3 A;  1SRY A;  3X2Q C;  3T5J A;  2AXT Z;  5EDW A;  3CCL V;  3RAQ A;  5KFK A;  4LF8 O;  1P49 A;  4ED1 A;  1I5X A;  2Y48 A;  4X66 B;  4A2B A;  3RFR A;  4PDL A;  3STL C;  1GH6 A;  4TQD A;  1AI7 A;  4FM9 A;  4G3I A;  4EKW A;  3OTO B;  4NXN O;  4NTY A;  1XNR B;  1IBL B;  3CC2 V;  4NTX A;  5FNV A;  1S68 A;  1F23 A;  3AG7 A;  2ITC C;  3G6X A;  3JAM N;  2B63 A;  4NTW A;  5KA5 A;  5I5U A;  4KHP B;  3ABT A;  3U0Z A;  1XMQ O;  4UCS A;  4J42 A;  2UXD B;  4I4T B;  4Q0Y A;  4PEL A;  3CD6 V;  5K1X A;  3C3T A;  4O3O A;  4RB3 C;  5BWV A;  4TWK A;  1G8M A;  3TK1 A;  3FYE B;  3CXC U;  5C8Y F;  4FFR A;  1J5E O;  3CRC A;  3V6K A;  1GGO A;  4GKK O;  2UUA H;  1YTF B;  1FXK A;  2BQU A;  1IBK H;  4DV5 H;  1DGS A;  3GB8 B;  2CDY A;  1HNW B;  3E83 A;  2UVW A;  4OXS A;  4ICG A;  1FXV A;  5LA6 F;  3CCV V;  4O4L B;  2CKZ B;  2IU0 A;  1XUQ A;  2NU7 B;  1KKC A;  3OAA G;  4PA4 A;  2YWV A;  5B1B C;  3QZ7 A;  2HKO A;  3HXL A;  4FM2 A;  1KJ8 A;  3OD4 A;  5BY1 A;  4NXM H;  3KHR A;  2A79 B;  1BGW A;  4DV1 O;  4ECQ A;  4JYA O;  3WB1 A;  3MHH C;  4ZOL A;  1YHQ V;  1I50 A;  5JQG A;  5FR9 A;  4F50 A;  2LW1 A;  1O9H A;  5L1I A;  2P4V A;  1S5H C;  2R92 G;  5F2V O;  4LF7 O;  4DR6 B;  2PI5 A;  2W71 A;  4OPA A;  2QKA A;  3LSQ A;  2K9P A;  3RT3 C;  3HT5 A;  3PW5 A;  5IY5 C;  4O2B A;  2UUB H;  4X64 O;  5KX5 B;  1AP6 A;  1K4C C;  1V55 B;  1J95 A;  3UKM A;  4MVM A;  3HB9 A;  3F5W C;  5LP6 C;  4FLZ A;  2Z04 A;  4ECX A;  3WWH A;  3MR6 A;  1F4M A;  4DR4 O;  5KFL A;  3GTM A;  4MTX A;  4LFC H;  2XD4 A;  2P06 A;  4GLX A;  5BWX A;  2BTQ A;  1RM1 B;  4G28 B;  1WCM G;  5FD6 A;  2CNU A;  3MFI A;  2IMW P;  1UC9 A;  2YC0 A;  4TQR A;  4GKJ H;  1ZSP A;  4ASU G;  4IYH A;  1S0M A;  5C93 A;  2PI4 A;  2FML A;  3HKD A;  3VPB A;  2P90 A;  4YB8 B;  4B3S O;  3TY9 A;  4RAZ A;  4O4H F;  4X1I B;  4ZI7 B;  1A32 A;  5HFM A;  2Q4P A;  4UUG A;  4TV8 A;  1FJG H;  3HOY G;  1HNX H;  2W57 A;  3T4D A;  3L4J A;  2R8J A;  3DSQ A;  1EN5 A;  3ZRW B;  5CB4 A;  4O7R A;  4YIO A;  3JRW A;  1KJQ A;  1ZQ7 A;  4MVQ A;  2Q7G A;  3RYC A;  2UVU A;  2DWC A;  2Q9L A;  4YP3 A;  5GON B;  2O57 A;  4D6T H;  2EJ3 A;  1OCZ C;  2WLK A;  1JCH A;  2EZO A;  2UU9 O;  4JI8 H;  1V9P A;  5EZY B;  2X7R B;  2ZR2 A;  4MVS A;  4PWQ A;  1SER A;  1UNN C;  4F4X A;  4A93 G;  1W96 A;  2J6S A;  3ZHS A;  2H3O A;  1R3L C;  3ZN0 A;  1FS0 G;  4DL7 A;  4DV4 B;  2W9C A;  3F7V C;  1S5J A;  3V4S A;  1TUB B;  3IAY A;  1XRE A;  3E8B A;  2W6Q A;  2GUZ B;  5DGI A;  2HGX A;  1G1X B;  1G2W A;  2AHZ A;  2GSM B;  4EEY A;  2ZIN A;  1QR8 A;  2EIN C;  5LXT F;  3LDE A;  5FLX N;  1EKF A;  2QWR B;  2JK5 C;  3AG2 B;  1P8L A;  4M0J A;  4F6R A;  3BJY A;  4O4I A;  3RB6 A;  4JI8 B;  4LBE C;  3QQM A;  4DUZ B;  4GC6 A;  2GTS A;  4DXW A;  3N40 P;  2H94 A;  4FU0 A;  2HHF B;  1M93 A;  2NVX A;  4BIU A;  3H1K H;  2UVV A;  3JAK A;  1QBZ A;  3TET A;  2ZXW B;  3G67 A;  3FDS A;  1M5I A;  1VQ4 V;  1OHH G;  1N33 H;  5KT2 A;  3G6E V;  1S0O A;  2R6F A;  3OGI B;  1DV2 A;  3ZMZ A;  1VEW A;  4JI6 O;  2WLJ A;  2QM4 A;  3UCS C;  4MA5 A;  5J2T F;  1CKN B;  4YHH H;  2BQR A;  1ZL8 A;  4CE5 A;  4DW1 A;  3WNZ A;  3T1C A;  3ZJZ A;  4DV3 H;  4EYI B;  2JDI G;  1Q6U A;  2VQE H;  3ZHU A;  1N32 O;  2WAQ A;  3OFN G;  3DGE A;  2Y0S E;  1SQQ H;  2VPS A;  4W4L A;  4I0X A;  2D2C B;  3LUT B;  1VQ5 V;  2DIK A;  3FAV A;  4J9K A;  4O3P A;  4IHJ B;  1L0N H;  4YAJ B;  3AG1 B;  3NGD A;  4J9Q A;  4QJF B;  3K3W A;  1BCC H;  1Y6X A;  4U7O A;  1V54 B;  2ZIM A;  2FE3 A;  4MTF A;  2QB5 A;  2QYZ A;  1Y4M A;  3VA7 A;  4R8C A;  3H1I H;  3CCE V;  5KMG A;  1DK1 A;  5KUK A;  2VQF B;  5KFP A;  3D3Q A;  4X62 B;  4DV7 H;  5BXZ A;  5JH7 A;  3K0D A;  1EYZ A;  5FPR A;  1GK9 A;  4AQY H;  5DMX A;  4U3F H;  2NUA B;  2Q2T A;  4X1Y B;  2RF4 A;  1VQ8 V;  5IE9 A;  2CGO A;  1JX4 A;  4GUN A;  4NYK A;  5BWT A;  2JJ1 G;  3ZHV A;  3WWI A;  3WU2 Z;  1SQG A;  3E2E A;  2YZG A;  2FLN A;  5JVD A;  4JI4 H;  1MMM A;  3RGB A;  3NR7 A;  4DV6 H;  2RGR A;  1IBM H;  3E8H A;  5IWA H;  3HOV G;  5I5V A;  1VQL V;  4EGJ A;  3ETG A;  1TWH A;  4DR7 O;  3GIP A;  4A3L G;  1MAB G;  5J2U A;  4YBZ B;  4DL5 A;  1JA8 A;  4WBN A;  5KHK A;  2JVD A;  3FB7 C;  3H20 A;  2XUM A;  3BFR A;  1AIL A;  4JI4 B;  3JAR B;  4F6E A;  2N04 A;  4N21 A;  3LDC A;  1Z2N X;  2DPI A;  4QWB A;  2NU9 B;  2QR4 A;  5LMU B;  3J80 W;  1IBM B;  1XNQ H;  3AW8 A;  5FNV F;  4RU9 A;  5I5W A;  2K1E A;  1M90 W;  2QWN B;  3GTK A;  4MTO A;  2EIJ B;  1HP8 A;  2HJW A;  3ML0 A;  3RYF B;  1V55 C;  3CEI A;  1B3Q A;  4E2L A;  4DAA A;  1YF2 A;  2FKX A;  3CS5 A;  2HHH H;  4WFH A;  2Q68 A;  2VA3 A;  4TM5 A;  2Q0A A;  1FAF A;  4Z1V A;  4R7R A;  3K3P A;  4PA9 A;  3HKB B;  2PF4 E;  3ETH A;  1WPB A;  1EN4 A;  1NTM H;  1RM1 C;  1KC7 A;  2R93 G;  2JA7 A;  3MD0 A;  1I0H A;  2XND G;  2ZE7 A;  4UV8 A;  3K5M A;  1KJJ A;  4JPR A;  2Q8V A;  4XDJ A;  1N36 H;  2N74 A;  4YR2 A;  3WWJ A;  1QU7 A;  4TV9 B;  2R82 A;  4B3T O;  4YAK B;  1NH2 D;  3JAL B;  2CE4 A;  1KKD A;  4MAM A;  1P7G A;  3DAA A;  4DR3 B;  4FGR A;  2HHH B;  4QWA A;  2VUM A;  2F4V B;  3SPI A;  3ZX6 A;  1GRJ A;  1S0V A;  3J7A U;  3PZP A;  3I12 A;  2YDE A;  4UV9 A;  1RSO B;  4JUZ A;  2F1M A;  2XOK G;  5CMU A;  5E25 A;  1H2G A;  3DC5 A;  4X65 H;  4QIW E;  4YIP A;  2GQR A;  2UXB O;  4ZOL F;  4O7N A;  3WO1 A;  1MSD A;  2CTW A;  5JQG F;  1XIL A;  1XI1 A;  3FMA A;  1N36 B;  4O4J B;  2OTL V;  2JEX A;  4JI1 H;  4X1K B;  4JV5 B;  2M7W A;  4MV3 A;  5I5S A;  2IH3 C;  5BR8 O;  3GTG A;  1WPX A;  5LOV F;  3K3V A;  5I5Y A;  1HNZ O;  3SPH A;  4FM1 A;  2E2I A;  4FPP A;  1HWY A;  1JKJ B;  1PD3 A;  4ED7 A;  2BTO A;  4O82 A;  4O2B F;  4E6N A;  3MWM A;  4LF9 O;  4I9W A;  4DR5 H;  2Q7E A;  4JI0 O;  3HKE B;  1YIJ V;  2KSW A;  1PK8 A;  2UUC B;  2WLM A;  3GII A;  5C5J A;  3JD2 A;  3LP8 A;  5FD5 A;  5A9G A;  2ABJ A;  1ZET A;  3N6R A;  3HOU G;  1NZ6 A;  1KUQ A;  1WA8 A;  4U3J B;  3CRA A;  2NN4 A;  5C4X G;  3DF7 A;  4O4L A;  3ETD A;  3H4D A;  4HNA B;  4B3R B;  3AG2 C;  4IT5 A;  5D1P A;  4YJ2 F;  2ZJT A;  3R9R A;  4JYY A;  3V6J A;  3RYI A;  1Z5W A;  3P32 A;  2Y4R A;  1Q3E A;  5KT4 A;  2W6Z A;  2FYU H;  2ASD A;  4DV0 O;  4DR5 B;  2YW2 A;  2ZXW C;  5CBF A;  1BZK A;  2R7Z A;  3U55 A;  3JCU Z;  3T54 A;  5JVL A;  3U11 A;  2Y0I A;  4JV0 A;  3EVK A;  2R7K A;  4BY1 G;  1HR0 H;  2FP4 B;  4LFA H;  4TV8 F;  4P30 A;  2CFM A;  1IYD A;  5DN6 G;  5D5P A;  4X66 O;  4MV6 A;  4MV1 A;  3IN5 A;  2HR3 A;  3CRM A;  4IWY A;  2AHY A;  5EYP B;  2X6B A;  5I60 A;  1KJ9 A;  4FFN A;  1ZTE A;  3U54 A;  1I94 H;  4NLG A;  4TUY B;  3OTO O;  4O7S A;  1XNR O;  4QIW F;  3CC7 V;  2HVK C;  2QTO A;  2PYJ A;  4CH4 A;  2HP8 A;  3E8F A;  3CRR A;  4JI2 O;  4KHP O;  1FXH A;  4QE9 A;  2UXD O;  5IJ9 B;  3ORR A;  4J9N A;  1BE3 H;  1SS3 A;  3PR5 B;  2CQY A;  1A9X A;  1A0G A;  5GTH Z;  2CNQ A;  1AR1 B;  2QK4 A;  4ZBM A;  3AG1 C;  3K5H A;  3TIG A;  4NZM A;  1SES A;  3CHX A;  1CKM A;  1Q8I A;  1SQX H;  3F8N A;  1OCO B;  3LNN A;  3GV7 B;  5D1O A;  1V54 C;  4WD3 A;  2FK3 A;  1I94 B;  2ARH A;  1F4N A;  3CB2 A;  2EJR A;  1Y1V G;  2R8G A;  4LF6 H;  4I55 A;  5KHI A;  3RBZ A;  3RB3 A;  1PL0 A;  2ZGI A;  3IC9 A;  2E5L B;  1HNW O;  5I47 A;  1VQM V;  1RJR A;  3J7A K;  4X1I A;  2OLS A;  1R3K C;  2GPS A;  4XYM B;  1TVK B;  4H33 A;  1JQ0 A;  1NVP D;  1Y74 A;  4DV2 H;  3DTU B;  1C3O A;  2WPD G;  3OUS A;  3ZRW A;  1IXB A;  3BA9 A;  4Q8F A;  4XDK A;  1K5Q A;  4ED0 A;  1MZF A;  5GON A;  2VPQ A;  2V9W A;  1ZHQ A;  3BCC H;  3AEI A;  1EUC B;  4IWX A;  4RUE A;  4HYK A;  4MSW C;  3ZMV A;  2XAH A;  1CKO A;  1W2B U;  4YY3 O;  5IYB O;  3O65 A;  4A3K G;  3KCY A;  4DR6 O;  1WJZ A;  4EFE A;  2B1G A;  1Q5O A;  5DG8 A;  5KFN A;  2I8C A;  4WFF A;  4F4Y A;  1YJN V;  1JLL B;  2YRW A;  2GUZ A;  3MR2 A;  2I87 A;  5L3C A;  3RJ0 A;  1MZE A;  1H8H G;  1URF A;  4ECU A;  1KB9 F;  3A8T A;  4U7C A;  1PL4 A;  4YQW A;  3RR5 A;  2EX3 A;  2COJ A;  3I5D A;  4C5B A;  4CH3 A;  4JAU A;  1VQ7 V;  1B6S A;  4ZKI A;  5LYJ F;  4ECR A;  5IJ0 B;  1I1L A;  1SQP H;  1PKX A;  2EIJ C;  2HJF C;  2P6J A;  3H01 A;  3T9B A;  4DR1 H;  4DIM A;  1YEW A;  2ITD C;  4BAY A;  1YDX A;  1E4G T;  4LF5 H;  4DUY O;  2FMA A;  2R9A A;  3H0G A;  4MTE A;  2CGN A;  1E4E B;  3T1H H;  1GM7 A;  4BW5 A;  2HGS A;  1JFF A;  3KKY A;  2WAM A;  1WRV A;  1IOW A;  2NU8 B;  4HYO A;  1YSC A;  3OMN B;  3VMM A;  5J2T A;  1QNM A;  4PD4 F;  4P9O A;  4AI8 A;  1GTO A;  2A9H A;  2FJZ A;  2G38 A;  4HNT A;  2YL2 A;  3R5X A;  2ZQM A;  3SGI A;  4DR1 B;  4DQN A;  5IT9 W;  1H2L A;  1MG1 A;  1W0J G;  5K3W A;  2R92 A;  4FLT A;  1WP8 A;  3DXR B;  3JYC A;  2PTM A;  1P16 A;  1CPY A;  4J0M A;  5J2U F;  4Q44 A;  2HVS A;  4NVP A;  4EB6 B;  3HKZ E;  3M9M B;  5C1O A;  2F43 G;  4X9Q A;  1A3G A;  4IGG A;  2ZM6 B;  1NH2 B;  4FFB B;  4TT3 G;  1THZ A;  1ZUQ A;  3STZ C;  1AB3 A;  1Q6I A;  3GVM A;  4DV4 O;  5KFM A;  4IIJ B;  2RQ6 A;  3K04 A;  1OZ0 A;  3ZMU A;  4LFB H;  1TUE B;  1SKV A;  4L87 A;  4UB8 Z;  5H9C A;  3SJB C;  2W6N A;  1EUD B;  2F93 B;  3OGC C;  5KAF Z;  5EC1 C;  1VF6 C;  4LNU A;  4WFG A;  3VQY A;  5H80 A;  3IJ4 A;  2R8H A;  1I08 A;  3OHB A;  1BGY H;  4DUZ O;  1F51 A;  2EIL B;  2QTS A;  1M7J A;  2NR5 A;  3GTJ A;  4P9P A;  3QO8 A;  3T2M A;  3V4Z A;  3E86 A;  1BXR A;  5KG5 A;  4Q6G A;  4GX1 A;  3ZMT A;  5GTI Z;  3MWD A;  3ZIA G;  2XAJ A;  2DN9 A;  4B7E A;  2EBO A;  3E22 A;  4QGP A;  5KG7 A;  3FFQ A;  4JI7 H;  2R87 A;  1GMG A;  4MV4 A;  2XAQ A;  3KHH A;  2W9B B;  4JI3 O;  2VWK A;  5EWG A;  2DE0 X;  1I2L A;  5DGB A;  3TXQ A;  1KJI A;  2XGP A;  3ABM B;  5CR5 A;  3W7S A;  2AW9 A;  5CA0 B;  4EBC A;  4J7K A;  3MAQ A;  4DR2 B;  5LMN B;  1IX9 A;  2ZE5 A;  3APQ A;  4X89 A;  4O3N A;  3BPZ A;  2Y0S A;  4OX9 B;  2XCA A;  1RK5 A;  3SJA C;  1CEZ A;  3OT7 A;  3SNO A;  3Q4H A;  3LSS A;  1SQV H;  1WN7 A;  4RNM A;  1GO3 E;  4IR1 A;  3MDS A;  3P3P A;  2XAG A;  4GX0 A;  2VOB A;  3V6H A;  1DTO A;  1ARO P;  1SZT A;  2YIC A;  4N23 A;  2OCC B;  3FKI G;  1WR2 A;  2QSA A;  2VQF O;  2L6L A;  4A2A A;  3BQ2 A;  1R73 A;  4X62 O;  1D2D A;  1X9N A;  3T1Y H;  2V5A A;  1W93 A;  1VIB A;  1OCO C;  2IM9 A;  4I9Q A;  5L3D A;  3A0H Z;  5EBW C;  2FB9 A;  4IZO A;  4ED8 A;  2ODT X;  3RN4 A;  4M7E A;  2EUL A;  3OM3 B;  3ORQ A;  4O4L F;  3H0G G;  3CX5 F;  4I7H A;  4TVI A;  3RGX A;  2PBZ A;  3H3V H;  1D5A A;  2X5R A;  4B3M H;  2XCP A;  4ED2 A;  3JAT B;  3N43 B;  2RDJ A;  5KS8 A;  1RSO A;  5JJN B;  2W0X A;  4F4Z A;  3S3W A;  2UUA B;  3LUL A;  1UJW B;  3HOZ G;  2V1D A;  1O9G A;  3LDD A;  2HIX A;  5B1A B;  1IBK B;  1E79 G;  4DV5 B;  5LA6 B;  1H2K A;  5EIB C;  3NUA A;  4L1K A;  2NU6 B;  4QWC A;  4JI5 H;  4LF4 H;  3ETQ A;  4K0K H;  3RYH A;  4YR3 A;  3D8C A;  3GIQ A;  3JSN A;  5LOV A;  5BMV B;  5KT6 A;  2ZDI A;  3HBL A;  3LQS A;  1K34 A;  3AK1 A;  1M9N A;  3UT5 A;  3KAJ A;  4ABM A;  2UXC H;  3EXA A;  3N2G B;  2FLP A;  3K5N A;  2Z3Y A;  5LMU O;  5KX5 F;  1VF6 A;  4NXM B;  2XTA A;  1JXL A;  1KYO F;  2NNU A;  1JVM A;  4I50 B;  4GLW A;  3HKE A;  4K35 A;  2Q69 A;  3WB0 A;  3HKC A;  4RB1 A;  1N4C A;  5KFU A;  2OH2 A;  2DJV A;  2PN1 A;  3IC7 A;  2ATK C;  4K3A A;  2Y69 B;  3TEK A;  1K97 A;  2LP7 A;  2COI A;  1EKV A;  4NZN A;  5JJJ B;  3J80 N;  4JI5 B;  3R66 A;  4EYH B;  1FFX B;  4MV9 A;  1GO3 F;  4LWS B;  5KFD A;  4RZR A;  1RYR A;  1S5L Z;  4YJ2 A;  5DLF A;  3G8C A;  5DQH A;  4FS2 A;  2JEI A;  3VQX A;  1I6U A;  3N2K B;  2Z02 A;  2UUB B;  1OWT A;  2HIV A;  1N34 H;  3G6V A;  4I55 F;  4PZ6 A;  3LML A;  1WP7 A;  3ZMS A;  4O83 A;  1VQN V;  3DC6 A;  3GJX B;  4U7N A;  4LFC B;  3Q8R B;  1GSH A;  5KFY A;  4HBN A;  2YCH A;  3FYI B;  4DR3 O;  1VBG A;  4E4T A;  3T7A A;  1XL4 A;  2F4V O;  1EFR G;  2O03 A;  2DPJ A;  4J10 A;  2Y0P A;  2DLN A;  4TQF A;  4GKJ B;  3U10 A;  3SJC C;  4RO2 A;  2YZM A;  4RB0 A;  4QIW A;  4TUY A;  3PW4 A;  4GT1 A;  3SYO A;  1SET A;  4J11 A;  5GON F;  5B3S C;  3T4Z A;  4M9U A;  4RCN A;  5CA1 B;  4MT8 A;  4BIZ A;  4LC1 A;  2ASL A;  4XDL A;  4UCT A;  4QW9 A;  3RB0 A;  1W59 A;  1XMO H;  3H1H H;  2WLH A;  5ITZ A;  1K73 W;  4JV5 O;  1FJG B;  2MK3 A;  3ETJ A;  1HNX B;  1YJW V;  5EWE A;  4R6Z A;  2XC9 A;  4KFM A;  4D7T A;  4CZZ A;  2IJH A;  2CH7 B;  3SPC A;  1FKA O;  2R7M A;  4PDV A;  5KG0 A;  3TY8 A;  1D5N A;  2R93 A;  2UUC O;  3TXS A;  4YJ3 B;  5K2M A;  1VQO V;  2WTF A;  4O7T A;  1UFI A;  4KUM A;  4B7K A;  3CCU V;  5DAA A;  1V51 A;  5KFH A;  4TOI A;  1TVK A;  1SZX A;  1RK6 A;  2JA5 G;  1TGO A;  3ASN B;  1H2S B;  2ZIO A;  3W7W A;  1Y76 A;  4B3R O;  2W70 A;  3SPJ A;  2FL4 A;  4YR0 A;  2VRZ A;  3BVO A;  2W6P A;  4WFA V;  2EIL C;  2YEV B;  1AI4 A;  3MR5 A;  4H13 B;  5JQW A;  1I2K A;  1H8E G;  3JRX A;  4LF8 H;  4DR5 O;  1EBO A;  3N44 B;  1BNC A;  2HVJ C;  2WLN A;  5F9L A;  2ADP A;  4U6P A;  1K83 A;  4DRF A;  3GTP A;  2OIG A;  3L74 H;  4NXN H;  1K92 A;  2GPW A;  4DRX A;  4LCU C;  2B5U A;  4PZ8 A;  3GIL A;  1R6K A;  5LP6 A;  1E1R G;  5IYC O;  3PW0 A;  3ABM C;  1XMQ H;  1N33 B;  1US6 A;  2W6J G;  2OT5 A;  1A0I A;  4ECV A;  3O9O A;  3CE2 A;  3MR3 A;  4PV1 B;  4DK0 A;  5LYJ A;  3RWR D;  3N41 B;  4MVU A;  4RZQ A;  3CCM V;  5LBQ A;  3SI8 A;  1J5E H;  2X6A A;  5IJ0 A;  5FPO A;  4YHH B;  5T14 A;  4GKK H;  3B4S A;  2XIG A;  4DV3 B;  2P5O A;  2WLI A;  3OHA A;  1WNS A;  1TA8 A;  2VQE B;  2ZD9 A;  5FJ8 G;  1IOV A;  3DTF A;  4ED3 A;  1VF5 B;  1IUR A;  2UXN A;  1KMI Z;  1S03 G;  2ETN A;  3SYQ A;  1N0N A;  3PFF A;  2OCC C;  3U9S A;  4AIL C;  3FB5 C;  1K9M W;  2E5L O;  4JAS A;  2GBO A;  2WLL B;  4X20 A;  1B33 N;  3OUF A;  4DV1 H;  3WFV A;  3ZCC A;  4JYA H;  3N27 A;  3JD3 A;  3SYP A;  2DWD C;  5HV6 A;  2Q5Z A;  1QHT A;  4DL3 A;  4CMD A;  4IRK A;  1P84 F;  3PN1 A;  4DV7 B;  5BYA A;  2N05 A;  1VBH A;  4BWS C;  2RGV A;  1EZJ A;  2QM7 A;  4AQY B;  2E2H A;  2BOC C;  4LF7 H;  4I5S A;  3AG3 B;  2QWP B;  4HNV A;  2AU0 A;  3GV5 B;  5B1A C;  4O2A B;  4X64 H;  3ABL B;  5IYC G;  5L3F A;  2AZ0 A;  1H38 A;  4DV6 B;  3JAW B;  3TQ1 A;  2KG7 A;  4FK5 C;  1OCR B;  5CBG A;  5IWA B;  1L8D A;  2AGP A;  2A0L A;  4DR4 H;  3AK2 A;  2W6M A;  2XGQ A;  3T5K A;  3ZBH A;  4BBR G;  2PMZ E;  2DQ3 A;  3N6X A;  2ZE6 A;  3BRC A;  4ECT A;  3T5L A;  4UB6 Z;  3QVN A;  3CCJ V;  3JAS B;  2JS3 A;  4K6N A;  2QDO A;  1Z2O X;  1AUV A;  1Y1V A;  2LFR A;  1XOU A;  1K1S A;  3GV8 B;  3NC0 B;  1XK5 A;  2Y69 C;  2JS5 A;  3F7Y C;  3H1L H;  2EJ2 A;  1JJ2 U;  2V4Q A;  4QPJ A;  2KB1 A;  5FNV B;  1NS1 A;  3P30 A;  4B3S H;  1BHA A;  3MWE A;  2E75 B;  1XNQ B;  1H2M A;  2C22 A;  4NYE A;  5KFB A;  1XBL A;  4JZ2 A;  5EC2 C;  5KFO A;  4G2K A;  3OMI B;  5KAI Z;  3G6Y A;  3W7T A;  1CQI B;  1NJI W;  2R7N A;  1XL6 A;  2BE3 A;  2X6C A;  3RW0 A;  2J6T A;  4KXR A;  5KT3 A;  3PVX A;  4EEQ A;  1NTZ H;  5BZB A;  2B1I A;  1FXK B;  3NXS A;  3JD1 A;  3G6B A;  3JD4 A;  3T9D A;  3L9D A;  3HKZ A;  5IT9 N;  3KXY T;  4O4J F;  2QKC A;  3PJS K;  1FPO A;  1BQZ A;  4I4T A;  1QVG U;  4FZ1 A;  2R9R B;  2R86 A;  2WYO A;  2ZM6 O;  5B1N A;  4JTD B;  2AQ4 A;  4MA0 A;  4ZOL B;  4BR6 A;  3ASO B;  5JQG B;  4BWA A;  4X65 B;  1WB7 A;  5A2Q W;  5DQG A;  5KFC A;  3UFX B;  3VOU A;  4ECZ A;  2CTP A;  2HEP A;  4IYI A;  3VQW A;  3GQC A;  4JI1 B;  3QF7 A;  4FLV A;  3VPC A;  5KFX A;  2JEF A;  2R72 A;  3PR4 A;  1X4T A;  4QWE A;  5DED A;  3CJH B;  2BOB C;  2Z5U A;  3GWK C;  4O2B B;  1IDS A;  5CA3 A;  3T9F A;  3KHL A;  1SCU B;  5DGH A;  4A5U B;  3K5L A;  4CKE A;  4C5C A;  3ASN C;  3L71 H;  1H2N A;  4GX5 A;  1SF9 A;  1KU9 A;  2C2A A;  4J9O A;  2P22 C;  4XBF A;  2AGA A;  3RVY A;  4R7C A;  3TII A;  2BCC H;  1XHX A;  3G71 V;  2OYQ A;  1QVF U;  2BTQ B;  2HDK A;  1VQP V;  1JX9 A;  4Q8E A;  1BSM A;  1QQC A;  3B2E E;  4EG0 A;  4CC6 A;  1Q90 D;  3G8D A;  2W7O A;  5CE8 A;  1N32 H;  3OUZ A;  5BWR A;  4CKC A;  5KFR A;  1KD1 W;  3FB8 C;  5FL7 G;  1GKF A;  3HKD B;  1BS3 A;  2W6I G;  4OPH A;  4UCU A;  5KX5 A;  5BWU A;  2F95 B;  1AN7 A;  1IBL O;  3JD0 A;  5LMN O;  4DR2 O;  2J9G A;  4TUY F;  3L2P A;  2YZN A;  2W7P A;  4I50 A;  4OX9 O;  3MFH A;  4TV8 B;  3UYY A;  2IW5 A;  4O7L A;  1WSC A;  1EZV H;  2EJ7 A;  3ZRV A;  2RJZ A;  2WE6 A;  4BXX G;  5EOY A;  2W0F C;  2W8L A;  3NBY B;  1HR0 B;  4LFA B;  3RVZ A;  1KQS U;  5CB4 B;  1CS0 A;  4LWS A;  4UCR A;  3OSP A;  1A48 A;  3RYC B;  5B66 Z;  1GN3 A;  1KEC A;  3N8D A;  1NR7 A;  1N56 A;  1YCI A;  1ZX3 A;  4A3D G;  2V59 A;  3J81 W;  1T5E A;  2JA8 G;  2LO1 A;  3SPG A;  4JZG A;  1OV9 A;  5KKN B;  4ZI7 A;  2M6Y A;  1OBD A;  2W9C B;  3RIZ A;  3QWU A;  3Q8P B;  4QE7 A;  2YUA A;  1M0W A;  3I4M G;  4DR7 H;  2AZ2 A;  3IG0 A;  4JTA B;  3LWB A;  5H2F Z;  2UXX A;  4QNH B;  5AG2 A;  4JV2 A;  1LR1 A;  3I55 V;  4Z1M G;  2UUA O;  4O4I B;  5DIS C;  1IBK O;  4DV5 O;  2YYA A;  4LF6 B;  4AHC A;  2CTR A;  5IP9 G;  5EZY A;  5KG1 A;  2M05 A;  2OCH A;  2EIK B;  3FKS G;  4DL4 A;  5B1O A;  3JAK B;  2YU9 A;  4MTG A;  2JEG A;  3AG3 C;  1T94 A;  2IJI A;  4DV2 B;  4ME6 A;  5L9X A;  4PJ0 Z;  4MW8 A;  4IL6 Z;  1TUB A;  5LP6 F;  3ABL C;  5KG2 A;  3T9A A;  1Q81 W;  1JDE A;  1PM9 A;  4QPK A;  2LQT A;  2CH7 A;  5H6Q A;  2Q0O C;  1GLV A;  4NXM O;  3KG2 A;  1OCR C;  1JIH A;  1JDB B;  4FE2 A;  1RPO A;  4EBE A;  3FKI A;  4ECS A;  1ZL8 B;  3GIJ A;  5KHG A;  5E1A C;  4EQ5 A;  3RAX A;  2HLD G;  4A3M G;  2YIA A;  1SEI A;  1JPX A;  3IGA C;  5DQI A;  3ZRX A;  4WFE A;  3RV3 A;  4LH6 A;  2QEX V;  2BQ3 A;  2HHF A;  1Z5V A;  4FMT A;  5KFI A;  4EBD A;  1ORQ C;  1COW G;  3B8N A;  1E4F T;  4JV1 A;  1UPG A;  2GDS A;  3SYA A;  1S10 A;  2LFS A;  4I0X B;  3KYH C;  1N0J A;  2P67 A;  4NKG B;  3K5I A;  3L70 H;  2UUB O;  4B3T H;  3FAV B;  3Q8S B;  4IRD A;  5KUM A;  2F23 A;  3NBZ B;  5KFV A;  3ABK B;  2C2R A;  1TWA A;  4PDM A;  3G4S V;  1S72 V;  5KLV H;  1CKN A;  1YVW A;  3EPG A;  4LFC O;  3CXH F;  5KMG B;  2PYL A;  2ZE8 A;  5LGU A;  3K57 A;  2ZNI A;  1W0K G;  2UXB H;  3ICX A;  3UZO A;  5CN0 A;  1MOF A;  2QF7 A;  4LF5 B;  2WB1 A;  5JH7 B;  4YXW G;  5L3B A;  2HG8 A;  3T1H B;  3ABU A;  4GKJ O;  3GIK A;  4ECY A;  1N8R W;  2B9Z A;  5C1P A;  2V58 A;  5BR8 H;  1FXK C;  3EFF K;  1OCC B;  5KG3 A;  4K8X A;  5IYZ B;  1HNZ H;  5JWP A;  1NKD A;  5JVD B;  1AJQ A;  2DOS A;  3ZED A;  1GSO A;  4IHJ A;  3ZHQ A;  1X59 A;  4H44 B;  2JGU A;  4CH5 A;  4QJF A;  3R23 A;  1KEE A;  1FJG O;  3KCX A;  4LF9 H;  2IA6 A;  1KC8 W;  4JI0 H;  1HNX O;  4ETS A;  4FFM A;  4IIJ F;  3AG4 B;  3M4I A;  2FK2 A;  5J2U B;  3CCS V;  3HO8 A;  2YS6 A;  2WA4 A;  5C3E G;  5DG9 A;  2DZD A;  2GHY A;  3D36 C;  4WBN B;  4PDB A;  3A0R A;  5HNE A;  1R6T A;  2JEU A;  1G6U A;  4LR3 A;  4X1Y A;  3ASO C;  1IYE A;  2FPP B;  4MV8 A;  1L0L H;  3T9C A;  3W5O A;  1P7B A;  5JUM A;  1Q86 W;  1B06 A;  4JI8 O;  2ZDG A;  3RBD A;  3TIN A;  1CP9 A;  1JMK C;  4DV0 H;  4LSX A;  5LL6 Y;  3C3S A;  4LFB B;  4O7Y A;  4LSA A;  3ZN1 A;  2IBZ H;  4ED6 A;  1VQK V;  3SYC A;  3E35 A;  3OMA B;  4X66 H;  3GB7 C;  5KT5 A;  2YS8 A;  1BJT A;  4CHI A;  1TAE A;  1EHI A;  3OTO H;  4O3R A;  3JAR A;  3I4N G;  1XNR H;  3M9N B;  2Z0A A;  3OSN A;  4AYB E;  5CA0 F;  1LUV A;  2VQD A;  4O7Z A;  3WG7 B;  1YJ9 V;  3JAW A;  4APM A;  3TJT A;  2JA6 A;  4J80 A;  5L3G A;  4UCV A;  4JI2 H;  2ATL A;  1EN6 A;  4ZHQ B;  1KBL A;  4GC7 A;  4KHP H;  1N33 O;  2UXD H;  3S24 A;  4F4W A;  3RYF A;  4JI7 B;  3RFC A;  1ULZ A;  3JAS A;  2CK3 G;  2JEJ A;  4I4T F;  4C5A A;  5KFE A;  1ZWI C;  4YHH O;  4O7V A;  2LGQ A;  5GW7 A;  4DV3 O;  3HKB A;  2DMX A;  2BSK B;  5LHI A;  4DLK A;  2JA5 A;  2DYS B;  2COG A;  3Q1K A;  5L1K A;  2VQE O;  1HNW H;  3G80 A;  2F66 C;  4J9S A;  1K7D A;  2CAZ C;  3OTF A;  4JI2 B;  2PUS A;  4C2M A;  1EKP A;  4XZ3 B;  1I7F A;  1Y1W G;  4EGQ A;  4FBT A;  4RAY A;  1K5S A;  1S9F A;  4TV9 A;  5J9P C;  2YIB A;  2ALZ A;  2C2D A;  5C8Y B;  3JAL A;  3ETE A;  3OR6 C;  2YXY A;  3K0G A;  1Q6H A;  4EFB A;  2VS0 A;  3JZI A;  3BA8 A;  1O75 A;  2XCL A;  4RQF A;  1SFO A;  3QG5 A;  1VQ6 V;  3APO A;  4DV7 O;  3T1Y B;  1WA8 B;  3H40 A;  4R8U B;  4Q20 A;  4YY3 H;  4MVR A;  2IU3 A;  4AQY O;  1Y14 B;  4O4J A;  3H9V A;  4FLW A;  2A1H A;  4DR6 H;  1VP7 A;  4X1K A;  2SCU B;  4MV7 A;  1I7N A;  3RYI B;  1KBH A;  5BMV F;  5KFZ A;  1V4Y A;  4JI4 O;  4XYL B;  1NVP B;  1I7L A;  4DL6 A;  2Q2U A;  1ENV A;  2EIK C;  4B3M B;  1S77 D;  4DV6 O;  3D36 A;  4OGQ B;  2QA4 V;  4IR9 A;  2NVY A;  1IBM O;  4PDR A;  5IWA O;  1T36 A;  2VR1 A;  2ZDQ A;  2PY5 A;  2HVR A;  1M57 B;  2PMZ A;  1QLE B;  3B40 A;  4I50 F;  3B09 A;  5EBL C;  1BHB A;  1JR9 A;  4YY3 B;  1FYJ A;  4DUY H;  3RF2 A;  3CYO A;  4LF4 B;  1BMF G;  4U3J A;  4K0K B;  3CMA V;  3CQZ A;  4HNA A;  4Q4D A;  3CJH A;  3BY6 A;  4FJC C;  3L4K A;  4KL1 A;  2UXC B;  2EIM B;  3C90 A;  4PA7 A;  4DO2 A;  2OIE A;  1B6R A;  1XNQ O;  2YIB D;  2QWO B;  4FFL A;  2ODM A;  2JRI A;  1EZ1 A;  4UCO A;  2QKS A;  3GWO A;  1RYS A;  2DQ0 A;  4ZI7 F;  4TQS A;  4A3C G;  3WB2 A;  2FLL A;  1AP5 A;  4BBS G;  4CMF A;  3ABK C;  3A2F A;  4DUY B;  3P3N A;  4MW3 A;  3GID A;  5HBR B;  5DLG A;  1OJH A;  1U97 A;  3ZHT A;  1RJP A;  2HHH O;  1BL8 A;  1OBG A;  2WB1 E;  5D1O B;  3TQT A;  3VBB A;  2NLJ C;  1Y66 A;  2DYR B;  5EYP A;  5HFL A;  1XEQ A;  3L73 H;  4WCE V;  3OUU A;  3SDL A;  4GZR B;  2C35 B;  1GM9 A;  4G27 B;  3RV4 A;  1VF7 A;  4HR7 A;  4I55 B;  3M9O B;  4KP4 A;  2UVR A;  4O4H B;  2MW2 B;  2IBK A;  1SQB H;  1N34 B;  1TWG A;  3M7M X;  1N36 O;  1VS0 A;  5CA1 F;  2MCT A;  5EZY F;  4DV4 H;  1SYX B;  3N42 B;  1Y74 B;  2V4D A;  3W7X A;  1OCC C;  5IJ9 A;  4F4L A;  2JA6 G;  2R85 A;  2QGN A;  3UO3 A;  1GSA A;  4A3B G;  2FPI B;  5KFA A;  1B04 A;  1SA0 B;  5KFQ A;  3AG4 C;  4X65 O;  3CCR V;  4FFP A;  2Q6A A;  4DUZ H;  4YJ3 F;  2FK1 A;  4DL2 A;  4RUC A;  3ZS8 C;  1K1Q A;  2C28 A;  4FS1 A;  1R9T A;  3PW2 A;  3CC4 V;  1XMO B;  4E4E A;  4JI1 O;  2WA3 A;  4UVB A;  3W1G A;  3MHS C;  2CUG A;  1BT8 A;  1K3E A;  5A2Q N;  2X0L A;  5DGA A;  2B63 G;  5FLM G;  4UFZ A;  1NTK H;  1Y67 A;  2ZCE A;  2R84 A;  1WLE A;  5LXT B;  1SC5 B;  3OEH G;  1I5Y A;  5BWW A;  5DG7 A;  4JI3 H;  1ZHS A;  1U96 A;  3QO5 A;  5LHH A;  1MA1 A;  1KP3 A;  2ZNJ A;  2OTJ V;  3FX7 A;  1M56 B;  2A06 H;  3OEE G;  3PO3 G;  2H8P C;  2CNV A;  4UXN A;  2V4R A;  5L3E A;  3TW7 A;  1TWF A;  1JFF B;  1PP9 H;  2ADQ B;  2KSD A;  5TIS Z;  2RCV A;  4FBU A;  2JIZ G;  5J2T B;  2YZL A;  3WG7 C;  3K03 A;  3M99 B;  3BG5 A;  4CS2 A;  1DLB A;  2FPG B;  4LF8 B;  4JI3 B;  1RJQ A;  1YXB A;  4IHJ F;  3GLK A;  3JAM W;  2YI9 A;  5BYB A;  4PZ7 A;  4CS3 A;  1PX2 A;  4UVA A;  2IH1 C;  1HR0 O;  4LFA O;  4J9Y B;  2VWJ A;  1WH2 A;  2VQF H;  2RDI A;  2R9I A;  4NXN B;  4X62 H;  2YRX A;  4NZO A;  3KAK A;  4HQ6 A;  4DYL A;  4BW9 A;  5K1P A;  1R3J C;  1E4E A;  3TY5 A;  4FVM A;  2XT9 A;  3AYH B;  2Q73 A;  3RBE A;  2LGW A;  3R65 A;  1HDJ A;  3UQ8 A;  1XMQ B;  2Y4U A;  1I94 O;  3W7U A;  1VMG A;  1WB8 A;  2W9A A;  2DYS C;  3R5F A;  3FD9 A;  3CSW A;  2JJ2 G;  1K8A W;  4O3Q A;  2WSS G;  1YI2 V;  5I5X A;  1VAR A;  3MJF A;  2DAB A;  3RB4 A;  5L1J A;  2ZKO A;  5KFT A;  3S3X A;  1AI5 A;  3SR2 C;  2PGG A;  1XHZ A;  1J5E B;  1CE8 A;  2EJ0 A;  1KP2 A;  2JGD B;  1R6N A;  1F7Y A;  3OE7 G;  4GKK B;  5EIB D;  5H5N A;  5KG4 A;  4Y8V B;  4RQE A;  3J81 N;  4D7S A;  1NBM G;  5KG6 A;  4C7U A;  4HZ3 A;  3DXR A;  2R7L A;  4LNU B;  1G4Y B;  1AR5 A;  1QCE A;  3CCQ V;  1ET0 A;  1AR4 A;  3F5T A;  4EB6 A;  3PW7 A;  5IYZ A;  4WFB V;  4LF6 O;  2ASJ A;  2R8I A;  3CWB H;  4O7W A;  1Q82 W;  5LMU H;  1PNL A;  4O2A F;  1Q7Y W;  2CW7 A;  1DF5 A;  4FFB A;  3U0G A;  2CZG A;  3HR0 A;  1XQ8 A;  4IIJ A;  4DV1 B;  4X8A A;  1DF4 A;  4DV2 O;  4JYA B;  1VQ9 V;  1ZLZ A;  5LGT A;  3GTQ A;  4J41 A;  4J7J A;  3GTO A;  3K9S A;  3E22 B;  4IRC A;  1S97 A;  4JAV A;  2IJJ A;  1M1K W;  2D3O W;  2HJD A;  4XX0 B;  1NQT A;  3PO2 G;  4LF7 B;  2OWO A;  1M57 C;  1QLE C;  3AX6 A;  1B6Q A;  4DW0 A;  4PHZ A;  4TSF G;  4X64 B;  2R70 A;  2VUG A;  1RP3 B;  1AJP A;  2XHB A;  1MZB A;  1GN2 A;  2Q7H A;  3K5O A;  5IDJ A;  4LMY A;  4DR4 B;  1Q43 A;  2ZT9 B;  2DAA A;  4FLU A;  3Q4H B;  3RTX A;  2EIM C;  1SQF A;  1M6V A;  4J7Z A;  3T9E A;  4DR3 H;  2KKW A;  4TV9 F;  3H4B A;  2F4V H;  3EYY A;  4CS4 A;  2W9B A;  4A3E G;  1PV0 A;  3TGU H;  5LHG A;  1S76 D;  4DR1 O;  4NB5 A;  5CA0 A;  3K06 A;  1M0T A;  2P4K A;  4LF5 O;  3K9A A;  2UU9 H;  5JCO C;  4B3S B;  1VKZ A;  3T1H O;  2YXH A;  4ZHQ A;  2DYR C;  5L1L A;  4LH7 A;  4JV5 H;  4MVO A;  4PBC A;  3IFX A;  4CKB A;  4BY7 G;  2KQX A;  1MSW D;  1ROP A;  1QLN A;  1NI8 A;  4HAM A;  4J9M A;  3D3I A;  2FKL A;  1IXM A;  3QTC A;  4JF3 A;  4PA6 A;  5CM0 A;  1FKA H;  1FVI A;  3K58 A;  4QWD A;  4MVZ A;  2UUC H;  1JJO A;  1NR1 A;  2BSK A;  3BAC A;  1PNM A;  1FFT B;  2UU9 B;  4P2Z A;  4MS2 A;  3THO A;  2HFE C;  2QWQ B;  3RYH B;  5LOV B;  4B3R H;  4NR1 A;  2DW4 A;  1JOY A;  4ZIB A;  5FLX W;  1KT8 A;  3UT5 B;  3KHG A;  2W8K A;  5C8Y A;  2VA2 A;  2YS7 A;  3WO0 A;  1UC8 A;  1LNQ A;  5CAE B;  4JI6 H;  2YI8 A;  3JAT A;  3A0B Z;  4LFB O;  1E1Q G;  3TW6 A;  1AJN A;  2FB5 A;  3E89 A;  3HKC B;  4PI2 A;  1EM1 A;  5EWF A;  3UO2 A;  2BR0 A;  1L2Z A;  3K79 A;  5LA6 A;  3K59 A;  1KUT A;  4IAJ A;  4R8U A;  3DTG A;  4YJ2 B;  3GIM A;  3TCU A;  5BMV A;  3HPL C;  3JCZ A;  5EK0 A;  3U9T A;  4FFK A;  5KFG A;  2YSU B;  4A3F G;  3QZ8 A;  1M56 C;  4AYB A;  3X2Q B;  3GTL A;  3N2G A;  5IP7 G;  4JI6 B;  1HW7 A;  4FLY A;  3EHB B;  2C00 A;  5D8D A;  3L72 H;  3VNN A;  3BEH A;  2V7Q G;  4GYC B;  3QFF A;  1C30 A;  1IZ3 A;  4JI7 O;  4RNN A;  3LSU A;  1FFX A;  3H1J H;  5KFS A;  1S3J A;  2PZS A;  1NT2 B;  2RN9 A;  5CB4 F;  1YTF D;  1N32 B;  2WAQ E;  1FD9 A;  1NU1 H;  1GN4 A;  2E74 B;  5F9N A;  3BAB A;  4J9L A;  1Z2G A;  2ZR3 A;  3N2K A;  4W4K A;  1P4R A;  2E5L H;  3HOW G;  5ITZ B;  4RUA A;  2R8K A;  3R5H A;  1XDC A;  2QJ1 A;  4FM0 A;  3Q2O A;  3GDE A;  4CH6 A;  5BPH A;  5KFF A;  4A3G G;  3CME V;  3C0F B;  3BQ0 A;  2E76 B;  2EIY A;  5JCO A;  4GX2 A;  5LGN A;  3EPI A;  4JGS A;  5C44 G;  1WAZ A;  4GCZ A;  2GV9 A;  4O4H A;  3E8G A;  4F6R B;  1I1K A;  1GYF A;  3T1Y O;  4FZ0 A;  4JAA A;  5B1B B;  4O4I F;  5CA1 A;  2I80 A;  1L1F A;  2LJ2 A;  2JA7 G;  1Y76 B;  3UM7 A;  1RFY A;  3SE7 A;  5KA6 A;  1CQJ B;  4RAI A;  4Q4C A;  4QW8 A;  2PVP A;  3M8A A;  3HB3 B;  1LUW A;  4DR7 B;  3E5N A;  2C2E A;  2QE7 G;  4RNO A;  1AI6 A;  4B3M O;  2EZP A;  2FTK A;  3BAA A;  4HN2 A;  1SA0 A;  4R50 A;  4RWU A;  4CBC A;  2VUM G;  4MTD A;  3B77 A;  2WWW A;  4YJ3 A;  5E79 Z;  2YID A;  5IY5 B;  2GTA A;  2GQS A;  5H6R A;  3W1B A;  4DRX B;  4JI5 O;  4LF4 O;  1KTA A;  1Y1W A;  2P7T C;  5D5Q A;  4UUJ C;  4K0K O;  5I5T A;  3FB6 C;  5LP6 B;  2ILM A;  3RUP A;  3L75 H;  1R3I C;  2YXL A;  4JXU A;  3VOT A;  1YIT V;  1CXZ B;  1I1M A;  5IYD O;  3B8M A;  2UXC O;  3ZRS A;  2YEV A;  1R1B A;  5LXT A;  3KZI Z;  5LYJ B;  1T3N A;  1TWC A;  2IJK A;  3BQ1 A;  3ZHR A;  2J6U A;  2P0A A;  4H0L B;  1GAX A;  3BHP A;  4DK1 A;  3SJQ C;  2WLI B;  1S0N A;  2Q67 A;  1PNK A;  4PA3 A;  5JJE B;  5KHJ A;  3T5H A;  3CRQ A;  3T99 A;  4JYC A;  1AUX A;  3VPD A;  1DV1 A;  5JH7 F;  2AGQ A;  4O84 A;  2RNB A;  3KTM A;  1XDN A;  4WHX A;  4Q43 A;  2Q7D A;  4BIO A;  1K33 A;  4I7Z B;  4B3T B;  2HGW A;  4QSH A;  3I56 V;  3QNE A;  5IYZ F;  1YZB A;  1RPR A;  5KFW A;  3HOX G;  5JVD F;  2ZM6 H;  1N34 O;  4X20 B;  4JYB A;  4A3I G;  4FIP C;  4FFO A;  3JSL A;  2LW7 A;  4Z2W A;  2X0S A;  4J9Z B;  2R7Z G;  4JTC B;  5B3S B;  1MNG A;  1OCZ B;  3CSX A;  2UXB B;  2WDT A;  1ZAU A;  3CP1 A; 
#chains in the Genus database with same CATH homology
 4X20 A;  3L4K A;  1HR0 H;  4LFA H;  4KL1 A;  2UXC B;  4DV1 H;  2CFM A;  3CVZ A;  5LL6 b;  4JYA H;  4L8J A;  4FLX A;  5BR8 B;  3RGZ A;  5D5P A;  2YIB D;  1QHT A;  1HNZ B;  4UCO A;  5EYP B;  3PN1 A;  4DV7 B;  1M4U A;  4BWS C;  4PI0 A;  1I94 H;  4TUY B;  2RGV A;  4AQY B;  3WB2 A;  2CW8 A;  4LF7 H;  4LF9 B;  4DUY B;  3A2F A;  2PYJ A;  4CH4 A;  4JI0 B;  5D1O B;  4O2A B;  4X64 H;  5EYP A;  2E3C A;  3VQV A;  5IJ9 B;  4CC5 A;  1VF7 A;  4DV6 B;  3JAW B;  4I55 B;  4O4H B;  5IWA B;  1L8D A;  4DR4 H;  3CHX A;  1CKM A;  1Q8I A;  3F8N A;  3LNN A;  1N34 B;  5KHH A;  3M7M X;  1VS0 A;  5D1O A;  3BRC A;  2MCT A;  3N6X A;  4O2A A;  4DV4 H;  1SYX B;  3N42 B;  2V4D A;  2HVQ A;  1Z2P X;  1I94 B;  4DR2 H;  5LMN H;  1IBL H;  3JAS B;  3CB2 A;  5IJ9 A;  4RB2 C;  4DV0 B;  1Z2O X;  4K8Z A;  4LF6 H;  4I55 A;  5KHI A;  4OX9 H;  2E5L B;  1B04 A;  3NC0 B;  4X1I A;  4B08 A;  3KAL A;  3J7A K;  1XK5 A;  2JS5 A;  1TVK B;  1SA0 B;  5FNV B;  4DV2 H;  4B3S H;  1P49 A;  1XNQ B;  4X66 B;  4DUZ H;  4A2B A;  3RFR A;  3BA9 A;  4TQD A;  3ZS8 C;  4FM9 A;  1XMO B;  3OTO B;  1XNR B;  1IBL B;  5GON A;  3W1G A;  5FNV A;  1S68 A;  1ZHQ A;  4EEQ A;  4UFZ A;  4KHP B;  3U0Z A;  2ZCE A;  4UCS A;  1CKO A;  5LXT B;  2UXD B;  4I4T B;  4Q0Y A;  5K1X A;  4JI3 H;  4EFE A;  1Q5O A;  4RB3 C;  1ZHS A;  3RJ0 A;  2ZNJ A;  3KXY T;  2UUA H;  3RR5 A;  2EX3 A;  4I4T A;  1IBK H;  4CH3 A;  4DV5 H;  1JFF B;  1DGS A;  3GB8 B;  5IJ0 B;  1HNW B;  2WYO A;  4DR1 H;  1YEW A;  4O4L B;  5J2T B;  1E4G T;  4ZOL B;  4LF5 H;  4CS2 A;  5JQG B;  4BWA A;  4X65 B;  2R9A A;  4LF8 B;  4MTE A;  4JI3 B;  3T1H H;  5A2Q W;  2HGS A;  1JFF A;  3JAM W;  2YI9 A;  4PZ7 A;  4CS3 A;  3HXL A;  4FM2 A;  2HEP A;  3VQW A;  4NXM H;  2VWJ A;  1WH2 A;  4JI1 B;  1BGW A;  2VQF H;  3QF7 A;  4NXN B;  5J2T A;  4X62 H;  4FLV A;  3WB1 A;  4ZOL A;  3KAK A;  2R72 A;  5JQG A;  1X4T A;  4BW9 A;  5K1P A;  4O2B B;  3TY5 A;  4FVM A;  1O9H A;  3UQ8 A;  1XMQ B;  3SGI A;  4DR1 B;  3K5L A;  5IT9 W;  4DR6 B;  4FLT A;  1KU9 A;  2P22 C;  3SR2 C;  1XHX A;  2PTM A;  2PGG A;  4O2B A;  1XHZ A;  2BTQ B;  5KX5 B;  1J5E B;  2OYQ A;  1P16 A;  4J0M A;  2HVS A;  4NVP A;  4EB6 B;  1QQC A;  4GKK B;  3B2E E;  5EIB D;  4CC6 A;  5LP6 C;  1N32 H;  4D7S A;  4FLZ A;  4LFC H;  2ZM6 B;  4LNU B;  4FFB B;  3HKD B;  4GLX A;  4LFB H;  4IIJ B;  2RQ6 A;  2BTQ A;  4UCU A;  5KX5 A;  2F95 B;  1AN7 A;  5FD6 A;  3L2P A;  1SKV A;  4EB6 A;  5IYZ A;  4I50 A;  3SJB C;  4GKJ H;  2F93 B;  4TV8 B;  2WE6 A;  2RJZ A;  5LMU H;  5EOY A;  2CW7 A;  4LNU A;  4FFB A;  3NBY B;  3HKD A;  1HR0 B;  4LFA B;  1XQ8 A;  4IIJ A;  4DV1 B;  3VQY A;  5CB4 B;  4JYA B;  3TY9 A;  4RAZ A;  4UCR A;  3E22 B;  4X1I B;  4ZI7 B;  3RYC B;  4TV8 A;  1FJG H;  1HNX H;  2W57 A;  3L4J A;  4LF7 B;  3DSQ A;  4Q6G A;  2OWO A;  3J81 W;  1T5E A;  5CB4 A;  4PHZ A;  3E22 A;  4ZI7 A;  2Q7G A;  3FFQ A;  3RYC A;  4X64 B;  4JI7 H;  2R70 A;  2VUG A;  5GON B;  3RIZ A;  3QWU A;  2XHB A;  1M0W A;  1MZB A;  4DR7 H;  2VWK A;  2Q7H A;  3K5O A;  3IG0 A;  1V9P A;  5EZY B;  4JI8 H;  4LMY A;  4DR4 B;  1Q43 A;  4FLU A;  5CA0 B;  3RTX A;  1SQF A;  4DV4 B;  3MAQ A;  4DR3 H;  4DR2 B;  5LMN B;  2KKW A;  1S5J A;  1TUB B;  4O4I B;  3IAY A;  2F4V H;  5DIS C;  3EYY A;  3BPZ A;  4CS4 A;  4LF6 B;  4AHC A;  4OX9 B;  5EZY A;  3SJA C;  2ZIN A;  5CA0 A;  3JAK B;  1WN7 A;  1M0T A;  2UU9 H;  5JCO C;  4DV2 B;  1P8L A;  4B3S B;  4F6R A;  1TUB A;  4O4I A;  4ZHQ A;  4JI8 B;  4DUZ B;  4LH7 A;  3N40 P;  4JV5 H;  2VOB A;  1M93 A;  4A2A A;  3JAK A;  1X9N A;  3T1Y H;  1M5I A;  5KHG A;  4EQ5 A;  1N33 H;  2YIA A;  2IM9 A;  4I9Q A;  1FKA H;  3QTC A;  1SEI A;  1FVI A;  3K58 A;  4LH6 A;  2UUC H;  1JJO A;  2QM4 A;  4M7E A;  1Z5V A;  4I7H A;  1CKN B;  1E4F T;  3RGX A;  2UU9 B;  4YHH H;  1D5A A;  4B3M H;  3KYH C;  4DV3 H;  3JAT B;  3THO A;  3N43 B;  3RYH B;  4B3T H;  5LOV B;  1RSO A;  4B3R H;  3NBZ B;  5JJN B;  2VQE H;  2UUB H;  4ZIB A;  2UUA B;  5FLX W;  3UT5 B;  1O9G A;  2HIX A;  1IBK B;  5C8Y A;  4DV5 B;  5LA6 B;  1CKN A;  5EIB C;  2VPS A;  4JI5 H;  5KMG B;  2PYL A;  4JI6 H;  2YI8 A;  4LF4 H;  3ETQ A;  3JAT A;  3K57 A;  4K0K H;  3RYH A;  3JSN A;  5LOV A;  3HKC B;  4IHJ B;  3ICX A;  5BMV B;  2ZNI A;  2UXB H;  4PI2 A;  4LF5 B;  5JH7 B;  3UT5 A;  3T1H B;  3KAJ A;  1L2Z A;  2UXC H;  2FE3 A;  2ZIM A;  3N2G B;  5LA6 A;  3K59 A;  4IAJ A;  3K5N A;  5BR8 H;  5KMG A;  4K8X A;  4NXM B;  4YJ2 B;  5IYZ B;  1HNZ H;  3ZED A;  5JVD B;  4I50 B;  2VQF B;  4RB1 A;  3HKE A;  3WB0 A;  3HKC A;  4IHJ A;  5BMV A;  4X62 B;  4DV7 H;  5JH7 A;  5FPR A;  2JGU A;  4CH5 A;  4AQY H;  2Q2T A;  4X1Y B;  4LF9 H;  5JJJ B;  3N2G A;  4JI5 B;  4JI0 H;  4JI6 B;  1FFX B;  1HW7 A;  4MV9 A;  4FLY A;  4ETS A;  3M4I A;  4YJ2 A;  1SQG A;  3VNN A;  5JVD A;  4JI4 H;  5J2U B;  3RGB A;  4WBN B;  3VQX A;  4DV6 H;  4GYC B;  2RGR A;  4PDB A;  1I6U A;  3N2K B;  1IBM H;  1G6U A;  4LR3 A;  2UUB B;  5IWA H;  4X1Y A;  1FFX A;  2HIV A;  2PZS A;  3W5O A;  1N34 H;  1NT2 B;  4PZ6 A;  1N32 B;  3LML A;  5J2U A;  3GJX B;  4LFC B;  1JMK C;  4WBN A;  3BAB A;  4DV0 H;  4LSX A;  5KHK A;  2JVD A;  3N2K A;  4HBN A;  4LFB B;  3H20 A;  2E5L H;  2YCH A;  4LSA A;  2O03 A;  4JI4 B;  3JAR B;  5ITZ B;  4TQF A;  4GKJ B;  1Z2N X;  3U10 A;  3SJC C;  2QJ1 A;  4RB0 A;  4FM0 A;  4TUY A;  3GDE A;  5LMU B;  3J80 W;  1IBM B;  1XNQ H;  4CH6 A;  4X66 H;  1BJT A;  3C0F B;  5CA1 B;  5JCO A;  4UCT A;  1TAE A;  1XMO H;  3OTO H;  3JAR A;  5ITZ A;  1XNR H;  3RYF B;  1FJG B;  1HNX B;  4APM A;  3JAW A;  2HHH H;  1GYF A;  4F6R B;  2GV9 A;  4O4H A;  4UCV A;  4JI2 H;  4ZHQ B;  4KHP H;  2Q0A A;  4D7T A;  4R7R A;  5CA1 A;  2UXD H;  3HKB B;  3S24 A;  1WPB A;  3TY8 A;  3RYF A;  4JI7 B;  3JAS A;  4YJ3 B;  3K5M A;  4DR7 B;  1N36 H;  3BAA A;  4TV9 B;  3HKB A;  1TVK A;  4TOI A;  1SA0 A;  1TGO A;  1H2S B;  2ZIO A;  3JAL B;  4MTD A;  1HNW H;  2F66 C;  4DR3 B;  2HHH B;  4YJ3 A;  2CAZ C;  3OTF A;  2F4V B;  4JI2 B;  2PUS A;  1I7F A;  3W1B A;  4DRX B;  2F1M A;  4RAY A;  4X65 H;  4LF8 H;  4TV9 A;  5D5Q A;  2YIB A;  3N44 B;  5LP6 B;  5C8Y B;  3JAL A;  2YXL A;  4DRF A;  1XI1 A;  3FMA A;  1N36 B;  4O4J B;  4JI1 H;  4NXN H;  4X1K B;  4EFB A;  4JV5 B;  5LXT A;  4DRX A;  5LYJ B;  3BA8 A;  4PZ8 A;  1O75 A;  3K3V A;  5LP6 A;  4FM1 A;  3QG5 A;  3T1Y B;  1XMQ H;  1N33 B;  4YY3 H;  2BTO A;  3BHP A;  4DK1 A;  4E6N A;  3MWM A;  4O4J A;  4FLW A;  1A0I A;  4DR6 H;  4DR5 H;  5JJE B;  5KHJ A;  4X1K A;  2Q7E A;  2KSW A;  3HKE B;  4MV7 A;  2UUC B;  4DK0 A;  5LYJ A;  3RWR D;  3RYI B;  3N41 B;  5FD5 A;  4RZQ A;  1J5E H;  5IJ0 A;  5FPO A;  4YHH B;  1XDN A;  2Q2U A;  4B3M B;  4GKK H;  4U3J B;  2XIG A;  4DV3 B;  2P5O A;  3DF7 A;  4O4L A;  4B3T B;  4HNA B;  1WNS A;  4B3R B;  1TA8 A;  2PY5 A;  2HVR A;  2VQE B;  5D1P A;  2ZJT A;  2ZM6 H;  3RYI A;  4X20 B;  1Z5W A;  1Q3E A;  1KMI Z;  3JSL A;  1S03 G;  4YY3 B;  4DUY H;  3RF2 A;  4LF4 B;  4U3J A;  4DR5 B;  4K0K B;  4AIL C;  4HNA A;  3CSX A;  2UXB B;  2WDT A;  1ZAU A;  3U11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...