1TAEA

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
QPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase, NAD-dependent
total genus 104
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1taeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1taeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1taeA02
3KYHC 4JYAB 2UXDB 1B04A 5D1OB 4E6NA 3TY5A 4UCSA 1N32B 2HIVA 5LMNB 1IBMB 4DR7B 4X62B 1N36B 2UUBB 2HVRA 3GB8B 4GLXA 1XNRB 2ZM6B 4LF4B 3BA9A 2E5LB 2VUGA 1ZAUA 1XMQB 1TAEA 4TOIA 4LH6A 2UU9B 4JV5B 4JI7B 1P8LA 4B3MB 3JSLA 2HVQA 2HVSA 4GKKB 1CKNA 4DR2B 3L2PA 1CKMA 1XDNA 2F4VB 4JI6B 4CC6A 3T1YB 4EEQA 3RR5A 1N33B 4JI3B 3TY8A 3RTXA 1J5EB 1S68A 1N34B 4JI4B 4PZ6A 4DV1B 4DUZB 4UCVA 4AQYB 3BA8A 1CKOA 1P16A 4LFBB 3NBYB 1VS0A 1HR0B 4K0KB 4X66B 4UCUA 3GJXB 1DGSA 1XK5A 4DR6B 4X64B 3NC0B 2UXBB 1TA8A 4JI5B 5BR8B 4LF7B 4X65B 1FVIA 4YY3B 3NBZB 5DISC 4LF8B 1FJGB 4OX9B 3VNNA 3W1GA 4B3TB 4LH7A 1HNXB 2Q2TA 3TY9A 4YHHB 5FPOA 2UUAB 4PZ8A 4EFBA 4DV5B 4DUYB 4LFCB 1A0IA 5D1PA 5FPRA 4DR5B 4LFAB 1CKNB 1XNQB 4KHPB 1HNWB 4DR3B 3JSNA 1IBKB 4GKJB 3BAAA 1V9PA 4JI1B 2VQFB 4JI0B 4LF6B 3S24A 4B3SB 4NXNB 4DR4B 1IBLB 2VQEB 2Q2UA 4DV2B 3SGIA 1I94B 1HNZB 3UQ8A 3BABA 2UXCB 4NXMB 4UFZA 4JI2B 2UUCB 4EFEA 2OWOA 5IWAB 3T1HB 1XMOB 4LF5B 4UCOA 4DV6B 4CC5A 4PZ7A 3QWUA 2HIXA 4B3RB 4DV4B 3PN1A 4JI8B 3OTOB 4UCRA 5LMUB 5D1OA 2HHHB 3GDEA 4LF9B 1X9NA 3W1BA 4UCTA 4EQ5A 4DV7B 4DV0B 2CFMA 4DV3B 3W5OA 4DR1B 4DRFA
chains in the Genus database with same CATH superfamily
1EUCB 3JASA 3K3WA 3ZMZA 4Y8VB 3GIDA 2FMAA 2XD4A 4DV2H 3M9MB 1WN7A 4PD4F 3JCUZ 2YXYA 3BFRA 2NUAB 3UT5A 2Y4TA 1ZHSA 4NZOA 4TV8B 1DV2A 5F2VO 2RGRA 4QE7A 1I0HA 5BYAA 3T5JA 2EINB 1P49A 4QWCA 1GN2A 4NXMO 1H2MA 2Q5ZA 4JZGA 3ZX6A 2LFSA 3OGIB 3T1HO 1N32O 1OCRB 2HHFB 1N34H 3ZHUA 1XEQA 1Q5OA 1VKZA 4DRXA 2FP4B 4B3SO 3TXQA 2F4VH 4Z2WA 3K08A 3BRCA 5JH7F 3UO3A 2RCVA 4X62O 4PA7A 1JIHA 2QJ1A 4O7WA 1E1QG 4X66B 5KKNB 3A0BZ 1DGSA 3QO7A 1Z2PX 3PO2G 1XUQA 3NC0B 5KHIA 1B06A 3SPIA 1PM9A 2VQDA 4I0XB 1VQ5V 3ORQA 5DISC 4RNNA 5KHJA 2BQRA 4ZI7B 3EHBB 4NTYA 2ASJA 3OD4A 2VUMG 5IYBO 4J9OA 2BE3A 1DAAA 3BVOA 4FFNA 4I50A 2GBOA 5KG7A 2W6NA 3QNEA 2AGPA 2AW9A 2C2RA 3ZRWB 2WB1A 4BW9A 1VF7A 3RGXA 3GWKC 3IFXA 5DQHA 4O86A 1KEEA 3HOYG 2WLLB 4DUZH 4I55B 3E8FA 2W6PA 3BABA 4RQEA 3KCYA 2VRZA 5DEDA 1W96A 3GV8B 2AGQA 5TISZ 5KT7A 4Z1VA 2IP4A 5J9PC 4TUYB 4U3FH 1IOVA 4I7ZB 4KHPH 2DYRC 4HAMA 1US6A 3ZIAG 2E2IA 4PDVA 3X2QB 1E1RG 1YJNV 2W6JG 1S3JA 3ETEA 4DK0A 3N41B 5LP6C 5BR8B 4CS4A 1I08A 1FPOA 3GV7B 1PX2A 2XNDG 4GT1A 3TINA 4J9QA 1HR0H 5LYJF 4LF7H 2RDJA 4RUAA 4NKGB 2JA5A 1F7YA 4O2AA 4JAVA 5KFGA 3JASB 3HKBA 4TOIA 2UU9B 4TSFG 1GN6A 1OCZB 2B9ZA 3CP1A 4JI0O 2M7WA 1SRYA 5KLVH 3T9BA 3VPCA 3G67A 1V55B 3D36A 3L9DA 2FPIB 1X59A 3HKDB 3G6XA 3ASNB 3BCCH 1G8MA 3KAKA 2DJVA 2GDSA 5GW7A 2ZINA 4TV9A 4G28B 4BW5A 2UXXA 1JFFB 1YCIA 2F93B 4AILC 1L8DA 4J9ZB 4JI3H 1D2DA 4DV1B 2DQ0A 1VIBA 2VQFH 4R7CA 3R66A 4D6TH 1BL8A 2NU7B 4ZHQA 2RDCA 2VR1A 4CKEA 4LFBH 4PJ0Z 3Q4HB 1XK5A 1F4NA 2Q7GA 1RK5A 1WRVA 1OZ0A 4A3DG 3AK2A 1TA8A 2ZE6A 2Q8VA 3TQTA 1WR2A 2W6QA 2COJA 1BT8A 4NZNA 2LGWA 1VQOV 2HGSA 1FJGH 4JI2H 1S0OA 2DE0X 4YY3O 5A2QN 2OTLV 4RB0A 2A06H 2YZLA 2P67A 3FDSA 5FLMG 2I8CA 3HOVG 2UUAB 4ME6A 4O4IB 4PZ8A 4EFBA 4RUCA 1NR7A 2CW7A 3OTOO 3UZOA 1IOWA 3S3WA 3E86A 4LFAB 4FLUA 1S72V 1HNZO 4HQ6A 4BBSG 3S24A 1HNXH 1XREA 4LF6B 4H0LB 4MTXA 4YR0A 5IYBG 1R3JC 3PW0A 1CEZA 4LF7O 4ED3A 4PHZA 2UUCB 2LW1A 4YBZB 4YIPA 1NT2B 3I5DA 2WTFA 3AG3B 3G80A 2R8GA 4R50A 1Y1WG 1VBGA 4DIMA 1QVGU 1GK9A 2HHHB 4LF5O 1VEWA 3RYFA 1VQPV 3AYHB 5I5YA 4KUMA 4RB3C 4JV2A 4MVUA 5IWAH 1K7DA 3OUSA 4JYAB 2UXDB 3D8CA 4WFAV 4DL3A 2IJIA 4FFKA 3WO1A 4ECUA 1UFIA 4QGPA 1JDEA 5B1AB 1CQJB 4DR7B 4DV3H 1L0NH 5CBHA 3SDLA 1S0VA 2BCCH 4RNOA 3Q1KA 4LC1A 5FL7G 5KFUA 5DGHA 4ED0A 2HVKC 4QIWA 2NU8B 1MNGA 2JA5G 4B3MB 5JCOA 3SJAC 4O82A 2N05A 2RF4A 2BSKB 4EB6A 3RBEA 2R6FA 4RUEA 3DGEA 4AYBA 2YW2A 2X0LA 2P22C 4JI6B 2YI8A 4RWUA 4PA6A 2ZM6H 2CH7B 5KFXA 1B6RA 3DC5A 3W7UA 3RTXA 4RB2C 2YXLA 3CCVV 3JAKB 1WH2A 4MTFA 3FYEB 3JZIA 2UXCH 2CDYA 3RYFB 4O4HF 4QSHA 1JX4A 5IYCG 4YJ2B 5F9NA 1EFRG 3E89A 4QPKA 4FE2A 1SEIA 3TIGA 2W0XA 5KFMA 4IRCA 3WB0A 3ZHQA 1HNXO 2CNQA 2RNBA 4QJFA 2F4VO 4ED8A 1FXKC 3CRAA 3PO3G 3FYIB 3W7XA 2GLTA 2QKSA 1KJQA 5BPFA 1Q6HA 2JA6G 3RIZA 3CRCA 4JI6O 3FB6C 4I4TB 1XNQO 4LF8B 4ECXA 3E2EA 2QF7A 3I12A 5EIBD 3UO2A 5LHIA 5J2UA 3CCUV 4JYAH 2UXDH 4BR6A 3AW8A 1JR9A 2A0LA 2PY5A 4B3TB 2WLLA 4NXNH 3GWOA 5DGBA 2Q2TA 1AJPA 1UPGA 2Q7HA 4LFCB 2DPIA 3A8TA 4PDLA 4U3JB 3H0GA 1FYJA 4EB6B 3ZMSA 3JZFA 4MV8A 2E2HA 3PZPA 2E74B 4QJFB 2ZE5A 2Q0AA 1I1MA 5GONB 3D3QA 4RZRA 4PA9A 5B1BC 4DV7O 1IURA 2DWCA 1Z2GA 5I5SA 5KG4A 3GTKA 3JCZA 4BXXG 4XDKA 4LF5B 3CEIA 1BHAA 3K5HA 3RYHA 3JD4A 4K6NA 1ZSPA 1TUEB 3WB1A 1A32A 4WD3A 4Q43A 5C93A 2PI5A 3VQYA 4B3RB 4ECVA 5J2UB 4GKKH 1JDBB 5L9XA 1NBMG 2M6YA 2ZM6O 3W1BA 1FKAH 4O2BB 1JFFA 2R93G 5LOVA 2FKXA 2DOSA 3N2KA 1S10A 3S3XA 3MHSC 4YXWG 1KD1W 3RT3C 2V5AA 4JI1O 4X1KB 5D1OB 1I5XA 3SYQA 4YP3A 3SPHA 1ZTEA 2JEJA 1Y1VG 1WP8A 4UB6Z 4KP4A 2HVRA 5EWFA 2E5LB 2HG8A 2CE4A 4QNHB 2VUGA 4ED1A 4NYKA 4A3MG 5CA3A 1K5QA 3CHXA 1P8LA 4P2ZA 5KT2A 5B1NA 2J6TA 2QE7G 4B3RH 3MHHC 2E5LO 4MV1A 3RAXA 5KFWA 4MAMA 5ITZA 2RGVA 3NXSA 1N36H 2UXDO 4JYAO 4JI3B 2UUBH 4O4IA 3TY8A 5C3EG 4G27B 2CK3G 3AG3C 4O3QA 1PL4A 2FB9A 4O3OA 5IP9G 1A48A 4O4HB 1PNKA 2D2CB 3K58A 3E22A 1D5AA 2HFEC 3J80N 3CCJV 1K73W 1GSHA 3GIQA 2DWDC 1ZL8B 2WLMA 4NTXA 4AQYB 4FFOA 3T1CA 3SJCC 3HOWG 1ZLZA 5H80A 3OFNG 5KFIA 5KFVA 4ED7A 1XILA 1KP2A 1M7JA 4Q8EA 4FS2A 2EILB 1YF2A 1Y1WA 2XC9A 3PW2A 5FLXN 2UXBB 4JTCB 5KUMA 1QCEA 1BMFG 4NB5A 4B3TH 2HKOA 3DXRA 3CMAV 3FAVB 4ASUG 1FXHA 2JGDB 1FKAO 3SYOA 4MTGA 4OX9H 3FD9A 3TQ1A 5F9LA 2NN4A 5JQGB 3L72H 4DV0H 5CA1B 4JI1H 2QSAA 5DAAA 4FJCC 1Y76A 5D1PA 1D5NA 4IWXA 3SJQC 4UV9A 4J41A 5LBQA 2WAMA 3P3NA 3V6KA 4DR5B 3MR3A 4IT5A 2JK5C 3RBZA 3NUAA 5KFQA 2UUAH 2E5LH 3KKYA 3JARB 1ROPA 2E3CA 5H5NA 3HT5A 3HO8A 3RWRD 4JI2B 1CE8A 5LOVF 2JGDA 3GIPA 4TM5A 1DIKA 5LP6F 4U7CA 4CC5A 5IY5B 2EIMB 1VF5B 1S5LZ 4LFAO 2WSSG 1E4GT 4W4LA 3OTOB 4BBRG 2E75B 2WWWA 4QIWE 2X7RB 4XDLA 3QTCA 4FFBA 1SQPH 1V54B 1P7GA 5BZBA 5KS8A 2YWVA 4EQ5A 3Q8PB 4DV3B 2R72A 2HJDA 3AG7A 3F5TA 1XDCA 3B8MA 3ETJA 1AROP 1EKFA 4LF8H 1S76D 2JVDA 2VQEH 1WB7A 4H13B 5LYJB 5LA6F 1W2BU 5KAIZ 1XOUA 5LMNO 4HN2A 4MA5A 4O2AF 3K06A 3CVZA 5KT5A 1OJHA 1A0GA 2HVQA 1GRJA 3ZHTA 3AG2C 4I55F 3CB2A 3ZHVA 4YR2A 2GV9A 4BIUA 5KFFA 4A5UB 3TGUH 4CBCA 3MFHA 4DR7O 2R8JA 2QDOA 2WDTA 4A3LG 1KKCA 1Y76B 3L75H 5JVDA 3RJ0A 4M9UA 3TK1A 1N34B 2FB5A 1B6SA 4I9WA 1XL4A 3WU2Z 2ZR2A 3ZRVA 3HB3B 4YJ2A 1EZ1A 5J2TB 2KG7A 3JATA 4RAYA 4LFAH 4UV8A 2AHYA 5D5PA 5KHGA 2K9PA 4GX2A 4MV9A 2ALZA 4LNUB 5CBGA 4J10A 1VQ6V 5IY5C 3N27A 3M4IA 5JVLA 4J0MA 3B8NA 4O3SA 3KAJA 3MR6A 5KFKA 3RYHB 1Q6IA 4JV1A 1Y74A 1YXBA 5J2TA 1VQNV 3UYYA 1FJGB 1SFOA 4O3PA 4I7HA 4DRXB 2YICA 5JQGF 3CEBA 1KMIZ 4CS3A 1JA8A 1Z2NX 5CAEB 5L3DA 1WPBA 3ZCCA 1NKDA 2AQ4A 2BTQA 1KBHA 3BQ1A 4A3KG 4O4IF 4KXRA 2BR0A 2ITCC 2Q68A 4PELA 3ZS8C 2RDIA 2FLLA 5LMUH 4GLWA 2UXBO 4JGSA 2OLSA 4O7VA 1W0KG 4K0KO 5FD6A 5FNVA 3JSNA 4I55A 4GKJB 2VQFB 2Q2UA 2QWQB 2VQEB 4DR7H 3SGIA 3UT5B 4AQYO 4UFZA 1CP9A 2HDKA 1RYSA 3AEIA 4WFFA 5CBFA 1IVSA 1K34A 5H6RA 5GONF 3H9VA 5LA6A 5IWAB 1R6NA 4DV7H 2EILC 1ET0A 3QFFA 5J2TF 2BTQB 4DV4B 1K5SA 1AP6A 2ZDIC 4FLXA 1G6UA 5B3SB 4FM9A 3HXLA 3AX6A 2JS5A 2VWKA 4O7RA 4ECSA 4X65O 4DL6A 4E4EA 1G1XB 3CXCU 1GGOA 1M9NA 5KX5B 1B04A 3ASOB 2GHYA 4LNUA 5C5JA 1XQ8A 4YIOA 5LXTF 2NVYA 1IBLH 2WA4A 5KFNA 1A3GA 2W8LA 4U7OA 2W9BA 4DUZO 1C3OA 4LMYA 4B7KA 4QWAA 4EBDA 4GKKB 1M57B 1PKXA 2ADPA 1V4YA 3ETHA 2WLIA 4IIJA 3T9EA 5KG1A 1BXRA 4QW9A 3ABMC 2Z04A 3E5NA 2CQYA 2OIGA 5LL6b 1AR5A 3KCXA 5KFPA 1YZBA 1L2ZA 2ZDIA 4LR3A 3GTPA 1TVKA 3CCEV 2NR5A 3AG4B 4RQFA 1AR1B 4PZ6A 3E35A 2FLNA 1BS3A 4DXWA 1NVPB 5BWWA 2XHBA 1I2LA 2QWPB 3E8HA 1SQQH 1P7BA 1WJZA 1YI2V 1K4CC 2AXTZ 4MA0A 4LFBB 2W9CB 5EC1C 1VS0A 1VQ8V 1R3LC 4LFCH 1L1FA 2VQFO 4AQYH 3T99A 5KMGB 2XGQA 4O4LA 4HNAB 4J7JA 2YRXA 4HNTA 4QWEA 1S9FA 5KFTA 2PUSA 3QZ7A 1VARA 4FLTA 3NBZB 4MW8A 2JDIG 5HBRB 3K9SA 5EBLC 1SQBH 5LP6A 3VQWA 2RN9A 4J7ZA 2YIBA 5C1PA 5C8YF 4N23A 1Z5WA 4X64H 2R87A 1XNRO 4X66H 3U9SA 1RPRA 3MDSA 4CH5A 5FJ8G 5DLGA 2QGNA 4DV0O 1Q82W 3CSWA 3LMLA 4O2BF 4JI7O 2ZGIA 2UVRA 2QEXV 4KHPB 4K8XA 2IU0A 4JAAA 2YIAA 1AN7A 1VQ9V 5EBMC 3M9NB 1KC8W 2SCUB 4IGGA 4NR1A 4PDMA 2PMZA 4B3SH 2EZPA 5K1XA 3PW5A 3G8DA 2YDEA 1N34O 4QW8A 1CQIB 1SKVA 5L3EA 1XHXA 2PYLA 3GDEA 4IAJA 1I7NA 3HKEA 3APOA 2IMWP 4FFMA 1SESA 4UCTA 2XCLA 3JZ6A 3W5OA 1AUVA 1YIJV 1ZUQA 2YXHA 2EJ3A 3OMIB 1U96A 4UCSA 2V4DA 2WB1E 5DECA 3CJHB 1Q3EA 4D7TA 2ATLA 1MZEA 2DYSC 3C3TA 2GTSA 3JAWA 3OHBA 3KG2A 1XMQB 4DR6O 3SYAA 1BE3H 5DN6G 2V9WA 2JGUA 4I50F 2CUGA 3THOA 5CB4A 4DV3O 2Q9LA 4JV5H 4XDJA 4C5AA 4H33A 1I1KA 1CKMA 2JEGA 2P0AA 4O3RA 1FFXB 2DW4A 2FL4A 2Q4PA 4DV6H 1N56A 3T5LA 3DXRB 1UJWB 3SNOA 1ZHQA 2Y0SE 1BGYH 4O4JF 3GIIA 2NU6B 5IJ0B 4JPRA 1FD9A 4HYOA 1R1BA 2UVUA 3NR7A 4DV4O 3H1HH 4Q4CA 1I7LA 1WP7A 3D3IA 3DC6A 2JA7A 3V6JA 3BA8A 4UXNA 4D7SA 5B3SC 5GTIZ 4FM0A 5KFSA 4EBEA 3D36C 3GJXB 5K3WA 1BQZA 4X1YA 1MZBA 2Z3YA 1K9MW 5EZYF 2F95B 4O3NA 1SA0A 2EULA 1GM7A 2W9CA 3EPGA 3ZHRA 4DLKA 1JX9A 2BOBC 3W1GA 5BWRA 4EGQA 2YI9A 3IN5A 2R86A 4BIOA 1M5IA 4JI5H 1XMOO 5I60A 5JQWA 2PMZE 3J7AK 3QO5A 2W9AA 2WA3A 1XNQH 3I56V 4DUYB 2OCCB 4JV0A 5KUKA 3OMNB 4WBNF 4B3MH 3U11A 3N2GA 4DUYH 1H2LA 4I50B 4MT8A 3JRWA 3N40P 3BQ2A 4O7YA 1V9PA 1JVMA 2V1DA 1Q81W 2WPDG 5KT3A 4DV2B 1BSMA 3VQVA 5JJNB 4DYLA 4O81A 2OWOA 1NJIW 5FD5A 3FB8C 1B6QA 5BYBA 4UCOA 1V51A 3G71V 1VF6A 2VUMA 3U10A 3T2MA 5B66Z 5H9CA 1S97A 4CMFA 1NH2D 2FLPA 4Z1MG 2CTPA 4TQSA 4JI3O 4P30A 2UU9H 4R7RA 1M0TA 1C30A 2C2DA 1T36A 1R6TA 2IJKA 1DF5A 1I6UA 1BJTA 4O4LF 3K0GA 2PI4A 5BMVF 3RYIA 1GAXA 4K35A 2HHFA 4PBCA 3M9OB 4YY3H 5L1KA 4JI0H 1RSOB 4Q6GA 1XNRB 3AG2B 3RVZA 1YITV 2UXNA 3C0FB 1S0NA 4JV5B 4C2MA 1NI8A 2IU3A 2HVSA 5E25A 1EM1A 4WBNB 4JV5O 1A9XA 1P84F 5FNVB 1Y67A 3O65A 2XTAA 2EJRA 2NLJC 5KFAA 5KG6A 4QIWF 3GVMA 4GUNA 2PN1A 2ZDQA 4C5BA 5HFMA 1B33N 4FLWA 4MVSA 1IYEA 2PTMA 3IC9A 5IYDO 4JI4B 5BPHA 4GCZA 2ODTX 5CB4B 5BWTA 1SF9A 4ABMA 3K9AA 4BWAA 3ABKB 3VOTA 4MTDA 2R84A 4UCVA 2Z5UA 3X2QC 2W6ZA 2NNUA 2KSDA 5BXZA 2ZXWB 1RJQA 1PD3A 4U3JA 3ZMTA 1KKDA 4YAJB 4UCUA 1CXZB 5JJJB 4JI2O 3DTFA 4JI5B 2B5UA 5KG3A 4ZHQF 3ABTA 2CH7A 1EN5A 3MWMA 3RGZA 2R8HA 1IBMH 3QF7A 1K97A 1QLEB 4F50A 4CMDA 2P4VA 4LF4O 2JEFA 1GO3F 3B77A 4DR4H 3K0DA 4JYCA 3OE7G 1NTMH 1DF4A 2MCTA 2GUZA 1LR1A 3EFFK 2Y0SA 3FKIG 4DUYO 2YRWA 1SQFA 1JLLB 3K5LA 4FFBB 4YHHO 4O4JA 3OUUA 2B63G 1XNRH 2R92A 5KA5A 3HOZG 1GN4A 4QWBA 3UQ8A 1EBOA 1PL0A 5IJ9B 2DPJA 2BQ3A 1CPYA 3DSQA 4TQFA 1Q43A 1NTKH 4GKJH 1JCHA 3VBBA 1FFXA 3QWUA 3BHPA 4E2LA 2EBOA 4JTAB 3K5OA 4B3TO 3RFCA 3IAYA 5KHHA 1WB8A 1PPJH 1M57C 4DV5H 3CCMV 3UZBA 3SE7A 2N74A 2QWNB 4G2KA 3FFQA 2NU9B 4DR1B 2COGA 2C2EA 1EN4A 1JQ0A 2R7MA 3K03A 2MW2B 4ZHQB 1J5EH 3T9AA 1IXMA 4X20A 3PW4A 1H2GA 5HFLA 4DR1H 5L1LA 5LXTB 5LHGA 3TW6A 1M6VA 1SZTA 5I47A 4GKKO 2YSUB 2W6OA 4LH6A 4DO2A 1LNQA 3CQZA 4TQRA 1TWHA 2CTRA 4TV9B 4A3BG 4LWSB 3L2PA 2YZMA 3MFIA 3CRRA 3JD1A 2HGXA 2RJZA 3BJYA 4YHHH 4F4YA 1MZFA 1W0JG 3AK3A 3ZRWA 3J7AU 2DZDA 3ZRXA 3G6VA 1COWG 1WCMA 2KKWA 3H20A 5JJEB 3MWEA 4EKWA 1KP3A 3TCUA 3ORRA 4Q45A 4BY1G 1R3IC 2LGQA 1RJRA 5CE8A 3W7WA 4LWSA 2F1MA 3T5KA 4A3FG 5K2MA 4ZOLA 2AZ0A 3N2KB 2YZNA 2V59A 2CTQA 4DK1A 3T9CA 1P16A 2QK4A 1TGOA 5L1JA 3NBYB 1WSCA 4ZBMA 3LSUA 1H38A 2H3OA 4LSAA 2QYZA 4DAAA 1AI6A 4DV5O 1Y1VA 1GTOA 1I1LA 4B08A 3CCQV 1H2KA 2CKZB 4IYIA 5LMNH 3SJBC 3H1KH 3JD2A 2IBZH 5B1BB 4GKJO 3A0HZ 4DR4O 3CYOA 2WLJA 5KMGA 3PR4A 2A1HA 2Y69B 2A7WA 2GUZB 4O2AB 4J80A 2JJ2G 1OWTA 4O7SA 2R7ZG 2ZIMA 3EXAA 4F4LA 5DQIA 1GLVA 2ZKOA 1XNQB 4X88A 2YS8A 3ICXA 3MD0A 4FMTA 4J9MA 4DR3B 1IBKB 2W70A 2WYOA 3GTGA 5IYCO 1JKJB 3DTUB 5IYZF 2YS7A 1MOFA 1HNZB 1SYXB 4ECYA 4JI4H 4X1IA 2JA7G 1GSOA 2AGOA 5FR9A 2DAAA 1NR1A 4F4XA 1N33O 1Y4MA 1RSOA 4M7EA 1LUVA 2P06A 4PV1B 1NQTA 1V55C 2V58A 3CCRV 1W93A 3QQMA 4ZI7A 1I5YA 2GTAA 4JASA 2QA4V 4HNUA 5L3FA 3CS5A 5JUMA 2OH2A 4O2BA 2M05A 5LOVB 1AVMA 5LGTA 1Q8IA 4EYHB 1E4EB 4L1KA 2ADQB 2EJ7A 4U7NA 1AR4A 1AI5A 5JH7A 1IXBA 4JI0B 4ICGA 3KYHC 3JD3A 2VWJA 2JIZG 5C8YA 1IDSA 1KB9F 1NS1A 5I5XA 4XBFA 2ZIOA 4WFGA 4DV2O 2J6UA 2YS6A 2XAHA 1VAJA 2UVVA 3E8GA 4LF4B 3U54A 3TJTA 4HR7A 4GC6A 4RAIA 3ABUA 1RYRA 3BACA 3U55A 3CMEV 4YJ2F 5IT9W 5BR8O 1SCUB 2R82A 4JXUA 5BWVA 1TUBB 1OV9A 1M56C 1XMQH 1YEWA 2PVPA 2QTSA 2A79B 4DL4A 2B63A 2Y4UA 4ZQIA 5IYZB 1N0NA 1GYFA 2ZNIA 5FLXW 5EYPA 3U0ZA 3FB5C 4LFCO 1YHQV 2ZJTA 3UCSC 1ZQ7A 3K57A 1GH6A 4XZ3B 4FIPC 1AB3A 2XCPA 1KTAA 3LSQA 4XX0B 1N48A 1IBLO 2I87A 2XIGA 3WNZA 3LULA 2R7KA 4FBUA 3JALA 2MK3A 5KHKA 2X0SA 3OAAG 1GN3A 4X64O 1K92A 3H1LH 2DLNA 4NYEA 4QWDA 2BOCC 3CJHA 4NXNO 1AILA 2W6IG 3HBLA 3CE2A 2P7TC 3JYCA 3TY9A 1KBLA 1DLBA 3B4SA 2V4QA 4J7KA 3JRXA 4GC7A 4BWSC 4DR2O 3MAQA 1AI7A 3RGBA 4FLYA 3CC2V 5LGUA 4HZ3A 4BAYA 3L71H 1XMQO 2A3QA 3I4MG 3BAAA 1GKFA 4JI1B 3JAMW 1IBLB 4X66O 5C1OA 2JS3A 1NH2B 1ZWIC 1I94B 3H4DA 1KJ9A 3JALB 4H44B 4CH4A 4EG0A 4X1YB 1S5JA 4ED2A 2R9RB 3RBDA 1U97A 3N2GB 1EUDB 3KALA 1RM1B 2WLKA 3M99B 1H8EG 4J42A 3RV4A 2UXBH 3VA7A 2Z0AA 5KFEA 1HDJA 4K0KH 2W0FC 5LMUB 4PDRA 2HLDG 1F4MA 4MVMA 3STZC 4RNMA 1THZA 3RVYA 4DV7B 3J80W 2JA8G 1QR9A 2CFMA 2ILMA 4HNVA 4J9RA 3K3VA 5KFBA 3GTJA 4IL6Z 3TY5A 4X20B 1EZJA 1M1KW 4JZ2A 3L73H 4X62B 1N36B 2UUBB 3N44B 1M56B 4AI8A 3H3VH 3BA9A 4QPJA 3C3SA 1RK6A 5JCOC 2HR3A 4JI7B 2R85A 5L3GA 3R5FA 4LF9H 3WG7B 1BZKA 1YJ9V 4AHCA 3OT7A 1CKNA 3PW7A 3EPIA 1GSAA 2V4RA 4JUZA 2A9HA 2QM4A 4CE5A 1S68A 1VQLV 2BSKA 2C22A 4JYYA 3LQSA 3H0GG 3LDDA 1RP3B 3SPGA 3FX7A 2C35B 4J9YB 1TWFA 3HKCB 2ZCEA 2DYRB 4ZIBA 3A0RA 4PDBA 1VP7A 3TW7A 3H4BA 3OGCC 3O9OA 2JJ1G 2OYQA 4DV4H 3T4DA 2YEVB 4X64B 4HNAA 1UC9A 2CGOA 5EWGA 2ZQMA 4JI8O 1HP8A 3LNNA 3AK1A 3ZEDA 4R6ZA 4X1IB 5DGAA 2L6LA 4MV4A 1QVFU 4FS1A 2K1EA 3B2EE 1ZX3A 2Q73A 3CRQA 3WWHA 1QLEC 4IYHA 3H40A 2FTKA 2P4KA 3OHAA 2JEIA 1J95A 4J9KA 5H6QA 3ETDA 3MR5A 5I5WA 2ASLA 1YVWA 3C90A 2ZT9B 4TQDA 5FPRA 3ZN0A 5D8DA 4A93G 2YIDA 3RUPA 3OTFA 4LFBO 3BEHA 1ZL8A 4LF8O 3HKCA 2CGNA 3ABKC 3VQXA 1M0WA 5EOYA 3N8DA 1Z5VA 3N6RA 3PR5B 3HR0A 4NXMH 2HEPA 4H37A 4TUYA 1XMOB 3ZMVA 5LA6B 2X5RA 4XYLB 5ITZB 1KUQA 5CA0F 1FJGO 3T5HA 2UU9O 1WAZA 2VPSA 1EZVH 2Y0IA 2QKCA 1W59A 2B1IA 4ZKIA 3ZN1A 3T54A 3Q8SB 3CSXA 2VS0A 3OSPA 4UB8Z 4WFHA 3F8NA 4Q8FA 4ZOLB 3WG7C 4TVIA 3APQA 1DK1A 1VQMV 5KT6A 3E83A 4F4WA 2IH3C 1I94O 1WPXA 3ZHSA 4DV0B 4LF6O 2X6BA 3G6EV 4ECRA 4DL2A 1OHHG 4MV7A 1TWAA 3RB6A 1TUBA 3GIJA 2R7NA 1Y14B 3Q4HA 2EINC 2FMLA 4CZZA 4R8CA 3LDEA 5CA1A 2ZM6B 3HPLC 2O03A 5KAFZ 5A9GA 3RF2A 1SETA 4DR5H 2FYUH 3ZRSA 2Q67A 3OW2U 1EKVA 1LUWA 3M7MX 3WO0A 3FAVA 3OUZA 3GILA 4TV8A 4DL7A 4YQWA 1HR0O 3JAKA 2LQTA 3QVNA 5I5VA 5KFHA 1M93A 1Z2OX 1XDNA 3IC7A 2ODMA 2EIKC 4DW0A 4DV1H 5JWPA 4DQNA 2CNVA 3M8AA 3JATB 4DR3O 3VPDA 4OGQB 1AJQA 4Q4DA 3V6HA 2DIKA 3UKMA 4J9LA 3CX5F 4N21A 1GM8A 2UXCO 3SI8A 3LNMB 4PA4A 2IJHA 5T14A 3TETA 5CM0A 3G8CA 3LDCA 4QE9A 3RAQA 5GONA 1PNLA 4J9PA 5LMUO 1UC8A 3FMAA 3GTLA 3G6BA 4EGJA 4EBCA 2ZNJA 5KFCA 1E79G 2Y48A 3ABLB 1YSCA 4K0KB 5FNVF 4HYKA 2OCCC 4IIJF 2FPGB 2GQSA 3EYYA 2AHZA 4LF4H 1ZETA 2OIEA 2ZE7A 3BQ0A 4LF7B 3T4ZA 3Q2OA 1FVIA 5CR5A 3G6YA 3E8BA 2XUMA 3W7SA 2R7LA 1BCCH 2Y0PA 1I94H 2R93A 5DM6V 4LH7A 4LF6H 5KA6A 1HNXB 1RFYA 5GTHZ 3RN4A 4K3AA 3KTMA 3I55V 2CZGA 1Y66A 4NZMA 4F6RA 4I5SA 1QR8A 5B1OA 5IP7G 1KECA 2JEUA 2XASA 3R9RA 5L3BA 2ETNA 5KG2A 2IH1C 2GPSA 1BHBA 3J81W 5KX5F 1VQ7V 1R73A 4LBEC 2UXCB 4NXMB 5EZYB 5E79Z 2IBKA 4YJ3B 2GSMB 4EFEA 4FK5C 1BNCA 1MG1A 3ETGA 1H2SB 4BY7G 2IM9A 3K79A 4WCEV 3MR2A 3WWJA 1QNMA 4GX0A 4UVCA 1FS0G 4MVOA 1TWCA 1Q7YW 2W71A 1IBKH 3ZJZA 3CC7V 3R5HA 4B3MO 1OCCB 3K5MA 2ZXWC 4UCRA 5H2FZ 3ETQA 5I5TA 3PVXA 5C44G 5KFJA 4WHXA 4DV1O 1P4RA 2COIA 4RUFA 2QM7A 3BG5A 4FU0A 3HKZE 3GQCA 4BIZA 3KZIZ 4X62H 1XMOH 1GMGA 4DRFA 4IWYA 1MA1A 3A2FA 2PBZA 1VF6C 3Q8QB 3N6XA 2GQRA 2V7QG 2X6AA 1WNSA 2RMKB 3GB8B 2XAJA 5J2UF 1OCOB 3AG1B 4IZOA 1Q6UA 2H94A 4C7UA 5KX5A 3CXHF 2R70A 4J9NA 3HKEB 1XHZA 1VBHA 1EHIA 3OTOH 3GTQA 3K59A 1KJ8A 3KHGA 1K4DC 2QR4A 4UUJC 5CN0A 4B3RO 1FFTB 2FK2A 4F4ZA 3L4JA 1WA8A 1Y6XA 3HKDA 3CC4V 3N42B 1X4TA 2QWOB 3H1JH 3K5IA 1NU1H 2LW7A 3OR6C 4UUGA 1GM9A 2IJJA 1FAFA 4O4HA 2KSWA 5JVDF 1F23A 1G4YB 4XYMB 2PF4E 1BQ0A 3MWDA 2JRIA 1I7FA 5KFYA 5C8YB 2AZ2A 3UFXB 3EVKA 5LYJA 5IJ9A 2Q6AA 3OEHG 2VOBA 2Y69C 1OBDA 5EK0A 4FM1A 4RCNA 2WE6A 1N4CA 3RW0A 3OMAB 4MTEA 1XBLA 2LP7A 2CW8A 4OX9B 3VNNA 1IBKO 3Q8RB 1S77D 2W8KA 5CA0A 2DMXA 3VMMA 2J6SA 4R8UB 5IWAO 3U9TA 3JD0A 5FPOA 2FJZA 1T5EA 5BWXA 2QB5A 1Y74B 2HHHH 3GTOA 2HG5C 4PA3A 2NVXA 1R9TA 4EYIB 4IR1A 2B1GA 4JI7H 2R92G 4JI4O 1JMKC 3F7YC 3ZMUA 4B7EA 4TV8F 3LWBA 3P32A 2Q7DA 5KG5A 1XL6A 4NXNB 3RB3A 1S5HC 2EIJC 2N04A 4KHPO 3CD6V 3K04A 2RQ6A 5KFRA 3OR7C 4RAZA 4EEYA 3AG4C 1OCRC 4NLGA 4MS2A 5IDJA 3U0GA 5JVDB 4YB8B 1KQSU 2IW5A 2JEXA 4JI8B 1CS0A 3BPZA 4ZOLF 1SC5B 3ML0A 5D1OA 3B40A 5KFDA 3GV5B 4WF9V 3SYPA 1URFA 4UVBA 2QTOA 4ETSA 2ARHA 4JTDB 3N43B 4LP8A 5LXTA 2EIKB 1IBMB 1RPOA 3ASOC 4JI6H 4GLXA 3KHRA 1Q90D 2ZDGA 1IBMO 4IR9A 1YTFB 4J9SA 4DL5A 4A2AA 4LSXA 4CH3A 4KFMA 3VOUA 3RFRA 1NVPD 2YIBD 2DYSB 4FLVA 1M4UA 2XGPA 2KB1A 2YUAA 3R23A 3V4SA 3RYCB 4MV3A 1YJWV 2GPWA 2R8IA 1DV1A 5HNEA 3KXYT 1J5EB 3TIIA 3GTMA 1NZ6A 4LCUC 1PP9H 2Y4RA 1HNZH 3ZBHA 3PFFA 1IYDA 4FFPA 2UVWA 4FVMA 4DUZB 2Z02A 3W7TA 1KYOF 4DR3H 2AGAA 3OM3B 4OPAA 4TV9F 2DWEC 4MW3A 1H8HG 1JOYA 4L8JA 4APMA 1ULZA 2BQUA 1F51A 4AYBE 4Q0YA 2XAFA 4KL1A 1KT8A 1FXKA 2YYAA 1KU9A 4X65B 4YY3B 2QWRB 4A2BA 3GIMA 3FKSG 3SPCA 1SQVH 2UUCH 2WLIB 4RO2A 4DR1O 5JQGA 1JJ2U 2OT5A 1AUXA 2W9BB 1TWGA 1HNWH 5L1IA 4OXSA 1JPXA 3SR2C 4GZRB 1E4FT 1ENVA 1XI1A 2WAQA 4JF3A 1NTZH 2VA3A 3GB7C 5IYDG 3OEEG 3WFVA 5D5QA 5LGNA 3GLKA 2W57A 3I4NG 4O7ZA 2E76B 5BMVB 2KG7B 3RV3A 4YJ3F 4ECWA 4DR4B 4IRDA 4FBTA 1N36O 2UUBO 1MSDA 2FK1A 1QHTA 2C00A 2ZDHA 1WLEA 5BWUA 4IHJA 2PGGA 3QG5A 2IA6A 1RJPA 4O4LB 2YC0A 3RB0A 2KQXA 1I2KA 4A3CG 1FXKB 2F23A 3QO8A 3IGAC 5LHHA 2P5OA 3PN1A 5DMXA 4ED6A 3SYCA 2FK3A 1UNNC 2P90A 3L70H 4E4TA 1T3NA 4LF9B 4OX9O 3GIKA 1X9NA 1SQGA 1J5EO 3K3PA 1WCMG 3G4SV 4FFLA 2W6MA 2EJ0A 4CKBA 2HP8A 4CKCA 3WB2A 1EN6A 2ABJA 4I4TA 4LF5H 4I4TF 2DN9A 4M0JA 1N32B 4ECTA 1IX9A 5LMNB 2EJ2A 1L0LH 2P6JA 4MSWC 1T94A 4TUYF 2I80A 3STLC 1R6KA 1AJNA 3RYCA 2YL2A 3R65A 2QM8A 4O83A 2EX3A 1JXLA 1V54C 2ASDA 2JA6A 1SZXA 2W7OA 4DR2B 3R5XA 1VQ4V 2L35A 4G3IA 3HKZA 5BMVA 2F4VB 4FGRA 1OCCC 5B1AC 1FXVA 3T9FA 5HV6A 5KFLA 1HW7A 4TWKA 3RR5A 1N33B 4W4KA 1DTOA 3RB4A 2W7PA 3LUTB 4NVPA 4YJ3A 3T7AA 5CA1F 4NTWA 1R3KC 5EZYA 3H1IH 1HNWO 4A3JG 4CS2A 1K33A 4WFBV 3L4KA 1N33H 1YDXA 3LP8A 3HOUG 2VPQA 4O7TA 4JYBA 4FZ1A 5EIBC 3RYIB 1K3EA 1PV0A 4DW1A 1AI4A 4A3EG 1RM1C 2ZR3A 2VQEO 4ZI7F 3PJSK 3F7VC 4O84A 2H8PC 1B3QA 2OCHA 3KHLA 2FKLA 2UUAO 1OBGA 2EIJB 3BY6A 1MSWD 2LJ2A 4WBNA 2WLNA 4C5CA 5EYPB 3DTGA 5KFOA 2DQ3A 3QZ8A 3KHHA 3CPWU 4YHHB 1YTFD 3UM7A 2ZD9A 4RB1A 4JAUA 2XT9A 4DV5B 5C4XG 1SA0B 4ECQA 1K1QA 4F6EA 5IYZA 2YZGA 3CWBH 3ABLC 2CTWA 2ZE8A 2LFRA 1CKNB 4IHJF 3F5WC 1KJIA 4WFEA 4FPPA 2WLHA 1EYZA 4L87A 2HHHO 4B3SB 2YU9A 3HB9A 2PYJA 1H2NA 2ITDC 4FLZA 1Q86W 2EIYA 3T1YO 4FZ0A 2R9IA 1MMMA 3T1HB 2XAQA 4HBNA 4J11A 2QKAA 4PZ7A 3MJFA 2F43G 3P3PA 4TT3G 2HIXA 1I50A 1QBZA 3T9DA 2AU0A 2C28A 5IT9N 2XCAA 3OUFA 1VMGA 4RZQA 2Q7EA 5I5UA 4UVAA 4X89A 5DLFA 3H01A 3K5NA 3DF7A 3JARA 2X6CA 1N8RW 3V4ZA 1HR0B 3CCSV 4PI2A 4FFRA 2LO1A 4E6NA 1O75A 2HIVA 1QU7A 3ASNC 2WAQE 4RU9A 3HOXG 5DG7A 4X65H 5CB4F 5BR8H 4P9PA 1M90W 5CA0B 4OPHA 4PI0A 2G38A 1O9GA 2HVJC 4O7LA 5AG2A 3J81N 1ZAUA 4GX5A 5DG8A 4DR6H 1TAEA 1BGWA 4DR2H 1OCZC 4I0XA 4Q20A 3JSLA 2PZSA 5IJ0A 1OCOC 3AG1C 3FKIA 5E1AC 4CC6A 4EEQA 3T1YB 4DR5O 1PNMA 1MABG 4DV6O 2OTJV 3FB7C 4O7NA 1N32H 1ORQC 1JJOA 5DGIA 4A3GG 2YEVA 3LSSA 4GYCB 4MVRA 4K8ZA 3DAAA 3NGDA 5LP6B 4R8UA 3KREA 4LF9O 2ATKC 1GO3E 3JAWB 3CCLV 4A3IG 3L74H 5IE9A 1KJJA 4X8AA 2CNUA 1KC7A 2EZOA 2HJFC 1CKOA 2Q0OC 2YCHA 3HKBB 3B09A 1HWYA 2FPPB 2EIMC 1IZ3A 1SERA 1S0MA 4DR6B 1KUTA 4Q44A 4P9OA 4MVQA 1I3QA 1K8AW 2HGWA 1N0JA 1G2WA 2FE3A 5KFZA 2R8KA 2CAZC 4PWQA 5LL6Y 3WWIA 1EKPA 5BY1A 5DQGA 4MV6A 4CH6A 4O4JB 3CRMA 3T1YH 4CHIA 3JAMN 2UUCO 1SQXH 3TXSA 1O9HA 2XAGA 1A0IA 4FM2A 4X1KA 2BTOA 4F6RB 3IJ4A 4JI8H 4IHJB 4IIJB 1VQKV 5A2QW 2O57A 5KT4A 1SS3A 1WA8B 4MTOA 3SPJA 5L3CA 1HNWB 2R7ZA 5KG0A 1PK8A 5EWEA 2DABA 3T1HH 5EBWC 2R9AA 1QQCA 5EC2C 2HJWA 5DG9A 4IRKA 1K1SA 5EDWA 2VA2A 4DV6B 5B5EZ 4I9QA 4U6PA 3OSNA 3VPBA 5JH7B 4GX1A 1TVKB 2F66C 5K1PA 1E4EA 3TEKA 3P30A 4JI5O 3ABMB 2XOKG 4ECZA 4MVZA 4X9QA 4YR3A 1AP5A 5CMUA 2D3OW 3E22B 4YAKB 1K83A 3IG0A 2C2AA 2J9GA 1S03G 2Q69A 1QLNA
chains in the Genus database with same CATH topology
3JASA 3A2FA 4ZHQB 1J5EH 4LF8H 4X20A 3N6XA 2JVDA 4DV2H 4DR1H 1WN7A 5LXTB 2VQEH 1WNSA 5LYJB 3GB8B 3UT5A 5KX5A 4LH6A 1ZHSA 3CVZA 2HVQA 2R70A 4TV8B 3HKEB 4TV9B 1XHZA 3OTOH 2RGRA 3K59A 3CB2A 3L2PA 2GV9A 1P49A 2RJZA 4YHHH 3L4JA 2WDTA 3HKDA 5JVDA 3N42B 1X4TA 3RJ0A 1N34H 2KKWA 1N34B 5JJEB 1Q5OA 3H20A 4DRXA 4O4HA 2F1MA 4ZOLA 4YJ2A 2F4VH 3N2KB 2KSWA 3BRCA 4DK1A 5J2TB 3JATA 4RAYA 4LFAH 1P16A 1TGOA 5D5PA 1I7FA 5KHGA 3NBYB 5C8YB 2QJ1A 4MV9A 4LNUB 4X66B 1DGSA 4LSAA 1Z2PX 5LYJA 3M4IA 5IJ9A 3NC0B 4J0MA 5KHIA 2VOBA 3KAJA 4FM1A 3RYHB 4B08A 2WE6A 5J2TA 5LMNH 3SJBC 5DISC 4MTEA 5KHJA 1FJGB 2CW8A 4ZI7B 4OX9B 3VNNA 4I7HA 4DRXB 5CA0A 1KMIZ 4CS3A 1Z2NX 4I50A 1WPBA 5KMGA 2BTQA 5FPOA 1T5EA 3ZS8C 4O2AB 2HHHH 4BW9A 5LMUH 2ZIMA 1VF7A 3RGXA 4JI7H 1XNQB 5FD6A 1JMKC 3ICXA 5FNVA 4DR3B 3JSNA 4I55A 1IBKB 2VQFB 4GKJB 2WYOA 4DUZH 4I55B 2Q2UA 4NXNB 2VQEB 4DR7H 3SGIA 3BABA 3UT5B 1HNZB 1SYXB 4UFZA 2RQ6A 4JI4H 4X1IA 4RAZA 5LA6A 5IWAB 4TUYB 4DV7H 1RSOA 4M7EA 4KHPH 5JVDB 2BTQB 4DV4B 4JI8B 3BPZA 4FLXA 1G6UA 5D1OA 4FM9A 3HXLA 4ZI7A 2JS5A 2VWKA 4O2BA 4DK0A 3N41B 5LP6C 5LOVB 1Q8IA 4ETSA 5BR8B 4JI0B 5JH7A 4CS4A 5KX5B 3KYHC 1B04A 4LNUA 2VWJA 3N43B 5C8YA 1XQ8A 5LXTA 1IBMB 1HR0H 2ZIOA 1IBLH 4LF7H 4JI6H 4GLXA 4LF4B 4O2AA 3JASB 4LMYA 3HKBA 4TOIA 2UU9B 4A2AA 4LSXA 4CH3A 4GKKB 5IT9W 4IIJA 3RFRA 2YIBD 4FLVA 1M4UA 1TUBB 1XMQH 1YEWA 3RYCB 3HKDB 5LL6b 1L2ZA 3KAKA 4LR3A 5IYZB 1TVKA 3KXYT 1J5EB 2ZINA 4TV9A 4PZ6A 1JFFB 1GYFA 2ZNIA 2F93B 1HNZH 5FLXW 5EYPA 1L8DA 4AILC 3U0ZA 4X62H 2XHBA 4JI3H 4DV1B 4FVMA 4DUZB 2VQFH 4DR3H 2ZJTA 3K57A 4LFBB 4ZHQA 1VS0A 4L8JA 4APMA 4LFBH 4LFCH 1XK5A 4Q0YA 4KL1A 2Q7GA 4AQYH 5KMGB 4O4LA 2XIGA 4HNAB 1TA8A 2PUSA 1KU9A 4X65B 3JALA 4YY3B 4FLTA 3NBZB 5KHKA 4A2BA 2UUCH 2HGSA 1FJGH 4JI2H 5LP6A 3VQWA 5JQGA 2YIBA 4RB0A 3TY9A 2UUAB 1HNWH 4O4IB 4PZ8A 4EFBA 1Z5WA 4X64H 3SR2C 4BWSC 1E4FT 1XI1A 3MAQA 4X66H 2CW7A 4CH5A 3RGBA 4FLYA 3LMLA 4LFAB 5D5QA 4FLUA 4KHPB 2W57A 4K8XA 3S24A 3BAAA 5BMVB 4JI1B 4LF6B 1HNXH 4DR4B 3JAMW 1IBLB 1I94B 1QHTA 2YIAA 1AN7A 3JALB 4PHZA 2UUCB 4CH4A 4IHJA 2PGGA 4X1YB 3QG5A 1NT2B 1S5JA 4O4LB 4B3SH 3N2GB 3KALA 5K1XA 2P5OA 2UXBH 4DRFA 3PN1A 4K0KH 1SKVA 5LMUB 1XHXA 2HHHB 2PYLA 3GDEA 4IAJA 3HKEA 3RYFA 4LF9B 1X9NA 1SQGA 4UCTA 3J80W 4DV7B 3WB2A 2CFMA 4RB3C 4LF5H 4I4TA 3W5OA 5IWAH 3K3VA 4JYAB 2UXDB 3TY5A 4X20B 4UCSA 1N32B 2V4DA 5LMNB 4DR7B 4X62B 4DV3H 1N36B 2UUBB 3N44B 1Q3EA 4D7TA 3BA9A 3RYCA 3JAWA 1XMQB 2EX3A 5JCOC 4LF9H 4JI7B 2JGUA 4B3MB 4AHCA 3THOA 5JCOA 3SJAC 5CB4A 1CKNA 4DR2B 4EB6A 4JV5H 5BMVA 1CKMA 2F4VB 2ZM6H 1FFXB 2P22C 2YI8A 4JI6B 1HW7A 3RR5A 4DV6H 1N33B 2QM4A 1ZHQA 3RTXA 4RB2C 4NVPA 4YJ3A 2YXLA 5IJ0B 1S68A 5EZYA 3JAKB 1WH2A 2UXCH 4CS2A 3RYFB 3L4KA 1N33H 4YJ2B 3BA8A 4D7SA 3HKCB 2ZCEA 1SEIA 4FM0A 4ZIBA 4PDBA 3WB0A 5EIBC 3RYIB 3GJXB 2OYQA 4DV4H 4X64B 4X1YA 1MZBA 4HNAA 2F95B 3LNNA 1SA0A 3RIZA 3ZEDA 4X1IB 4I4TB 4LF8B 5EIBD 3W1GA 5J2UA 3B2EE 4JYAH 2UXDH 2YI9A 4WBNA 2PY5A 4B3TB 4NXNH 1M5IA 4JI5H 5EYPB 2Q2TA 3J7AK 4YHHB 4RB1A 1XNQH 4DV5B 4DUYB 2Q7HA 4LFCB 1SA0B 5IYZA 4TQDA 4U3JB 4B3MH 5FPRA 3U11A 4EB6B 3N2GA 1CKNB 4DUYH 4I50B 3N40P 2Q0AA 3OTFA 1V9PA 4B3SB 5GONB 3HKCA 2PYJA 4DV2B 3VQVA 4FLZA 3VQXA 1M0WA 5JJNB 5EOYA 1Z5VA 4NXMH 5FD5A 2OWOA 2HEPA 4TUYA 3T1HB 1XMOB 4LF5B 4UCOA 5LA6B 4HBNA 5ITZB 3RYHA 4PZ7A 3WB1A 3U10A 2VPSA 2HIXA 3VQYA 4B3RB 3CSXA 5J2UB 4GKKH 4RZQA 2Q7EA 2UU9H 3W1BA 3F8NA 4O2BB 1JFFA 4R7RA 4ZOLB 1M0TA 1FKAH 5LOVA 3N2KA 3K5NA 3DF7A 3JARA 4DV0B 1I6UA 1HR0B 1BJTA 4X1KB 5D1OB 4PI2A 3RYIA 4E6NA 1O75A 2HIVA 4MV7A 4YY3H 1TUBA 4X65H 5BR8H 4JI0H 2HVRA 5CA0B 4PI0A 4Q6GA 1O9GA 2ZM6B 5CA1A 1XNRB 2E5LB 2O03A 2VUGA 1ZAUA 3RF2A 3C0FB 4DR6H 1TAEA 4JV5B 1BGWA 4DR2H 4DR5H 3CHXA 1P8LA 3JSLA 3M7MX 2PZSA 2HVSA 4TV8A 5IJ0A 4WBNB 3JAKA 4B3RH 5FNVB 1M93A 1Z2OX 1XDNA 4CC6A 4EEQA 5ITZA 3T1YB 2RGVA 4DV1H 1N36H 2UUBH 4JI3B 4O4IA 4FLWA 3TY8A 3JATB 1N32H 2PTMA 1JJOA 4JI4B 4GYCB 5CB4B 4O4HB 4K8ZA 5LP6B 3K58A 3E22A 4BWAA 1D5AA 4MTDA 3JAWB 5GONA 4UCVA 4AQYB 3FMAA 3SJCC 1CKOA 2YCHA 2ZNJA 3HKBB 4U3JA 4K0KB 4UCUA 5JJJB 4DR6B 2UXBB 3EYYA 4LF4H 2FE3A 4JI5B 2CAZC 4LF7B 4B3TH 3MWMA 3RGZA 1FVIA 1IBMH 3QF7A 4OX9H 1I94H 4CH6A 5JQGB 4O4JB 4DR4H 4DV0H 5CA1B 4LH7A 3T1YH 4JI1H 4LF6H 1HNXB 2MCTA 1O9HA 1A0IA 5D1PA 4F6RA 4FM2A 4X1KA 2BTOA 4F6RB 4JI8H 4IHJB 4DR5B 4IIJB 1SQFA 5A2QW 3K5LA 4FFBB 1HNWB 2UUAH 2E5LH 4O4JA 1XNRH 3JARB 3J81W 3T1HH 3UQ8A 2E3CA 2UXCB 2R9AA 1QQCA 3RWRD 4JI2B 4NXMB 5EZYB 4YJ3B 4EFEA 5IJ9B 1H2SB 2IM9A 3DSQA 4TQFA 4DV6B 1Q43A 4CC5A 4I9QA 1IBKH 4GKJH 5JH7B 1FFXA 3QWUA 1TVKB 2F66C 5K1PA 1E4GT 3BHPA 3K5MA 3OTOB 3K5OA 4UCRA 3ETQA 3QTCA 3IAYA 5KHHA 4FFBA 4DV5H 3E22B 1S03G 4EQ5A 3IG0A 3FFQA 4DV3B 4DR1B 1XMOH 2R72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYH C;  4JYA B;  2UXD B;  1B04 A;  5D1O B;  4E6N A;  3TY5 A;  4UCS A;  1N32 B;  2HIV A;  5LMN B;  1IBM B;  4DR7 B;  4X62 B;  1N36 B;  2UUB B;  2HVR A;  3GB8 B;  4GLX A;  1XNR B;  2ZM6 B;  4LF4 B;  3BA9 A;  2E5L B;  2VUG A;  1ZAU A;  1XMQ B;  1TAE A;  4TOI A;  4LH6 A;  2UU9 B;  4JV5 B;  4JI7 B;  1P8L A;  4B3M B;  3JSL A;  2HVQ A;  2HVS A;  4GKK B;  1CKN A;  4DR2 B;  3L2P A;  1CKM A;  1XDN A;  2F4V B;  4JI6 B;  4CC6 A;  3T1Y B;  4EEQ A;  3RR5 A;  1N33 B;  4JI3 B;  3TY8 A;  3RTX A;  1J5E B;  1S68 A;  1N34 B;  4JI4 B;  4PZ6 A;  4DV1 B;  4DUZ B;  4UCV A;  4AQY B;  3BA8 A;  1CKO A;  1P16 A;  4LFB B;  3NBY B;  1VS0 A;  1HR0 B;  4K0K B;  4X66 B;  4UCU A;  3GJX B;  1DGS A;  1XK5 A;  4DR6 B;  4X64 B;  3NC0 B;  2UXB B;  1TA8 A;  4JI5 B;  5BR8 B;  4LF7 B;  4X65 B;  1FVI A;  4YY3 B;  3NBZ B;  5DIS C;  4LF8 B;  1FJG B;  4OX9 B;  3VNN A;  3W1G A;  4B3T B;  4LH7 A;  1HNX B;  2Q2T A;  3TY9 A;  4YHH B;  5FPO A;  2UUA B;  4PZ8 A;  4EFB A;  4DV5 B;  4DUY B;  4LFC B;  1A0I A;  5D1P A;  5FPR A;  4DR5 B;  4LFA B;  1CKN B;  1XNQ B;  4KHP B;  1HNW B;  4DR3 B;  3JSN A;  1IBK B;  4GKJ B;  3BAA A;  1V9P A;  4JI1 B;  2VQF B;  4JI0 B;  4LF6 B;  3S24 A;  4B3S B;  4NXN B;  4DR4 B;  1IBL B;  2VQE B;  2Q2U A;  4DV2 B;  3SGI A;  1I94 B;  1HNZ B;  3UQ8 A;  3BAB A;  2UXC B;  4NXM B;  4UFZ A;  4JI2 B;  2UUC B;  4EFE A;  2OWO A;  5IWA B;  3T1H B;  1XMO B;  4LF5 B;  4UCO A;  4DV6 B;  4CC5 A;  4PZ7 A;  3QWU A;  2HIX A;  4B3R B;  4DV4 B;  3PN1 A;  4JI8 B;  3OTO B;  4UCR A;  5LMU B;  5D1O A;  2HHH B;  3GDE A;  4LF9 B;  1X9N A;  3W1B A;  4UCT A;  4EQ5 A;  4DV7 B;  4DV0 B;  2CFM A;  4DV3 B;  3W5O A;  4DR1 B;  4DRF A; 
#chains in the Genus database with same CATH topology
 1EUC B;  3JAS A;  3K3W A;  3ZMZ A;  4Y8V B;  3GID A;  2FMA A;  2XD4 A;  4DV2 H;  3M9M B;  1WN7 A;  4PD4 F;  3JCU Z;  2YXY A;  3BFR A;  2NUA B;  3UT5 A;  2Y4T A;  1ZHS A;  4NZO A;  4TV8 B;  1DV2 A;  5F2V O;  2RGR A;  4QE7 A;  1I0H A;  5BYA A;  3T5J A;  2EIN B;  1P49 A;  4QWC A;  1GN2 A;  4NXM O;  1H2M A;  2Q5Z A;  4JZG A;  3ZX6 A;  2LFS A;  3OGI B;  3T1H O;  1N32 O;  1OCR B;  2HHF B;  1N34 H;  3ZHU A;  1XEQ A;  1Q5O A;  1VKZ A;  4DRX A;  2FP4 B;  4B3S O;  3TXQ A;  2F4V H;  4Z2W A;  3K08 A;  3BRC A;  5JH7 F;  3UO3 A;  2RCV A;  4X62 O;  4PA7 A;  1JIH A;  2QJ1 A;  4O7W A;  1E1Q G;  4X66 B;  5KKN B;  3A0B Z;  1DGS A;  3QO7 A;  1Z2P X;  3PO2 G;  1XUQ A;  3NC0 B;  5KHI A;  1B06 A;  3SPI A;  1PM9 A;  2VQD A;  4I0X B;  1VQ5 V;  3ORQ A;  5DIS C;  4RNN A;  5KHJ A;  2BQR A;  4ZI7 B;  3EHB B;  4NTY A;  2ASJ A;  3OD4 A;  2VUM G;  5IYB O;  4J9O A;  2BE3 A;  1DAA A;  3BVO A;  4FFN A;  4I50 A;  2GBO A;  5KG7 A;  2W6N A;  3QNE A;  2AGP A;  2AW9 A;  2C2R A;  3ZRW B;  2WB1 A;  4BW9 A;  1VF7 A;  3RGX A;  3GWK C;  3IFX A;  5DQH A;  4O86 A;  1KEE A;  3HOY G;  2WLL B;  4DUZ H;  4I55 B;  3E8F A;  2W6P A;  3BAB A;  4RQE A;  3KCY A;  2VRZ A;  5DED A;  1W96 A;  3GV8 B;  2AGQ A;  5TIS Z;  5KT7 A;  4Z1V A;  2IP4 A;  5J9P C;  4TUY B;  4U3F H;  1IOV A;  4I7Z B;  4KHP H;  2DYR C;  4HAM A;  1US6 A;  3ZIA G;  2E2I A;  4PDV A;  3X2Q B;  1E1R G;  1YJN V;  2W6J G;  1S3J A;  3ETE A;  4DK0 A;  3N41 B;  5LP6 C;  5BR8 B;  4CS4 A;  1I08 A;  1FPO A;  3GV7 B;  1PX2 A;  2XND G;  4GT1 A;  3TIN A;  4J9Q A;  1HR0 H;  5LYJ F;  4LF7 H;  2RDJ A;  4RUA A;  4NKG B;  2JA5 A;  1F7Y A;  4O2A A;  4JAV A;  5KFG A;  3JAS B;  3HKB A;  4TOI A;  2UU9 B;  4TSF G;  1GN6 A;  1OCZ B;  2B9Z A;  3CP1 A;  4JI0 O;  2M7W A;  1SRY A;  5KLV H;  3T9B A;  3VPC A;  3G67 A;  1V55 B;  3D36 A;  3L9D A;  2FPI B;  1X59 A;  3HKD B;  3G6X A;  3ASN B;  3BCC H;  1G8M A;  3KAK A;  2DJV A;  2GDS A;  5GW7 A;  2ZIN A;  4TV9 A;  4G28 B;  4BW5 A;  2UXX A;  1JFF B;  1YCI A;  2F93 B;  4AIL C;  1L8D A;  4J9Z B;  4JI3 H;  1D2D A;  4DV1 B;  2DQ0 A;  1VIB A;  2VQF H;  4R7C A;  3R66 A;  4D6T H;  1BL8 A;  2NU7 B;  4ZHQ A;  2RDC A;  2VR1 A;  4CKE A;  4LFB H;  4PJ0 Z;  3Q4H B;  1XK5 A;  1F4N A;  2Q7G A;  1RK5 A;  1WRV A;  1OZ0 A;  4A3D G;  3AK2 A;  1TA8 A;  2ZE6 A;  2Q8V A;  3TQT A;  1WR2 A;  2W6Q A;  2COJ A;  1BT8 A;  4NZN A;  2LGW A;  1VQO V;  2HGS A;  1FJG H;  4JI2 H;  1S0O A;  2DE0 X;  4YY3 O;  5A2Q N;  2OTL V;  4RB0 A;  2A06 H;  2YZL A;  2P67 A;  3FDS A;  5FLM G;  2I8C A;  3HOV G;  2UUA B;  4ME6 A;  4O4I B;  4PZ8 A;  4EFB A;  4RUC A;  1NR7 A;  2CW7 A;  3OTO O;  3UZO A;  1IOW A;  3S3W A;  3E86 A;  4LFA B;  4FLU A;  1S72 V;  1HNZ O;  4HQ6 A;  4BBS G;  3S24 A;  1HNX H;  1XRE A;  4LF6 B;  4H0L B;  4MTX A;  4YR0 A;  5IYB G;  1R3J C;  3PW0 A;  1CEZ A;  4LF7 O;  4ED3 A;  4PHZ A;  2UUC B;  2LW1 A;  4YBZ B;  4YIP A;  1NT2 B;  3I5D A;  2WTF A;  3AG3 B;  3G80 A;  2R8G A;  4R50 A;  1Y1W G;  1VBG A;  4DIM A;  1QVG U;  1GK9 A;  2HHH B;  4LF5 O;  1VEW A;  3RYF A;  1VQP V;  3AYH B;  5I5Y A;  4KUM A;  4RB3 C;  4JV2 A;  4MVU A;  5IWA H;  1K7D A;  3OUS A;  4JYA B;  2UXD B;  3D8C A;  4WFA V;  4DL3 A;  2IJI A;  4FFK A;  3WO1 A;  4ECU A;  1UFI A;  4QGP A;  1JDE A;  5B1A B;  1CQJ B;  4DR7 B;  4DV3 H;  1L0N H;  5CBH A;  3SDL A;  1S0V A;  2BCC H;  4RNO A;  3Q1K A;  4LC1 A;  5FL7 G;  5KFU A;  5DGH A;  4ED0 A;  2HVK C;  4QIW A;  2NU8 B;  1MNG A;  2JA5 G;  4B3M B;  5JCO A;  3SJA C;  4O82 A;  2N05 A;  2RF4 A;  2BSK B;  4EB6 A;  3RBE A;  2R6F A;  4RUE A;  3DGE A;  4AYB A;  2YW2 A;  2X0L A;  2P22 C;  4JI6 B;  2YI8 A;  4RWU A;  4PA6 A;  2ZM6 H;  2CH7 B;  5KFX A;  1B6R A;  3DC5 A;  3W7U A;  3RTX A;  4RB2 C;  2YXL A;  3CCV V;  3JAK B;  1WH2 A;  4MTF A;  3FYE B;  3JZI A;  2UXC H;  2CDY A;  3RYF B;  4O4H F;  4QSH A;  1JX4 A;  5IYC G;  4YJ2 B;  5F9N A;  1EFR G;  3E89 A;  4QPK A;  4FE2 A;  1SEI A;  3TIG A;  2W0X A;  5KFM A;  4IRC A;  3WB0 A;  3ZHQ A;  1HNX O;  2CNQ A;  2RNB A;  4QJF A;  2F4V O;  4ED8 A;  1FXK C;  3CRA A;  3PO3 G;  3FYI B;  3W7X A;  2GLT A;  2QKS A;  1KJQ A;  5BPF A;  1Q6H A;  2JA6 G;  3RIZ A;  3CRC A;  4JI6 O;  3FB6 C;  4I4T B;  1XNQ O;  4LF8 B;  4ECX A;  3E2E A;  2QF7 A;  3I12 A;  5EIB D;  3UO2 A;  5LHI A;  5J2U A;  3CCU V;  4JYA H;  2UXD H;  4BR6 A;  3AW8 A;  1JR9 A;  2A0L A;  2PY5 A;  4B3T B;  2WLL A;  4NXN H;  3GWO A;  5DGB A;  2Q2T A;  1AJP A;  1UPG A;  2Q7H A;  4LFC B;  2DPI A;  3A8T A;  4PDL A;  4U3J B;  3H0G A;  1FYJ A;  4EB6 B;  3ZMS A;  3JZF A;  4MV8 A;  2E2H A;  3PZP A;  2E74 B;  4QJF B;  2ZE5 A;  2Q0A A;  1I1M A;  5GON B;  3D3Q A;  4RZR A;  4PA9 A;  5B1B C;  4DV7 O;  1IUR A;  2DWC A;  1Z2G A;  5I5S A;  5KG4 A;  3GTK A;  3JCZ A;  4BXX G;  4XDK A;  4LF5 B;  3CEI A;  1BHA A;  3K5H A;  3RYH A;  3JD4 A;  4K6N A;  1ZSP A;  1TUE B;  3WB1 A;  1A32 A;  4WD3 A;  4Q43 A;  5C93 A;  2PI5 A;  3VQY A;  4B3R B;  4ECV A;  5J2U B;  4GKK H;  1JDB B;  5L9X A;  1NBM G;  2M6Y A;  2ZM6 O;  3W1B A;  1FKA H;  4O2B B;  1JFF A;  2R93 G;  5LOV A;  2FKX A;  2DOS A;  3N2K A;  1S10 A;  3S3X A;  3MHS C;  4YXW G;  1KD1 W;  3RT3 C;  2V5A A;  4JI1 O;  4X1K B;  5D1O B;  1I5X A;  3SYQ A;  4YP3 A;  3SPH A;  1ZTE A;  2JEJ A;  1Y1V G;  1WP8 A;  4UB6 Z;  4KP4 A;  2HVR A;  5EWF A;  2E5L B;  2HG8 A;  2CE4 A;  4QNH B;  2VUG A;  4ED1 A;  4NYK A;  4A3M G;  5CA3 A;  1K5Q A;  3CHX A;  1P8L A;  4P2Z A;  5KT2 A;  5B1N A;  2J6T A;  2QE7 G;  4B3R H;  3MHH C;  2E5L O;  4MV1 A;  3RAX A;  5KFW A;  4MAM A;  5ITZ A;  2RGV A;  3NXS A;  1N36 H;  2UXD O;  4JYA O;  4JI3 B;  2UUB H;  4O4I A;  3TY8 A;  5C3E G;  4G27 B;  2CK3 G;  3AG3 C;  4O3Q A;  1PL4 A;  2FB9 A;  4O3O A;  5IP9 G;  1A48 A;  4O4H B;  1PNK A;  2D2C B;  3K58 A;  3E22 A;  1D5A A;  2HFE C;  3J80 N;  3CCJ V;  1K73 W;  1GSH A;  3GIQ A;  2DWD C;  1ZL8 B;  2WLM A;  4NTX A;  4AQY B;  4FFO A;  3T1C A;  3SJC C;  3HOW G;  1ZLZ A;  5H80 A;  3OFN G;  5KFI A;  5KFV A;  4ED7 A;  1XIL A;  1KP2 A;  1M7J A;  4Q8E A;  4FS2 A;  2EIL B;  1YF2 A;  1Y1W A;  2XC9 A;  3PW2 A;  5FLX N;  2UXB B;  4JTC B;  5KUM A;  1QCE A;  1BMF G;  4NB5 A;  4B3T H;  2HKO A;  3DXR A;  3CMA V;  3FAV B;  4ASU G;  1FXH A;  2JGD B;  1FKA O;  3SYO A;  4MTG A;  4OX9 H;  3FD9 A;  3TQ1 A;  5F9L A;  2NN4 A;  5JQG B;  3L72 H;  4DV0 H;  5CA1 B;  4JI1 H;  2QSA A;  5DAA A;  4FJC C;  1Y76 A;  5D1P A;  1D5N A;  4IWX A;  3SJQ C;  4UV9 A;  4J41 A;  5LBQ A;  2WAM A;  3P3N A;  3V6K A;  4DR5 B;  3MR3 A;  4IT5 A;  2JK5 C;  3RBZ A;  3NUA A;  5KFQ A;  2UUA H;  2E5L H;  3KKY A;  3JAR B;  1ROP A;  2E3C A;  5H5N A;  3HT5 A;  3HO8 A;  3RWR D;  4JI2 B;  1CE8 A;  5LOV F;  2JGD A;  3GIP A;  4TM5 A;  1DIK A;  5LP6 F;  4U7C A;  4CC5 A;  5IY5 B;  2EIM B;  1VF5 B;  1S5L Z;  4LFA O;  2WSS G;  1E4G T;  4W4L A;  3OTO B;  4BBR G;  2E75 B;  2WWW A;  4QIW E;  2X7R B;  4XDL A;  3QTC A;  4FFB A;  1SQP H;  1V54 B;  1P7G A;  5BZB A;  5KS8 A;  2YWV A;  4EQ5 A;  3Q8P B;  4DV3 B;  2R72 A;  2HJD A;  3AG7 A;  3F5T A;  1XDC A;  3B8M A;  3ETJ A;  1ARO P;  1EKF A;  4LF8 H;  1S76 D;  2JVD A;  2VQE H;  1WB7 A;  4H13 B;  5LYJ B;  5LA6 F;  1W2B U;  5KAI Z;  1XOU A;  5LMN O;  4HN2 A;  4MA5 A;  4O2A F;  3K06 A;  3CVZ A;  5KT5 A;  1OJH A;  1A0G A;  2HVQ A;  1GRJ A;  3ZHT A;  3AG2 C;  4I55 F;  3CB2 A;  3ZHV A;  4YR2 A;  2GV9 A;  4BIU A;  5KFF A;  4A5U B;  3TGU H;  4CBC A;  3MFH A;  4DR7 O;  2R8J A;  2QDO A;  2WDT A;  4A3L G;  1KKC A;  1Y76 B;  3L75 H;  5JVD A;  3RJ0 A;  4M9U A;  3TK1 A;  1N34 B;  2FB5 A;  1B6S A;  4I9W A;  1XL4 A;  3WU2 Z;  2ZR2 A;  3ZRV A;  3HB3 B;  4YJ2 A;  1EZ1 A;  5J2T B;  2KG7 A;  3JAT A;  4RAY A;  4LFA H;  4UV8 A;  2AHY A;  5D5P A;  5KHG A;  2K9P A;  4GX2 A;  4MV9 A;  2ALZ A;  4LNU B;  5CBG A;  4J10 A;  1VQ6 V;  5IY5 C;  3N27 A;  3M4I A;  5JVL A;  4J0M A;  3B8N A;  4O3S A;  3KAJ A;  3MR6 A;  5KFK A;  3RYH B;  1Q6I A;  4JV1 A;  1Y74 A;  1YXB A;  5J2T A;  1VQN V;  3UYY A;  1FJG B;  1SFO A;  4O3P A;  4I7H A;  4DRX B;  2YIC A;  5JQG F;  3CEB A;  1KMI Z;  4CS3 A;  1JA8 A;  1Z2N X;  5CAE B;  5L3D A;  1WPB A;  3ZCC A;  1NKD A;  2AQ4 A;  2BTQ A;  1KBH A;  3BQ1 A;  4A3K G;  4O4I F;  4KXR A;  2BR0 A;  2ITC C;  2Q68 A;  4PEL A;  3ZS8 C;  2RDI A;  2FLL A;  5LMU H;  4GLW A;  2UXB O;  4JGS A;  2OLS A;  4O7V A;  1W0K G;  4K0K O;  5FD6 A;  5FNV A;  3JSN A;  4I55 A;  4GKJ B;  2VQF B;  2Q2U A;  2QWQ B;  2VQE B;  4DR7 H;  3SGI A;  3UT5 B;  4AQY O;  4UFZ A;  1CP9 A;  2HDK A;  1RYS A;  3AEI A;  4WFF A;  5CBF A;  1IVS A;  1K34 A;  5H6R A;  5GON F;  3H9V A;  5LA6 A;  5IWA B;  1R6N A;  4DV7 H;  2EIL C;  1ET0 A;  3QFF A;  5J2T F;  2BTQ B;  4DV4 B;  1K5S A;  1AP6 A;  2ZDI C;  4FLX A;  1G6U A;  5B3S B;  4FM9 A;  3HXL A;  3AX6 A;  2JS5 A;  2VWK A;  4O7R A;  4ECS A;  4X65 O;  4DL6 A;  4E4E A;  1G1X B;  3CXC U;  1GGO A;  1M9N A;  5KX5 B;  1B04 A;  3ASO B;  2GHY A;  4LNU A;  5C5J A;  1XQ8 A;  4YIO A;  5LXT F;  2NVY A;  1IBL H;  2WA4 A;  5KFN A;  1A3G A;  2W8L A;  4U7O A;  2W9B A;  4DUZ O;  1C3O A;  4LMY A;  4B7K A;  4QWA A;  4EBD A;  4GKK B;  1M57 B;  1PKX A;  2ADP A;  1V4Y A;  3ETH A;  2WLI A;  4IIJ A;  3T9E A;  5KG1 A;  1BXR A;  4QW9 A;  3ABM C;  2Z04 A;  3E5N A;  2CQY A;  2OIG A;  5LL6 b;  1AR5 A;  3KCX A;  5KFP A;  1YZB A;  1L2Z A;  2ZDI A;  4LR3 A;  3GTP A;  1TVK A;  3CCE V;  2NR5 A;  3AG4 B;  4RQF A;  1AR1 B;  4PZ6 A;  3E35 A;  2FLN A;  1BS3 A;  4DXW A;  1NVP B;  5BWW A;  2XHB A;  1I2L A;  2QWP B;  3E8H A;  1SQQ H;  1P7B A;  1WJZ A;  1YI2 V;  1K4C C;  2AXT Z;  4MA0 A;  4LFB B;  2W9C B;  5EC1 C;  1VS0 A;  1VQ8 V;  1R3L C;  4LFC H;  1L1F A;  2VQF O;  4AQY H;  3T99 A;  5KMG B;  2XGQ A;  4O4L A;  4HNA B;  4J7J A;  2YRX A;  4HNT A;  4QWE A;  1S9F A;  5KFT A;  2PUS A;  3QZ7 A;  1VAR A;  4FLT A;  3NBZ B;  4MW8 A;  2JDI G;  5HBR B;  3K9S A;  5EBL C;  1SQB H;  5LP6 A;  3VQW A;  2RN9 A;  4J7Z A;  2YIB A;  5C1P A;  5C8Y F;  4N23 A;  1Z5W A;  4X64 H;  2R87 A;  1XNR O;  4X66 H;  3U9S A;  1RPR A;  3MDS A;  4CH5 A;  5FJ8 G;  5DLG A;  2QGN A;  4DV0 O;  1Q82 W;  3CSW A;  3LML A;  4O2B F;  4JI7 O;  2ZGI A;  2UVR A;  2QEX V;  4KHP B;  4K8X A;  2IU0 A;  4JAA A;  2YIA A;  1AN7 A;  1VQ9 V;  5EBM C;  3M9N B;  1KC8 W;  2SCU B;  4IGG A;  4NR1 A;  4PDM A;  2PMZ A;  4B3S H;  2EZP A;  5K1X A;  3PW5 A;  3G8D A;  2YDE A;  1N34 O;  4QW8 A;  1CQI B;  1SKV A;  5L3E A;  1XHX A;  2PYL A;  3GDE A;  4IAJ A;  1I7N A;  3HKE A;  3APO A;  2IMW P;  4FFM A;  1SES A;  4UCT A;  2XCL A;  3JZ6 A;  3W5O A;  1AUV A;  1YIJ V;  1ZUQ A;  2YXH A;  2EJ3 A;  3OMI B;  1U96 A;  4UCS A;  2V4D A;  2WB1 E;  5DEC A;  3CJH B;  1Q3E A;  4D7T A;  2ATL A;  1MZE A;  2DYS C;  3C3T A;  2GTS A;  3JAW A;  3OHB A;  3KG2 A;  1XMQ B;  4DR6 O;  3SYA A;  1BE3 H;  5DN6 G;  2V9W A;  2JGU A;  4I50 F;  2CUG A;  3THO A;  5CB4 A;  4DV3 O;  2Q9L A;  4JV5 H;  4XDJ A;  4C5A A;  4H33 A;  1I1K A;  1CKM A;  2JEG A;  2P0A A;  4O3R A;  1FFX B;  2DW4 A;  2FL4 A;  2Q4P A;  4DV6 H;  1N56 A;  3T5L A;  3DXR B;  1UJW B;  3SNO A;  1ZHQ A;  2Y0S E;  1BGY H;  4O4J F;  3GII A;  2NU6 B;  5IJ0 B;  4JPR A;  1FD9 A;  4HYO A;  1R1B A;  2UVU A;  3NR7 A;  4DV4 O;  3H1H H;  4Q4C A;  1I7L A;  1WP7 A;  3D3I A;  3DC6 A;  2JA7 A;  3V6J A;  3BA8 A;  4UXN A;  4D7S A;  5B3S C;  5GTI Z;  4FM0 A;  5KFS A;  4EBE A;  3D36 C;  3GJX B;  5K3W A;  1BQZ A;  4X1Y A;  1MZB A;  2Z3Y A;  1K9M W;  5EZY F;  2F95 B;  4O3N A;  1SA0 A;  2EUL A;  1GM7 A;  2W9C A;  3EPG A;  3ZHR A;  4DLK A;  1JX9 A;  2BOB C;  3W1G A;  5BWR A;  4EGQ A;  2YI9 A;  3IN5 A;  2R86 A;  4BIO A;  1M5I A;  4JI5 H;  1XMO O;  5I60 A;  5JQW A;  2PMZ E;  3J7A K;  3QO5 A;  2W9A A;  2WA3 A;  1XNQ H;  3I56 V;  4DUY B;  2OCC B;  4JV0 A;  5KUK A;  3OMN B;  4WBN F;  4B3M H;  3U11 A;  3N2G A;  4DUY H;  1H2L A;  4I50 B;  4MT8 A;  3JRW A;  3N40 P;  3BQ2 A;  4O7Y A;  1V9P A;  1JVM A;  2V1D A;  1Q81 W;  2WPD G;  5KT3 A;  4DV2 B;  1BSM A;  3VQV A;  5JJN B;  4DYL A;  4O81 A;  2OWO A;  1NJI W;  5FD5 A;  3FB8 C;  1B6Q A;  5BYB A;  4UCO A;  1V51 A;  3G71 V;  1VF6 A;  2VUM A;  3U10 A;  3T2M A;  5B66 Z;  5H9C A;  1S97 A;  4CMF A;  1NH2 D;  2FLP A;  4Z1M G;  2CTP A;  4TQS A;  4JI3 O;  4P30 A;  2UU9 H;  4R7R A;  1M0T A;  1C30 A;  2C2D A;  1T36 A;  1R6T A;  2IJK A;  1DF5 A;  1I6U A;  1BJT A;  4O4L F;  3K0G A;  2PI4 A;  5BMV F;  3RYI A;  1GAX A;  4K35 A;  2HHF A;  4PBC A;  3M9O B;  4YY3 H;  5L1K A;  4JI0 H;  1RSO B;  4Q6G A;  1XNR B;  3AG2 B;  3RVZ A;  1YIT V;  2UXN A;  3C0F B;  1S0N A;  4JV5 B;  4C2M A;  1NI8 A;  2IU3 A;  2HVS A;  5E25 A;  1EM1 A;  4WBN B;  4JV5 O;  1A9X A;  1P84 F;  5FNV B;  1Y67 A;  3O65 A;  2XTA A;  2EJR A;  2NLJ C;  5KFA A;  5KG6 A;  4QIW F;  3GVM A;  4GUN A;  2PN1 A;  2ZDQ A;  4C5B A;  5HFM A;  1B33 N;  4FLW A;  4MVS A;  1IYE A;  2PTM A;  3IC9 A;  5IYD O;  4JI4 B;  5BPH A;  4GCZ A;  2ODT X;  5CB4 B;  5BWT A;  1SF9 A;  4ABM A;  3K9A A;  4BWA A;  3ABK B;  3VOT A;  4MTD A;  2R84 A;  4UCV A;  2Z5U A;  3X2Q C;  2W6Z A;  2NNU A;  2KSD A;  5BXZ A;  2ZXW B;  1RJQ A;  1PD3 A;  4U3J A;  3ZMT A;  1KKD A;  4YAJ B;  4UCU A;  1CXZ B;  5JJJ B;  4JI2 O;  3DTF A;  4JI5 B;  2B5U A;  5KG3 A;  4ZHQ F;  3ABT A;  2CH7 A;  1EN5 A;  3MWM A;  3RGZ A;  2R8H A;  1IBM H;  3QF7 A;  1K97 A;  1QLE B;  4F50 A;  4CMD A;  2P4V A;  4LF4 O;  2JEF A;  1GO3 F;  3B77 A;  4DR4 H;  3K0D A;  4JYC A;  3OE7 G;  1NTM H;  1DF4 A;  2MCT A;  2GUZ A;  1LR1 A;  3EFF K;  2Y0S A;  3FKI G;  4DUY O;  2YRW A;  1SQF A;  1JLL B;  3K5L A;  4FFB B;  4YHH O;  4O4J A;  3OUU A;  2B63 G;  1XNR H;  2R92 A;  5KA5 A;  3HOZ G;  1GN4 A;  4QWB A;  3UQ8 A;  1EBO A;  1PL0 A;  5IJ9 B;  2DPJ A;  2BQ3 A;  1CPY A;  3DSQ A;  4TQF A;  1Q43 A;  1NTK H;  4GKJ H;  1JCH A;  3VBB A;  1FFX A;  3QWU A;  3BHP A;  4E2L A;  2EBO A;  4JTA B;  3K5O A;  4B3T O;  3RFC A;  3IAY A;  5KHH A;  1WB8 A;  1PPJ H;  1M57 C;  4DV5 H;  3CCM V;  3UZB A;  3SE7 A;  2N74 A;  2QWN B;  4G2K A;  3FFQ A;  2NU9 B;  4DR1 B;  2COG A;  2C2E A;  1EN4 A;  1JQ0 A;  2R7M A;  3K03 A;  2MW2 B;  4ZHQ B;  1J5E H;  3T9A A;  1IXM A;  4X20 A;  3PW4 A;  1H2G A;  5HFL A;  4DR1 H;  5L1L A;  5LXT B;  5LHG A;  3TW6 A;  1M6V A;  1SZT A;  5I47 A;  4GKK O;  2YSU B;  2W6O A;  4LH6 A;  4DO2 A;  1LNQ A;  3CQZ A;  4TQR A;  1TWH A;  2CTR A;  4TV9 B;  4A3B G;  4LWS B;  3L2P A;  2YZM A;  3MFI A;  3CRR A;  3JD1 A;  2HGX A;  2RJZ A;  3BJY A;  4YHH H;  4F4Y A;  1MZF A;  1W0J G;  3AK3 A;  3ZRW A;  3J7A U;  2DZD A;  3ZRX A;  3G6V A;  1COW G;  1WCM A;  2KKW A;  3H20 A;  5JJE B;  3MWE A;  4EKW A;  1KP3 A;  3TCU A;  3ORR A;  4Q45 A;  4BY1 G;  1R3I C;  2LGQ A;  1RJR A;  5CE8 A;  3W7W A;  4LWS A;  2F1M A;  3T5K A;  4A3F G;  5K2M A;  4ZOL A;  2AZ0 A;  3N2K B;  2YZN A;  2V59 A;  2CTQ A;  4DK1 A;  3T9C A;  1P16 A;  2QK4 A;  1TGO A;  5L1J A;  3NBY B;  1WSC A;  4ZBM A;  3LSU A;  1H38 A;  2H3O A;  4LSA A;  2QYZ A;  4DAA A;  1AI6 A;  4DV5 O;  1Y1V A;  1GTO A;  1I1L A;  4B08 A;  3CCQ V;  1H2K A;  2CKZ B;  4IYI A;  5LMN H;  3SJB C;  3H1K H;  3JD2 A;  2IBZ H;  5B1B B;  4GKJ O;  3A0H Z;  4DR4 O;  3CYO A;  2WLJ A;  5KMG A;  3PR4 A;  2A1H A;  2Y69 B;  2A7W A;  2GUZ B;  4O2A B;  4J80 A;  2JJ2 G;  1OWT A;  4O7S A;  2R7Z G;  2ZIM A;  3EXA A;  4F4L A;  5DQI A;  1GLV A;  2ZKO A;  1XNQ B;  4X88 A;  2YS8 A;  3ICX A;  3MD0 A;  4FMT A;  4J9M A;  4DR3 B;  1IBK B;  2W70 A;  2WYO A;  3GTG A;  5IYC O;  1JKJ B;  3DTU B;  5IYZ F;  2YS7 A;  1MOF A;  1HNZ B;  1SYX B;  4ECY A;  4JI4 H;  4X1I A;  2JA7 G;  1GSO A;  2AGO A;  5FR9 A;  2DAA A;  1NR1 A;  4F4X A;  1N33 O;  1Y4M A;  1RSO A;  4M7E A;  1LUV A;  2P06 A;  4PV1 B;  1NQT A;  1V55 C;  2V58 A;  3CCR V;  1W93 A;  3QQM A;  4ZI7 A;  1I5Y A;  2GTA A;  4JAS A;  2QA4 V;  4HNU A;  5L3F A;  3CS5 A;  5JUM A;  2OH2 A;  4O2B A;  2M05 A;  5LOV B;  1AVM A;  5LGT A;  1Q8I A;  4EYH B;  1E4E B;  4L1K A;  2ADQ B;  2EJ7 A;  4U7N A;  1AR4 A;  1AI5 A;  5JH7 A;  1IXB A;  4JI0 B;  4ICG A;  3KYH C;  3JD3 A;  2VWJ A;  2JIZ G;  5C8Y A;  1IDS A;  1KB9 F;  1NS1 A;  5I5X A;  4XBF A;  2ZIO A;  4WFG A;  4DV2 O;  2J6U A;  2YS6 A;  2XAH A;  1VAJ A;  2UVV A;  3E8G A;  4LF4 B;  3U54 A;  3TJT A;  4HR7 A;  4GC6 A;  4RAI A;  3ABU A;  1RYR A;  3BAC A;  3U55 A;  3CME V;  4YJ2 F;  5IT9 W;  5BR8 O;  1SCU B;  2R82 A;  4JXU A;  5BWV A;  1TUB B;  1OV9 A;  1M56 C;  1XMQ H;  1YEW A;  2PVP A;  2QTS A;  2A79 B;  4DL4 A;  2B63 A;  2Y4U A;  4ZQI A;  5IYZ B;  1N0N A;  1GYF A;  2ZNI A;  5FLX W;  5EYP A;  3U0Z A;  3FB5 C;  4LFC O;  1YHQ V;  2ZJT A;  3UCS C;  1ZQ7 A;  3K57 A;  1GH6 A;  4XZ3 B;  4FIP C;  1AB3 A;  2XCP A;  1KTA A;  3LSQ A;  4XX0 B;  1N48 A;  1IBL O;  2I87 A;  2XIG A;  3WNZ A;  3LUL A;  2R7K A;  4FBU A;  3JAL A;  2MK3 A;  5KHK A;  2X0S A;  3OAA G;  1GN3 A;  4X64 O;  1K92 A;  3H1L H;  2DLN A;  4NYE A;  4QWD A;  2BOC C;  3CJH A;  4NXN O;  1AIL A;  2W6I G;  3HBL A;  3CE2 A;  2P7T C;  3JYC A;  3TY9 A;  1KBL A;  1DLB A;  3B4S A;  2V4Q A;  4J7K A;  3JRX A;  4GC7 A;  4BWS C;  4DR2 O;  3MAQ A;  1AI7 A;  3RGB A;  4FLY A;  3CC2 V;  5LGU A;  4HZ3 A;  4BAY A;  3L71 H;  1XMQ O;  2A3Q A;  3I4M G;  3BAA A;  1GKF A;  4JI1 B;  3JAM W;  1IBL B;  4X66 O;  5C1O A;  2JS3 A;  1NH2 B;  1ZWI C;  1I94 B;  3H4D A;  1KJ9 A;  3JAL B;  4H44 B;  4CH4 A;  4EG0 A;  4X1Y B;  1S5J A;  4ED2 A;  2R9R B;  3RBD A;  1U97 A;  3N2G B;  1EUD B;  3KAL A;  1RM1 B;  2WLK A;  3M99 B;  1H8E G;  4J42 A;  3RV4 A;  2UXB H;  3VA7 A;  2Z0A A;  5KFE A;  1HDJ A;  4K0K H;  2W0F C;  5LMU B;  4PDR A;  2HLD G;  1F4M A;  4MVM A;  3STZ C;  4RNM A;  1THZ A;  3RVY A;  4DV7 B;  3J80 W;  2JA8 G;  1QR9 A;  2CFM A;  2ILM A;  4HNV A;  4J9R A;  3K3V A;  5KFB A;  3GTJ A;  4IL6 Z;  3TY5 A;  4X20 B;  1EZJ A;  1M1K W;  4JZ2 A;  3L73 H;  4X62 B;  1N36 B;  2UUB B;  3N44 B;  1M56 B;  4AI8 A;  3H3V H;  3BA9 A;  4QPJ A;  3C3S A;  1RK6 A;  5JCO C;  2HR3 A;  4JI7 B;  2R85 A;  5L3G A;  3R5F A;  4LF9 H;  3WG7 B;  1BZK A;  1YJ9 V;  4AHC A;  3OT7 A;  1CKN A;  3PW7 A;  3EPI A;  1GSA A;  2V4R A;  4JUZ A;  2A9H A;  2QM4 A;  4CE5 A;  1S68 A;  1VQL V;  2BSK A;  2C22 A;  4JYY A;  3LQS A;  3H0G G;  3LDD A;  1RP3 B;  3SPG A;  3FX7 A;  2C35 B;  4J9Y B;  1TWF A;  3HKC B;  2ZCE A;  2DYR B;  4ZIB A;  3A0R A;  4PDB A;  1VP7 A;  3TW7 A;  3H4B A;  3OGC C;  3O9O A;  2JJ1 G;  2OYQ A;  4DV4 H;  3T4D A;  2YEV B;  4X64 B;  4HNA A;  1UC9 A;  2CGO A;  5EWG A;  2ZQM A;  4JI8 O;  1HP8 A;  3LNN A;  3AK1 A;  3ZED A;  4R6Z A;  4X1I B;  5DGA A;  2L6L A;  4MV4 A;  1QVF U;  4FS1 A;  2K1E A;  3B2E E;  1ZX3 A;  2Q73 A;  3CRQ A;  3WWH A;  1QLE C;  4IYH A;  3H40 A;  2FTK A;  2P4K A;  3OHA A;  2JEI A;  1J95 A;  4J9K A;  5H6Q A;  3ETD A;  3MR5 A;  5I5W A;  2ASL A;  1YVW A;  3C90 A;  2ZT9 B;  4TQD A;  5FPR A;  3ZN0 A;  5D8D A;  4A93 G;  2YID A;  3RUP A;  3OTF A;  4LFB O;  3BEH A;  1ZL8 A;  4LF8 O;  3HKC A;  2CGN A;  3ABK C;  3VQX A;  1M0W A;  5EOY A;  3N8D A;  1Z5V A;  3N6R A;  3PR5 B;  3HR0 A;  4NXM H;  2HEP A;  4H37 A;  4TUY A;  1XMO B;  3ZMV A;  5LA6 B;  2X5R A;  4XYL B;  5ITZ B;  1KUQ A;  5CA0 F;  1FJG O;  3T5H A;  2UU9 O;  1WAZ A;  2VPS A;  1EZV H;  2Y0I A;  2QKC A;  1W59 A;  2B1I A;  4ZKI A;  3ZN1 A;  3T54 A;  3Q8S B;  3CSX A;  2VS0 A;  3OSP A;  4UB8 Z;  4WFH A;  3F8N A;  4Q8F A;  4ZOL B;  3WG7 C;  4TVI A;  3APQ A;  1DK1 A;  1VQM V;  5KT6 A;  3E83 A;  4F4W A;  2IH3 C;  1I94 O;  1WPX A;  3ZHS A;  4DV0 B;  4LF6 O;  2X6B A;  3G6E V;  4ECR A;  4DL2 A;  1OHH G;  4MV7 A;  1TWA A;  3RB6 A;  1TUB A;  3GIJ A;  2R7N A;  1Y14 B;  3Q4H A;  2EIN C;  2FML A;  4CZZ A;  4R8C A;  3LDE A;  5CA1 A;  2ZM6 B;  3HPL C;  2O03 A;  5KAF Z;  5A9G A;  3RF2 A;  1SET A;  4DR5 H;  2FYU H;  3ZRS A;  2Q67 A;  3OW2 U;  1EKV A;  1LUW A;  3M7M X;  3WO0 A;  3FAV A;  3OUZ A;  3GIL A;  4TV8 A;  4DL7 A;  4YQW A;  1HR0 O;  3JAK A;  2LQT A;  3QVN A;  5I5V A;  5KFH A;  1M93 A;  1Z2O X;  1XDN A;  3IC7 A;  2ODM A;  2EIK C;  4DW0 A;  4DV1 H;  5JWP A;  4DQN A;  2CNV A;  3M8A A;  3JAT B;  4DR3 O;  3VPD A;  4OGQ B;  1AJQ A;  4Q4D A;  3V6H A;  2DIK A;  3UKM A;  4J9L A;  3CX5 F;  4N21 A;  1GM8 A;  2UXC O;  3SI8 A;  3LNM B;  4PA4 A;  2IJH A;  5T14 A;  3TET A;  5CM0 A;  3G8C A;  3LDC A;  4QE9 A;  3RAQ A;  5GON A;  1PNL A;  4J9P A;  5LMU O;  1UC8 A;  3FMA A;  3GTL A;  3G6B A;  4EGJ A;  4EBC A;  2ZNJ A;  5KFC A;  1E79 G;  2Y48 A;  3ABL B;  1YSC A;  4K0K B;  5FNV F;  4HYK A;  2OCC C;  4IIJ F;  2FPG B;  2GQS A;  3EYY A;  2AHZ A;  4LF4 H;  1ZET A;  2OIE A;  2ZE7 A;  3BQ0 A;  4LF7 B;  3T4Z A;  3Q2O A;  1FVI A;  5CR5 A;  3G6Y A;  3E8B A;  2XUM A;  3W7S A;  2R7L A;  1BCC H;  2Y0P A;  1I94 H;  2R93 A;  5DM6 V;  4LH7 A;  4LF6 H;  5KA6 A;  1HNX B;  1RFY A;  5GTH Z;  3RN4 A;  4K3A A;  3KTM A;  3I55 V;  2CZG A;  1Y66 A;  4NZM A;  4F6R A;  4I5S A;  1QR8 A;  5B1O A;  5IP7 G;  1KEC A;  2JEU A;  2XAS A;  3R9R A;  5L3B A;  2ETN A;  5KG2 A;  2IH1 C;  2GPS A;  1BHB A;  3J81 W;  5KX5 F;  1VQ7 V;  1R73 A;  4LBE C;  2UXC B;  4NXM B;  5EZY B;  5E79 Z;  2IBK A;  4YJ3 B;  2GSM B;  4EFE A;  4FK5 C;  1BNC A;  1MG1 A;  3ETG A;  1H2S B;  4BY7 G;  2IM9 A;  3K79 A;  4WCE V;  3MR2 A;  3WWJ A;  1QNM A;  4GX0 A;  4UVC A;  1FS0 G;  4MVO A;  1TWC A;  1Q7Y W;  2W71 A;  1IBK H;  3ZJZ A;  3CC7 V;  3R5H A;  4B3M O;  1OCC B;  3K5M A;  2ZXW C;  4UCR A;  5H2F Z;  3ETQ A;  5I5T A;  3PVX A;  5C44 G;  5KFJ A;  4WHX A;  4DV1 O;  1P4R A;  2COI A;  4RUF A;  2QM7 A;  3BG5 A;  4FU0 A;  3HKZ E;  3GQC A;  4BIZ A;  3KZI Z;  4X62 H;  1XMO H;  1GMG A;  4DRF A;  4IWY A;  1MA1 A;  3A2F A;  2PBZ A;  1VF6 C;  3Q8Q B;  3N6X A;  2GQR A;  2V7Q G;  2X6A A;  1WNS A;  2RMK B;  3GB8 B;  2XAJ A;  5J2U F;  1OCO B;  3AG1 B;  4IZO A;  1Q6U A;  2H94 A;  4C7U A;  5KX5 A;  3CXH F;  2R70 A;  4J9N A;  3HKE B;  1XHZ A;  1VBH A;  1EHI A;  3OTO H;  3GTQ A;  3K59 A;  1KJ8 A;  3KHG A;  1K4D C;  2QR4 A;  4UUJ C;  5CN0 A;  4B3R O;  1FFT B;  2FK2 A;  4F4Z A;  3L4J A;  1WA8 A;  1Y6X A;  3HKD A;  3CC4 V;  3N42 B;  1X4T A;  2QWO B;  3H1J H;  3K5I A;  1NU1 H;  2LW7 A;  3OR6 C;  4UUG A;  1GM9 A;  2IJJ A;  1FAF A;  4O4H A;  2KSW A;  5JVD F;  1F23 A;  1G4Y B;  4XYM B;  2PF4 E;  1BQ0 A;  3MWD A;  2JRI A;  1I7F A;  5KFY A;  5C8Y B;  2AZ2 A;  3UFX B;  3EVK A;  5LYJ A;  5IJ9 A;  2Q6A A;  3OEH G;  2VOB A;  2Y69 C;  1OBD A;  5EK0 A;  4FM1 A;  4RCN A;  2WE6 A;  1N4C A;  3RW0 A;  3OMA B;  4MTE A;  1XBL A;  2LP7 A;  2CW8 A;  4OX9 B;  3VNN A;  1IBK O;  3Q8R B;  1S77 D;  2W8K A;  5CA0 A;  2DMX A;  3VMM A;  2J6S A;  4R8U B;  5IWA O;  3U9T A;  3JD0 A;  5FPO A;  2FJZ A;  1T5E A;  5BWX A;  2QB5 A;  1Y74 B;  2HHH H;  3GTO A;  2HG5 C;  4PA3 A;  2NVX A;  1R9T A;  4EYI B;  4IR1 A;  2B1G A;  4JI7 H;  2R92 G;  4JI4 O;  1JMK C;  3F7Y C;  3ZMU A;  4B7E A;  4TV8 F;  3LWB A;  3P32 A;  2Q7D A;  5KG5 A;  1XL6 A;  4NXN B;  3RB3 A;  1S5H C;  2EIJ C;  2N04 A;  4KHP O;  3CD6 V;  3K04 A;  2RQ6 A;  5KFR A;  3OR7 C;  4RAZ A;  4EEY A;  3AG4 C;  1OCR C;  4NLG A;  4MS2 A;  5IDJ A;  3U0G A;  5JVD B;  4YB8 B;  1KQS U;  2IW5 A;  2JEX A;  4JI8 B;  1CS0 A;  3BPZ A;  4ZOL F;  1SC5 B;  3ML0 A;  5D1O A;  3B40 A;  5KFD A;  3GV5 B;  4WF9 V;  3SYP A;  1URF A;  4UVB A;  2QTO A;  4ETS A;  2ARH A;  4JTD B;  3N43 B;  4LP8 A;  5LXT A;  2EIK B;  1IBM B;  1RPO A;  3ASO C;  4JI6 H;  4GLX A;  3KHR A;  1Q90 D;  2ZDG A;  1IBM O;  4IR9 A;  1YTF B;  4J9S A;  4DL5 A;  4A2A A;  4LSX A;  4CH3 A;  4KFM A;  3VOU A;  3RFR A;  1NVP D;  2YIB D;  2DYS B;  4FLV A;  1M4U A;  2XGP A;  2KB1 A;  2YUA A;  3R23 A;  3V4S A;  3RYC B;  4MV3 A;  1YJW V;  2GPW A;  2R8I A;  1DV1 A;  5HNE A;  3KXY T;  1J5E B;  3TII A;  3GTM A;  1NZ6 A;  4LCU C;  1PP9 H;  2Y4R A;  1HNZ H;  3ZBH A;  3PFF A;  1IYD A;  4FFP A;  2UVW A;  4FVM A;  4DUZ B;  2Z02 A;  3W7T A;  1KYO F;  4DR3 H;  2AGA A;  3OM3 B;  4OPA A;  4TV9 F;  2DWE C;  4MW3 A;  1H8H G;  1JOY A;  4L8J A;  4APM A;  1ULZ A;  2BQU A;  1F51 A;  4AYB E;  4Q0Y A;  2XAF A;  4KL1 A;  1KT8 A;  1FXK A;  2YYA A;  1KU9 A;  4X65 B;  4YY3 B;  2QWR B;  4A2B A;  3GIM A;  3FKS G;  3SPC A;  1SQV H;  2UUC H;  2WLI B;  4RO2 A;  4DR1 O;  5JQG A;  1JJ2 U;  2OT5 A;  1AUX A;  2W9B B;  1TWG A;  1HNW H;  5L1I A;  4OXS A;  1JPX A;  3SR2 C;  4GZR B;  1E4F T;  1ENV A;  1XI1 A;  2WAQ A;  4JF3 A;  1NTZ H;  2VA3 A;  3GB7 C;  5IYD G;  3OEE G;  3WFV A;  5D5Q A;  5LGN A;  3GLK A;  2W57 A;  3I4N G;  4O7Z A;  2E76 B;  5BMV B;  2KG7 B;  3RV3 A;  4YJ3 F;  4ECW A;  4DR4 B;  4IRD A;  4FBT A;  1N36 O;  2UUB O;  1MSD A;  2FK1 A;  1QHT A;  2C00 A;  2ZDH A;  1WLE A;  5BWU A;  4IHJ A;  2PGG A;  3QG5 A;  2IA6 A;  1RJP A;  4O4L B;  2YC0 A;  3RB0 A;  2KQX A;  1I2K A;  4A3C G;  1FXK B;  2F23 A;  3QO8 A;  3IGA C;  5LHH A;  2P5O A;  3PN1 A;  5DMX A;  4ED6 A;  3SYC A;  2FK3 A;  1UNN C;  2P90 A;  3L70 H;  4E4T A;  1T3N A;  4LF9 B;  4OX9 O;  3GIK A;  1X9N A;  1SQG A;  1J5E O;  3K3P A;  1WCM G;  3G4S V;  4FFL A;  2W6M A;  2EJ0 A;  4CKB A;  2HP8 A;  4CKC A;  3WB2 A;  1EN6 A;  2ABJ A;  4I4T A;  4LF5 H;  4I4T F;  2DN9 A;  4M0J A;  1N32 B;  4ECT A;  1IX9 A;  5LMN B;  2EJ2 A;  1L0L H;  2P6J A;  4MSW C;  1T94 A;  4TUY F;  2I80 A;  3STL C;  1R6K A;  1AJN A;  3RYC A;  2YL2 A;  3R65 A;  2QM8 A;  4O83 A;  2EX3 A;  1JXL A;  1V54 C;  2ASD A;  2JA6 A;  1SZX A;  2W7O A;  4DR2 B;  3R5X A;  1VQ4 V;  2L35 A;  4G3I A;  3HKZ A;  5BMV A;  2F4V B;  4FGR A;  1OCC C;  5B1A C;  1FXV A;  3T9F A;  5HV6 A;  5KFL A;  1HW7 A;  4TWK A;  3RR5 A;  1N33 B;  4W4K A;  1DTO A;  3RB4 A;  2W7P A;  3LUT B;  4NVP A;  4YJ3 A;  3T7A A;  5CA1 F;  4NTW A;  1R3K C;  5EZY A;  3H1I H;  1HNW O;  4A3J G;  4CS2 A;  1K33 A;  4WFB V;  3L4K A;  1N33 H;  1YDX A;  3LP8 A;  3HOU G;  2VPQ A;  4O7T A;  4JYB A;  4FZ1 A;  5EIB C;  3RYI B;  1K3E A;  1PV0 A;  4DW1 A;  1AI4 A;  4A3E G;  1RM1 C;  2ZR3 A;  2VQE O;  4ZI7 F;  3PJS K;  3F7V C;  4O84 A;  2H8P C;  1B3Q A;  2OCH A;  3KHL A;  2FKL A;  2UUA O;  1OBG A;  2EIJ B;  3BY6 A;  1MSW D;  2LJ2 A;  4WBN A;  2WLN A;  4C5C A;  5EYP B;  3DTG A;  5KFO A;  2DQ3 A;  3QZ8 A;  3KHH A;  3CPW U;  4YHH B;  1YTF D;  3UM7 A;  2ZD9 A;  4RB1 A;  4JAU A;  2XT9 A;  4DV5 B;  5C4X G;  1SA0 B;  4ECQ A;  1K1Q A;  4F6E A;  5IYZ A;  2YZG A;  3CWB H;  3ABL C;  2CTW A;  2ZE8 A;  2LFR A;  1CKN B;  4IHJ F;  3F5W C;  1KJI A;  4WFE A;  4FPP A;  2WLH A;  1EYZ A;  4L87 A;  2HHH O;  4B3S B;  2YU9 A;  3HB9 A;  2PYJ A;  1H2N A;  2ITD C;  4FLZ A;  1Q86 W;  2EIY A;  3T1Y O;  4FZ0 A;  2R9I A;  1MMM A;  3T1H B;  2XAQ A;  4HBN A;  4J11 A;  2QKA A;  4PZ7 A;  3MJF A;  2F43 G;  3P3P A;  4TT3 G;  2HIX A;  1I50 A;  1QBZ A;  3T9D A;  2AU0 A;  2C28 A;  5IT9 N;  2XCA A;  3OUF A;  1VMG A;  4RZQ A;  2Q7E A;  5I5U A;  4UVA A;  4X89 A;  5DLF A;  3H01 A;  3K5N A;  3DF7 A;  3JAR A;  2X6C A;  1N8R W;  3V4Z A;  1HR0 B;  3CCS V;  4PI2 A;  4FFR A;  2LO1 A;  4E6N A;  1O75 A;  2HIV A;  1QU7 A;  3ASN C;  2WAQ E;  4RU9 A;  3HOX G;  5DG7 A;  4X65 H;  5CB4 F;  5BR8 H;  4P9P A;  1M90 W;  5CA0 B;  4OPH A;  4PI0 A;  2G38 A;  1O9G A;  2HVJ C;  4O7L A;  5AG2 A;  3J81 N;  1ZAU A;  4GX5 A;  5DG8 A;  4DR6 H;  1TAE A;  1BGW A;  4DR2 H;  1OCZ C;  4I0X A;  4Q20 A;  3JSL A;  2PZS A;  5IJ0 A;  1OCO C;  3AG1 C;  3FKI A;  5E1A C;  4CC6 A;  4EEQ A;  3T1Y B;  4DR5 O;  1PNM A;  1MAB G;  4DV6 O;  2OTJ V;  3FB7 C;  4O7N A;  1N32 H;  1ORQ C;  1JJO A;  5DGI A;  4A3G G;  2YEV A;  3LSS A;  4GYC B;  4MVR A;  4K8Z A;  3DAA A;  3NGD A;  5LP6 B;  4R8U A;  3KRE A;  4LF9 O;  2ATK C;  1GO3 E;  3JAW B;  3CCL V;  4A3I G;  3L74 H;  5IE9 A;  1KJJ A;  4X8A A;  2CNU A;  1KC7 A;  2EZO A;  2HJF C;  1CKO A;  2Q0O C;  2YCH A;  3HKB B;  3B09 A;  1HWY A;  2FPP B;  2EIM C;  1IZ3 A;  1SER A;  1S0M A;  4DR6 B;  1KUT A;  4Q44 A;  4P9O A;  4MVQ A;  1I3Q A;  1K8A W;  2HGW A;  1N0J A;  1G2W A;  2FE3 A;  5KFZ A;  2R8K A;  2CAZ C;  4PWQ A;  5LL6 Y;  3WWI A;  1EKP A;  5BY1 A;  5DQG A;  4MV6 A;  4CH6 A;  4O4J B;  3CRM A;  3T1Y H;  4CHI A;  3JAM N;  2UUC O;  1SQX H;  3TXS A;  1O9H A;  2XAG A;  1A0I A;  4FM2 A;  4X1K A;  2BTO A;  4F6R B;  3IJ4 A;  4JI8 H;  4IHJ B;  4IIJ B;  1VQK V;  5A2Q W;  2O57 A;  5KT4 A;  1SS3 A;  1WA8 B;  4MTO A;  3SPJ A;  5L3C A;  1HNW B;  2R7Z A;  5KG0 A;  1PK8 A;  5EWE A;  2DAB A;  3T1H H;  5EBW C;  2R9A A;  1QQC A;  5EC2 C;  2HJW A;  5DG9 A;  4IRK A;  1K1S A;  5EDW A;  2VA2 A;  4DV6 B;  5B5E Z;  4I9Q A;  4U6P A;  3OSN A;  3VPB A;  5JH7 B;  4GX1 A;  1TVK B;  2F66 C;  5K1P A;  1E4E A;  3TEK A;  3P30 A;  4JI5 O;  3ABM B;  2XOK G;  4ECZ A;  4MVZ A;  4X9Q A;  4YR3 A;  1AP5 A;  5CMU A;  2D3O W;  3E22 B;  4YAK B;  1K83 A;  3IG0 A;  2C2A A;  2J9G A;  1S03 G;  2Q69 A;  1QLN A; 
#chains in the Genus database with same CATH homology
 3JAS A;  3A2F A;  4ZHQ B;  1J5E H;  4LF8 H;  4X20 A;  3N6X A;  2JVD A;  4DV2 H;  4DR1 H;  1WN7 A;  5LXT B;  2VQE H;  1WNS A;  5LYJ B;  3GB8 B;  3UT5 A;  5KX5 A;  4LH6 A;  1ZHS A;  3CVZ A;  2HVQ A;  2R70 A;  4TV8 B;  3HKE B;  4TV9 B;  1XHZ A;  3OTO H;  2RGR A;  3K59 A;  3CB2 A;  3L2P A;  2GV9 A;  1P49 A;  2RJZ A;  4YHH H;  3L4J A;  2WDT A;  3HKD A;  5JVD A;  3N42 B;  1X4T A;  3RJ0 A;  1N34 H;  2KKW A;  1N34 B;  5JJE B;  1Q5O A;  3H20 A;  4DRX A;  4O4H A;  2F1M A;  4ZOL A;  4YJ2 A;  2F4V H;  3N2K B;  2KSW A;  3BRC A;  4DK1 A;  5J2T B;  3JAT A;  4RAY A;  4LFA H;  1P16 A;  1TGO A;  5D5P A;  1I7F A;  5KHG A;  3NBY B;  5C8Y B;  2QJ1 A;  4MV9 A;  4LNU B;  4X66 B;  1DGS A;  4LSA A;  1Z2P X;  5LYJ A;  3M4I A;  5IJ9 A;  3NC0 B;  4J0M A;  5KHI A;  2VOB A;  3KAJ A;  4FM1 A;  3RYH B;  4B08 A;  2WE6 A;  5J2T A;  5LMN H;  3SJB C;  5DIS C;  4MTE A;  5KHJ A;  1FJG B;  2CW8 A;  4ZI7 B;  4OX9 B;  3VNN A;  4I7H A;  4DRX B;  5CA0 A;  1KMI Z;  4CS3 A;  1Z2N X;  4I50 A;  1WPB A;  5KMG A;  2BTQ A;  5FPO A;  1T5E A;  3ZS8 C;  4O2A B;  2HHH H;  4BW9 A;  5LMU H;  2ZIM A;  1VF7 A;  3RGX A;  4JI7 H;  1XNQ B;  5FD6 A;  1JMK C;  3ICX A;  5FNV A;  4DR3 B;  3JSN A;  4I55 A;  1IBK B;  2VQF B;  4GKJ B;  2WYO A;  4DUZ H;  4I55 B;  2Q2U A;  4NXN B;  2VQE B;  4DR7 H;  3SGI A;  3BAB A;  3UT5 B;  1HNZ B;  1SYX B;  4UFZ A;  2RQ6 A;  4JI4 H;  4X1I A;  4RAZ A;  5LA6 A;  5IWA B;  4TUY B;  4DV7 H;  1RSO A;  4M7E A;  4KHP H;  5JVD B;  2BTQ B;  4DV4 B;  4JI8 B;  3BPZ A;  4FLX A;  1G6U A;  5D1O A;  4FM9 A;  3HXL A;  4ZI7 A;  2JS5 A;  2VWK A;  4O2B A;  4DK0 A;  3N41 B;  5LP6 C;  5LOV B;  1Q8I A;  4ETS A;  5BR8 B;  4JI0 B;  5JH7 A;  4CS4 A;  5KX5 B;  3KYH C;  1B04 A;  4LNU A;  2VWJ A;  3N43 B;  5C8Y A;  1XQ8 A;  5LXT A;  1IBM B;  1HR0 H;  2ZIO A;  1IBL H;  4LF7 H;  4JI6 H;  4GLX A;  4LF4 B;  4O2A A;  3JAS B;  4LMY A;  3HKB A;  4TOI A;  2UU9 B;  4A2A A;  4LSX A;  4CH3 A;  4GKK B;  5IT9 W;  4IIJ A;  3RFR A;  2YIB D;  4FLV A;  1M4U A;  1TUB B;  1XMQ H;  1YEW A;  3RYC B;  3HKD B;  5LL6 b;  1L2Z A;  3KAK A;  4LR3 A;  5IYZ B;  1TVK A;  3KXY T;  1J5E B;  2ZIN A;  4TV9 A;  4PZ6 A;  1JFF B;  1GYF A;  2ZNI A;  2F93 B;  1HNZ H;  5FLX W;  5EYP A;  1L8D A;  4AIL C;  3U0Z A;  4X62 H;  2XHB A;  4JI3 H;  4DV1 B;  4FVM A;  4DUZ B;  2VQF H;  4DR3 H;  2ZJT A;  3K57 A;  4LFB B;  4ZHQ A;  1VS0 A;  4L8J A;  4APM A;  4LFB H;  4LFC H;  1XK5 A;  4Q0Y A;  4KL1 A;  2Q7G A;  4AQY H;  5KMG B;  4O4L A;  2XIG A;  4HNA B;  1TA8 A;  2PUS A;  1KU9 A;  4X65 B;  3JAL A;  4YY3 B;  4FLT A;  3NBZ B;  5KHK A;  4A2B A;  2UUC H;  2HGS A;  1FJG H;  4JI2 H;  5LP6 A;  3VQW A;  5JQG A;  2YIB A;  4RB0 A;  3TY9 A;  2UUA B;  1HNW H;  4O4I B;  4PZ8 A;  4EFB A;  1Z5W A;  4X64 H;  3SR2 C;  4BWS C;  1E4F T;  1XI1 A;  3MAQ A;  4X66 H;  2CW7 A;  4CH5 A;  3RGB A;  4FLY A;  3LML A;  4LFA B;  5D5Q A;  4FLU A;  4KHP B;  2W57 A;  4K8X A;  3S24 A;  3BAA A;  5BMV B;  4JI1 B;  4LF6 B;  1HNX H;  4DR4 B;  3JAM W;  1IBL B;  1I94 B;  1QHT A;  2YIA A;  1AN7 A;  3JAL B;  4PHZ A;  2UUC B;  4CH4 A;  4IHJ A;  2PGG A;  4X1Y B;  3QG5 A;  1NT2 B;  1S5J A;  4O4L B;  4B3S H;  3N2G B;  3KAL A;  5K1X A;  2P5O A;  2UXB H;  4DRF A;  3PN1 A;  4K0K H;  1SKV A;  5LMU B;  1XHX A;  2HHH B;  2PYL A;  3GDE A;  4IAJ A;  3HKE A;  3RYF A;  4LF9 B;  1X9N A;  1SQG A;  4UCT A;  3J80 W;  4DV7 B;  3WB2 A;  2CFM A;  4RB3 C;  4LF5 H;  4I4T A;  3W5O A;  5IWA H;  3K3V A;  4JYA B;  2UXD B;  3TY5 A;  4X20 B;  4UCS A;  1N32 B;  2V4D A;  5LMN B;  4DR7 B;  4X62 B;  4DV3 H;  1N36 B;  2UUB B;  3N44 B;  1Q3E A;  4D7T A;  3BA9 A;  3RYC A;  3JAW A;  1XMQ B;  2EX3 A;  5JCO C;  4LF9 H;  4JI7 B;  2JGU A;  4B3M B;  4AHC A;  3THO A;  5JCO A;  3SJA C;  5CB4 A;  1CKN A;  4DR2 B;  4EB6 A;  4JV5 H;  5BMV A;  1CKM A;  2F4V B;  2ZM6 H;  1FFX B;  2P22 C;  2YI8 A;  4JI6 B;  1HW7 A;  3RR5 A;  4DV6 H;  1N33 B;  2QM4 A;  1ZHQ A;  3RTX A;  4RB2 C;  4NVP A;  4YJ3 A;  2YXL A;  5IJ0 B;  1S68 A;  5EZY A;  3JAK B;  1WH2 A;  2UXC H;  4CS2 A;  3RYF B;  3L4K A;  1N33 H;  4YJ2 B;  3BA8 A;  4D7S A;  3HKC B;  2ZCE A;  1SEI A;  4FM0 A;  4ZIB A;  4PDB A;  3WB0 A;  5EIB C;  3RYI B;  3GJX B;  2OYQ A;  4DV4 H;  4X64 B;  4X1Y A;  1MZB A;  4HNA A;  2F95 B;  3LNN A;  1SA0 A;  3RIZ A;  3ZED A;  4X1I B;  4I4T B;  4LF8 B;  5EIB D;  3W1G A;  5J2U A;  3B2E E;  4JYA H;  2UXD H;  2YI9 A;  4WBN A;  2PY5 A;  4B3T B;  4NXN H;  1M5I A;  4JI5 H;  5EYP B;  2Q2T A;  3J7A K;  4YHH B;  4RB1 A;  1XNQ H;  4DV5 B;  4DUY B;  2Q7H A;  4LFC B;  1SA0 B;  5IYZ A;  4TQD A;  4U3J B;  4B3M H;  5FPR A;  3U11 A;  4EB6 B;  3N2G A;  1CKN B;  4DUY H;  4I50 B;  3N40 P;  2Q0A A;  3OTF A;  1V9P A;  4B3S B;  5GON B;  3HKC A;  2PYJ A;  4DV2 B;  3VQV A;  4FLZ A;  3VQX A;  1M0W A;  5JJN B;  5EOY A;  1Z5V A;  4NXM H;  5FD5 A;  2OWO A;  2HEP A;  4TUY A;  3T1H B;  1XMO B;  4LF5 B;  4UCO A;  5LA6 B;  4HBN A;  5ITZ B;  3RYH A;  4PZ7 A;  3WB1 A;  3U10 A;  2VPS A;  2HIX A;  3VQY A;  4B3R B;  3CSX A;  5J2U B;  4GKK H;  4RZQ A;  2Q7E A;  2UU9 H;  3W1B A;  3F8N A;  4O2B B;  1JFF A;  4R7R A;  4ZOL B;  1M0T A;  1FKA H;  5LOV A;  3N2K A;  3K5N A;  3DF7 A;  3JAR A;  4DV0 B;  1I6U A;  1HR0 B;  1BJT A;  4X1K B;  5D1O B;  4PI2 A;  3RYI A;  4E6N A;  1O75 A;  2HIV A;  4MV7 A;  4YY3 H;  1TUB A;  4X65 H;  5BR8 H;  4JI0 H;  2HVR A;  5CA0 B;  4PI0 A;  4Q6G A;  1O9G A;  2ZM6 B;  5CA1 A;  1XNR B;  2E5L B;  2O03 A;  2VUG A;  1ZAU A;  3RF2 A;  3C0F B;  4DR6 H;  1TAE A;  4JV5 B;  1BGW A;  4DR2 H;  4DR5 H;  3CHX A;  1P8L A;  3JSL A;  3M7M X;  2PZS A;  2HVS A;  4TV8 A;  5IJ0 A;  4WBN B;  3JAK A;  4B3R H;  5FNV B;  1M93 A;  1Z2O X;  1XDN A;  4CC6 A;  4EEQ A;  5ITZ A;  3T1Y B;  2RGV A;  4DV1 H;  1N36 H;  2UUB H;  4JI3 B;  4O4I A;  4FLW A;  3TY8 A;  3JAT B;  1N32 H;  2PTM A;  1JJO A;  4JI4 B;  4GYC B;  5CB4 B;  4O4H B;  4K8Z A;  5LP6 B;  3K58 A;  3E22 A;  4BWA A;  1D5A A;  4MTD A;  3JAW B;  5GON A;  4UCV A;  4AQY B;  3FMA A;  3SJC C;  1CKO A;  2YCH A;  2ZNJ A;  3HKB B;  4U3J A;  4K0K B;  4UCU A;  5JJJ B;  4DR6 B;  2UXB B;  3EYY A;  4LF4 H;  2FE3 A;  4JI5 B;  2CAZ C;  4LF7 B;  4B3T H;  3MWM A;  3RGZ A;  1FVI A;  1IBM H;  3QF7 A;  4OX9 H;  1I94 H;  4CH6 A;  5JQG B;  4O4J B;  4DR4 H;  4DV0 H;  5CA1 B;  4LH7 A;  3T1Y H;  4JI1 H;  4LF6 H;  1HNX B;  2MCT A;  1O9H A;  1A0I A;  5D1P A;  4F6R A;  4FM2 A;  4X1K A;  2BTO A;  4F6R B;  4JI8 H;  4IHJ B;  4DR5 B;  4IIJ B;  1SQF A;  5A2Q W;  3K5L A;  4FFB B;  1HNW B;  2UUA H;  2E5L H;  4O4J A;  1XNR H;  3JAR B;  3J81 W;  3T1H H;  3UQ8 A;  2E3C A;  2UXC B;  2R9A A;  1QQC A;  3RWR D;  4JI2 B;  4NXM B;  5EZY B;  4YJ3 B;  4EFE A;  5IJ9 B;  1H2S B;  2IM9 A;  3DSQ A;  4TQF A;  4DV6 B;  1Q43 A;  4CC5 A;  4I9Q A;  1IBK H;  4GKJ H;  5JH7 B;  1FFX A;  3QWU A;  1TVK B;  2F66 C;  5K1P A;  1E4G T;  3BHP A;  3K5M A;  3OTO B;  3K5O A;  4UCR A;  3ETQ A;  3QTC A;  3IAY A;  5KHH A;  4FFB A;  4DV5 H;  3E22 B;  1S03 G;  4EQ5 A;  3IG0 A;  3FFQ A;  4DV3 B;  4DR1 B;  1XMO H;  2R72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...