1TAEA

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
QPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase, NAD-dependent
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 104
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1taeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1taeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1taeA02
2Q2UA 4UFZA 4B3RB 4UCOA 1VS0A 5D1PA 4B3SB 4DRFA 5FPRA 4DV5B 4X65B 4DR5B 3KYHC 4OX9B 5BR8B 4NXMB 2UXBB 1N36B 1CKNB 1IBMB 4DV3B 4UCUA 4B3TB 4DR7B 4JI1B 4DV0B 4DR6B 2UUCB 2VQEB 1XMQB 4DUYB 4JV5B 1ZAUA 3UQ8A 4DV7B 4LFCB 3GDEA 4LF6B 4LH6A 1A0IA 1CKMA 4DR2B 3VNNA 1DGSA 2ZM6B 3BA8A 1CKNA 2Q2TA 4UCVA 3OTOB 3SGIA 1V9PA 2F4VB 3BAAA 1HR0B 5D1OB 3BABA 3RTXA 4JI0B 3NBYB 1CKOA 1J5EB 4PZ8A 3T1YB 3W1BA 1N33B 3S24A 1P16A 4CC5A 5DISC 4LF8B 4DR4B 4GKJB 1N32B 1B04A 2HIVA 3GB8B 4JI3B 4JI2B 1X9NA 1XMOB 1IBLB 1HNZB 3PN1A 5D1OA 3QWUA 4TOIA 3NC0B 4EQ5A 1FVIA 4YY3B 2VUGA 3JSLA 3W1GA 4EFBA 3JSNA 5LMUB 4GKKB 4LFAB 1TAEA 1S68A 2E5LB 4LF9B 2HVQA 4LF7B 5FPOA 4PZ6A 4X62B 4JI7B 1I94B 4UCRA 2UU9B 4DR1B 3TY5A 5IWAB 2HHHB 2OWOA 1FJGB 1HNXB 4DV1B 2HVRA 4DV6B 2UXDB 4EEQA 3RR5A 1IBKB 4GLXA 4LF4B 2UUBB 4CC6A 4YHHB 4K0KB 4DV4B 3BA9A 5LMNB 4NXNB 2CFMA 4JI5B 2UUAB 1XDNA 2VQFB 4AQYB 4X66B 1TA8A 4DUZB 3TY8A 3NBZB 4DR3B 1XK5A 4DV2B 1HNWB 3T1HB 3W5OA 4PZ7A 4JI8B 4E6NA 4LFBB 1XNQB 2UXCB 3TY9A 3GJXB 4JI6B 1N34B 4X64B 1P8LA 4UCTA 4B3MB 4LH7A 4UCSA 4JI4B 4EFEA 4JYAB 2HIXA 2HVSA 4KHPB 4LF5B 3L2PA 1XNRB
chains in the Genus database with same CATH superfamily
2CE4A 3HOXG 1I94O 3CCJV 2UU9O 2ZE8A 2Q5ZA 2W7PA 3N6RA 4A2BA 3F5TA 3TGUH 3ZJZA 5KUMA 1W0JG 5C3EG 2JDIG 4B3TB 1K97A 4DR7B 1GSHA 2UUCB 5K2MA 3G6VA 3CX5F 5IP9G 1BCCH 1DIKA 4J11A 2Q4PA 4LBEC 4LNUA 5B3SB 3K5NA 2Y0SA 5A2QN 1A0IA 5JCOC 2FLLA 2XT9A 2EIMC 4BXXG 3M7MX 4NXMH 1GTOA 1VIBA 3NBYB 4ZI7A 4IAJA 1KP3A 1NS1A 3J80W 4DR6H 3U9TA 3TJTA 5DN6G 5DQGA 1WJZA 2R92A 4X64O 3GWOA 1SQGA 2NN4A 4U3JB 4G28B 4I0XA 4JYYA 4EGQA 3SI8A 3X2QC 4LF5O 4FLTA 5EYPB 3ZCCA 3N27A 2QA4V 4B3SO 3TETA 1J95A 4BIUA 2BQRA 3BJYA 4A3CG 2D2CB 4LF9B 1RM1C 4PZ6A 1L2ZA 2A79B 5KFGA 4DR1B 2DLNA 4QWCA 2KB1A 4CKCA 2OWOA 2IJIA 1ZL8B 3QO5A 1DV1A 1FKAO 3CE2A 4FFLA 5I5WA 3U0GA 4JV0A 5KHHA 1DF5A 3RV4A 3H1JH 1Q6HA 1L0LH 3UCSC 1BL8A 3T1CA 1FXVA 2PTMA 1GN2A 2Z02A 4GLXA 4LMYA 4WFAV 3JZIA 3OEHG 4IGGA 5GONA 5KG0A 4IRCA 5JH7F 5KFTA 1AR4A 1Q7YW 4JI5B 3K57A 1GH6A 1JX4A 3JRXA 3K06A 4BY1G 2JA7G 2YL2A 2VS0A 2FK3A 1IBLO 5K3WA 4QWBA 2W0FC 3SYPA 3RYCA 3T54A 3FKIA 1OCRC 3CHXA 2C2EA 2QWRB 2R92G 4BBSG 1Q6IA 5C1OA 1BZKA 4O2BB 4B3RB 4X66H 4GX2A 4BW9A 1XUQA 2UXNA 5L1IA 4DUZH 3UM7A 2HP8A 4DR5B 3OUUA 4PV1B 2R93A 3RWRD 4JI8H 1BT8A 5LOVF 2NVXA 4L87A 4EEYA 3ZHVA 4CH6A 4JGSA 4P9PA 3HKDA 3RBZA 2M05A 1IBKO 2FYUH 4JV5B 4PI0A 1NQTA 2KSDA 2YW2A 1D5NA 4LF6B 4K0KO 2R8IA 2JA5A 3ZMTA 1Y4MA 2PZSA 3KREA 1NVPD 4XX0B 2HLDG 2W6ZA 3DF7A 4MV7A 1W2BU 1JMKC 1SETA 2KG7B 5IYZF 1TWCA 1A48A 1HNWO 5JVDB 3I4MG 4PZ8A 5KG3A 4B3TH 2WYOA 1T5EA 4J9RA 4DR7H 1B6SA 3ZMZA 1PK8A 3I55V 3C90A 1EZVH 4JZGA 3WG7C 4HNUA 2RQ6A 3LULA 3V6HA 3GTGA 3A2FA 3L9DA 1M0TA 2QTOA 1M6VA 3FAVB 4M7EA 4IWYA 4TQSA 1ZWIC 1JA8A 1S3JA 2WLJA 4FFNA 3CJHB 3FB7C 4EFBA 4QJFB 4I4TF 1EZJA 5BPFA 3RYIB 1TAEA 4DV5O 4MTDA 4OX9O 5LHGA 3STLC 1YDXA 1I94B 1S03G 1WPBA 4UCRA 2N05A 2EULA 1NZ6A 2UU9B 4RAZA 1EKPA 4AYBA 4FFKA 1R6NA 2VQEO 1S0MA 1KECA 4YIPA 4O7TA 3UZOA 1Q86W 2FMLA 4KP4A 4QIWF 4EEQA 5KMGA 2CW8A 1PL4A 4FBTA 4H44B 5LP6F 3ZMSA 4LF9H 2JVDA 3ASNB 2EJ0A 4WBNB 4DR1H 2WLKA 5I5UA 3AG4B 5H9CA 1ENVA 4Q8EA 1VP7A 4MA5A 1M7JA 3L70H 1TA8A 2QYZA 2GUZB 1K3EA 3OD4A 4A3FG 4A2AA 4JYAH 3GJXB 1V4YA 4O4LF 2DABA 3T5LA 4X64B 3RGBA 5HV6A 4JI4B 2HVSA 3JAKA 4GKKO 4HN2A 4LF5B 3N41B 3W7SA 5I47A 4ED6A 4X62O 4JI5H 3H01A 4FFBA 3LNNA 2A3QA 1FD9A 4B3SB 4O7RA 2JIZG 5KFKA 1CQIB 2IBZH 3PO2G 4MVSA 3BQ0A 1W59A 3BY6A 2CH7B 3J80N 1PNMA 1C3OA 4ED1A 5JQGA 4UCUA 3OUSA 1K34A 4RO2A 5LBQA 4IIJB 5LGUA 1R6TA 1FXHA 3VQWA 2XTAA 3SJBC 4O3NA 4LSAA 2A7WA 3HT5A 4XBFA 2IM9A 4L1KA 2ZGIA 4B3RH 1SCUB 3RGXA 4IYHA 1VQ5V 3OMIB 2YCHA 1XI1A 1I5XA 4PI2A 4YR0A 1S0OA 5LYJF 5BYAA 2B63A 4J9PA 4DR5H 2CQYA 5FNVF 5IYCG 5ITZB 4DV2O 2XCPA 3OR7C 3K0DA 4UB8Z 1GN3A 2R9AA 3D3QA 3BEHA 3GIMA 3CEBA 5FLXW 4TV9B 2W6JG 1VF5B 5DISC 4I7HA 3PVXA 5DAAA 2LW1A 1NBMG 5EBLC 1IURA 4LF6H 5KX5A 3UT5B 3TINA 4TV8A 1IBLB 2P0AA 1GMGA 5CB4B 3PN1A 2GSMB 4A3EG 3E22A 2EIKC 4E4TA 4C7UA 3JD2A 5IYZB 1JDEA 2QK4A 3HKEA 5IT9W 3CVZA 1RPOA 5I5SA 2FL4A 1VF6A 1CP9A 4X88A 3VQYA 4EGJA 2V59A 3SYCA 3N44B 3KAJA 1E79G 2IU0A 3ABKB 3QNEA 2P5OA 3CYOA 1OZ0A 3JASB 4DUYO 3H20A 2ADQB 2ZDIA 1P84F 5J2UB 1TVKA 3K58A 1AP5A 4ZI7F 2QJ1A 2J6TA 2GDSA 2QWNB 1M56C 1IBKB 3GV7B 5HNEA 4K0KB 1K1SA 2E3CA 5IJ9A 4U7OA 1I94H 2P4VA 4X1YB 2CFMA 1MZBA 1JLLB 2UU9H 1VQMV 2YYAA 5CAEB 1VF6C 1RK6A 3T5KA 1KJQA 1FFXB 3BFRA 2B63G 2K1EA 3NBZB 1HNWB 4QPKA 3E35A 5JJEB 3PFFA 1E1RG 2ZDIC 2O57A 2QM4A 3OGIB 3TY9A 5KG4A 4EG0A 1NR1A 2VA2A 4DIMA 2EJRA 2R7NA 4DL6A 1K33A 1K92A 2GLTA 4P30A 4KL1A 3JALB 5CBGA 4LFAO 3U9SA 2RGVA 5IJ0B 3CC2V 4FMTA 3E5NA 4O84A 3I12A 3LMLA 4YJ3B 5JQWA 2R6FA 5LGNA 4IHJA 1WR2A 1QHTA 2R86A 3PR5B 2X0SA 2C28A 3GIDA 5LA6A 5IWAO 5EWFA 2OIGA 4DV5B 1YJ9V 5EOYA 1I5YA 4F4WA 4OX9B 4HQ6A 4JPRA 5E25A 4K35A 1CKNB 2VUMA 2ETNA 5GONF 3K5MA 2PYLA 3Q4HB 1D2DA 1S5HC 5EWGA 4X64H 2VQEB 4MVRA 4CBCA 1ZHQA 1CQJB 2R7ZG 1ZAUA 4LF5H 1ZSPA 1NR7A 2IJJA 2JGDA 2UUAO 4B3SH 2Q2TA 3M9NB 1QVGU 3JYCA 5C8YA 3R5HA 4BY7G 2R82A 3M9OB 3BAAA 3K08A 1JPXA 3RB4A 1AI5A 3OM3B 5L9XA 2GQRA 3KTMA 4RB1A 2B1GA 3T5HA 2ZXWC 1PNKA 4WFBV 2OIEA 3LDEA 4Q44A 1FKAH 1Y66A 2OCCC 3VOUA 5I5XA 5KT3A 4TSFG 5BMVA 1Y1WG 5KG5A 4R6ZA 1SA0A 3S3XA 3U11A 4AYBE 1VQOV 5LYJB 4GKKB 2E2HA 3AG3B 2VR1A 1BJTA 3R5FA 5FPOA 2PMZE 2ZR3A 4X62B 3HBLA 3FDSA 1Y76B 2MCTA 1S0NA 1R9TA 2C2DA 4ZHQA 2WAQE 3EPIA 2EIMB 3K9AA 2DQ3A 4DRXB 4AHCA 1N0NA 2YSUB 3UFXB 3OFNG 2QTSA 2LGQA 4FPPA 1IBLH 2VUMG 3BACA 2YIBD 5IYDG 2BR0A 3CCLV 4O81A 4JTDB 3N2KA 1VQ6V 5KFUA 3OUZA 3ORRA 3RYHA 2QKCA 2FKLA 1WSCA 4J9OA 2OTJV 5B1BC 4JI0O 5IYCO 3IFXA 3X2QB 1GK9A 2IMWP 4DW1A 4Q0YA 2JA8G 1AUXA 4LWSB 2BE3A 3FYIB 1XOUA 5I5YA 3TQTA 4DV2B 3F7YC 2W9BA 3H0GG 2CDYA 4JI2O 1K83A 3H40A 1TGOA 1HNZO 3ZRWB 4HYOA 3A0BZ 4QW9A 4O2AB 3JARB 1T94A 4I9QA 1IBKH 4O4JB 1KBLA 3R9RA 3GTPA 3SJAC 4K0KH 5HFMA 1Y14B 2PYJA 1MABG 4FS2A 2Q2UA 5H6QA 4RB3C 3E86A 3K79A 3SYAA 3V4ZA 2DIKA 4GX1A 3QTCA 3CCQV 4X8AA 1BXRA 2CTPA 2R70A 3P3PA 1YTFB 1WB8A 2JGUA 3KCYA 4N21A 2NU6B 3K3PA 1HNWH 5FLXN 2IJHA 1FYJA 3E83A 4Q4DA 2CGNA 4F4XA 4DV6O 3G80A 4LP8A 1P4RA 3GIIA 4EKWA 3PW5A 4CE5A 4DUYB 2W71A 4LF4O 3DGEA 4NZMA 2XOKG 2A1HA 5H6RA 2MK3A 4JF3A 4C5BA 1OCRB 1UNNC 3K5OA 2AGQA 4DV5H 1GSOA 4EBEA 2QF7A 2W6OA 5D1OB 3BABA 4OX9H 3SPIA 1AILA 1CKOA 3UO3A 2YC0A 2ZR2A 4HNAA 5BWUA 4PDRA 3DXRB 4FM2A 5DMXA 3J7AK 5DG9A 1U97A 3SPHA 5B1OA 3AG7A 3ABTA 2VQEH 3CC4V 2PGGA 1OWTA 1YIJV 2HIVA 1B04A 4JYAO 3ETHA 3MR2A 2NNUA 1OCZC 3NC0B 5JQGF 3CRMA 1FVIA 1MOFA 3ZS8C 4LFAB 1S68A 2PVPA 3ZHRA 5L3BA 4YR3A 4FM1A 3ZEDA 1KBHA 1EKFA 5LHIA 2ZE5A 3B8MA 3FYEB 1VBGA 3J7AU 3F7VC 3JAWB 4FIPC 3OMNB 3CSWA 5BWXA 3ZMUA 4P2ZA 4J9MA 4RCNA 4XYMB 5L3EA 5IWAB 3IN5A 3BRCA 4UUGA 1WA8B 3N42B 5J2TB 2XAFA 4AILC 2P22C 3KXYT 3J81W 1JXLA 2F66C 4DV7O 1P49A 1V54B 2YUAA 4LC1A 1K73W 3CMEV 1QR8A 2ZINA 4DXWA 2YRWA 2ZM6O 3D3IA 3OUFA 1T36A 4GKKH 1SS3A 4WF9V 2PUSA 4X62H 2DZDA 2X0LA 5KX5F 5CA0B 2UUAB 4O7VA 4TV8F 2W9AA 5LXTB 4BAYA 3HB3B 3IAYA 3SE7A 3U55A 1S76D 3JZFA 1VQLV 2DPIA 2N04A 3R66A 2OYQA 4X20B 2FE3A 2VA3A 4ZKIA 2PBZA 3K04A 4QW8A 3K5HA 3HKZE 5IYBO 2YZMA 5L1JA 4B08A 4UCSA 1GN4A 4LF7O 5E1AC 2BQUA 3T9AA 2ZT9B 2FMAA 3T9FA 5A9GA 1RJRA 2BTQA 1OV9A 1EBOA 5CBHA 1R3JC 2QEXV 4DV2H 2HVJC 2FLNA 5CN0A 1NU1H 4LR3A 2ODMA 1PNLA 4NZOA 2F95B 4YBZB 2E75B 2W7OA 1V51A 4X1IA 1NTKH 4BIOA 3CD6V 4O4HB 2FK1A 2W9CA 1SFOA 1Q81W 1XQ8A 4J9LA 5B1NA 3BA8A 2QKSA 2VQFO 3RB3A 4KFMA 1VQKV 1MZEA 3GV5B 2Y4UA 4O3PA 4F50A 2GTAA 4FM0A 5CA1A 1PD3A 4JI0B 4F6RB 3W1BA 1COWG 5H5NA 1K5SA 4CS4A 2UXCO 4MA0A 4CC5A 4JI6O 3MFIA 2E74B 4DUYH 5LA6F 2AU0A 1N0JA 3OHAA 4FLWA 4JI2B 1H2LA 2Y4TA 1KYOF 4JAAA 3CCUV 1HNZB 1XNRO 1E4EB 1A9XA 5CMUA 2DE0X 3H1KH 2EZOA 3K3WA 2Q68A 1K9MW 4DK0A 4WFHA 1GO3E 1EN6A 1MSWD 5EK0A 4ZOLA 2AGAA 4F6EA 1PM9A 4BIZA 4R7RA 4IRKA 3A0RA 4QNHB 4PDLA 5C8YF 3MAQA 5KT4A 1KJ9A 1TUBB 4IZOA 1EFRG 4MVQA 3KHHA 4DV6B 4RAYA 2ZD9A 2ALZA 2BTOA 1Y74B 3GVMA 2ASLA 1CEZA 1NVPB 4LFAH 3M8AA 4LF4B 2WLNA 4CC6A 3CQZA 2XAGA 4I55B 3TXSA 3BA9A 4ZQIA 5FLMG 3SNOA 2JEFA 3GILA 5BY1A 1VEWA 5BMVF 3NGDA 5IWAH 3QO8A 3SJCC 4O3RA 5KFEA 2BSKA 3TY8A 3PJSK 3LSSA 3BQ2A 3QFFA 4MVUA 4RUFA 1KJ8A 3W5OA 1I7LA 4E6NA 1XMOO 1MNGA 4WHXA 5KFYA 5EZYF 3RGZA 5CBFA 1RP3B 4LH7A 4JYAB 4DL2A 4NLGA 1GO3F 2UUAH 3JCUZ 4UCOA 1B33N 1H8HG 1IZ3A 4Q6GA 2X6AA 2QSAA 1DV2A 2QE7G 1FJGO 1GM8A 3CS5A 3HKCA 5IY5C 3H3VH 2UXDO 5LL6b 3HKBA 3ZHSA 4P9OA 2ADPA 4PA9A 2EIJC 1W0KG 4DV7B 1KEEA 2WLLB 3DC5A 3ZBHA 2EJ7A 2ZM6B 2X5RA 1EYZA 2ODTX 4J9NA 2EILC 5LL6Y 2IP4A 1Q8IA 1I7NA 2GPSA 4TQDA 1YJWV 5IJ9B 2GPWA 5FJ8G 1TUEB 1EN5A 3R65A 4UUJC 5L3DA 4DL7A 2QWQB 5KFNA 4WD3A 3FX7A 2YDEA 1EHIA 1JJ2U 2RDCA 5T14A 4MTFA 4J9ZB 4MVZA 5I5VA 1CPYA 1YZBA 2AHYA 3EHBB 3CXCU 4ECSA 1I3QA 2O03A 4TUYA 4FLYA 4O4IB 4QIWE 1H38A 4HYKA 4GLWA 1OCCB 2JEGA 5KFHA 4IYIA 1GRJA 2PY5A 4KUMA 4JI0H 4LF7B 1IYDA 4A3JG 1N36O 2W8KA 4X1KA 1IBMO 1B6RA 1M9NA 4I50A 1JFFA 1ZUQA 2HFEC 4RZQA 1V55B 2WLMA 3RYFA 3WU2Z 5B1AC 4JI2H 2XGPA 1H8EG 5DGBA 2LQTA 4MSWC 1HNZH 1K7DA 1MZFA 2ZXWB 5KFBA 1I0HA 3U10A 1W93A 2CNQA 3Q2OA 4R8UB 4K8XA 3FKIG 4YJ2A 1QU7A 3ETGA 4B7EA 1RSOB 1VQ8V 3WO1A 3T1YO 1XDNA 2QM7A 4FGRA 2VQFB 1IX9A 4F4ZA 3ML0A 2WA3A 1VQ9V 4BBRG 2ZQMA 3QZ8A 3D36A 3CRCA 3FKSG 4WCEV 4DV6H 4F4LA 3KKYA 2UXCB 2R93G 2FK2A 4JI6B 4PWQA 5K1XA 3CCSV 4WFFA 4LF4H 1EZ1A 2AGOA 1Y67A 1TWAA 2QB5A 1XNRB 3ZHQA 2Q0AA 2WPDG 1VS0A 5D1PA 3JCZA 5FPRA 2I8CA 1SQQH 1FPOA 3N2GB 3IJ4A 3F8NA 2JA5G 2GV9A 3AG2B 2M7WA 4A3GG 3LP8A 5B1BB 4EB6A 3JATB 2NU7B 3EPGA 2RDIA 2XD4A 5EZYB 5KFXA 3GTQA 1AR1B 4DR2H 2MW2B 4X89A 5DG8A 3OMAB 4YHHO 1SZXA 1ZTEA 3IC7A 4PDMA 1QVFU 1E4FT 4DLKA 1M5IA 4NXNO 3HB9A 4MTOA 2WDTA 2XCAA 3MJFA 5JH7B 5D8DA 4FLZA 1DK1A 4GC6A 4HNVA 5JUMA 3R5XA 2QGNA 3HOVG 3PZPA 4RUAA 3VQVA 5F9LA 2YI9A 1MG1A 5KHGA 4NTYA 3GIPA 2V1DA 4QWDA 2Y0SE 4QPJA 3TW6A 3ABLC 4H33A 1A3GA 1EKVA 4QWAA 4I7ZB 4DV7H 2B1IA 4H37A 2WWWA 3JD3A 1WLEA 4FVMA 1Z2GA 4NYKA 1XMOB 3OT7A 2W9BB 5JWPA 3Q8RB 4H0LB 5EIBD 1EUCB 5BWWA 2ZM6H 2UVRA 2YEVB 3JRWA 3JSLA 4MAMA 1WCMA 3W7XA 2H8PC 3OTFA 1SYXB 2YXYA 2DYSB 3VQXA 1Q3EA 3A0HZ 3GWKC 4IWXA 4MV4A 2WSSG 4U3JA 4CKEA 1MA1A 4U6PA 3BVOA 5EYPA 2CW7A 2X6CA 3ZRXA 2W6QA 3GTLA 4NKGB 5LOVB 1XMQO 1JQ0A 3ZHTA 1FJGB 4ED0A 5CA1F 5JVLA 5KAIZ 1ZHSA 3EYYA 2UXXA 2UXDB 2C00A 1M57C 2P6JA 4FJCC 4BWSC 4ETSA 4DO2A 2E5LO 2Z5UA 3QZ7A 4LF7H 1HR0O 2ITDC 3T4DA 3V6JA 1ZL8A 1OCZB 1N33O 2P67A 2XASA 2AGPA 5KA6A 1P7GA 2IU3A 4MW8A 3LDDA 4LF8O 1ZETA 5KFWA 1KKDA 1ROPA 2ZIMA 1O9GA 4RWUA 5BWVA 1AI6A 5CR5A 5DQHA 4TQFA 2FB9A 2V9WA 1AVMA 1QLEC 1IVSA 1BHAA 1URFA 4I4TB 3OAAG 2VQFH 3AYHB 1Y6XA 2FLPA 2OTLV 3RIZA 1S72V 2DN9A 1VQ7V 2RJZA 4GCZA 1N36B 1IBMB 2ASDA 2PI5A 3CRRA 5L3FA 3KG2A 2UXCH 1S10A 2J6UA 4JI6H 1BMFG 3H1HH 2DMXA 2CTQA 2KSWA 4O2BA 2DYRC 1K4CC 3DSQA 3FMAA 3OEEG 3T9BA 1UC9A 4GZRB 2HDKA 1XNRH 4O3SA 5LP6B 4E4EA 4GT1A 4XDLA 2ARHA 4QE9A 1UC8A 2EBOA 3QF7A 1YVWA 3RVZA 2LFSA 3T2MA 3T1YB 2DWDC 1RFYA 1P16A 3JD0A 4D6TH 2G38A 2Q6AA 4O4LB 4YXWG 4KHPO 2WLIB 2KG7A 3CCVV 1XHZA 3DAAA 1GM9A 4MV9A 5EBMC 5JVDA 2XNDG 2DWCA 1D5AA 5D5QA 3BQ1A 2JJ2G 5DQIA 3PR4A 3ETJA 3ZX6A 1H2NA 2YIAA 2XHBA 1Z2PX 5EDWA 1RJPA 3HPLC 2Y0IA 5BR8O 5BXZA 4UXNA 2HHFB 3BPZA 4FFOA 3ETEA 3LSUA 4DV3O 3LQSA 5I5TA 3APOA 1M1KW 1QLNA 4A93G 1O9HA 5EIBC 2Y0PA 3FAVA 3H4DA 1S0VA 1KQSU 3RB0A 3P30A 2Y4RA 1B3QA 3CJHA 4QJFA 1FS0G 1XMOH 4LFCO 3RYIA 4FK5C 5KLVH 2P4KA 4DK1A 3B09A 4DV4H 3ZMVA 3KAKA 3WWHA 2BQ3A 4YHHB 3S3WA 3CCEV 5KT6A 3KZIZ 2V4QA 4LCUC 4NXNB 5FNVB 2LJ2A 4FLUA 1B6QA 4PA3A 4TUYF 3GIJA 1Q5OA 1I7FA 4NR1A 1PX2A 4MT8A 4I9WA 3PW2A 1FJGH 4TM5A 3DTGA 3U54A 1N32O 2R85A 2UXDH 5F2VO 3CC7V 5CM0A 1K4DC 1XL4A 2P06A 4GC7A 5GTHZ 1Z2NX 2A0LA 4ECZA 4FU0A 4WBNA 3CXHF 1S77D 3JD1A 2QKAA 5KS8A 3G71V 2GUZA 4H13B 4Z1MG 2LO1A 2R8KA 2F43G 4DRFA 2HJWA 4LNUB 1NJIW 2YS7A 3MWMA 4EYHB 3KYHC 4PDBA 4FS1A 4GYCB 2R8GA 4O7LA 2HG5C 4YJ2F 5HFLA 4M9UA 1NTZH 1JIHA 3SPGA 4XDJA 1WPXA 1RM1B 1R3IC 2NU9B 3SPCA 3ASNC 4PD4F 1XMQB 4ZI7B 2WLHA 5DGHA 2JS3A 5KFZA 5KHIA 5KT5A 5BZBA 4TWKA 4LH6A 5A2QW 1CKMA 2CH7A 5DGAA 2HGSA 4E2LA 2ITCC 4I0XB 3ETDA 1Y1VA 1R3KC 4MS2A 4IIJA 4F4YA 2A06H 1HR0B 4J9KA 1K1QA 3SR2C 4RNNA 1N36H 1IBMH 4MVMA 5C93A 2EJ2A 1N33B 1QQCA 1A0GA 3HOYG 2JEXA 4ED2A 3F5WC 4LF8B 4EBDA 4B3MO 4O7YA 2UVWA 2NUAB 1DTOA 1AI7A 3C0FB 5ITZA 1BGYH 4K6NA 2EJ3A 5IP7G 3NXSA 2LW7A 2HVKC 1AUVA 5CE8A 1DAAA 3L75H 4J10A 2EIJB 4TV9A 4Z2WA 4X65O 3E89A 5IT9N 1VAJA 3T1YH 4J80A 1AROP 3UT5A 4RU9A 3RVYA 1SZTA 5CB4A 5GONB 4Y8VB 2EILB 1IYEA 4Q43A 3EFFK 3JD4A 2HEPA 3HO8A 2HVRA 2DQ0A 5IYZA 1F4MA 3ETQA 4DR2O 5KFVA 2Q0OC 1THZA 2GBOA 3O65A 2Q67A 2F4VO 5KFPA 5KFIA 3GQCA 5EWEA 4NZNA 3RYCB 1I2LA 4YAKB 3NUAA 5EBWC 3JASA 3TQ1A 1KB9F 4MV6A 1KP2A 5J2UA 1B06A 2EIYA 5I60A 2Q69A 1RPRA 1K8AW 4ECXA 1AP6A 1Q90D 2ZE6A 3Q8QB 4ECVA 1SESA 4NVPA 1VKZA 2OCHA 4X1YA 4UCTA 4EFEA 5LMUO 4YHHH 4KHPB 1FFXA 1H2MA 4MVOA 5B1AB 3L2PA 4YQWA 1L8DA 1N8RW 3WG7B 2PN1A 4NXNH 1M93A 2AXTZ 5KFJA 3ABKC 3HKDB 2FPGB 3CRQA 1ZX3A 4ZIBA 3MR6A 4R7CA 5BR8B 3THOA 1ZLZA 4DV1O 4DV3B 3JALA 1EM1A 5IJ0A 5B66Z 2XCLA 3WNZA 1RK5A 1YF2A 4ECQA 3ZN1A 4YJ3A 5C5JA 1AR5A 5KG6A 4UB6Z 2YZNA 1MMMA 2FPIB 5KFDA 3OSPA 4LFCB 1G4YB 3MDSA 5LMNO 1X4TA 1N56A 1CKNA 3I56V 4AQYO 3AEIA 1L0NH 3BCCH 4O83A 2WB1A 3Q4HA 3RTXA 2VQDA 4FM9A 2R7MA 2RN9A 4TQRA 5E79Z 3T1HO 3KHLA 2V4DA 1QBZA 4LFBO 4DR4H 3RFCA 3DTFA 1T3NA 3FB6C 2UVUA 1XMQH 2RDJA 1NT2B 1LUVA 1JOYA 1N32B 1VF7A 5IYDO 2H94A 3C3SA 3K3VA 3P32A 3PW7A 1YSCA 3PO3G 4KXRA 1F4NA 4DYLA 4G2KA 4EQ5A 2WE6A 1YITV 2E5LH 3N43B 3RAXA 4GX0A 3ZN0A 4CKBA 1HR0H 4EYIB 3AG1C 1YJNV 2HVQA 2IJKA 5KMGB 3U0ZA 4J42A 3BHPA 1PKXA 1S5JA 1N33H 3K5IA 2UVVA 4MV8A 4ASUG 4JV2A 4DV0O 2WAMA 1OBGA 5H80A 3LUTB 4XYLB 4LF8H 3B8NA 3M4IA 3VPBA 1HWYA 4IHJF 1OCOC 4U7NA 1YEWA 2FPPB 4O7WA 1Y76A 3ABLB 3OTOO 5JCOA 4YB8B 1KU9A 4DRXA 3G6EV 2FP4B 2V4RA 2DWEC 5AG2A 3JAMW 2Q7EA 1O75A 3H4BA 3JAKB 3B2EE 2RNBA 2EINC 5JVDF 5KFSA 1YI2V 4MTEA 3LNMB 4GKJO 4FFBB 2RCVA 4JI3O 3QQMA 2COGA 1L1FA 1N34H 2KQXA 4CH5A 3RB6A 3AG3C 3ASOC 4JXUA 2PI4A 4B3MB 4CMFA 4LWSA 5JQGB 2COIA 2Z04A 1GM7A 1G1XB 1BHBA 4FFMA 3GIKA 3ZHUA 4QGPA 5DM6V 4UFZA 4JI7O 4ZBMA 4O3OA 1RYRA 2L6LA 1M57B 2JA7A 3WWIA 2ZDHA 1G6UA 1LR1A 4MTGA 2HHHO 3M9MB 2R7KA 3ZRWA 1FXKA 2HR3A 4X65B 2W6NA 4O2AA 2EIKB 3B4SA 3JARA 4WFGA 4FLXA 4Z1VA 1HNXO 1GYFA 4O4JA 3Q1KA 3T9DA 3Q8PB 1PP9H 5C44G 4JI4O 2XAHA 5IE9A 4NYEA 2C22A 5KFLA 5TISZ 5FR9A 4KHPH 4ZHQF 4O7NA 2UUBO 3GDEA 4RUEA 4DV4O 4DR2B 1WNSA 3K5LA 1FFTB 1NH2D 2KKWA 1NTMH 5KG1A 3SGIA 5KX5B 2F4VB 4TV8B 4WBNF 5BR8H 1FXKC 1QLEB 1M56B 3E22B 4DV3H 3CEIA 1XILA 3L4KA 5BWTA 1XNQO 2YZGA 1I50A 4OGQB 4HNTA 3HKEB 3ICXA 3MHSC 2DJVA 3VPDA 1HW7A 4LFCH 1R1BA 1BQZA 1KKCA 5D1OA 4JUZA 5FD6A 4TOIA 2P7TC 2QM8A 3ORQA 3DXRA 3JSNA 2DYRB 5LMUB 4K8ZA 1TVKB 1Q82W 4JAUA 1XDCA 4RAIA 3GTOA 4MTXA 2COJA 2CUGA 3GB7C 3RF2A 2Y69C 1A32A 1IDSA 3K03A 4N23A 3ZRSA 3T5JA 2I87A 4XDKA 1N32H 3L73H 4IIJF 1F23A 3J81N 3ZRVA 3TCUA 1SRYA 4DV1B 2RF4A 2HGWA 4D7TA 1BSMA 1I08A 4O86A 2JA6A 1YXBA 3JAWA 2R9RB 2I80A 1US6A 1X59A 1KT8A 2CKZB 5LMNB 4IL6Z 2V5AA 1WA8A 1J5EO 1WN7A 5J2TA 4AQYB 4CS2A 2FTKA 3SJQC 4C5CA 3MR5A 4OXSA 3G6YA 3G67A 1H2GA 4NTWA 3T1HB 5KHJA 4IHJB 5GTIZ 4TV9F 3ABMC 1DLBA 1UPGA 3H1LH 5LA6B 4LFBB 1SQFA 2M6YA 3AW8A 4ECUA 5CA0A 2YICA 5CB4F 4G3IA 5LXTA 1YCIA 1R6KA 1FAFA 1RJQA 5KFRA 2IW5A 2OH2A 1PL0A 4OPHA 1WP7A 2OCCB 4FBUA 4X20A 1IOWA 1KJJA 1LUWA 3GTJA 4QWEA 2W57A 1V54C 4RB0A 3TXQA 4J7KA 1MSDA 2JGDB 1JJOA 1GLVA 3L74H 2UUCH 3QG5A 5C8YB 4DV0B 2YWVA 4EBCA 4B3MH 5J2UF 2WB1E 2HJFC 3PW4A 4WFEA 3CB2A 1N4CA 2C2AA 5KUKA 2AZ2A 4M0JA 3OTOB 3ABUA 1LNQA 2FB5A 2JA6G 1KUQA 3UZBA 4RZRA 4X65H 2J6SA 3SYOA 5BMVB 2OLSA 4DR3O 5C4XG 4ED7A 3HOZG 1SA0B 1SQVH 3SDLA 2VWJA 4O4HA 5D5PA 3G8CA 3TIIA 1ZQ7A 4IT5A 2PMZA 3D36C 5EC1C 5KFFA 2JRIA 4MV1A 1WAZA 4GKJB 3GB8B 2VPQA 3HR0A 4ZHQB 4JI3B 2WAQA 5HBRB 1Q6UA 2QDOA 4A3BG 2DPJA 3WB1A 4F6RA 4PBCA 5KFQA 2F4VH 2ZDQA 3E8BA 4YJ3F 2JK5C 1BS3A 2OT5A 3JAMN 2CAZC 2R87A 3KHRA 2UXBO 4JI7B 1AJNA 3NR7A 1HP8A 3N2KB 3RW0A 3RYHB 4JI1O 2XAJA 3APQA 2HHHB 1E4EA 4A3IG 4RUCA 2PF4E 4RNOA 1HNXB 3IG0A 1VMGA 5GW7A 2J9GA 4PA4A 3G8DA 3VBBA 3CCMV 3RR5A 4J0MA 4A3MG 4U3FH 2W6IG 5LMUH 3RBDA 5KKNB 3BG5A 1QR9A 4JYCA 1SERA 3A8TA 2UUBB 2B9ZA 3AK1A 2AZ0A 4DV4B 3N6XA 2WTFA 4UVBA 1NKDA 2ZJTA 4YP3A 4Q4CA 2CZGA 1TUBA 1H2SB 4JTAB 1BQ0A 3MWDA 2XAQA 4UV8A 2EX3A 1Y74A 4DR4O 3TEKA 2NU8B 5KG7A 5B3SC 3V6KA 4PELA 4DV1H 1CE8A 4BWAA 1XNQB 4ABMA 3AK3A 4I55A 4GUNA 2VWKA 3MHHC 3CPWU 4YY3O 1P8LA 1XEQA 3LWBA 4YR2A 2Y48A 5KFCA 2YXLA 3OW2U 1GGOA 5LMNH 1S9FA 1PV0A 4HBNA 3CWBH 4AQYH 3LDCA 4J41A 1TWHA 1TWGA 4JV1A 2SCUB 1BE3H 4CMDA 2VOBA 1VARA 4B7KA 3GTKA 3T1HH 3O9OA 5DEDA 1P7BA 4PA6A 2LFRA 4LFBH 4A3LG 1JDBB 1WRVA 3CCRV 3RV3A 4JV5H 2Q9LA 2IBKA 2HJDA 4ZOLF 4HNAB 3WWJA 2HG8A 1SQPH 4A5UB 2HKOA 2X7RB 3L4JA 1ULZA 4OPAA 2BCCH 4RQEA 4BR6A 1CXZB 3T9EA 2Z0AA 2DAAA 2DOSA 4QE7A 4RNMA 1J5EB 1WCMG 1JVMA 4G27B 1WP8A 1H2KA 4DV0H 2WLLA 1JKJB 2R7ZA 3PW0A 4PA7A 2R8HA 1N34O 1PPJH 1I1LA 2Q7DA 3GLKA 4O2AF 1X9NA 4DL4A 3D8CA 1VBHA 4O4JF 4ICGA 3OTOH 2VUGA 5J9PC 3W1GA 2JS5A 1I6UA 3B40A 3T99A 1OHHG 1DF4A 4W4KA 4NXMO 3E8FA 1HDJA 5C1PA 4UVAA 2D3OW 2W0XA 1G2WA 4ECRA 4DR6O 2C35B 1UFIA 1G8MA 3MFHA 4GKJH 4O4IA 4HAMA 4O82A 1Y1WA 3T7AA 5FD5A 4JI3H 5DLFA 3M99B 1JR9A 2DW4A 4APMA 2ZCEA 2CNUA 1XL6A 4J7ZA 5L1KA 1NI8A 3W7TA 2CK3G 4TVIA 3STZC 3HKZA 1R73A 1R3LC 4FZ1A 4JI7H 3KALA 4A3DG 1SEIA 2RGRA 1UJWB 2HHHH 3H9VA 2JEUA 1EUDB 3AG1B 4DR3B 1HNXH 2BTQB 1YHQV 4R8UA 3AK2A 3G6XA 1OCCC 4JI4H 1KC7A 4LSXA 1RSOA 3MR3A 3VPCA 4BW5A 1GSAA 2HIXA 4FFRA 2UUBH 5L1LA 4O3QA 2FKXA 2F1MA 1WB7A 1JCHA 2CTRA 4JAVA 4X1IB 1OCOB 4ME6A 3CSXA 1V55C 3RN4A 1AI4A 3MD0A 2W9CB 1CS0A 3H0GA 4FZ0A 1IOVA 4DL3A 1BNCA 1KUTA 1TWFA 4TT3G 4ECWA 4NB5A 1Z5WA 2UXBB 4RQFA 2W6MA 4A3KG 4DL5A 2C2RA 1XNQH 5DLGA 4UVCA 1I2KA 4JI1B 5DGIA 5BWRA 2Q7GA 5J2TF 2XC9A 5CA1B 4Q45A 3FD9A 2EINB 1E4GT 3B77A 1K5QA 3L71H 4FFPA 2YIDA 4I50F 5IYBG 4NTXA 1ORQC 3WFVA 3N2GA 3WO0A 5IDJA 3VNNA 1DGSA 5KFOA 4AI8A 2K9PA 3ASOB 4UCVA 3JATA 2VPSA 5LGTA 4X66O 1V9PA 1VQNV 3UKMA 5CA0F 5EZYA 4DUZO 3IC9A 5LXTF 4HR7A 2W70A 3FB8C 4K3AA 3JZ6A 2QR4A 3K0GA 4JI8O 2EZPA 3S24A 3RBEA 5FL7G 1QCEA 3SYQA 1XREA 2A9HA 3W7UA 3QO7A 4PHZA 4DAAA 2ATKC 4ZOLB 4DR4B 4ECYA 5JH7A 2Q7HA 3CP1A 2F23A 2E76B 2Z3YA 1I1MA 3I5DA 3AG2C 3GIQA 3AG4C 4U7CA 4YY3B 3EVKA 4CH3A 3RAQA 4O7ZA 5KG2A 5JJJB 4GX5A 2AW9A 1F7YA 2E5LB 3T4ZA 1J5EH 1W96A 3W7WA 3Q8SB 4HZ3A 2ASJA 2E2IA 1U96A 3N8DA 4B3TO 3EXAA 4DR7O 3OHBA 3TY5A 5DG7A 2UUCO 3T9CA 1F51A 2N74A 4C2MA 4JASA 2YEVA 4JYBA 3VOTA 3E8HA 1FXKB 1S5LZ 4IRDA 3SPJA 2ZNJA 1ET0A 1OBDA 2BSKB 1VQPV 4PJ0Z 3ZIAG 1JX9A 3DTUB 1SKVA 1KC8W 4O4HF 1RYSA 3RFRA 3P3NA 4D7SA 1VQ4V 5IY5B 1Z2OX 3RJ0A 3HOUG 2VRZA 1KMIZ 3OE7G 4J9QA 4W4LA 2AQ4A 5LOVA 3TIGA 4MV3A 1AN7A 1Q43A 3G6BA 1WH2A 3HXLA 2NVYA 5B5EZ 5F9NA 4RB2C 1IXMA 3LSQA 3H1IH 3QVNA 2V7QG 1XK5A 2IH3C 2R84A 3OR6C 4CZZA 1N48A 2Y69B 1XHXA 3OGCC 3V4SA 3AX6A 4R50A 2XIGA 2DYSC 3K9SA 1N34B 2RMKB 3UYYA 2W6PA 3HKCB 2NR5A 4L8JA 1KD1W 3I4NG 4IR9A 4LF9O 3WB2A 2BOBC 3HKBB 3N40P 4ED8A 2ZKOA 2XGQA 1OJHA 4Q20A 4DR1O 4Q8FA 1AJQA 2R9IA 3G4SV 2ILMA 1QNMA 4DR3H 2B5UA 3L72H 4NXMB 4I5SA 5EC2C 1Y1VG 2GQSA 4MW3A 1EN4A 2HGXA 4DR6B 4I4TA 3IGAC 1GN6A 5JJNB 2AHZA 4CS3A 5L3GA 2ZDGA 3UQ8A 3R23A 4FLVA 3RUPA 2X6BA 2R72A 3VMMA 3ABMB 2YU9A 3HOWG 4JI5O 2FJZA 3CMAV 1E1QG 2R7LA 1M0WA 5BYBA 4I55F 1SC5B 2GTSA 3DC6A 5DECA 2CTWA 2YIBA 4TUYB 4DW0A 2UXBH 3E2EA 5H2FZ 4JTCB 4QIWA 4FE2A 4JI1H 4J9SA 5LP6A 2IA6A 3KHGA 4X1KB 1AJPA 3FFQA 2ABJA 3MWEA 4I50B 1JFFB 2IH1C 2L35A 4C5AA 2YS6A 4XZ3B 3GV8B 4ED3A 2H3OA 3QWUA 2R8JA 2Q8VA 3C3TA 3RYFB 4B3RO 2W8LA 2P90A 2QWOB 4DR5O 4CHIA 2CNVA 5LHHA 4R8CA 1M4UA 4YIOA 2CGOA 2YRXA 2LP7A 4O4LA 1S97A 4CH4A 1YTFD 2WLIA 4YJ2B 4UV9A 2NLJC 2YXHA 4DQNA 4J9YB 2YS8A 5LP6C 2BOCC 3E8GA 5KAFZ 3K59A 5KT2A 4JV5O 3OSNA 4LF6O 4JZ2A 2ZE7A 4YY3H 4ECTA 5KFAA 2HHFA 1NH2B 4IR1A 2JEIA 4X9QA 3RT3C 1SQXH 2YZLA 2YI8A 5K1PA 1SF9A 2QWPB 5CA3A 2ATLA 2Q73A 4O2BF 2LGWA 1SQBH 3CRAA 4PDVA 4X66B 1I1KA 2WA4A 1Z5VA 4O7SA 4DUZB 1M90W 2JJ1G 3KCXA 2ZNIA 1GKFA 3VA7A 5KA5A 1C30A 4PZ7A 4JI8B 5L3CA 1GAXA 3WB0A 1BGWA 5LYJA 2GHYA 2JEJA 2F93B 1KTAA 1IXBA 5KFMA 5FNVA 2XUMA 4EB6B 4QSHA 4YAJB 3GTMA 2ZIOA 3UO2A 1KJIA 1AB3A 5BPHA 5KHKA 4J7JA 2V58A 3TW7A 5KT7A 4O4IF 3FB5C 1XBLA 3TK1A
chains in the Genus database with same CATH topology
2Q2UA 4RB3C 2VQFH 4X20A 3RIZA 3QTCA 2W57A 2R70A 4A2BA 4RB0A 2JGUA 1HNWH 2RJZA 1N36B 1JJOA 1IBMB 2UUCH 3QG5A 2UXCH 5C8YB 4B3TB 4DR7B 4DV0B 4JI6H 2UUCB 2KSWA 4O2BA 4B3MH 4DUYB 3DSQA 3CB2A 3FMAA 4LNUA 3K5NA 1XNRH 1A0IA 5LP6B 5JCOC 3OTOB 3M7MX 3K5OA 3JAMW 4DV5H 4X65H 3QF7A 5BMVB 4OX9H 5D1OB 3BABA 4NXMH 3NBYB 1SA0B 1CKOA 4HNAA 4ZI7A 4O4HA 2VWJA 3T1YB 4IAJA 5D5PA 4FM2A 3J7AK 3J80W 4DR6H 1P16A 2VQEH 2PGGA 1SQGA 4GKJB 4U3JB 1B04A 2HIVA 3GB8B 4O4LB 4JI3B 4ZHQB 4FLTA 1XHZA 5EYPB 4MV9A 3NC0B 1FVIA 3WB1A 4F6RA 5JVDA 1D5AA 5D5QA 2F4VH 3ZS8C 2YIAA 2XHBA 4LFAB 1S68A 1Z2PX 4LF9B 4FM1A 2CAZC 3ZEDA 4PZ6A 4JI7B 1L2ZA 3N2KB 3BPZA 3JAWB 3RYHB 4DR1B 1O9HA 5EIBC 5IWAB 2HHHB 3BRCA 2OWOA 3N42B 5J2TB 4AILC 3KXYT 2P22C 3J81W 1HNXB 2F66C 3IG0A 1P49A 1XMOH 3RYIA 2ZINA 5KHHA 3RR5A 4J0MA 4DK1A 4DV4H 5LMUH 4GKKH 2PTMA 4GLXA 3KAKA 4LMYA 2UUBB 4YHHB 2PUSA 5GONA 4DV4B 3N6XA 4X62H 2ZJTA 4NXNB 5CA0B 4JI5B 5FNVB 2UUAB 4FLUA 1TUBA 1H2SB 5LXTB 1Q5OA 1I7FA 3K57A 3IAYA 1FJGH 2EX3A 2OYQA 4X20B 2FE3A 4DV1H 4BWAA 2UXDH 1XNQB 4I55A 3RYCA 1Z2NX 2VWKA 3CHXA 4WBNA 1P8LA 4B08A 4UCSA 2YXLA 5LMNH 4HBNA 4O2BB 4B3RB 4AQYH 2UU9H 2BTQA 4X66H 4DRFA 4BW9A 4LNUB 3MWMA 4DUZH 2VOBA 4DV2H 4DR5B 3KYHC 3T1HH 4GYCB 4PDBA 3RWRD 4LR3A 4JI8H 4LFBH 2F95B 4JV5H 4CH6A 4X1IA 1XMQB 3HKDA 4HNAB 4ZI7B 4O4HB 4JV5B 4PI0A 5KHIA 4LF6B 3L4JA 1XQ8A 4LH6A 5A2QW 2PZSA 1CKMA 2HGSA 3BA8A 3DF7A 4MV7A 1JMKC 4IIJA 4FM0A 1HR0B 5CA1A 3SR2C 4JI0B 1N36H 1IBMH 5JVDB 4F6RB 1J5EB 4PZ8A 4B3TH 2WYOA 1T5EA 3W1BA 4DR7H 1N33B 4CS4A 1QQCA 4DV0H 4CC5A 4LF8B 4DUYH 2RQ6A 3A2FA 4FLWA 1M0TA 4JI2B 1X9NA 4M7EA 1HNZB 3C0FB 5ITZA 3OTOH 2VUGA 3W1GA 4EFBA 2JS5A 1I6UA 3RYIB 1TAEA 4DK0A 4TV9A 4MTDA 3T1YH 1I94B 4ZOLA 1S03G 1WPBA 4UCRA 2UU9B 4RAZA 3UT5A 4R7RA 5CB4A 5GONB 4GKJH 4O4IA 3MAQA 5FD5A 4JI3H 1TUBB 2HEPA 2HVRA 5IYZA 4APMA 2ZCEA 3ETQA 4DV6B 4RAYA 4EEQA 5KMGA 2CW8A 2BTOA 4LFAH 4LF4B 4LF9H 2JVDA 4CC6A 4I55B 3BA9A 3RYCB 4JI7H 3KALA 1SEIA 4WBNB 3JASA 4DR1H 2RGRA 5IWAH 3SJCC 5J2UA 2HHHH 1TA8A 3TY8A 4DR3B 1HNXH 2BTQB 3W5OA 4E6NA 4JI4H 4A2AA 4JYAH 3GJXB 3RGZA 4LSXA 1RSOA 4NVPA 4X64B 4X1YA 3RGBA 4UCTA 4JI4B 4LH7A 2HIXA 2HVSA 3JAKA 4EFEA 4JYAB 2UUBH 4YHHH 4KHPB 1FFXA 2F1MA 4LF5B 3L2PA 1L8DA 3N41B 4NXNH 4X1IB 1M93A 2UUAH 4JI5H 3CSXA 4UCOA 4FFBA 3HKDB 3LNNA 4Q6GA 4B3SB 4ZIBA 5BR8B 1Z5WA 2UXBB 3THOA 3HKCA 5JQGA 1XNQH 4DV3B 4UCUA 3JALA 4JI1B 4IIJB 2Q7GA 5IJ0A 5CA1B 5LL6b 3HKBA 1E4GT 4YJ3A 3VQWA 3SJBC 4LSAA 4DV7B 3N2GA 4LFCB 2IM9A 3VNNA 4B3RH 1DGSA 2ZM6B 1X4TA 3RGXA 1CKNA 4UCVA 3JATA 2VPSA 1XI1A 4PI2A 2YCHA 1V9PA 4DR5H 5EZYA 3RTXA 5ITZB 4FM9A 1Q8IA 2R9AA 4TQDA 5IJ9B 2V4DA 3S24A 4DR4H 5FLXW 4TV9B 5DISC 1XMQH 4I7HA 1NT2B 4PHZA 4ZOLB 4DR4B 1N32B 1VF7A 5JH7A 2Q7HA 3UT5B 5KX5A 3K3VA 4LF6H 4TV8A 1IBLB 5CB4B 3PN1A 2O03A 4TUYA 4FLYA 4EQ5A 2WE6A 4O4IB 2E5LH 4YY3B 3E22A 3N43B 4CH3A 1HR0H 5IYZB 5JJJB 2PY5A 4JI0H 2E5LB 2HVQA 4LF7B 5KMGB 3U0ZA 3HKEA 1J5EH 5IT9W 3BHPA 4X1KA 3CVZA 1S5JA 1N33H 4I50A 1JFFA 3VQYA 3N44B 3TY5A 3KAJA 4RZQA 4LF8H 3M4IA 3RYFA 2P5OA 3JASB 3H20A 4JI2H 1HNZH 5J2UB 2ZNJA 1TVKA 1YEWA 3K58A 2QJ1A 1SKVA 3RFRA 4D7SA 1Z2OX 5JCOA 3U10A 3RJ0A 1IBKB 4K8XA 1KMIZ 4YJ2A 1KU9A 4DRXA 4K0KB 2E3CA 5IJ9A 1I94H 5LOVA 4X1YB 2CFMA 1AN7A 2Q7EA 1XDNA 1Q43A 1MZBA 1O75A 2VQFB 1WH2A 3JAKB 3B2EE 3HXLA 1FFXB 4RB2C 4MTEA 3NBZB 1XK5A 1HNWB 4FFBB 5JJEB 1N34H 1XHXA 4DV6H 4CH5A 2UXCB 2QM4A 3TY9A 4JI6B 2XIGA 1N34B 5K1XA 4B3MB 3HKCB 5JQGB 4LF4H 4KL1A 3JALB 4L8JA 2RGVA 5IJ0B 3WB2A 3LMLA 3HKBB 1XNRB 4YJ3B 4UFZA 3N40P 2Q0AA 1VS0A 5D1PA 4IHJA 1QHTA 5FPRA 1G6UA 3F8NA 3N2GB 5LA6A 2GV9A 4DV5B 4DR3H 4X65B 5EOYA 4O2AA 4OX9B 4NXMB 3JARA 4FLXA 1CKNB 4EB6A 3JATB 1GYFA 4O4JA 3K5MA 2PYLA 5EZYB 4DR6B 4I4TA 4X64H 2VQEB 5JJNB 4CS3A 1ZHQA 4DR2H 4KHPH 1ZAUA 3UQ8A 4LF5H 3GDEA 4FLVA 2R72A 1E4FT 4DR2B 1WNSA 1M5IA 3K5LA 2KKWA 4B3SH 2WDTA 2Q2TA 1M0WA 3SGIA 5JH7B 5KX5B 5C8YA 4FLZA 4TV8B 2F4VB 3BAAA 5BR8H 2YIBA 4TUYB 2UXBH 3VQVA 3E22B 4DV3H 2YI9A 5KHGA 4JI1H 3L4KA 4RB1A 5LP6A 3HKEB 3ICXA 4X1KB 3FFQA 4DV7H 1FKAH 4I50B 1JFFB 1HW7A 4FVMA 4LFCH 1XMOB 5BMVA 5D1OA 5EIBD 3QWUA 4TOIA 5FD6A 2ZM6H 3RYFB 1SA0A 3JSLA 3U11A 3JSNA 5LYJB 5LMUB 4GKKB 4K8ZA 1TVKB 3OTFA 1SYXB 1BJTA 5FPOA 3VQXA 1Q3EA 4X62B 1M4UA 3RF2A 2MCTA 4U3JA 4O4LA 4ZHQA 4CH4A 4YJ2B 4DRXB 5EYPA 2CW7A 4AHCA 1N32H 5LP6C 5LOVB 1FJGB 3K59A 4DV1B 1IBLH 1ZHSA 3EYYA 2YIBD 2UXDB 4YY3H 4D7TA 4BWSC 4ETSA 3N2KA 3JAWA 3RYHA 4LF7H 2YI8A 5K1PA 5LMNB 1WN7A 5J2TA 4Q0YA 4AQYB 4CS2A 4X66B 1Z5VA 4DUZB 4DV2B 2ZNIA 3T1HB 5KHJA 4IHJB 4PZ7A 4JI8B 5LA6B 4LFBB 1TGOA 1SQFA 2ZIMA 3WB0A 1BGWA 1O9GA 4O2AB 5LYJA 2F93B 3JARB 5CA0A 4I9QA 4EB6B 5FNVA 1IBKH 2ZIOA 4O4JB 5LXTA 4TQFA 3SJAC 5KHKA 4K0KH 2PYJA 4I4TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2U A;  4UFZ A;  4B3R B;  4UCO A;  1VS0 A;  5D1P A;  4B3S B;  4DRF A;  5FPR A;  4DV5 B;  4X65 B;  4DR5 B;  3KYH C;  4OX9 B;  5BR8 B;  4NXM B;  2UXB B;  1N36 B;  1CKN B;  1IBM B;  4DV3 B;  4UCU A;  4B3T B;  4DR7 B;  4JI1 B;  4DV0 B;  4DR6 B;  2UUC B;  2VQE B;  1XMQ B;  4DUY B;  4JV5 B;  1ZAU A;  3UQ8 A;  4DV7 B;  4LFC B;  3GDE A;  4LF6 B;  4LH6 A;  1A0I A;  1CKM A;  4DR2 B;  3VNN A;  1DGS A;  2ZM6 B;  3BA8 A;  1CKN A;  2Q2T A;  4UCV A;  3OTO B;  3SGI A;  1V9P A;  2F4V B;  3BAA A;  1HR0 B;  5D1O B;  3BAB A;  3RTX A;  4JI0 B;  3NBY B;  1CKO A;  1J5E B;  4PZ8 A;  3T1Y B;  3W1B A;  1N33 B;  3S24 A;  1P16 A;  4CC5 A;  5DIS C;  4LF8 B;  4DR4 B;  4GKJ B;  1N32 B;  1B04 A;  2HIV A;  3GB8 B;  4JI3 B;  4JI2 B;  1X9N A;  1XMO B;  1IBL B;  1HNZ B;  3PN1 A;  5D1O A;  3QWU A;  4TOI A;  3NC0 B;  4EQ5 A;  1FVI A;  4YY3 B;  2VUG A;  3JSL A;  3W1G A;  4EFB A;  3JSN A;  5LMU B;  4GKK B;  4LFA B;  1TAE A;  1S68 A;  2E5L B;  4LF9 B;  2HVQ A;  4LF7 B;  5FPO A;  4PZ6 A;  4X62 B;  4JI7 B;  1I94 B;  4UCR A;  2UU9 B;  4DR1 B;  3TY5 A;  5IWA B;  2HHH B;  2OWO A;  1FJG B;  1HNX B;  4DV1 B;  2HVR A;  4DV6 B;  2UXD B;  4EEQ A;  3RR5 A;  1IBK B;  4GLX A;  4LF4 B;  2UUB B;  4CC6 A;  4YHH B;  4K0K B;  4DV4 B;  3BA9 A;  5LMN B;  4NXN B;  2CFM A;  4JI5 B;  2UUA B;  1XDN A;  2VQF B;  4AQY B;  4X66 B;  1TA8 A;  4DUZ B;  3TY8 A;  3NBZ B;  4DR3 B;  1XK5 A;  4DV2 B;  1HNW B;  3T1H B;  3W5O A;  4PZ7 A;  4JI8 B;  4E6N A;  4LFB B;  1XNQ B;  2UXC B;  3TY9 A;  3GJX B;  4JI6 B;  1N34 B;  4X64 B;  1P8L A;  4UCT A;  4B3M B;  4LH7 A;  4UCS A;  4JI4 B;  4EFE A;  4JYA B;  2HIX A;  2HVS A;  4KHP B;  4LF5 B;  3L2P A;  1XNR B; 
#chains in the Genus database with same CATH topology
 2CE4 A;  3HOX G;  1I94 O;  3CCJ V;  2UU9 O;  2ZE8 A;  2Q5Z A;  2W7P A;  3N6R A;  4A2B A;  3F5T A;  3TGU H;  3ZJZ A;  5KUM A;  1W0J G;  5C3E G;  2JDI G;  4B3T B;  1K97 A;  4DR7 B;  1GSH A;  2UUC B;  5K2M A;  3G6V A;  3CX5 F;  5IP9 G;  1BCC H;  1DIK A;  4J11 A;  2Q4P A;  4LBE C;  4LNU A;  5B3S B;  3K5N A;  2Y0S A;  5A2Q N;  1A0I A;  5JCO C;  2FLL A;  2XT9 A;  2EIM C;  4BXX G;  3M7M X;  4NXM H;  1GTO A;  1VIB A;  3NBY B;  4ZI7 A;  4IAJ A;  1KP3 A;  1NS1 A;  3J80 W;  4DR6 H;  3U9T A;  3TJT A;  5DN6 G;  5DQG A;  1WJZ A;  2R92 A;  4X64 O;  3GWO A;  1SQG A;  2NN4 A;  4U3J B;  4G28 B;  4I0X A;  4JYY A;  4EGQ A;  3SI8 A;  3X2Q C;  4LF5 O;  4FLT A;  5EYP B;  3ZCC A;  3N27 A;  2QA4 V;  4B3S O;  3TET A;  1J95 A;  4BIU A;  2BQR A;  3BJY A;  4A3C G;  2D2C B;  4LF9 B;  1RM1 C;  4PZ6 A;  1L2Z A;  2A79 B;  5KFG A;  4DR1 B;  2DLN A;  4QWC A;  2KB1 A;  4CKC A;  2OWO A;  2IJI A;  1ZL8 B;  3QO5 A;  1DV1 A;  1FKA O;  3CE2 A;  4FFL A;  5I5W A;  3U0G A;  4JV0 A;  5KHH A;  1DF5 A;  3RV4 A;  3H1J H;  1Q6H A;  1L0L H;  3UCS C;  1BL8 A;  3T1C A;  1FXV A;  2PTM A;  1GN2 A;  2Z02 A;  4GLX A;  4LMY A;  4WFA V;  3JZI A;  3OEH G;  4IGG A;  5GON A;  5KG0 A;  4IRC A;  5JH7 F;  5KFT A;  1AR4 A;  1Q7Y W;  4JI5 B;  3K57 A;  1GH6 A;  1JX4 A;  3JRX A;  3K06 A;  4BY1 G;  2JA7 G;  2YL2 A;  2VS0 A;  2FK3 A;  1IBL O;  5K3W A;  4QWB A;  2W0F C;  3SYP A;  3RYC A;  3T54 A;  3FKI A;  1OCR C;  3CHX A;  2C2E A;  2QWR B;  2R92 G;  4BBS G;  1Q6I A;  5C1O A;  1BZK A;  4O2B B;  4B3R B;  4X66 H;  4GX2 A;  4BW9 A;  1XUQ A;  2UXN A;  5L1I A;  4DUZ H;  3UM7 A;  2HP8 A;  4DR5 B;  3OUU A;  4PV1 B;  2R93 A;  3RWR D;  4JI8 H;  1BT8 A;  5LOV F;  2NVX A;  4L87 A;  4EEY A;  3ZHV A;  4CH6 A;  4JGS A;  4P9P A;  3HKD A;  3RBZ A;  2M05 A;  1IBK O;  2FYU H;  4JV5 B;  4PI0 A;  1NQT A;  2KSD A;  2YW2 A;  1D5N A;  4LF6 B;  4K0K O;  2R8I A;  2JA5 A;  3ZMT A;  1Y4M A;  2PZS A;  3KRE A;  1NVP D;  4XX0 B;  2HLD G;  2W6Z A;  3DF7 A;  4MV7 A;  1W2B U;  1JMK C;  1SET A;  2KG7 B;  5IYZ F;  1TWC A;  1A48 A;  1HNW O;  5JVD B;  3I4M G;  4PZ8 A;  5KG3 A;  4B3T H;  2WYO A;  1T5E A;  4J9R A;  4DR7 H;  1B6S A;  3ZMZ A;  1PK8 A;  3I55 V;  3C90 A;  1EZV H;  4JZG A;  3WG7 C;  4HNU A;  2RQ6 A;  3LUL A;  3V6H A;  3GTG A;  3A2F A;  3L9D A;  1M0T A;  2QTO A;  1M6V A;  3FAV B;  4M7E A;  4IWY A;  4TQS A;  1ZWI C;  1JA8 A;  1S3J A;  2WLJ A;  4FFN A;  3CJH B;  3FB7 C;  4EFB A;  4QJF B;  4I4T F;  1EZJ A;  5BPF A;  3RYI B;  1TAE A;  4DV5 O;  4MTD A;  4OX9 O;  5LHG A;  3STL C;  1YDX A;  1I94 B;  1S03 G;  1WPB A;  4UCR A;  2N05 A;  2EUL A;  1NZ6 A;  2UU9 B;  4RAZ A;  1EKP A;  4AYB A;  4FFK A;  1R6N A;  2VQE O;  1S0M A;  1KEC A;  4YIP A;  4O7T A;  3UZO A;  1Q86 W;  2FML A;  4KP4 A;  4QIW F;  4EEQ A;  5KMG A;  2CW8 A;  1PL4 A;  4FBT A;  4H44 B;  5LP6 F;  3ZMS A;  4LF9 H;  2JVD A;  3ASN B;  2EJ0 A;  4WBN B;  4DR1 H;  2WLK A;  5I5U A;  3AG4 B;  5H9C A;  1ENV A;  4Q8E A;  1VP7 A;  4MA5 A;  1M7J A;  3L70 H;  1TA8 A;  2QYZ A;  2GUZ B;  1K3E A;  3OD4 A;  4A3F G;  4A2A A;  4JYA H;  3GJX B;  1V4Y A;  4O4L F;  2DAB A;  3T5L A;  4X64 B;  3RGB A;  5HV6 A;  4JI4 B;  2HVS A;  3JAK A;  4GKK O;  4HN2 A;  4LF5 B;  3N41 B;  3W7S A;  5I47 A;  4ED6 A;  4X62 O;  4JI5 H;  3H01 A;  4FFB A;  3LNN A;  2A3Q A;  1FD9 A;  4B3S B;  4O7R A;  2JIZ G;  5KFK A;  1CQI B;  2IBZ H;  3PO2 G;  4MVS A;  3BQ0 A;  1W59 A;  3BY6 A;  2CH7 B;  3J80 N;  1PNM A;  1C3O A;  4ED1 A;  5JQG A;  4UCU A;  3OUS A;  1K34 A;  4RO2 A;  5LBQ A;  4IIJ B;  5LGU A;  1R6T A;  1FXH A;  3VQW A;  2XTA A;  3SJB C;  4O3N A;  4LSA A;  2A7W A;  3HT5 A;  4XBF A;  2IM9 A;  4L1K A;  2ZGI A;  4B3R H;  1SCU B;  3RGX A;  4IYH A;  1VQ5 V;  3OMI B;  2YCH A;  1XI1 A;  1I5X A;  4PI2 A;  4YR0 A;  1S0O A;  5LYJ F;  5BYA A;  2B63 A;  4J9P A;  4DR5 H;  2CQY A;  5FNV F;  5IYC G;  5ITZ B;  4DV2 O;  2XCP A;  3OR7 C;  3K0D A;  4UB8 Z;  1GN3 A;  2R9A A;  3D3Q A;  3BEH A;  3GIM A;  3CEB A;  5FLX W;  4TV9 B;  2W6J G;  1VF5 B;  5DIS C;  4I7H A;  3PVX A;  5DAA A;  2LW1 A;  1NBM G;  5EBL C;  1IUR A;  4LF6 H;  5KX5 A;  3UT5 B;  3TIN A;  4TV8 A;  1IBL B;  2P0A A;  1GMG A;  5CB4 B;  3PN1 A;  2GSM B;  4A3E G;  3E22 A;  2EIK C;  4E4T A;  4C7U A;  3JD2 A;  5IYZ B;  1JDE A;  2QK4 A;  3HKE A;  5IT9 W;  3CVZ A;  1RPO A;  5I5S A;  2FL4 A;  1VF6 A;  1CP9 A;  4X88 A;  3VQY A;  4EGJ A;  2V59 A;  3SYC A;  3N44 B;  3KAJ A;  1E79 G;  2IU0 A;  3ABK B;  3QNE A;  2P5O A;  3CYO A;  1OZ0 A;  3JAS B;  4DUY O;  3H20 A;  2ADQ B;  2ZDI A;  1P84 F;  5J2U B;  1TVK A;  3K58 A;  1AP5 A;  4ZI7 F;  2QJ1 A;  2J6T A;  2GDS A;  2QWN B;  1M56 C;  1IBK B;  3GV7 B;  5HNE A;  4K0K B;  1K1S A;  2E3C A;  5IJ9 A;  4U7O A;  1I94 H;  2P4V A;  4X1Y B;  2CFM A;  1MZB A;  1JLL B;  2UU9 H;  1VQM V;  2YYA A;  5CAE B;  1VF6 C;  1RK6 A;  3T5K A;  1KJQ A;  1FFX B;  3BFR A;  2B63 G;  2K1E A;  3NBZ B;  1HNW B;  4QPK A;  3E35 A;  5JJE B;  3PFF A;  1E1R G;  2ZDI C;  2O57 A;  2QM4 A;  3OGI B;  3TY9 A;  5KG4 A;  4EG0 A;  1NR1 A;  2VA2 A;  4DIM A;  2EJR A;  2R7N A;  4DL6 A;  1K33 A;  1K92 A;  2GLT A;  4P30 A;  4KL1 A;  3JAL B;  5CBG A;  4LFA O;  3U9S A;  2RGV A;  5IJ0 B;  3CC2 V;  4FMT A;  3E5N A;  4O84 A;  3I12 A;  3LML A;  4YJ3 B;  5JQW A;  2R6F A;  5LGN A;  4IHJ A;  1WR2 A;  1QHT A;  2R86 A;  3PR5 B;  2X0S A;  2C28 A;  3GID A;  5LA6 A;  5IWA O;  5EWF A;  2OIG A;  4DV5 B;  1YJ9 V;  5EOY A;  1I5Y A;  4F4W A;  4OX9 B;  4HQ6 A;  4JPR A;  5E25 A;  4K35 A;  1CKN B;  2VUM A;  2ETN A;  5GON F;  3K5M A;  2PYL A;  3Q4H B;  1D2D A;  1S5H C;  5EWG A;  4X64 H;  2VQE B;  4MVR A;  4CBC A;  1ZHQ A;  1CQJ B;  2R7Z G;  1ZAU A;  4LF5 H;  1ZSP A;  1NR7 A;  2IJJ A;  2JGD A;  2UUA O;  4B3S H;  2Q2T A;  3M9N B;  1QVG U;  3JYC A;  5C8Y A;  3R5H A;  4BY7 G;  2R82 A;  3M9O B;  3BAA A;  3K08 A;  1JPX A;  3RB4 A;  1AI5 A;  3OM3 B;  5L9X A;  2GQR A;  3KTM A;  4RB1 A;  2B1G A;  3T5H A;  2ZXW C;  1PNK A;  4WFB V;  2OIE A;  3LDE A;  4Q44 A;  1FKA H;  1Y66 A;  2OCC C;  3VOU A;  5I5X A;  5KT3 A;  4TSF G;  5BMV A;  1Y1W G;  5KG5 A;  4R6Z A;  1SA0 A;  3S3X A;  3U11 A;  4AYB E;  1VQO V;  5LYJ B;  4GKK B;  2E2H A;  3AG3 B;  2VR1 A;  1BJT A;  3R5F A;  5FPO A;  2PMZ E;  2ZR3 A;  4X62 B;  3HBL A;  3FDS A;  1Y76 B;  2MCT A;  1S0N A;  1R9T A;  2C2D A;  4ZHQ A;  2WAQ E;  3EPI A;  2EIM B;  3K9A A;  2DQ3 A;  4DRX B;  4AHC A;  1N0N A;  2YSU B;  3UFX B;  3OFN G;  2QTS A;  2LGQ A;  4FPP A;  1IBL H;  2VUM G;  3BAC A;  2YIB D;  5IYD G;  2BR0 A;  3CCL V;  4O81 A;  4JTD B;  3N2K A;  1VQ6 V;  5KFU A;  3OUZ A;  3ORR A;  3RYH A;  2QKC A;  2FKL A;  1WSC A;  4J9O A;  2OTJ V;  5B1B C;  4JI0 O;  5IYC O;  3IFX A;  3X2Q B;  1GK9 A;  2IMW P;  4DW1 A;  4Q0Y A;  2JA8 G;  1AUX A;  4LWS B;  2BE3 A;  3FYI B;  1XOU A;  5I5Y A;  3TQT A;  4DV2 B;  3F7Y C;  2W9B A;  3H0G G;  2CDY A;  4JI2 O;  1K83 A;  3H40 A;  1TGO A;  1HNZ O;  3ZRW B;  4HYO A;  3A0B Z;  4QW9 A;  4O2A B;  3JAR B;  1T94 A;  4I9Q A;  1IBK H;  4O4J B;  1KBL A;  3R9R A;  3GTP A;  3SJA C;  4K0K H;  5HFM A;  1Y14 B;  2PYJ A;  1MAB G;  4FS2 A;  2Q2U A;  5H6Q A;  4RB3 C;  3E86 A;  3K79 A;  3SYA A;  3V4Z A;  2DIK A;  4GX1 A;  3QTC A;  3CCQ V;  4X8A A;  1BXR A;  2CTP A;  2R70 A;  3P3P A;  1YTF B;  1WB8 A;  2JGU A;  3KCY A;  4N21 A;  2NU6 B;  3K3P A;  1HNW H;  5FLX N;  2IJH A;  1FYJ A;  3E83 A;  4Q4D A;  2CGN A;  4F4X A;  4DV6 O;  3G80 A;  4LP8 A;  1P4R A;  3GII A;  4EKW A;  3PW5 A;  4CE5 A;  4DUY B;  2W71 A;  4LF4 O;  3DGE A;  4NZM A;  2XOK G;  2A1H A;  5H6R A;  2MK3 A;  4JF3 A;  4C5B A;  1OCR B;  1UNN C;  3K5O A;  2AGQ A;  4DV5 H;  1GSO A;  4EBE A;  2QF7 A;  2W6O A;  5D1O B;  3BAB A;  4OX9 H;  3SPI A;  1AIL A;  1CKO A;  3UO3 A;  2YC0 A;  2ZR2 A;  4HNA A;  5BWU A;  4PDR A;  3DXR B;  4FM2 A;  5DMX A;  3J7A K;  5DG9 A;  1U97 A;  3SPH A;  5B1O A;  3AG7 A;  3ABT A;  2VQE H;  3CC4 V;  2PGG A;  1OWT A;  1YIJ V;  2HIV A;  1B04 A;  4JYA O;  3ETH A;  3MR2 A;  2NNU A;  1OCZ C;  3NC0 B;  5JQG F;  3CRM A;  1FVI A;  1MOF A;  3ZS8 C;  4LFA B;  1S68 A;  2PVP A;  3ZHR A;  5L3B A;  4YR3 A;  4FM1 A;  3ZED A;  1KBH A;  1EKF A;  5LHI A;  2ZE5 A;  3B8M A;  3FYE B;  1VBG A;  3J7A U;  3F7V C;  3JAW B;  4FIP C;  3OMN B;  3CSW A;  5BWX A;  3ZMU A;  4P2Z A;  4J9M A;  4RCN A;  4XYM B;  5L3E A;  5IWA B;  3IN5 A;  3BRC A;  4UUG A;  1WA8 B;  3N42 B;  5J2T B;  2XAF A;  4AIL C;  2P22 C;  3KXY T;  3J81 W;  1JXL A;  2F66 C;  4DV7 O;  1P49 A;  1V54 B;  2YUA A;  4LC1 A;  1K73 W;  3CME V;  1QR8 A;  2ZIN A;  4DXW A;  2YRW A;  2ZM6 O;  3D3I A;  3OUF A;  1T36 A;  4GKK H;  1SS3 A;  4WF9 V;  2PUS A;  4X62 H;  2DZD A;  2X0L A;  5KX5 F;  5CA0 B;  2UUA B;  4O7V A;  4TV8 F;  2W9A A;  5LXT B;  4BAY A;  3HB3 B;  3IAY A;  3SE7 A;  3U55 A;  1S76 D;  3JZF A;  1VQL V;  2DPI A;  2N04 A;  3R66 A;  2OYQ A;  4X20 B;  2FE3 A;  2VA3 A;  4ZKI A;  2PBZ A;  3K04 A;  4QW8 A;  3K5H A;  3HKZ E;  5IYB O;  2YZM A;  5L1J A;  4B08 A;  4UCS A;  1GN4 A;  4LF7 O;  5E1A C;  2BQU A;  3T9A A;  2ZT9 B;  2FMA A;  3T9F A;  5A9G A;  1RJR A;  2BTQ A;  1OV9 A;  1EBO A;  5CBH A;  1R3J C;  2QEX V;  4DV2 H;  2HVJ C;  2FLN A;  5CN0 A;  1NU1 H;  4LR3 A;  2ODM A;  1PNL A;  4NZO A;  2F95 B;  4YBZ B;  2E75 B;  2W7O A;  1V51 A;  4X1I A;  1NTK H;  4BIO A;  3CD6 V;  4O4H B;  2FK1 A;  2W9C A;  1SFO A;  1Q81 W;  1XQ8 A;  4J9L A;  5B1N A;  3BA8 A;  2QKS A;  2VQF O;  3RB3 A;  4KFM A;  1VQK V;  1MZE A;  3GV5 B;  2Y4U A;  4O3P A;  4F50 A;  2GTA A;  4FM0 A;  5CA1 A;  1PD3 A;  4JI0 B;  4F6R B;  3W1B A;  1COW G;  5H5N A;  1K5S A;  4CS4 A;  2UXC O;  4MA0 A;  4CC5 A;  4JI6 O;  3MFI A;  2E74 B;  4DUY H;  5LA6 F;  2AU0 A;  1N0J A;  3OHA A;  4FLW A;  4JI2 B;  1H2L A;  2Y4T A;  1KYO F;  4JAA A;  3CCU V;  1HNZ B;  1XNR O;  1E4E B;  1A9X A;  5CMU A;  2DE0 X;  3H1K H;  2EZO A;  3K3W A;  2Q68 A;  1K9M W;  4DK0 A;  4WFH A;  1GO3 E;  1EN6 A;  1MSW D;  5EK0 A;  4ZOL A;  2AGA A;  4F6E A;  1PM9 A;  4BIZ A;  4R7R A;  4IRK A;  3A0R A;  4QNH B;  4PDL A;  5C8Y F;  3MAQ A;  5KT4 A;  1KJ9 A;  1TUB B;  4IZO A;  1EFR G;  4MVQ A;  3KHH A;  4DV6 B;  4RAY A;  2ZD9 A;  2ALZ A;  2BTO A;  1Y74 B;  3GVM A;  2ASL A;  1CEZ A;  1NVP B;  4LFA H;  3M8A A;  4LF4 B;  2WLN A;  4CC6 A;  3CQZ A;  2XAG A;  4I55 B;  3TXS A;  3BA9 A;  4ZQI A;  5FLM G;  3SNO A;  2JEF A;  3GIL A;  5BY1 A;  1VEW A;  5BMV F;  3NGD A;  5IWA H;  3QO8 A;  3SJC C;  4O3R A;  5KFE A;  2BSK A;  3TY8 A;  3PJS K;  3LSS A;  3BQ2 A;  3QFF A;  4MVU A;  4RUF A;  1KJ8 A;  3W5O A;  1I7L A;  4E6N A;  1XMO O;  1MNG A;  4WHX A;  5KFY A;  5EZY F;  3RGZ A;  5CBF A;  1RP3 B;  4LH7 A;  4JYA B;  4DL2 A;  4NLG A;  1GO3 F;  2UUA H;  3JCU Z;  4UCO A;  1B33 N;  1H8H G;  1IZ3 A;  4Q6G A;  2X6A A;  2QSA A;  1DV2 A;  2QE7 G;  1FJG O;  1GM8 A;  3CS5 A;  3HKC A;  5IY5 C;  3H3V H;  2UXD O;  5LL6 b;  3HKB A;  3ZHS A;  4P9O A;  2ADP A;  4PA9 A;  2EIJ C;  1W0K G;  4DV7 B;  1KEE A;  2WLL B;  3DC5 A;  3ZBH A;  2EJ7 A;  2ZM6 B;  2X5R A;  1EYZ A;  2ODT X;  4J9N A;  2EIL C;  5LL6 Y;  2IP4 A;  1Q8I A;  1I7N A;  2GPS A;  4TQD A;  1YJW V;  5IJ9 B;  2GPW A;  5FJ8 G;  1TUE B;  1EN5 A;  3R65 A;  4UUJ C;  5L3D A;  4DL7 A;  2QWQ B;  5KFN A;  4WD3 A;  3FX7 A;  2YDE A;  1EHI A;  1JJ2 U;  2RDC A;  5T14 A;  4MTF A;  4J9Z B;  4MVZ A;  5I5V A;  1CPY A;  1YZB A;  2AHY A;  3EHB B;  3CXC U;  4ECS A;  1I3Q A;  2O03 A;  4TUY A;  4FLY A;  4O4I B;  4QIW E;  1H38 A;  4HYK A;  4GLW A;  1OCC B;  2JEG A;  5KFH A;  4IYI A;  1GRJ A;  2PY5 A;  4KUM A;  4JI0 H;  4LF7 B;  1IYD A;  4A3J G;  1N36 O;  2W8K A;  4X1K A;  1IBM O;  1B6R A;  1M9N A;  4I50 A;  1JFF A;  1ZUQ A;  2HFE C;  4RZQ A;  1V55 B;  2WLM A;  3RYF A;  3WU2 Z;  5B1A C;  4JI2 H;  2XGP A;  1H8E G;  5DGB A;  2LQT A;  4MSW C;  1HNZ H;  1K7D A;  1MZF A;  2ZXW B;  5KFB A;  1I0H A;  3U10 A;  1W93 A;  2CNQ A;  3Q2O A;  4R8U B;  4K8X A;  3FKI G;  4YJ2 A;  1QU7 A;  3ETG A;  4B7E A;  1RSO B;  1VQ8 V;  3WO1 A;  3T1Y O;  1XDN A;  2QM7 A;  4FGR A;  2VQF B;  1IX9 A;  4F4Z A;  3ML0 A;  2WA3 A;  1VQ9 V;  4BBR G;  2ZQM A;  3QZ8 A;  3D36 A;  3CRC A;  3FKS G;  4WCE V;  4DV6 H;  4F4L A;  3KKY A;  2UXC B;  2R93 G;  2FK2 A;  4JI6 B;  4PWQ A;  5K1X A;  3CCS V;  4WFF A;  4LF4 H;  1EZ1 A;  2AGO A;  1Y67 A;  1TWA A;  2QB5 A;  1XNR B;  3ZHQ A;  2Q0A A;  2WPD G;  1VS0 A;  5D1P A;  3JCZ A;  5FPR A;  2I8C A;  1SQQ H;  1FPO A;  3N2G B;  3IJ4 A;  3F8N A;  2JA5 G;  2GV9 A;  3AG2 B;  2M7W A;  4A3G G;  3LP8 A;  5B1B B;  4EB6 A;  3JAT B;  2NU7 B;  3EPG A;  2RDI A;  2XD4 A;  5EZY B;  5KFX A;  3GTQ A;  1AR1 B;  4DR2 H;  2MW2 B;  4X89 A;  5DG8 A;  3OMA B;  4YHH O;  1SZX A;  1ZTE A;  3IC7 A;  4PDM A;  1QVF U;  1E4F T;  4DLK A;  1M5I A;  4NXN O;  3HB9 A;  4MTO A;  2WDT A;  2XCA A;  3MJF A;  5JH7 B;  5D8D A;  4FLZ A;  1DK1 A;  4GC6 A;  4HNV A;  5JUM A;  3R5X A;  2QGN A;  3HOV G;  3PZP A;  4RUA A;  3VQV A;  5F9L A;  2YI9 A;  1MG1 A;  5KHG A;  4NTY A;  3GIP A;  2V1D A;  4QWD A;  2Y0S E;  4QPJ A;  3TW6 A;  3ABL C;  4H33 A;  1A3G A;  1EKV A;  4QWA A;  4I7Z B;  4DV7 H;  2B1I A;  4H37 A;  2WWW A;  3JD3 A;  1WLE A;  4FVM A;  1Z2G A;  4NYK A;  1XMO B;  3OT7 A;  2W9B B;  5JWP A;  3Q8R B;  4H0L B;  5EIB D;  1EUC B;  5BWW A;  2ZM6 H;  2UVR A;  2YEV B;  3JRW A;  3JSL A;  4MAM A;  1WCM A;  3W7X A;  2H8P C;  3OTF A;  1SYX B;  2YXY A;  2DYS B;  3VQX A;  1Q3E A;  3A0H Z;  3GWK C;  4IWX A;  4MV4 A;  2WSS G;  4U3J A;  4CKE A;  1MA1 A;  4U6P A;  3BVO A;  5EYP A;  2CW7 A;  2X6C A;  3ZRX A;  2W6Q A;  3GTL A;  4NKG B;  5LOV B;  1XMQ O;  1JQ0 A;  3ZHT A;  1FJG B;  4ED0 A;  5CA1 F;  5JVL A;  5KAI Z;  1ZHS A;  3EYY A;  2UXX A;  2UXD B;  2C00 A;  1M57 C;  2P6J A;  4FJC C;  4BWS C;  4ETS A;  4DO2 A;  2E5L O;  2Z5U A;  3QZ7 A;  4LF7 H;  1HR0 O;  2ITD C;  3T4D A;  3V6J A;  1ZL8 A;  1OCZ B;  1N33 O;  2P67 A;  2XAS A;  2AGP A;  5KA6 A;  1P7G A;  2IU3 A;  4MW8 A;  3LDD A;  4LF8 O;  1ZET A;  5KFW A;  1KKD A;  1ROP A;  2ZIM A;  1O9G A;  4RWU A;  5BWV A;  1AI6 A;  5CR5 A;  5DQH A;  4TQF A;  2FB9 A;  2V9W A;  1AVM A;  1QLE C;  1IVS A;  1BHA A;  1URF A;  4I4T B;  3OAA G;  2VQF H;  3AYH B;  1Y6X A;  2FLP A;  2OTL V;  3RIZ A;  1S72 V;  2DN9 A;  1VQ7 V;  2RJZ A;  4GCZ A;  1N36 B;  1IBM B;  2ASD A;  2PI5 A;  3CRR A;  5L3F A;  3KG2 A;  2UXC H;  1S10 A;  2J6U A;  4JI6 H;  1BMF G;  3H1H H;  2DMX A;  2CTQ A;  2KSW A;  4O2B A;  2DYR C;  1K4C C;  3DSQ A;  3FMA A;  3OEE G;  3T9B A;  1UC9 A;  4GZR B;  2HDK A;  1XNR H;  4O3S A;  5LP6 B;  4E4E A;  4GT1 A;  4XDL A;  2ARH A;  4QE9 A;  1UC8 A;  2EBO A;  3QF7 A;  1YVW A;  3RVZ A;  2LFS A;  3T2M A;  3T1Y B;  2DWD C;  1RFY A;  1P16 A;  3JD0 A;  4D6T H;  2G38 A;  2Q6A A;  4O4L B;  4YXW G;  4KHP O;  2WLI B;  2KG7 A;  3CCV V;  1XHZ A;  3DAA A;  1GM9 A;  4MV9 A;  5EBM C;  5JVD A;  2XND G;  2DWC A;  1D5A A;  5D5Q A;  3BQ1 A;  2JJ2 G;  5DQI A;  3PR4 A;  3ETJ A;  3ZX6 A;  1H2N A;  2YIA A;  2XHB A;  1Z2P X;  5EDW A;  1RJP A;  3HPL C;  2Y0I A;  5BR8 O;  5BXZ A;  4UXN A;  2HHF B;  3BPZ A;  4FFO A;  3ETE A;  3LSU A;  4DV3 O;  3LQS A;  5I5T A;  3APO A;  1M1K W;  1QLN A;  4A93 G;  1O9H A;  5EIB C;  2Y0P A;  3FAV A;  3H4D A;  1S0V A;  1KQS U;  3RB0 A;  3P30 A;  2Y4R A;  1B3Q A;  3CJH A;  4QJF A;  1FS0 G;  1XMO H;  4LFC O;  3RYI A;  4FK5 C;  5KLV H;  2P4K A;  4DK1 A;  3B09 A;  4DV4 H;  3ZMV A;  3KAK A;  3WWH A;  2BQ3 A;  4YHH B;  3S3W A;  3CCE V;  5KT6 A;  3KZI Z;  2V4Q A;  4LCU C;  4NXN B;  5FNV B;  2LJ2 A;  4FLU A;  1B6Q A;  4PA3 A;  4TUY F;  3GIJ A;  1Q5O A;  1I7F A;  4NR1 A;  1PX2 A;  4MT8 A;  4I9W A;  3PW2 A;  1FJG H;  4TM5 A;  3DTG A;  3U54 A;  1N32 O;  2R85 A;  2UXD H;  5F2V O;  3CC7 V;  5CM0 A;  1K4D C;  1XL4 A;  2P06 A;  4GC7 A;  5GTH Z;  1Z2N X;  2A0L A;  4ECZ A;  4FU0 A;  4WBN A;  3CXH F;  1S77 D;  3JD1 A;  2QKA A;  5KS8 A;  3G71 V;  2GUZ A;  4H13 B;  4Z1M G;  2LO1 A;  2R8K A;  2F43 G;  4DRF A;  2HJW A;  4LNU B;  1NJI W;  2YS7 A;  3MWM A;  4EYH B;  3KYH C;  4PDB A;  4FS1 A;  4GYC B;  2R8G A;  4O7L A;  2HG5 C;  4YJ2 F;  5HFL A;  4M9U A;  1NTZ H;  1JIH A;  3SPG A;  4XDJ A;  1WPX A;  1RM1 B;  1R3I C;  2NU9 B;  3SPC A;  3ASN C;  4PD4 F;  1XMQ B;  4ZI7 B;  2WLH A;  5DGH A;  2JS3 A;  5KFZ A;  5KHI A;  5KT5 A;  5BZB A;  4TWK A;  4LH6 A;  5A2Q W;  1CKM A;  2CH7 A;  5DGA A;  2HGS A;  4E2L A;  2ITC C;  4I0X B;  3ETD A;  1Y1V A;  1R3K C;  4MS2 A;  4IIJ A;  4F4Y A;  2A06 H;  1HR0 B;  4J9K A;  1K1Q A;  3SR2 C;  4RNN A;  1N36 H;  1IBM H;  4MVM A;  5C93 A;  2EJ2 A;  1N33 B;  1QQC A;  1A0G A;  3HOY G;  2JEX A;  4ED2 A;  3F5W C;  4LF8 B;  4EBD A;  4B3M O;  4O7Y A;  2UVW A;  2NUA B;  1DTO A;  1AI7 A;  3C0F B;  5ITZ A;  1BGY H;  4K6N A;  2EJ3 A;  5IP7 G;  3NXS A;  2LW7 A;  2HVK C;  1AUV A;  5CE8 A;  1DAA A;  3L75 H;  4J10 A;  2EIJ B;  4TV9 A;  4Z2W A;  4X65 O;  3E89 A;  5IT9 N;  1VAJ A;  3T1Y H;  4J80 A;  1ARO P;  3UT5 A;  4RU9 A;  3RVY A;  1SZT A;  5CB4 A;  5GON B;  4Y8V B;  2EIL B;  1IYE A;  4Q43 A;  3EFF K;  3JD4 A;  2HEP A;  3HO8 A;  2HVR A;  2DQ0 A;  5IYZ A;  1F4M A;  3ETQ A;  4DR2 O;  5KFV A;  2Q0O C;  1THZ A;  2GBO A;  3O65 A;  2Q67 A;  2F4V O;  5KFP A;  5KFI A;  3GQC A;  5EWE A;  4NZN A;  3RYC B;  1I2L A;  4YAK B;  3NUA A;  5EBW C;  3JAS A;  3TQ1 A;  1KB9 F;  4MV6 A;  1KP2 A;  5J2U A;  1B06 A;  2EIY A;  5I60 A;  2Q69 A;  1RPR A;  1K8A W;  4ECX A;  1AP6 A;  1Q90 D;  2ZE6 A;  3Q8Q B;  4ECV A;  1SES A;  4NVP A;  1VKZ A;  2OCH A;  4X1Y A;  4UCT A;  4EFE A;  5LMU O;  4YHH H;  4KHP B;  1FFX A;  1H2M A;  4MVO A;  5B1A B;  3L2P A;  4YQW A;  1L8D A;  1N8R W;  3WG7 B;  2PN1 A;  4NXN H;  1M93 A;  2AXT Z;  5KFJ A;  3ABK C;  3HKD B;  2FPG B;  3CRQ A;  1ZX3 A;  4ZIB A;  3MR6 A;  4R7C A;  5BR8 B;  3THO A;  1ZLZ A;  4DV1 O;  4DV3 B;  3JAL A;  1EM1 A;  5IJ0 A;  5B66 Z;  2XCL A;  3WNZ A;  1RK5 A;  1YF2 A;  4ECQ A;  3ZN1 A;  4YJ3 A;  5C5J A;  1AR5 A;  5KG6 A;  4UB6 Z;  2YZN A;  1MMM A;  2FPI B;  5KFD A;  3OSP A;  4LFC B;  1G4Y B;  3MDS A;  5LMN O;  1X4T A;  1N56 A;  1CKN A;  3I56 V;  4AQY O;  3AEI A;  1L0N H;  3BCC H;  4O83 A;  2WB1 A;  3Q4H A;  3RTX A;  2VQD A;  4FM9 A;  2R7M A;  2RN9 A;  4TQR A;  5E79 Z;  3T1H O;  3KHL A;  2V4D A;  1QBZ A;  4LFB O;  4DR4 H;  3RFC A;  3DTF A;  1T3N A;  3FB6 C;  2UVU A;  1XMQ H;  2RDJ A;  1NT2 B;  1LUV A;  1JOY A;  1N32 B;  1VF7 A;  5IYD O;  2H94 A;  3C3S A;  3K3V A;  3P32 A;  3PW7 A;  1YSC A;  3PO3 G;  4KXR A;  1F4N A;  4DYL A;  4G2K A;  4EQ5 A;  2WE6 A;  1YIT V;  2E5L H;  3N43 B;  3RAX A;  4GX0 A;  3ZN0 A;  4CKB A;  1HR0 H;  4EYI B;  3AG1 C;  1YJN V;  2HVQ A;  2IJK A;  5KMG B;  3U0Z A;  4J42 A;  3BHP A;  1PKX A;  1S5J A;  1N33 H;  3K5I A;  2UVV A;  4MV8 A;  4ASU G;  4JV2 A;  4DV0 O;  2WAM A;  1OBG A;  5H80 A;  3LUT B;  4XYL B;  4LF8 H;  3B8N A;  3M4I A;  3VPB A;  1HWY A;  4IHJ F;  1OCO C;  4U7N A;  1YEW A;  2FPP B;  4O7W A;  1Y76 A;  3ABL B;  3OTO O;  5JCO A;  4YB8 B;  1KU9 A;  4DRX A;  3G6E V;  2FP4 B;  2V4R A;  2DWE C;  5AG2 A;  3JAM W;  2Q7E A;  1O75 A;  3H4B A;  3JAK B;  3B2E E;  2RNB A;  2EIN C;  5JVD F;  5KFS A;  1YI2 V;  4MTE A;  3LNM B;  4GKJ O;  4FFB B;  2RCV A;  4JI3 O;  3QQM A;  2COG A;  1L1F A;  1N34 H;  2KQX A;  4CH5 A;  3RB6 A;  3AG3 C;  3ASO C;  4JXU A;  2PI4 A;  4B3M B;  4CMF A;  4LWS A;  5JQG B;  2COI A;  2Z04 A;  1GM7 A;  1G1X B;  1BHB A;  4FFM A;  3GIK A;  3ZHU A;  4QGP A;  5DM6 V;  4UFZ A;  4JI7 O;  4ZBM A;  4O3O A;  1RYR A;  2L6L A;  1M57 B;  2JA7 A;  3WWI A;  2ZDH A;  1G6U A;  1LR1 A;  4MTG A;  2HHH O;  3M9M B;  2R7K A;  3ZRW A;  1FXK A;  2HR3 A;  4X65 B;  2W6N A;  4O2A A;  2EIK B;  3B4S A;  3JAR A;  4WFG A;  4FLX A;  4Z1V A;  1HNX O;  1GYF A;  4O4J A;  3Q1K A;  3T9D A;  3Q8P B;  1PP9 H;  5C44 G;  4JI4 O;  2XAH A;  5IE9 A;  4NYE A;  2C22 A;  5KFL A;  5TIS Z;  5FR9 A;  4KHP H;  4ZHQ F;  4O7N A;  2UUB O;  3GDE A;  4RUE A;  4DV4 O;  4DR2 B;  1WNS A;  3K5L A;  1FFT B;  1NH2 D;  2KKW A;  1NTM H;  5KG1 A;  3SGI A;  5KX5 B;  2F4V B;  4TV8 B;  4WBN F;  5BR8 H;  1FXK C;  1QLE B;  1M56 B;  3E22 B;  4DV3 H;  3CEI A;  1XIL A;  3L4K A;  5BWT A;  1XNQ O;  2YZG A;  1I50 A;  4OGQ B;  4HNT A;  3HKE B;  3ICX A;  3MHS C;  2DJV A;  3VPD A;  1HW7 A;  4LFC H;  1R1B A;  1BQZ A;  1KKC A;  5D1O A;  4JUZ A;  5FD6 A;  4TOI A;  2P7T C;  2QM8 A;  3ORQ A;  3DXR A;  3JSN A;  2DYR B;  5LMU B;  4K8Z A;  1TVK B;  1Q82 W;  4JAU A;  1XDC A;  4RAI A;  3GTO A;  4MTX A;  2COJ A;  2CUG A;  3GB7 C;  3RF2 A;  2Y69 C;  1A32 A;  1IDS A;  3K03 A;  4N23 A;  3ZRS A;  3T5J A;  2I87 A;  4XDK A;  1N32 H;  3L73 H;  4IIJ F;  1F23 A;  3J81 N;  3ZRV A;  3TCU A;  1SRY A;  4DV1 B;  2RF4 A;  2HGW A;  4D7T A;  1BSM A;  1I08 A;  4O86 A;  2JA6 A;  1YXB A;  3JAW A;  2R9R B;  2I80 A;  1US6 A;  1X59 A;  1KT8 A;  2CKZ B;  5LMN B;  4IL6 Z;  2V5A A;  1WA8 A;  1J5E O;  1WN7 A;  5J2T A;  4AQY B;  4CS2 A;  2FTK A;  3SJQ C;  4C5C A;  3MR5 A;  4OXS A;  3G6Y A;  3G67 A;  1H2G A;  4NTW A;  3T1H B;  5KHJ A;  4IHJ B;  5GTI Z;  4TV9 F;  3ABM C;  1DLB A;  1UPG A;  3H1L H;  5LA6 B;  4LFB B;  1SQF A;  2M6Y A;  3AW8 A;  4ECU A;  5CA0 A;  2YIC A;  5CB4 F;  4G3I A;  5LXT A;  1YCI A;  1R6K A;  1FAF A;  1RJQ A;  5KFR A;  2IW5 A;  2OH2 A;  1PL0 A;  4OPH A;  1WP7 A;  2OCC B;  4FBU A;  4X20 A;  1IOW A;  1KJJ A;  1LUW A;  3GTJ A;  4QWE A;  2W57 A;  1V54 C;  4RB0 A;  3TXQ A;  4J7K A;  1MSD A;  2JGD B;  1JJO A;  1GLV A;  3L74 H;  2UUC H;  3QG5 A;  5C8Y B;  4DV0 B;  2YWV A;  4EBC A;  4B3M H;  5J2U F;  2WB1 E;  2HJF C;  3PW4 A;  4WFE A;  3CB2 A;  1N4C A;  2C2A A;  5KUK A;  2AZ2 A;  4M0J A;  3OTO B;  3ABU A;  1LNQ A;  2FB5 A;  2JA6 G;  1KUQ A;  3UZB A;  4RZR A;  4X65 H;  2J6S A;  3SYO A;  5BMV B;  2OLS A;  4DR3 O;  5C4X G;  4ED7 A;  3HOZ G;  1SA0 B;  1SQV H;  3SDL A;  2VWJ A;  4O4H A;  5D5P A;  3G8C A;  3TII A;  1ZQ7 A;  4IT5 A;  2PMZ A;  3D36 C;  5EC1 C;  5KFF A;  2JRI A;  4MV1 A;  1WAZ A;  4GKJ B;  3GB8 B;  2VPQ A;  3HR0 A;  4ZHQ B;  4JI3 B;  2WAQ A;  5HBR B;  1Q6U A;  2QDO A;  4A3B G;  2DPJ A;  3WB1 A;  4F6R A;  4PBC A;  5KFQ A;  2F4V H;  2ZDQ A;  3E8B A;  4YJ3 F;  2JK5 C;  1BS3 A;  2OT5 A;  3JAM N;  2CAZ C;  2R87 A;  3KHR A;  2UXB O;  4JI7 B;  1AJN A;  3NR7 A;  1HP8 A;  3N2K B;  3RW0 A;  3RYH B;  4JI1 O;  2XAJ A;  3APQ A;  2HHH B;  1E4E A;  4A3I G;  4RUC A;  2PF4 E;  4RNO A;  1HNX B;  3IG0 A;  1VMG A;  5GW7 A;  2J9G A;  4PA4 A;  3G8D A;  3VBB A;  3CCM V;  3RR5 A;  4J0M A;  4A3M G;  4U3F H;  2W6I G;  5LMU H;  3RBD A;  5KKN B;  3BG5 A;  1QR9 A;  4JYC A;  1SER A;  3A8T A;  2UUB B;  2B9Z A;  3AK1 A;  2AZ0 A;  4DV4 B;  3N6X A;  2WTF A;  4UVB A;  1NKD A;  2ZJT A;  4YP3 A;  4Q4C A;  2CZG A;  1TUB A;  1H2S B;  4JTA B;  1BQ0 A;  3MWD A;  2XAQ A;  4UV8 A;  2EX3 A;  1Y74 A;  4DR4 O;  3TEK A;  2NU8 B;  5KG7 A;  5B3S C;  3V6K A;  4PEL A;  4DV1 H;  1CE8 A;  4BWA A;  1XNQ B;  4ABM A;  3AK3 A;  4I55 A;  4GUN A;  2VWK A;  3MHH C;  3CPW U;  4YY3 O;  1P8L A;  1XEQ A;  3LWB A;  4YR2 A;  2Y48 A;  5KFC A;  2YXL A;  3OW2 U;  1GGO A;  5LMN H;  1S9F A;  1PV0 A;  4HBN A;  3CWB H;  4AQY H;  3LDC A;  4J41 A;  1TWH A;  1TWG A;  4JV1 A;  2SCU B;  1BE3 H;  4CMD A;  2VOB A;  1VAR A;  4B7K A;  3GTK A;  3T1H H;  3O9O A;  5DED A;  1P7B A;  4PA6 A;  2LFR A;  4LFB H;  4A3L G;  1JDB B;  1WRV A;  3CCR V;  3RV3 A;  4JV5 H;  2Q9L A;  2IBK A;  2HJD A;  4ZOL F;  4HNA B;  3WWJ A;  2HG8 A;  1SQP H;  4A5U B;  2HKO A;  2X7R B;  3L4J A;  1ULZ A;  4OPA A;  2BCC H;  4RQE A;  4BR6 A;  1CXZ B;  3T9E A;  2Z0A A;  2DAA A;  2DOS A;  4QE7 A;  4RNM A;  1J5E B;  1WCM G;  1JVM A;  4G27 B;  1WP8 A;  1H2K A;  4DV0 H;  2WLL A;  1JKJ B;  2R7Z A;  3PW0 A;  4PA7 A;  2R8H A;  1N34 O;  1PPJ H;  1I1L A;  2Q7D A;  3GLK A;  4O2A F;  1X9N A;  4DL4 A;  3D8C A;  1VBH A;  4O4J F;  4ICG A;  3OTO H;  2VUG A;  5J9P C;  3W1G A;  2JS5 A;  1I6U A;  3B40 A;  3T99 A;  1OHH G;  1DF4 A;  4W4K A;  4NXM O;  3E8F A;  1HDJ A;  5C1P A;  4UVA A;  2D3O W;  2W0X A;  1G2W A;  4ECR A;  4DR6 O;  2C35 B;  1UFI A;  1G8M A;  3MFH A;  4GKJ H;  4O4I A;  4HAM A;  4O82 A;  1Y1W A;  3T7A A;  5FD5 A;  4JI3 H;  5DLF A;  3M99 B;  1JR9 A;  2DW4 A;  4APM A;  2ZCE A;  2CNU A;  1XL6 A;  4J7Z A;  5L1K A;  1NI8 A;  3W7T A;  2CK3 G;  4TVI A;  3STZ C;  3HKZ A;  1R73 A;  1R3L C;  4FZ1 A;  4JI7 H;  3KAL A;  4A3D G;  1SEI A;  2RGR A;  1UJW B;  2HHH H;  3H9V A;  2JEU A;  1EUD B;  3AG1 B;  4DR3 B;  1HNX H;  2BTQ B;  1YHQ V;  4R8U A;  3AK2 A;  3G6X A;  1OCC C;  4JI4 H;  1KC7 A;  4LSX A;  1RSO A;  3MR3 A;  3VPC A;  4BW5 A;  1GSA A;  2HIX A;  4FFR A;  2UUB H;  5L1L A;  4O3Q A;  2FKX A;  2F1M A;  1WB7 A;  1JCH A;  2CTR A;  4JAV A;  4X1I B;  1OCO B;  4ME6 A;  3CSX A;  1V55 C;  3RN4 A;  1AI4 A;  3MD0 A;  2W9C B;  1CS0 A;  3H0G A;  4FZ0 A;  1IOV A;  4DL3 A;  1BNC A;  1KUT A;  1TWF A;  4TT3 G;  4ECW A;  4NB5 A;  1Z5W A;  2UXB B;  4RQF A;  2W6M A;  4A3K G;  4DL5 A;  2C2R A;  1XNQ H;  5DLG A;  4UVC A;  1I2K A;  4JI1 B;  5DGI A;  5BWR A;  2Q7G A;  5J2T F;  2XC9 A;  5CA1 B;  4Q45 A;  3FD9 A;  2EIN B;  1E4G T;  3B77 A;  1K5Q A;  3L71 H;  4FFP A;  2YID A;  4I50 F;  5IYB G;  4NTX A;  1ORQ C;  3WFV A;  3N2G A;  3WO0 A;  5IDJ A;  3VNN A;  1DGS A;  5KFO A;  4AI8 A;  2K9P A;  3ASO B;  4UCV A;  3JAT A;  2VPS A;  5LGT A;  4X66 O;  1V9P A;  1VQN V;  3UKM A;  5CA0 F;  5EZY A;  4DUZ O;  3IC9 A;  5LXT F;  4HR7 A;  2W70 A;  3FB8 C;  4K3A A;  3JZ6 A;  2QR4 A;  3K0G A;  4JI8 O;  2EZP A;  3S24 A;  3RBE A;  5FL7 G;  1QCE A;  3SYQ A;  1XRE A;  2A9H A;  3W7U A;  3QO7 A;  4PHZ A;  4DAA A;  2ATK C;  4ZOL B;  4DR4 B;  4ECY A;  5JH7 A;  2Q7H A;  3CP1 A;  2F23 A;  2E76 B;  2Z3Y A;  1I1M A;  3I5D A;  3AG2 C;  3GIQ A;  3AG4 C;  4U7C A;  4YY3 B;  3EVK A;  4CH3 A;  3RAQ A;  4O7Z A;  5KG2 A;  5JJJ B;  4GX5 A;  2AW9 A;  1F7Y A;  2E5L B;  3T4Z A;  1J5E H;  1W96 A;  3W7W A;  3Q8S B;  4HZ3 A;  2ASJ A;  2E2I A;  1U96 A;  3N8D A;  4B3T O;  3EXA A;  4DR7 O;  3OHB A;  3TY5 A;  5DG7 A;  2UUC O;  3T9C A;  1F51 A;  2N74 A;  4C2M A;  4JAS A;  2YEV A;  4JYB A;  3VOT A;  3E8H A;  1FXK B;  1S5L Z;  4IRD A;  3SPJ A;  2ZNJ A;  1ET0 A;  1OBD A;  2BSK B;  1VQP V;  4PJ0 Z;  3ZIA G;  1JX9 A;  3DTU B;  1SKV A;  1KC8 W;  4O4H F;  1RYS A;  3RFR A;  3P3N A;  4D7S A;  1VQ4 V;  5IY5 B;  1Z2O X;  3RJ0 A;  3HOU G;  2VRZ A;  1KMI Z;  3OE7 G;  4J9Q A;  4W4L A;  2AQ4 A;  5LOV A;  3TIG A;  4MV3 A;  1AN7 A;  1Q43 A;  3G6B A;  1WH2 A;  3HXL A;  2NVY A;  5B5E Z;  5F9N A;  4RB2 C;  1IXM A;  3LSQ A;  3H1I H;  3QVN A;  2V7Q G;  1XK5 A;  2IH3 C;  2R84 A;  3OR6 C;  4CZZ A;  1N48 A;  2Y69 B;  1XHX A;  3OGC C;  3V4S A;  3AX6 A;  4R50 A;  2XIG A;  2DYS C;  3K9S A;  1N34 B;  2RMK B;  3UYY A;  2W6P A;  3HKC B;  2NR5 A;  4L8J A;  1KD1 W;  3I4N G;  4IR9 A;  4LF9 O;  3WB2 A;  2BOB C;  3HKB B;  3N40 P;  4ED8 A;  2ZKO A;  2XGQ A;  1OJH A;  4Q20 A;  4DR1 O;  4Q8F A;  1AJQ A;  2R9I A;  3G4S V;  2ILM A;  1QNM A;  4DR3 H;  2B5U A;  3L72 H;  4NXM B;  4I5S A;  5EC2 C;  1Y1V G;  2GQS A;  4MW3 A;  1EN4 A;  2HGX A;  4DR6 B;  4I4T A;  3IGA C;  1GN6 A;  5JJN B;  2AHZ A;  4CS3 A;  5L3G A;  2ZDG A;  3UQ8 A;  3R23 A;  4FLV A;  3RUP A;  2X6B A;  2R72 A;  3VMM A;  3ABM B;  2YU9 A;  3HOW G;  4JI5 O;  2FJZ A;  3CMA V;  1E1Q G;  2R7L A;  1M0W A;  5BYB A;  4I55 F;  1SC5 B;  2GTS A;  3DC6 A;  5DEC A;  2CTW A;  2YIB A;  4TUY B;  4DW0 A;  2UXB H;  3E2E A;  5H2F Z;  4JTC B;  4QIW A;  4FE2 A;  4JI1 H;  4J9S A;  5LP6 A;  2IA6 A;  3KHG A;  4X1K B;  1AJP A;  3FFQ A;  2ABJ A;  3MWE A;  4I50 B;  1JFF B;  2IH1 C;  2L35 A;  4C5A A;  2YS6 A;  4XZ3 B;  3GV8 B;  4ED3 A;  2H3O A;  3QWU A;  2R8J A;  2Q8V A;  3C3T A;  3RYF B;  4B3R O;  2W8L A;  2P90 A;  2QWO B;  4DR5 O;  4CHI A;  2CNV A;  5LHH A;  4R8C A;  1M4U A;  4YIO A;  2CGO A;  2YRX A;  2LP7 A;  4O4L A;  1S97 A;  4CH4 A;  1YTF D;  2WLI A;  4YJ2 B;  4UV9 A;  2NLJ C;  2YXH A;  4DQN A;  4J9Y B;  2YS8 A;  5LP6 C;  2BOC C;  3E8G A;  5KAF Z;  3K59 A;  5KT2 A;  4JV5 O;  3OSN A;  4LF6 O;  4JZ2 A;  2ZE7 A;  4YY3 H;  4ECT A;  5KFA A;  2HHF A;  1NH2 B;  4IR1 A;  2JEI A;  4X9Q A;  3RT3 C;  1SQX H;  2YZL A;  2YI8 A;  5K1P A;  1SF9 A;  2QWP B;  5CA3 A;  2ATL A;  2Q73 A;  4O2B F;  2LGW A;  1SQB H;  3CRA A;  4PDV A;  4X66 B;  1I1K A;  2WA4 A;  1Z5V A;  4O7S A;  4DUZ B;  1M90 W;  2JJ1 G;  3KCX A;  2ZNI A;  1GKF A;  3VA7 A;  5KA5 A;  1C30 A;  4PZ7 A;  4JI8 B;  5L3C A;  1GAX A;  3WB0 A;  1BGW A;  5LYJ A;  2GHY A;  2JEJ A;  2F93 B;  1KTA A;  1IXB A;  5KFM A;  5FNV A;  2XUM A;  4EB6 B;  4QSH A;  4YAJ B;  3GTM A;  2ZIO A;  3UO2 A;  1KJI A;  1AB3 A;  5BPH A;  5KHK A;  4J7J A;  2V58 A;  3TW7 A;  5KT7 A;  4O4I F;  3FB5 C;  1XBL A;  3TK1 A; 
#chains in the Genus database with same CATH homology
 2Q2U A;  4RB3 C;  2VQF H;  4X20 A;  3RIZ A;  3QTC A;  2W57 A;  2R70 A;  4A2B A;  4RB0 A;  2JGU A;  1HNW H;  2RJZ A;  1N36 B;  1JJO A;  1IBM B;  2UUC H;  3QG5 A;  2UXC H;  5C8Y B;  4B3T B;  4DR7 B;  4DV0 B;  4JI6 H;  2UUC B;  2KSW A;  4O2B A;  4B3M H;  4DUY B;  3DSQ A;  3CB2 A;  3FMA A;  4LNU A;  3K5N A;  1XNR H;  1A0I A;  5LP6 B;  5JCO C;  3OTO B;  3M7M X;  3K5O A;  3JAM W;  4DV5 H;  4X65 H;  3QF7 A;  5BMV B;  4OX9 H;  5D1O B;  3BAB A;  4NXM H;  3NBY B;  1SA0 B;  1CKO A;  4HNA A;  4ZI7 A;  4O4H A;  2VWJ A;  3T1Y B;  4IAJ A;  5D5P A;  4FM2 A;  3J7A K;  3J80 W;  4DR6 H;  1P16 A;  2VQE H;  2PGG A;  1SQG A;  4GKJ B;  4U3J B;  1B04 A;  2HIV A;  3GB8 B;  4O4L B;  4JI3 B;  4ZHQ B;  4FLT A;  1XHZ A;  5EYP B;  4MV9 A;  3NC0 B;  1FVI A;  3WB1 A;  4F6R A;  5JVD A;  1D5A A;  5D5Q A;  2F4V H;  3ZS8 C;  2YIA A;  2XHB A;  4LFA B;  1S68 A;  1Z2P X;  4LF9 B;  4FM1 A;  2CAZ C;  3ZED A;  4PZ6 A;  4JI7 B;  1L2Z A;  3N2K B;  3BPZ A;  3JAW B;  3RYH B;  4DR1 B;  1O9H A;  5EIB C;  5IWA B;  2HHH B;  3BRC A;  2OWO A;  3N42 B;  5J2T B;  4AIL C;  3KXY T;  2P22 C;  3J81 W;  1HNX B;  2F66 C;  3IG0 A;  1P49 A;  1XMO H;  3RYI A;  2ZIN A;  5KHH A;  3RR5 A;  4J0M A;  4DK1 A;  4DV4 H;  5LMU H;  4GKK H;  2PTM A;  4GLX A;  3KAK A;  4LMY A;  2UUB B;  4YHH B;  2PUS A;  5GON A;  4DV4 B;  3N6X A;  4X62 H;  2ZJT A;  4NXN B;  5CA0 B;  4JI5 B;  5FNV B;  2UUA B;  4FLU A;  1TUB A;  1H2S B;  5LXT B;  1Q5O A;  1I7F A;  3K57 A;  3IAY A;  1FJG H;  2EX3 A;  2OYQ A;  4X20 B;  2FE3 A;  4DV1 H;  4BWA A;  2UXD H;  1XNQ B;  4I55 A;  3RYC A;  1Z2N X;  2VWK A;  3CHX A;  4WBN A;  1P8L A;  4B08 A;  4UCS A;  2YXL A;  5LMN H;  4HBN A;  4O2B B;  4B3R B;  4AQY H;  2UU9 H;  2BTQ A;  4X66 H;  4DRF A;  4BW9 A;  4LNU B;  3MWM A;  4DUZ H;  2VOB A;  4DV2 H;  4DR5 B;  3KYH C;  3T1H H;  4GYC B;  4PDB A;  3RWR D;  4LR3 A;  4JI8 H;  4LFB H;  2F95 B;  4JV5 H;  4CH6 A;  4X1I A;  1XMQ B;  3HKD A;  4HNA B;  4ZI7 B;  4O4H B;  4JV5 B;  4PI0 A;  5KHI A;  4LF6 B;  3L4J A;  1XQ8 A;  4LH6 A;  5A2Q W;  2PZS A;  1CKM A;  2HGS A;  3BA8 A;  3DF7 A;  4MV7 A;  1JMK C;  4IIJ A;  4FM0 A;  1HR0 B;  5CA1 A;  3SR2 C;  4JI0 B;  1N36 H;  1IBM H;  5JVD B;  4F6R B;  1J5E B;  4PZ8 A;  4B3T H;  2WYO A;  1T5E A;  3W1B A;  4DR7 H;  1N33 B;  4CS4 A;  1QQC A;  4DV0 H;  4CC5 A;  4LF8 B;  4DUY H;  2RQ6 A;  3A2F A;  4FLW A;  1M0T A;  4JI2 B;  1X9N A;  4M7E A;  1HNZ B;  3C0F B;  5ITZ A;  3OTO H;  2VUG A;  3W1G A;  4EFB A;  2JS5 A;  1I6U A;  3RYI B;  1TAE A;  4DK0 A;  4TV9 A;  4MTD A;  3T1Y H;  1I94 B;  4ZOL A;  1S03 G;  1WPB A;  4UCR A;  2UU9 B;  4RAZ A;  3UT5 A;  4R7R A;  5CB4 A;  5GON B;  4GKJ H;  4O4I A;  3MAQ A;  5FD5 A;  4JI3 H;  1TUB B;  2HEP A;  2HVR A;  5IYZ A;  4APM A;  2ZCE A;  3ETQ A;  4DV6 B;  4RAY A;  4EEQ A;  5KMG A;  2CW8 A;  2BTO A;  4LFA H;  4LF4 B;  4LF9 H;  2JVD A;  4CC6 A;  4I55 B;  3BA9 A;  3RYC B;  4JI7 H;  3KAL A;  1SEI A;  4WBN B;  3JAS A;  4DR1 H;  2RGR A;  5IWA H;  3SJC C;  5J2U A;  2HHH H;  1TA8 A;  3TY8 A;  4DR3 B;  1HNX H;  2BTQ B;  3W5O A;  4E6N A;  4JI4 H;  4A2A A;  4JYA H;  3GJX B;  3RGZ A;  4LSX A;  1RSO A;  4NVP A;  4X64 B;  4X1Y A;  3RGB A;  4UCT A;  4JI4 B;  4LH7 A;  2HIX A;  2HVS A;  3JAK A;  4EFE A;  4JYA B;  2UUB H;  4YHH H;  4KHP B;  1FFX A;  2F1M A;  4LF5 B;  3L2P A;  1L8D A;  3N41 B;  4NXN H;  4X1I B;  1M93 A;  2UUA H;  4JI5 H;  3CSX A;  4UCO A;  4FFB A;  3HKD B;  3LNN A;  4Q6G A;  4B3S B;  4ZIB A;  5BR8 B;  1Z5W A;  2UXB B;  3THO A;  3HKC A;  5JQG A;  1XNQ H;  4DV3 B;  4UCU A;  3JAL A;  4JI1 B;  4IIJ B;  2Q7G A;  5IJ0 A;  5CA1 B;  5LL6 b;  3HKB A;  1E4G T;  4YJ3 A;  3VQW A;  3SJB C;  4LSA A;  4DV7 B;  3N2G A;  4LFC B;  2IM9 A;  3VNN A;  4B3R H;  1DGS A;  2ZM6 B;  1X4T A;  3RGX A;  1CKN A;  4UCV A;  3JAT A;  2VPS A;  1XI1 A;  4PI2 A;  2YCH A;  1V9P A;  4DR5 H;  5EZY A;  3RTX A;  5ITZ B;  4FM9 A;  1Q8I A;  2R9A A;  4TQD A;  5IJ9 B;  2V4D A;  3S24 A;  4DR4 H;  5FLX W;  4TV9 B;  5DIS C;  1XMQ H;  4I7H A;  1NT2 B;  4PHZ A;  4ZOL B;  4DR4 B;  1N32 B;  1VF7 A;  5JH7 A;  2Q7H A;  3UT5 B;  5KX5 A;  3K3V A;  4LF6 H;  4TV8 A;  1IBL B;  5CB4 B;  3PN1 A;  2O03 A;  4TUY A;  4FLY A;  4EQ5 A;  2WE6 A;  4O4I B;  2E5L H;  4YY3 B;  3E22 A;  3N43 B;  4CH3 A;  1HR0 H;  5IYZ B;  5JJJ B;  2PY5 A;  4JI0 H;  2E5L B;  2HVQ A;  4LF7 B;  5KMG B;  3U0Z A;  3HKE A;  1J5E H;  5IT9 W;  3BHP A;  4X1K A;  3CVZ A;  1S5J A;  1N33 H;  4I50 A;  1JFF A;  3VQY A;  3N44 B;  3TY5 A;  3KAJ A;  4RZQ A;  4LF8 H;  3M4I A;  3RYF A;  2P5O A;  3JAS B;  3H20 A;  4JI2 H;  1HNZ H;  5J2U B;  2ZNJ A;  1TVK A;  1YEW A;  3K58 A;  2QJ1 A;  1SKV A;  3RFR A;  4D7S A;  1Z2O X;  5JCO A;  3U10 A;  3RJ0 A;  1IBK B;  4K8X A;  1KMI Z;  4YJ2 A;  1KU9 A;  4DRX A;  4K0K B;  2E3C A;  5IJ9 A;  1I94 H;  5LOV A;  4X1Y B;  2CFM A;  1AN7 A;  2Q7E A;  1XDN A;  1Q43 A;  1MZB A;  1O75 A;  2VQF B;  1WH2 A;  3JAK B;  3B2E E;  3HXL A;  1FFX B;  4RB2 C;  4MTE A;  3NBZ B;  1XK5 A;  1HNW B;  4FFB B;  5JJE B;  1N34 H;  1XHX A;  4DV6 H;  4CH5 A;  2UXC B;  2QM4 A;  3TY9 A;  4JI6 B;  2XIG A;  1N34 B;  5K1X A;  4B3M B;  3HKC B;  5JQG B;  4LF4 H;  4KL1 A;  3JAL B;  4L8J A;  2RGV A;  5IJ0 B;  3WB2 A;  3LML A;  3HKB B;  1XNR B;  4YJ3 B;  4UFZ A;  3N40 P;  2Q0A A;  1VS0 A;  5D1P A;  4IHJ A;  1QHT A;  5FPR A;  1G6U A;  3F8N A;  3N2G B;  5LA6 A;  2GV9 A;  4DV5 B;  4DR3 H;  4X65 B;  5EOY A;  4O2A A;  4OX9 B;  4NXM B;  3JAR A;  4FLX A;  1CKN B;  4EB6 A;  3JAT B;  1GYF A;  4O4J A;  3K5M A;  2PYL A;  5EZY B;  4DR6 B;  4I4T A;  4X64 H;  2VQE B;  5JJN B;  4CS3 A;  1ZHQ A;  4DR2 H;  4KHP H;  1ZAU A;  3UQ8 A;  4LF5 H;  3GDE A;  4FLV A;  2R72 A;  1E4F T;  4DR2 B;  1WNS A;  1M5I A;  3K5L A;  2KKW A;  4B3S H;  2WDT A;  2Q2T A;  1M0W A;  3SGI A;  5JH7 B;  5KX5 B;  5C8Y A;  4FLZ A;  4TV8 B;  2F4V B;  3BAA A;  5BR8 H;  2YIB A;  4TUY B;  2UXB H;  3VQV A;  3E22 B;  4DV3 H;  2YI9 A;  5KHG A;  4JI1 H;  3L4K A;  4RB1 A;  5LP6 A;  3HKE B;  3ICX A;  4X1K B;  3FFQ A;  4DV7 H;  1FKA H;  4I50 B;  1JFF B;  1HW7 A;  4FVM A;  4LFC H;  1XMO B;  5BMV A;  5D1O A;  5EIB D;  3QWU A;  4TOI A;  5FD6 A;  2ZM6 H;  3RYF B;  1SA0 A;  3JSL A;  3U11 A;  3JSN A;  5LYJ B;  5LMU B;  4GKK B;  4K8Z A;  1TVK B;  3OTF A;  1SYX B;  1BJT A;  5FPO A;  3VQX A;  1Q3E A;  4X62 B;  1M4U A;  3RF2 A;  2MCT A;  4U3J A;  4O4L A;  4ZHQ A;  4CH4 A;  4YJ2 B;  4DRX B;  5EYP A;  2CW7 A;  4AHC A;  1N32 H;  5LP6 C;  5LOV B;  1FJG B;  3K59 A;  4DV1 B;  1IBL H;  1ZHS A;  3EYY A;  2YIB D;  2UXD B;  4YY3 H;  4D7T A;  4BWS C;  4ETS A;  3N2K A;  3JAW A;  3RYH A;  4LF7 H;  2YI8 A;  5K1P A;  5LMN B;  1WN7 A;  5J2T A;  4Q0Y A;  4AQY B;  4CS2 A;  4X66 B;  1Z5V A;  4DUZ B;  4DV2 B;  2ZNI A;  3T1H B;  5KHJ A;  4IHJ B;  4PZ7 A;  4JI8 B;  5LA6 B;  4LFB B;  1TGO A;  1SQF A;  2ZIM A;  3WB0 A;  1BGW A;  1O9G A;  4O2A B;  5LYJ A;  2F93 B;  3JAR B;  5CA0 A;  4I9Q A;  4EB6 B;  5FNV A;  1IBK H;  2ZIO A;  4O4J B;  5LXT A;  4TQF A;  3SJA C;  5KHK A;  4K0K H;  2PYJ A;  4I4T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...