1TAEA

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
QPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase, NAD-dependent
total genus 104
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1taeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1taeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1taeA02
2OWOA 3T1HB 4LF5B 1TAEA 3W1GA 3GDEA 5BR8B 4GKJB 1N32B 1X9NA 2HVSA 1HNWB 3NBZB 4LF8B 4UCRA 4X66B 2UUAB 4X65B 4LFCB 1DGSA 3S24A 5FPOA 2UUCB 1HNZB 4LF7B 4DUZB 4DR4B 2UXBB 1P16A 4UFZA 1VS0A 1B04A 4UCUA 1V9PA 1N34B 1IBMB 3NC0B 4UCOA 2VQFB 3TY5A 5IWAB 2ZM6B 5LMNB 1IBKB 4DRFA 4TOIA 1N36B 2UU9B 2CFMA 3VNNA 4JI2B 1HR0B 4DV5B 4UCTA 2HIVA 2E5LB 3QWUA 3L2PA 5DISC 4JI8B 2VQEB 4DV4B 1XMOB 2Q2UA 1A0IA 4B3SB 4JI6B 3T1YB 4DR6B 4DUYB 5D1OA 4B3MB 1XDNA 3GB8B 4DV6B 3JSNA 4DR5B 4E6NA 1N33B 3BABA 4AQYB 4DR3B 4YHHB 4JI0B 2HVRA 1XNQB 1XMQB 4JI7B 2UXDB 1TA8A 1CKNB 4OX9B 4KHPB 4JI3B 1HNXB 2HHHB 4LF6B 3RTXA 4EEQA 4CC5A 4DR7B 4LF9B 2UUBB 4PZ7A 1S68A 3BA9A 4GKKB 3NBYB 4X64B 2HVQA 4JI5B 3TY8A 3RR5A 4EFBA 1XNRB 1CKNA 4LFAB 3SGIA 2F4VB 1CKOA 4DV7B 3W5OA 4LH7A 1I94B 4NXMB 3BAAA 2UXCB 2Q2TA 4DV1B 3PN1A 3KYHC 1IBLB 3TY9A 4CC6A 4EQ5A 4LFBB 4PZ6A 4NXNB 3GJXB 4EFEA 3BA8A 2HIXA 4DV0B 3JSLA 4LH6A 4JI1B 4JYAB 4JI4B 1CKMA 4GLXA 4DV2B 2VUGA 4PZ8A 4DR1B 1FJGB 4YY3B 5FPRA 4K0KB 1FVIA 4B3TB 4UCSA 4DR2B 4UCVA 3UQ8A 4LF4B 1P8LA 4B3RB 5D1OB 3W1BA 5LMUB 4DV3B 1XK5A 1J5EB 4JV5B 1ZAUA 3OTOB 5D1PA 4X62B
chains in the Genus database with same CATH superfamily
2OIGA 2XGPA 3N44B 2WA4A 4LF4H 1XBLA 1KEEA 1YZBA 1M4UA 4FFKA 1KP2A 3S3XA 3OMIB 2ITDC 2QM4A 3MHHC 5KG6A 5IY5B 3M9OB 3AG3B 3UO2A 3HXLA 1M93A 2V5AA 4O2AF 1OCCC 3TXSA 3IN5A 1B04A 4FBUA 4YHHO 5BWRA 1JFFA 3TW6A 1XQ8A 4QSHA 3Q1KA 5BR8O 3AG2C 5JCOA 2VQFB 2BTQB 4QIWE 4GC6A 4O3QA 1MZFA 3O9OA 1W96A 3K08A 2R92G 1HR0B 3R9RA 3N40P 4DV5B 1SQFA 5JH7B 5DG9A 2UXBH 3FD9A 4ECUA 1NR1A 3SYAA 1A9XA 2JA7A 3Q4HB 1WA8A 4O81A 3BJYA 1S77D 4DR6B 1NTZH 1HR0O 1Y1WG 1LUVA 4Q43A 5CM0A 3R23A 5L3BA 5LGUA 1OJHA 2J6UA 3EHBB 2PVPA 1RM1C 1GM9A 1US6A 2JGUA 1IBKO 4JUZA 4CBCA 4ZOLF 3T1HH 1EN5A 1EYZA 3R5XA 1K1SA 4CKCA 1KU9A 5C44G 5CB4B 1VQOV 4BW9A 1K34A 1Q6UA 3ZMZA 1VQ4V 1JQ0A 4NZMA 5KT6A 3OEEG 1P49A 3ASNC 1ZUQA 3DTFA 4UVCA 4UUJC 1JPXA 4KL1A 5KMGB 2WYOA 2PYJA 1X4TA 1YITV 1K8AW 3GIDA 2ATLA 4NTYA 1EZJA 4DV7B 4QIWA 3F8NA 4LF8H 3OAAG 2A9HA 2V4DA 4X1IA 1K9MW 4LF5O 3N43B 3PN1A 2ZE5A 3OUZA 3MD0A 3JD0A 3VPDA 1Y67A 4M7EA 4LFBB 1G4YB 4UVBA 3J7AU 1EUDB 4MV7A 4DR4H 4OX9O 1VF6C 4RAYA 1BS3A 3H1IH 4FMTA 5T14A 2UXNA 5BMVF 4ZOLA 2DIKA 3NUAA 5L1KA 3ZRSA 2WB1A 4K6NA 4FBTA 4TWKA 4YHHH 2BQ3A 5FPRA 4PDLA 1GN6A 3G6XA 4FFOA 2E76B 2ZNJA 2DLNA 3JZFA 2H94A 1KC8W 1Q90D 5DM6V 4WBNA 1M6VA 3RB6A 3N8DA 1YTFD 4MTEA 4MVZA 1LR1A 1H38A 4J9SA 2E3CA 4FLXA 4Q0YA 2IA6A 5EWFA 3JASA 4DV3H 4PA9A 2HVSA 4MSWC 1K1QA 4HYOA 2VPQA 2IJKA 5FR9A 1M57B 3M8AA 3CRQA 3GQCA 4FGRA 4X65B 5EDWA 2VR1A 4Z1VA 4I4TB 3CCSV 2DAAA 3TK1A 1H2KA 1V51A 4HN2A 4LF7B 2CTWA 4B3SO 4UFZA 2VS0A 4U6PA 5IYZF 3ABLC 2QSAA 3FB7C 1G1XB 2EIJC 3M9NB 3DC6A 4TQSA 3H4BA 3RBEA 2GBOA 1SFOA 2ZM6B 3LNNA 3HKCA 1N36O 2HJWA 1RJPA 4UV9A 1PM9A 2FKXA 3K59A 4DV4O 5BY1A 2VQEO 1B6SA 5D5QA 5F9LA 1J5EH 4NR1A 4HYKA 5KG0A 4DUZO 2YXYA 5JQGF 4JI6B 2QWOB 4YAKB 5JWPA 4HQ6A 2ZR2A 1WCMA 2JK5C 1S0MA 1XDNA 2UXDO 3CHXA 2GTAA 2AHZA 3U0ZA 4O83A 1WAZA 2HHHO 3DC5A 4FLUA 1UFIA 4E6NA 5CBHA 2WTFA 1BE3H 1QLNA 3OT7A 2HVRA 1VF5B 5DQIA 1YHQV 2UXDB 1KP3A 1E79G 2Z5UA 3KALA 3H1KH 4TVIA 2ILMA 2HHHB 3RYCA 3KHRA 4RNOA 3AK3A 4IHJA 1AR4A 4DAAA 3PW5A 5LMUO 3FFQA 1SKVA 1KC7A 3OGCC 3TY8A 1COWG 3HPLC 2LW1A 1XNRB 2WLHA 4X1YB 2JIZG 3Q8QB 1GO3E 2X5RA 1FJGO 1NI8A 1F51A 1P7GA 3RYFA 4MA0A 2BSKB 1JFFB 2XC9A 3DXRA 3WNZA 3AG1C 2ZM6H 1IDSA 2W0FC 3VQWA 3TJTA 4X1YA 2RQ6A 3LP8A 4DUYH 2OTJV 4DR6O 5KHHA 1XHZA 5DN6G 5B3SB 4JI4B 3ZBHA 1GO3F 1M0WA 3VQVA 4YR2A 2DJVA 5IYZB 1W0JG 4CH4A 4ZKIA 3CC7V 4A3CG 4X66O 1NT2B 2AGPA 2X6AA 2R72A 2DPIA 4P9PA 2QYZA 5KFKA 2JJ2G 4KXRA 1YVWA 4Y8VB 1KUQA 1OCOB 4TUYB 5L1IA 3PZPA 4DR1H 3W7TA 2Y4RA 5I5UA 3JZ6A 3T9EA 3JCUZ 1OCZB 5L3EA 4WHXA 2YI8A 3K5LA 4A3GG 4YQWA 4DR1O 3CJHB 1QR8A 5J9PC 3RAQA 3J81N 2FMAA 5DEDA 4CH3A 2SCUB 3QO5A 1XNRH 3DTGA 4ECRA 3KKYA 4LFBO 3H9VA 3J80N 1J5EO 5BWWA 4GCZA 5KFMA 4I55B 2NU7B 3MFHA 5L1LA 3G6EV 1EZ1A 1RK5A 4UCOA 3TY5A 3JD4A 2DMXA 1IBKB 4I50A 2B1GA 4I4TA 1KJIA 4C5CA 1JJ2U 4J10A 2XCAA 3K3WA 1FKAO 3QWUA 3T5JA 4X20B 1PK8A 3GVMA 3T54A 4GLWA 2WLIA 3PVXA 1AROP 5KG3A 2J9GA 3K79A 2AGAA 1Y1WA 4J42A 3RGZA 2EILC 4RB0A 2Q5ZA 4PDBA 5JVDA 3OR7C 1GM8A 1T36A 5BR8H 1XI1A 2X0SA 3RV3A 3SPCA 1S03G 3HKBB 5C8YA 4DR3B 3STZC 1ULZA 4I55F 1DF5A 1ZSPA 3VOTA 1CQIB 5IYDG 4YXWG 4WD3A 4EEYA 5IE9A 2HVJC 2BCCH 1GM7A 2P0AA 3V6HA 4I4TF 3P3PA 3WWIA 1Y74A 3RWRD 5KFIA 4Q4DA 3SYOA 3U9SA 2YZNA 5KFYA 3P32A 3THOA 3T9BA 3GIPA 3Q8SB 2YSUB 2HP8A 2QWQB 2A0LA 4DV5H 4LH7A 3BAAA 1N34O 3TETA 4U7NA 5J2UA 1VQKV 1Q82W 2R7LA 5JVDF 2ODMA 4O7NA 3P3NA 4NYEA 2DQ0A 1Q6HA 2RMKB 2H3OA 2O57A 4JYAB 1JVMA 1XEQA 4J0MA 4PWQA 2CQYA 2XGQA 3OUFA 4MV6A 2NLJC 3JARA 4YY3O 2PYLA 4K0KO 4JI1O 4MS2A 3UQ8A 1OBGA 5KHKA 2OCCC 4MVUA 2GQRA 1H2LA 5LP6C 2IW5A 4X88A 3APQA 1QLEC 4IL6Z 4BBRG 4JYCA 1G2WA 3N6RA 5EZYB 1YJNV 5J2TF 2FK3A 1N48A 5KS8A 4DR4O 2AW9A 2FK2A 2XAGA 3H1HH 5KFSA 5H80A 2GUZB 1SQBH 2ASJA 2O03A 2EBOA 4GKJO 1Q3EA 1Q43A 2HEPA 4JI0H 1MMMA 4LF8B 1FJGH 4UUGA 4RNMA 1K3EA 3DF7A 3E22B 2ZJTA 2W9AA 4LNUB 3VMMA 1W93A 4NZNA 1WH2A 1IXMA 2B1IA 5GONA 4RCNA 2Q7DA 5FLXN 1KD1W 5H2FZ 1IYEA 2W8LA 2K1EA 3D8CA 4JI1H 1PD3A 4I7HA 3RYIA 1G8MA 1JX9A 4L8JA 2VQEB 2FMLA 1F4NA 4JV5H 1A0IA 5I5XA 2CDYA 3T1YO 1THZA 4A3EG 2Y0SA 2UUCH 4EG0A 5JJNB 5KHJA 2UXXA 3ABMB 4NXMO 3APOA 2FB9A 2Z02A 2DYRB 3B77A 4FPPA 4IYIA 2F4VH 4GKJH 1IBMH 2CTQA 4DK1A 4LFAO 1BQ0A 4HNAA 1M7JA 2F95B 1EN6A 1XNQO 5KT4A 4N23A 3I55V 1WPXA 1BGWA 3HKEB 2RDIA 5JJJB 4TV9B 2ZQMA 4JAVA 4J9NA 4A3FG 4FVMA 3AG4B 3BQ2A 1SRYA 4C5AA 5C93A 1JKJB 4WFFA 3NBYB 1VQ5V 2C2EA 4N21A 1C3OA 2NU9B 4WFBV 4IZOA 3ETEA 4AQYO 3QZ8A 5BWXA 4I9QA 5KT3A 1F7YA 1SEIA 2CUGA 1YXBA 2ADQB 2E74B 5KFBA 3KREA 2P22C 4BR6A 3SI8A 4GX1A 1BNCA 2DZDA 2UU9H 4TV8F 2FKLA 5DG7A 2P4VA 4O4LB 5BWVA 1Y6XA 2HHFB 4DR1B 3CX5F 5B1NA 4B3TB 1FPOA 2P90A 5KLVH 2B63G 2YXHA 1FXKC 1JR9A 2P6JA 3CMEV 1PV0A 3OSNA 1HNXH 2YU9A 3U10A 4QE9A 1VQ7V 4LC1A 2CNVA 3JALB 1ZQ7A 3CCUV 4F4ZA 2MW2B 3BEHA 4KFMA 3FKIA 2PY5A 3GWKC 5KFWA 2F23A 1S0NA 2DPJA 1IBKH 1DLBA 4H0LB 1AJQA 5KX5B 1L0LH 3K06A 4X1KB 4WFAV 2PMZE 3H4DA 2CE4A 2XASA 1IURA 2A79B 4NXMH 1OCRB 2R8GA 2V9WA 2QR4A 5IYBO 3N2GB 3E8BA 1DGSA 5JQGA 2VRZA 5IYBG 4LF9O 4JV5O 5K2MA 1YCIA 3SJCC 4JF3A 2UXCH 2WWWA 5ITZA 1SQPH 2YDEA 2OCCB 3G6YA 2HKOA 1E4EB 1SQGA 3G8CA 4A3DG 1P4RA 2QKAA 1PP9H 1NVPD 3RYHB 2HJDA 4D7TA 5CA1B 2JEGA 3Q4HA 4O4HB 4J9LA 4DUZH 3OM3B 5DISC 2YIBD 2PI5A 3V6KA 4IHJF 4NZOA 3FAVA 3E83A 4A2AA 2ASDA 1VIBA 3HR0A 2R7NA 2X7RB 4B3MB 3ABLB 4LFCO 3U54A 4JI7O 3WWJA 3L9DA 4DV6B 4IIJA 3MDSA 2Q8VA 1I2KA 3T9AA 5KFRA 4LF5H 5I5TA 2W7PA 4E4TA 1N0JA 3IAYA 2CW7A 3L70H 1WNSA 3T4DA 4JI7B 1UC8A 4YJ3A 1PX2A 4BXXG 4CKEA 2KG7A 4O2AB 2C2DA 2W6JG 1E1QG 1NZ6A 1M9NA 1VF7A 4GX2A 4O4JF 1Y14B 4DV3O 2QWPB 3TXQA 5IYDO 3CE2A 5B66Z 1FYJA 4DR2H 2HJFC 1WA8B 5EC2C 4MVSA 3OHAA 2HHHH 4A3IG 3TCUA 1CKOA 3QZ7A 3CQZA 5LYJB 3K5OA 3TY9A 1HNXO 5FNVB 3ZMVA 3GB7C 2QGNA 3SDLA 5BWTA 1HNZH 2COGA 2YS6A 3TIGA 4ZI7F 2BSKA 3KAJA 4LSXA 4YJ3F 2EINB 2NVXA 3JAMW 3PO3G 4DR3H 2AXTZ 4YY3B 1Q8IA 3G71V 4K0KB 4YAJB 4ED7A 1GTOA 3LNMB 3W1BA 5KMGA 1GGOA 3VBBA 2OT5A 5F9NA 1K92A 5F2VO 5L9XA 3OTOB 1O9HA 3CJHA 4PDVA 2GV9A 1ET0A 2QE7G 3ORQA 1UNNC 4JGSA 3QNEA 5EWEA 4PA7A 4QE7A 3QO8A 5IP9G 5C5JA 4JI5H 4JXUA 1H8EG 3GDEA 5BR8B 1VQPV 3FKIG 2F1MA 4EYIB 1X59A 2GHYA 5IYCG 1AI6A 1ZETA 3ZMUA 1SQQH 3LULA 3L73H 3B4SA 1ZWIC 1Y76B 3Q8PB 3M7MX 3K03A 3CD6V 2WLMA 1QVFU 4FLTA 2XAFA 1WR2A 1JX4A 4O3SA 2RDJA 4FFMA 3CSXA 4RQEA 5BZBA 2K9PA 1CEZA 4TSFG 4IRCA 4F4WA 4Q8FA 3RVZA 3UT5A 2I80A 4UB6Z 3UCSC 5CMUA 3ETGA 5EBLC 5J2TB 2IBZH 1N34H 2UXBO 4YR0A 2YUAA 3OGIB 4O84A 2YL2A 2JEJA 4X64H 3CC4V 5KA6A 2W70A 3N42B 5KT2A 2LJ2A 2X6BA 1A0GA 1Q81W 1YI2V 2E2HA 4IHJB 4DV7O 4LNUA 1IZ3A 3RYCB 1VAJA 5KFFA 1CKNB 5CN0A 4KHPB 2R9AA 3EFFK 1R73A 1HDJA 5I5WA 1IBLO 4LF6B 4QJFA 3RB4A 4LF9B 5KFOA 3GTPA 2E2IA 2QM8A 2GUZA 4PA6A 5TISZ 4O4HA 2JEUA 4C2MA 1T5EA 1CKNA 3T9CA 2YCHA 1FXHA 3AEIA 2DWEC 4QWCA 3K3PA 1S0VA 2P7TC 2CH7A 5ITZB 3ICXA 4DL7A 1QCEA 1B6QA 2YIBA 3RFCA 3HKCB 1Z2OX 2QEXV 4EYHB 4JI1B 4PBCA 2CTRA 2UUBO 2AGOA 4BY7G 2ZINA 2KKWA 1ENVA 2PGGA 2R87A 1H2GA 1TWAA 3GIQA 4QJFB 1VQLV 4ED2A 5B5EZ 4UCSA 5KG4A 2PZSA 1LNQA 4J9PA 2V58A 1S0OA 5CA0B 1GN4A 3JAMN 1FD9A 1MNGA 3A8TA 1JLLB 5LL6b 5KFEA 3K58A 1EUCB 5LOVF 4LF7O 4CH6A 2YICA 4AYBE 3MR2A 2BTQA 5JQGB 3N2KB 2W9BA 1L2ZA 2OWOA 1RSOB 1RPRA 2Q7GA 2ZM6O 1BZKA 5BMVA 4PA4A 3GTMA 4RQFA 4LF9H 5LP6A 1X9NA 1FFTB 2YZMA 1GSAA 4DR5O 3GIIA 5LA6B 4MTFA 4U3JB 1Q86W 4MVRA 3D36C 4F50A 1O9GA 2QA4V 4ASUG 4WBNF 4B3MH 4O4IA 2BE3A 2OYQA 3AX6A 5H6RA 4DV6O 1SYXB 5DQHA 3HOXG 4X62H 1W0KG 3D36A 1QBZA 4O2BF 2CKZB 2CK3G 1DIKA 3GTQA 3ABKB 3T5HA 3OHBA 4DRFA 1XMQH 1N36B 4TV9F 1VBHA 2FP4B 1IYDA 5I5YA 1YSCA 2XCLA 4JYYA 1CE8A 3IJ4A 5JCOC 2W6NA 4PELA 3J80W 5I5SA 1YF2A 3L71H 4DRXA 1W2BU 2Y69C 1NQTA 3HKEA 1I50A 3G6VA 3VA7A 4B3RH 5B1AB 4K8XA 4DR7H 4JV1A 3T1CA 3ZRWA 2YI9A 1IOVA 2JA6A 1MA1A 2B9ZA 3ZJZA 4O4IB 4OPAA 4YHHB 2LP7A 1GN2A 2VQFH 3SPGA 2Z04A 4O4IF 2W6ZA 4LCUC 4DV0O 1AB3A 3F5WC 1GLVA 1DF4A 1P7BA 1HNXB 4J9MA 2F66C 3AG4C 3D3IA 2Q0OC 4PZ7A 1OCZC 2IH1C 2D3OW 1FS0G 5LHGA 3MWMA 2L35A 2C28A 5KHGA 3WWHA 4BIZA 3BQ0A 2B63A 1Z2PX 2EIYA 2WA3A 1EKVA 2ETNA 1N33O 2ZE7A 3L72H 3CC2V 3A0RA 2UXCB 5KFCA 3HOZG 2RN9A 4DL5A 5JH7A 1S97A 3RB3A 4W4KA 3FKSG 2EIKC 2KSDA 1M56B 4WBNB 3PW0A 1XL4A 4E4EA 5CA1A 2WAQE 5IWAH 3SE7A 3IC7A 4O4JB 4YIPA 3ZIAG 1VQ6V 5DGIA 1V54C 4NYKA 4AILC 2B5UA 2VWKA 2ODTX 2EJ7A 1J5EB 3OTOO 2GTSA 3E8GA 3OEHG 2W6IG 5DGAA 4DV5O 4NXNO 2E5LO 5IT9N 2EIMB 4YBZB 4MTDA 3B8MA 5IDJA 4LF5B 4DV6H 1CPYA 3OMAB 1TAEA 2W6PA 2FLLA 1R6TA 1NU1H 2E75B 5LXTA 3CSWA 3BPZA 2E5LH 3R66A 4QGPA 2YEVA 1AR1B 1KKCA 3GLKA 4FZ0A 2ZXWB 5K1XA 1E4EA 1RPOA 1NH2B 5J2UB 5FPOA 1AJPA 3GV8B 1ZL8B 3J81W 2YXLA 1HNZB 2EJ0A 5CA1F 3HOUG 1TWGA 3P30A 4JYAO 3ZHSA 5L3FA 2DYSB 5KG2A 3CCLV 4FLWA 1ZHSA 5BYBA 1I2LA 1GYFA 2JS3A 2XD4A 2Z3YA 3VNNA 5BYAA 1DK1A 4RAIA 1HNWO 1EFRG 4R8CA 3L2PA 2HDKA 2R7KA 2YRWA 4O86A 4J7KA 2NNUA 3UT5B 4DYLA 2Q73A 4X1KA 1Q5OA 4YIOA 4KHPH 3BHPA 2JA8G 4FFNA 3CRRA 3T9FA 4O82A 2N05A 2VUMG 4DV2H 4F4YA 3GTKA 5KFUA 3OSPA 2KB1A 3RIZA 4TM5A 2HG8A 2ZIMA 1KJQA 5KAFZ 2C2AA 3HB3B 1GRJA 2UVUA 2A1HA 5D5PA 3A2FA 4JI6H 4LFBH 1I6UA 3JCZA 2W71A 4RZRA 3FYIB 3QVNA 4BIOA 4I50B 2W0XA 1S68A 1ZL8A 2PUSA 1DV1A 1Q6IA 2XTAA 4JPRA 3IGAC 1GMGA 1WJZA 2OH2A 3SJQC 4I55A 5I60A 2A06H 3X2QB 3CCQV 2ZT9B 3K5NA 1RK6A 4K35A 2JA5G 3AK1A 1GH6A 1KQSU 1I7LA 5KFQA 4A3JG 4RU9A 4CS2A 3AYHB 5DG8A 5E1AC 1XREA 4HR7A 4DR6H 1ZX3A 1R9TA 4B3MO 3B8NA 5KG1A 4HNAB 1VBGA 5J2UF 4LF6H 2W6OA 2HG5C 3BG5A 4H33A 5LOVB 1SZTA 1XL6A 2I87A 2R7ZG 4IRKA 1YTFB 4XZ3B 3KCXA 2DN9A 2EJRA 1L1FA 5L3GA 5IY5C 1GSHA 3ASOC 1DV2A 1NVPB 1PNLA 2BTOA 2BOCC 3LSUA 4JTDB 3K5MA 1Z2NX 1AI5A 4UCRA 3T1HO 4LF4O 2EIMC 3OTOH 4FS1A 2W8KA 1CS0A 1YEWA 1WP7A 2Q9LA 1SZXA 3CEBA 4XDJA 4Z1MG 4F6RA 4Q8EA 2LFRA 2JS5A 3MWEA 5J2TA 1V55C 4H44B 4ZHQF 1F4MA 5GW7A 4NTXA 4PI0A 3WO1A 5DGBA 2H8PC 2W6QA 3G67A 3A0BZ 3E8FA 2COJA 4EBDA 1JOYA 1S5JA 5DMXA 2UXDH 2FLPA 2YW2A 4B3TO 2UVRA 3CCEV 2WPDG 1IOWA 2HIVA 4CMDA 1SA0A 3CXHF 3GWOA 3T4ZA 5KUKA 4F4XA 4JTCB 3ZN0A 3MR5A 2R8KA 5FL7G 1SERA 4RB2C 5H9CA 4QIWF 4UB8Z 4JASA 4ZHQB 4RUFA 2A7WA 2RCVA 2XAHA 3BQ1A 1ORQC 1XHXA 2DQ3A 4DL2A 5IT9W 1N0NA 3C90A 3CRCA 3S3WA 2IP4A 1N33B 5KUMA 2VWJA 4J7JA 1WB7A 4JI4O 1XNQB 4J9OA 2NN4A 4ABMA 4MV3A 2ZD9A 3LSSA 4PI2A 4LMYA 2LFSA 4A5UB 4YJ2B 2GDSA 4JI4H 2WAMA 4CS4A 3RJ0A 2BQUA 4XX0B 4O7YA 2QB5A 2FLNA 3F5TA 4EFBA 1EBOA 5A2QN 2GQSA 5C1PA 5EOYA 3L75H 1I94B 3JAWA 3OR6C 4G27B 1A48A 2PF4E 3PR4A 1BCCH 1S5HC 1G6UA 5JVDB 1RM1B 2OTLV 3KYHC 1EHIA 1R3IC 1WP8A 4CC6A 5IWAO 2UUCO 1F23A 2ZCEA 3GJXB 1OV9A 5L3CA 4WFEA 5HBRB 1HR0H 3JZIA 4KHPO 1BMFG 4GLXA 3RB0A 3OFNG 4GUNA 5LP6F 3JD3A 3OD4A 3K0GA 3BCCH 1AILA 1K33A 3G6BA 3GTJA 2EIKB 1H2MA 1N36H 4FM1A 1H2SB 4EB6A 4MV9A 4GYCB 4BIUA 3O65A 3BFRA 1KBLA 2QK4A 3H3VH 4JI8H 4JV5B 3T9DA 1LUWA 2QF7A 4M9UA 3CXCU 4ECWA 1XOUA 4JI2O 5CE8A 3HO8A 4MW8A 4QNHB 4RO2A 1VEWA 3IG0A 2XCPA 4EBCA 1EZVH 1HNWB 2RF4A 1RFYA 1URFA 4IYHA 4ECXA 2ABJA 1EKPA 2LGWA 5IYCO 2ZDIA 2YS8A 5E25A 3RT3C 3QO7A 2WLLA 4TV8B 2XAQA 2M6YA 1QLEB 4DUZB 3HT5A 5KFZA 1SCUB 2JEIA 2YIDA 4X1IB 4FLVA 3BACA 5IWAB 4MT8A 3PR5B 1BGYH 2UU9B 4X9QA 3VQXA 4R7RA 3VOUA 3ZRWB 2QWNB 5CB4A 5KFTA 4LR3A 2QM7A 4J11A 4ZOLB 2GPWA 1Y76A 2NUAB 4MTOA 4DV2O 3GILA 1HP8A 4WCEV 2HLDG 1BL8A 2M7WA 2C35B 1I1KA 3UM7A 5FLMG 5D1OA 4P30A 4IT5A 3EYYA 1WLEA 3N2GA 3H1LH 3ORRA 4RB1A 1TWHA 3ZHUA 1AP5A 3ASNB 1TA8A 2R92A 5JH7F 2NR5A 5IYZA 3W7XA 2Q6AA 2WLJA 4EGJA 1SA0B 4CC5A 2Q7HA 4FK5C 4DLKA 5KFPA 4Q44A 3I56V 1VP7A 3QQMA 1N32H 1RP3B 2V1DA 2NU8B 3TQTA 4JZ2A 1ZHQA 2HVQA 3C0FB 3RR5A 5K1PA 4IIJF 3J7AK 2IU3A 4LWSB 4LF7H 4JI2H 5EZYA 4YJ2F 2XIGA 1WSCA 2AZ2A 4NXMB 2HHFA 2CW8A 2Y0SE 2YYAA 4AHCA 3M9MB 3UO3A 3EPGA 4EQ5A 3L4JA 4DV4H 5C3EG 3KTMA 1TWCA 1L0NH 3U11A 4R50A 1BHAA 2HIXA 4DV0B 2AU0A 2JRIA 1S72V 2QKSA 1HW7A 2R7ZA 1JJOA 2QTOA 4BWSC 5KAIZ 2Y4TA 1JA8A 1Z2GA 5KT5A 5BWUA 5LMNH 4UCVA 2W57A 1R3JC 3RBZA 2R86A 1JIHA 1VF6A 5EYPB 5AG2A 4ECYA 5KFXA 4PD4F 4I50F 1OZ0A 3Q8RB 3AW8A 3MJFA 3CB2A 5D1PA 1MZBA 3JD2A 4K8ZA 2ITCC 3RF2A 4U7CA 5EZYF 1M0TA 3SPIA 2W6MA 4J80A 1SF9A 5D8DA 1GSOA 2KSWA 1N32B 4D6TH 1MSDA 2VOBA 4A3LG 1AI4A 2UUAB 3VPCA 4B3RO 1UC9A 5KKNB 4AYBA 2AGQA 3RV4A 4J9ZB 1JXLA 1GAXA 5BPHA 3PW4A 2HGWA 3DAAA 4Z2WA 5LP6B 5B1AC 1SETA 4ED1A 1RJQA 1EN4A 2FE3A 1IBMB 3LSQA 2W9CA 3TIIA 4TQFA 4F4LA 4TOIA 2RNBA 2CFMA 1WN7A 2HFEC 2FK1A 2CZGA 2V59A 3K5HA 2XOKG 1IBMO 5FNVF 4BBSG 5GONB 4H37A 1VQ9V 2XHBA 2Q2UA 4ZQIA 4GC7A 2ZE8A 3ZRVA 2COIA 3RBDA 2JJ1G 4ECVA 3AG2B 3SYQA 2EIJB 2JA7G 2IU0A 3JSNA 3E35A 2ZDHA 4NKGB 3QF7A 1NH2D 1BHBA 4FE2A 1OCCB 4QW8A 4B08A 2WDTA 3W7UA 4IR9A 1MZEA 1RJRA 3JRXA 2VA3A 4J41A 3VQYA 1NR7A 4YB8B 5KFJA 4NXNH 3WB0A 4RZQA 4J9RA 2UUBB 1H8HG 2R8HA 4MVOA 3TQ1A 2XNDG 5B1OA 4JI5B 1K83A 1AN7A 1ROPA 1JDBB 4FLYA 3L74H 4TUYA 3H01A 4APMA 1OCOC 1N56A 1PL0A 2DYRC 4CKBA 1MOFA 5IP7G 4LSAA 2JA5A 4FFBA 3T2MA 1S10A 2N74A 3LDDA 1PL4A 1AUXA 4EFEA 3CWBH 3OUUA 1TVKB 3RUPA 4HNTA 1V4YA 1I7FA 3GTLA 1NJIW 1NTKH 4ED6A 4JI8O 1U97A 1B6RA 4XYMB 5B1BB 3PO2G 1FVIA 1KT8A 4DR2B 2IJIA 1R6KA 3ETQA 4NB5A 4PV1B 4LF8O 4O3PA 5LMUB 3ZS8C 1A32A 1QU7A 4LP8A 3CCRV 4FLZA 4ETSA 2IH3C 1R6NA 4I5SA 3K9SA 1SS3A 4X65H 3T5KA 2R82A 2ZXWC 3JATA 4BAYA 4F6EA 3PFFA 3T1HB 1R3KC 3ML0A 3K04A 2PTMA 3G8DA 3N6XA 3ETDA 4I0XB 4FS2A 4FIPC 4JAAA 2R93G 1XNQH 2P06A 3W7SA 2ZR3A 3LMLA 2Q69A 2Q0AA 4ICGA 5IJ9A 1R1BA 3G80A 4DR4B 2WB1E 4J9KA 1P16A 2DABA 4G28B 1FXKB 1V9PA 5CBFA 3I4NG 3RFRA 1AVMA 3E2EA 2JEFA 4IWXA 3CPWU 3KZIZ 2EILB 1QHTA 4DW0A 2R6FA 4RNNA 2BQRA 4JI7H 4C5BA 3HKZE 4DL4A 1KUTA 3HKDA 5DGHA 4JI8B 3HOYG 1H2NA 4DV1H 5EIBD 2UUAH 5HFMA 3G4SV 4FM0A 4BWAA 1Y66A 4FFRA 3JARB 4K3AA 2DW4A 1P84F 2J6TA 2ZIOA 3ABKC 4MV1A 2XUMA 1EKFA 4O2BA 3K9AA 4AQYB 4IR1A 1N32O 2WLLB 4TV8A 5CA3A 2EZPA 2YRXA 3FDSA 3I12A 2ZGIA 4O7SA 2HGXA 1I1LA 5GONF 3ZHQA 3UKMA 4DV0H 3LUTB 3E89A 4X62O 1M57C 2JEXA 4FM9A 5CR5A 3SNOA 3BA9A 4GKKB 4CMFA 5FD6A 4B7KA 4YP3A 1I5YA 1KKDA 3HB9A 4X64B 2R85A 5CA0F 1N4CA 3OTFA 3WG7C 2F93B 1XDCA 4LFAB 5HFLA 5LBQA 2Q4PA 3SGIA 1AUVA 4GKKO 1KB9F 3W5OA 3ABMC 4HBNA 1MSWD 3V6JA 3E8HA 3HKZA 3PJSK 2ZDQA 1YIJV 4U3FH 4QWEA 2EJ2A 4YJ3B 3T1YH 4CS3A 1V54B 5BXZA 5C8YB 4NXNB 3KAKA 5DECA 3FB6C 4DXWA 3GIKA 3WFVA 2R8JA 2FL4A 2VQEH 3ZX6A 3E86A 3DXRB 1QQCA 2VUGA 3R5HA 3L4KA 4PZ8A 4QWAA 3N2KA 3BVOA 3CYOA 1VARA 2YIAA 5IJ9B 3AG1B 3T5LA 4B3RB 4XDLA 4A2BA 1YJWV 5KHIA 4NLGA 1D5AA 5CA0A 3LWBA 1GN3A 4UCTA 4L87A 4D7SA 1I94O 1RYSA 3VPBA 1VKZA 4FFBB 1ZLZA 4WFHA 3BY6A 3N27A 3CMAV 4JI5O 3PW2A 2G38A 4JI0O 3JD1A 5KG5A 2J6SA 1S9FA 3ZRXA 4GKKH 5LXTB 4EKWA 2F43G 4LFAH 1DTOA 2X0LA 1K4DC 5H5NA 3K5IA 4XBFA 1VS0A 4DR3O 5LHIA 2LGQA 3JRWA 1NTMH 2DE0X 2JDIG 3FB5C 3FB8C 2PBZA 3TEKA 2RJZA 5LMNB 3V4SA 1I08A 1I3QA 4JI2B 4FU0A 4MV4A 2ALZA 3TW7A 5LMNO 3U9TA 1M56C 2R9IA 4B3SB 3TGUH 2Q7EA 3WU2Z 3X2QC 5KFVA 1Y1VG 1AI7A 5K3WA 1B3QA 2V4QA 4CZZA 1I7NA 5DLFA 2WLIB 4YJ2A 4X20A 2ADPA 1K5SA 1V55B 3BABA 4E2LA 3U0GA 1TGOA 3ZN1A 5DAAA 3MR3A 2MCTA 3AK2A 4OGQB 4JZGA 3H1JH 4DW1A 1M1KW 1JMKC 3NR7A 2WAQA 1VQ8V 1K5QA 4JI6O 4EEQA 4DR7B 4H13B 4Q20A 1Q7YW 2LW7A 3HKBA 4CH5A 2CTPA 1S3JA 3KHGA 3ASOB 4FFPA 2Q67A 4MTXA 2CNUA 1Y1VA 1IX9A 5FJ8G 2W7OA 2XAJA 2F4VB 3T7AA 3U55A 2ZE6A 2GSMB 4Q6GA 2VQDA 1KJ9A 2Q2TA 4A3BG 4PA3A 4QWBA 2VQFO 1I0HA 3ZCCA 3OMNB 5BPFA 2D2CB 3GTOA 1HWYA 2RDCA 4OXSA 4CHIA 4OPHA 2Y69B 2PI4A 2GLTA 4DV2B 5EYPA 3JAWB 4PHZA 2IMWP 1Y4MA 2R9RB 1FJGB 3WO0A 3OW2U 3ABTA 3DTUB 2R7MA 1K7DA 4LF4B 4DIMA 4MA5A 4GT1A 4O7TA 1AR5A 2V7QG 3EXAA 1D2DA 5LA6F 4IAJA 5KFLA 5KT7A 3JYCA 3AG7A 1ZAUA 1JDEA 3SYPA 5LGNA 4WFGA 4X62B 3N41B 5EBMC 3C3SA 4U7OA 3FYEB 3RW0A 5L3DA 4HNUA 5KFAA 4FM2A 4U3JA 2UXCO 3GV7B 3SPJA 2JGDB 3W1GA 2JA6G 1DAAA 2NU6B 1W59A 4DRXB 1FXKA 4X89A 3CRAA 3RGXA 3NBZB 5FNVA 4X66B 1M5IA 1RSOA 4ZI7A 4IWYA 3S24A 1M90W 1VQMV 2W9BB 4I7ZB 1WRVA 2UUCB 4Q4CA 4AI8A 4R8UA 5A9GA 3JASB 2UXBB 4Q45A 4JV2A 1R3LC 4A3MG 4XYLB 4UCUA 1KTAA 1FFXB 2DOSA 5LYJA 2FPGB 3LDEA 3ETJA 2AQ4A 2EX3A 4FZ1A 5LA6A 4PDRA 5L1JA 3M4IA 2EINC 3DSQA 2L6LA 2E5LB 4JYAH 4MVMA 5JVLA 2ZNIA 1S76D 4MTGA 4QWDA 1C30A 4EB6B 1XMOB 3HKDB 2Y0IA 4L1KA 4YY3H 4K0KH 2QTSA 1AP6A 2QWRB 3CCMV 3STLC 5H6QA 4O3NA 2KG7B 4O2AA 2LQTA 1Z5VA 1MG1A 4P9OA 4MV8A 1I5XA 1AJNA 2QDOA 2WLNA 2R84A 2I8CA 4O7LA 4TUYF 2DYSC 4A3KG 3AG3C 5LGTA 4JI0B 4CE5A 3QG5A 5GTHZ 1TVKA 3SJBC 1B33N 5EIBC 1E4FT 3H20A 3IFXA 4ECZA 4OX9B 1OWTA 4RUEA 4JI3B 2W9CB 1NS1A 1XILA 3SJAC 5LYJF 5KA5A 3DGEA 2EJ3A 1OCRC 5IJ0B 2VUMA 5C1OA 3RYHA 5I5VA 4TQRA 3BRCA 5GTIZ 4IRDA 3E5NA 4JI3O 2X6CA 4X65O 5C4XG 5JJEB 5CAEB 3D3QA 5E79Z 3ZMSA 4JV0A 4MAMA 1KYOF 5DQGA 3SPHA 1PNKA 3B2EE 2UUBH 4IIJB 3PW7A 4DL3A 4DV1B 1KJ8A 1Z5WA 1IBLB 4LF6O 4DQNA 1MABG 2GPSA 4J9YB 4DL6A 3ZEDA 3ZHVA 2Q68A 4DV1O 5KFNA 4ZBMA 4JTAB 2FPPB 1N33H 1FKAH 4ECTA 2YZGA 4TQDA 4AQYH 2KQXA 2UVWA 3KHHA 2VA2A 1GKFA 3EPIA 3JALA 2FPIB 4DV3B 2ASLA 1A3GA 4O4HF 1IXBA 3HBLA 3UZOA 1I1MA 3NXSA 4JI3H 2RGVA 3H40A 2HR3A 4GZRB 5EK0A 4LBEC 2YS7A 5FLXW 4GKJB 5LMUH 1EM1A 4LWSA 2P67A 2FYUH 4LFCB 3RAXA 3R5FA 2WE6A 1FFXA 4HNVA 3KG2A 2YWVA 3ETHA 2CAZC 1I94H 2RGRA 2P5OA 2QKCA 4O7WA 2ZKOA 1TWFA 1YJ9V 5EWGA 2NVYA 1IBLH 1BSMA 3NC0B 5DLGA 3KXYT 1T94A 5A2QW 3CCVV 5LOVA 3F7VC 1QVGU 2UU9O 4ME6A 4MW3A 1FAFA 4O7VA 3GIMA 4DV7H 3C3TA 2PN1A 4X8AA 4PJ0Z 3MAQA 2BR0A 3RGBA 4X66H 4DR7O 1PPJH 2FTKA 2Y0PA 3T1YB 3FX7A 4R7CA 4UV8A 5EBWC 1KJJA 2PMZA 3H0GA 4B3TH 3GB8B 4RWUA 3K3VA 1WB8A 2YC0A 1E4GT 4WF9V 3WG7B 4W4LA 1FXVA 4EGQA 2A3QA 1K97A 3R65A 2C22A 5KFGA 1SQVH 1K4CC 1N8RW 3TINA 2XT9A 2AZ0A 3UFXB 5CB4F 5KFDA 3RTXA 2FB5A 1IVSA 3ZHTA 2MK3A 3RYFB 4TV9A 2ZDGA 4NVPA 2EULA 5BMVB 2DWDC 3H0GG 1PKXA 3RYIB 1NKDA 3GTGA 3I5DA 2VPSA 2DWCA 2F4VO 3UYYA 1U96A 3Q2OA 3CCJV 4EBEA 3E22A 3RVYA 1OBDA 2WLKA 1J95A 5KG7A 4O3RA 4ED3A 1WPBA 1YDXA 4JAUA 3CS5A 4I0XA 1BJTA 3FAVB 3JSLA 4LH6A 3T99A 4RUAA 1CKMA 1TUBA 1GK9A 4O7RA 2EZOA 3RN4A 2IM9A 5LL6Y 1PNMA 4C7UA 3OUSA 4F6RB 1VQNV 2UUAO 5D1OB 1CQJB 1P8LA 5CBGA 2HVKC 4FJCC 4KP4A 3I4MG 3JAKB 2CGNA 3SR2C 1JCHA 5FD5A 2ARHA 1TUEB 2OCHA 3NGDA 4DR5H 3CVZA 4JYBA 4NTWA 4B3SH 3GV5B 5KX5F 1HNZO 4RUCA 5JQWA 3SYCA 2C00A 2OLSA 1NBMG 4IGGA 3HOVG 4M0JA 4UVAA 4ED0A 4B7EA 5IJ0A 2ATKC 5HNEA 3F7YC 1T3NA 2JVDA 4X64O 3JATB 1K73W 2Y4UA 2YZLA 2R70A 4YR3A 1BQZA 3UZBA 1SESA 1SC5B 3CP1A 4ED8A 4O3OA 1N34B 1HNWH 4PDMA 3MWDA 3ABUA 3W7WA 4DUYO 3B40A 3CEIA 4ECSA 4I9WA 5KX5A 1KECA 1UPGA 4J9QA 2QJ1A 1BXRA 4J7ZA 1XMOO 3JAKA 3LDCA 4DV4B 4P2ZA 1UJWB 1QNMA 2N04A 4LFCH 5LXTF 4O4JA 4OX9H 4DUYB 3M99B 3V4ZA 4BW5A 3ZMTA 1XMQO 1VMGA 2C2RA 4DR5B 1CXZB 2R93A 3HOWG 3CRMA 2OIEA 5I47A 2V4RA 4DK0A 4R8UB 1ZTEA 1XMQB 1Y74B 3MFIA 4MVQA 1QR9A 3OE7G 3ZHRA 2P4KA 2FJZA 1BT8A 1D5NA 4DO2A 4O4LA 3MHSC 2R8IA 2LO1A 2JGDA 3QTCA 2CNQA 3A0HZ 3WB2A 1XNRO 1WCMG 4GX5A 2HGSA 4KUMA 3IC9A 4GX0A 2IBKA 4FFLA 1SQXH 5LHHA 2IJJA 1L8DA 1E1RG 5C8YF 3FMAA 4G2KA 4QW9A 4O7ZA 1XMOH 1OHHG 3B09A 3K57A 4G3IA 1S5LZ 1KMIZ 4ZIBA 4PZ6A 2Y48A 4TT3G 3MR6A 5EC1C 5JUMA 3BA8A 4RB3C 2IJHA 2WSSG 2UVVA 5B1BC 2BOBC 3EVKA 4QPJA 4UXNA 3KCYA 4HZ3A 1CP9A 4XDKA 2AHYA 1B06A 2CH7B 2ZDIC 3WB1A 3LQSA 5B3SC 1KBHA 1XUQA 4DR2O 5HV6A 2M05A 3KHLA 3QFFA 4ZI7B 5KFHA 4ZHQA 1RYRA 2CGOA 4R6ZA 4ECQA 4O4LF 1O75A 3GIJA 4QPKA 4A93G 3K0DA 4HAMA 2Z0AA 1XK5A 2YEVB 1TUBB 4RAZA 4O2BB 4BY1G
chains in the Genus database with same CATH topology
2PY5A 3N44B 4FFBB 4LF4H 1IBKH 1M4UA 5KX5B 4X1KB 4GKKH 2BTOA 4NXMH 3K5MA 5LXTB 1Z2NX 3OTOH 4UCRA 3N2GB 2QM4A 1DGSA 5JQGA 4LFAH 1YEWA 3HXLA 1M93A 4F6RA 3SJCC 2JS5A 1VS0A 1B04A 2UXCH 5J2TA 5ITZA 1JFFA 1XQ8A 4PI0A 1SQGA 5JCOA 2BTQB 2VQFB 2RJZA 5LMNB 2UXDH 1S5JA 4JI2B 3RYHB 4D7TA 5CA1B 1HR0B 3N40P 4DV5B 1SQFA 4O4HB 5JH7B 1SA0A 2HIVA 4DUZH 2UXBH 5DISC 2YIBD 4RB2C 4B3SB 4A2AA 4DR6B 2Q7EA 4ZHQB 4B3MB 1XHXA 4IIJA 4DV6B 4LF5H 5IT9W 4YJ2A 1N33B 4X20A 3BABA 2VWJA 1TGOA 3IAYA 2CW7A 2MCTA 2JGUA 1XNQB 1WNSA 4JI7B 3T1HH 4YJ3A 1JMKC 4O2AB 4LMYA 4PI2A 1KU9A 4EEQA 5CB4B 4BW9A 4YJ2B 4DR7B 4JI4H 3HKBA 4CS4A 4CH5A 3RJ0A 1VF7A 1P49A 4EFBA 4DR2H 2WYOA 4KL1A 5KMGB 2PYJA 1X4TA 5EOYA 2HHHH 2F4VB 1CKOA 4DV7B 1I94B 3F8NA 4LF8H 3JAWA 2V4DA 4X1IA 5LYJB 3K5OA 4Q6GA 1G6UA 5JVDB 2Q2TA 3KYHC 3PN1A 3TY9A 3N43B 4M7EA 4CC6A 4LFBB 2ZCEA 3GJXB 5FNVB 4MV7A 1HR0H 1HNZH 4DR4H 4RAYA 4GLXA 4ZOLA 3KAJA 4LSXA 4DV2B 5EYPA 3JAWB 4PHZA 1FJGB 3JAMW 4YHHH 4YY3B 5FPRA 1Q8IA 4K0KB 4DR3H 1N36H 4LF4B 2ZNJA 4FM1A 3W1BA 5KMGA 1H2SB 4EB6A 4MV9A 4GYCB 4IAJA 4JI8H 4WBNA 4JV5B 1ZAUA 3OTOB 1O9HA 4MTEA 2GV9A 4X62B 3N41B 2E3CA 4U3JA 4FM2A 4JI5H 4FLXA 4Q0YA 3W1GA 3GDEA 5BR8B 3IG0A 4DRXB 3JASA 2F1MA 4DV3H 2HVSA 1HNWB 3RGXA 3NBZB 5FNVA 4X66B 1M5IA 4X65B 1RSOA 4ZI7A 3S24A 4I4TB 4TV8B 2UUCB 4LF7B 3JASB 4DUZB 2UXBB 4UFZA 3M7MX 4UCUA 1FFXB 4X1IB 5LYJA 4FLTA 2EX3A 4FLVA 5LA6A 3CSXA 5IWAB 2ZM6B 3M4IA 3LNNA 3HKCA 2UU9B 3VQXA 4R7RA 3DSQA 3UT5A 3K59A 2E5LB 5CB4A 4JYAH 4LR3A 4ZOLB 2ZNIA 4EB6B 1XMOB 5J2TB 3HKDB 5D5QA 1J5EH 4YY3H 1N34H 4K0KH 4JI6B 5D1OA 4O2AA 4X64H 1Z5VA 1XDNA 3N42B 3EYYA 3CHXA 3N2GA 4RB1A 3U0ZA 4E6NA 4FLUA 4IHJB 4LNUA 4JI0B 3QG5A 2HVRA 1TVKA 3SJBC 3H20A 5EIBC 1E4FT 3RYCB 2UXDB 1CKNB 1TA8A 4OX9B 4KHPB 2R9AA 4JI3B 3KALA 5IYZA 3SJAC 2HHHB 3RYCA 4LF6B 1SA0B 4CC5A 2Q7HA 5IJ0B 4LF9B 4IHJA 3RYHA 1N32H 3BRCA 3FFQA 4O4HA 1SKVA 1ZHQA 2HVQA 3C0FB 1T5EA 3TY8A 3RR5A 5JJEB 1XNRB 5K1PA 1CKNA 2YCHA 3J7AK 4X1YB 4LF7H 4JI2H 5EZYA 2XIGA 3RYFA 4NXMB 2CW8A 1JFFB 5ITZB 3B2EE 3ICXA 4IIJB 4AHCA 2UUBH 4DV1B 4EQ5A 1Z5WA 1IBLB 3L4JA 2ZM6H 4DV4H 2YIBA 3VQWA 4X1YA 2RQ6A 3U11A 3HKCB 1Z2OX 4DUYH 2HIXA 5KHHA 4DV0B 4JI1B 3ZEDA 1XHZA 1HW7A 4JI4B 2ZINA 1JJOA 2KKWA 1M0WA 3VQVA 4BWSC 2PGGA 5IYZB 1N33H 1FKAH 4CH4A 4TQDA 4AQYH 5LMNH 4UCSA 4UCVA 2PZSA 1NT2B 2W57A 3JALA 5CA0B 2R72A 4DV3B 5LL6b 3K58A 5EYPB 4CH6A 3CB2A 5D1PA 1MZBA 4TUYB 4K8ZA 3RF2A 4DR1H 2BTQA 5JQGB 3N2KB 1M0TA 4JI3H 1L2ZA 2OWOA 2RGVA 2Q7GA 2YI8A 5BMVA 3K5LA 2KSWA 5FLXW 4LF9H 4GKJB 5LP6A 1N32B 5LMUH 1X9NA 2VOBA 2UUAB 4CH3A 1XNRH 5LA6B 4U3JB 4LFCB 1O9GA 2WE6A 1FFXA 4B3MH 4O4IA 2CAZC 1I94H 2RGRA 2OYQA 2P5OA 1SYXB 5LP6B 4X62H 4I55B 1IBLH 2FE3A 1IBMB 3NC0B 4UCOA 3TY5A 3KXYT 4TQFA 5A2QW 1IBKB 4DRFA 1XMQH 5LOVA 4TOIA 1N36B 4I50A 2CFMA 4I4TA 1WN7A 4DV7H 3QWUA 5JCOC 4X20B 3MAQA 5GONB 3RGBA 3J80W 4X66H 2XHBA 2Q2UA 4DRXA 3T1YB 3RGZA 4RB0A 3HKEA 4B3TH 4PDBA 4B3RH 3GB8B 4K8XA 5JVDA 4DR7H 3JSNA 3K3VA 2YI9A 3QF7A 1XI1A 5BR8H 1E4GT 1S03G 3HKBB 5C8YA 4O4IB 4B08A 4YHHB 4DR3B 2WDTA 2VQFH 3VQYA 4NXNH 1HNXB 2F66C 3WB0A 3RTXA 4RZQA 2UUBB 3RYFB 4PZ7A 4TV9A 4NVPA 5BMVB 3RYIB 3RWRD 3MWMA 4JI5B 1AN7A 5KHGA 4FLYA 3THOA 1Z2PX 2VPSA 4TUYA 4APMA 4DV5H 4LH7A 3BAAA 2UXCB 3E22A 5J2UA 5JH7A 1WPBA 4LSAA 4FFBA 4EFEA 1TVKB 1BJTA 3JSLA 4LH6A 4JYAB 1I7FA 4WBNB 1CKMA 1TUBA 4J0MA 2IM9A 5CA1A 5IWAH 1FVIA 4O4JB 3JARA 4F6RB 2PYLA 4DR2B 3UQ8A 5D1OB 1P8LA 5KHKA 3JAKB 3ETQA 5LP6C 3SR2C 4AILC 5FD5A 5LMUB 3ZS8C 2VWKA 4FLZA 4DR5H 1J5EB 3CVZA 4ETSA 5EZYB 4B3SH 4X65H 3JATA 4MTDA 3T1HB 4LF5B 4DV6H 2PTMA 1TAEA 5LXTA 2O03A 1Q3EA 3BPZA 1Q43A 5IJ0A 2E5LH 3N6XA 2HEPA 4JI0H 4LF8B 1FJGH 2JVDA 1XNQH 5K1XA 3JATB 3LMLA 3DF7A 3E22B 2Q0AA 5FPOA 5J2UB 2ZJTA 4LNUB 3J81W 2R70A 2YXLA 5IJ9A 1HNZB 4DR4B 1WH2A 1P16A 1V9PA 1N34B 5GONA 3RFRA 1HNWH 4FLWA 1ZHSA 1QHTA 1GYFA 4JI7H 3VNNA 4JI1H 4I7HA 3HKDA 3RYIA 5KX5A 3L2PA 2QJ1A 4JI8B 4L8JA 2VQEB 3JAKA 4DV4B 5EIBD 4DV1H 1A0IA 3UT5B 2UUAH 4JV5H 4X1KA 1Q5OA 4BWAA 4FM0A 4LFCH 3JARB 4O4JA 3BHPA 4OX9H 4KHPH 4DUYB 2UUCH 2ZIOA 5JJNB 5KHJA 4DR5B 4DV2H 2F4VH 4GKJH 1IBMH 4O2BA 4DK0A 4DK1A 4AQYB 3RIZA 2ZIMA 4TV8A 4HNAA 2F95B 1XMQB 5D5PA 3A2FA 4JI6H 4LFBH 1BGWA 3HKEB 1I6UA 5JJJB 4TV9B 4DV0H 4FVMA 4FM9A 4O4LA 4I50B 1S68A 3BA9A 4GKKB 5FD6A 3NBYB 2PUSA 3QTCA 4X64B 3WB2A 3OTFA 2F93B 4LFAB 2HGSA 4I9QA 3SGIA 1SEIA 3W5OA 1L8DA 3FMAA 4HBNA 4I55A 1XMOH 2P22C 3K57A 1KMIZ 4ZIBA 4YJ3B 4CS3A 4NXNB 4PZ6A 5C8YB 3KAKA 3T1YH 3K5NA 3BA8A 4RB3C 2UU9H 2VQEH 1QQCA 4O4LB 2VUGA 3L4KA 4PZ8A 3WB1A 4DR1B 4CS2A 3N2KA 5IJ9B 4B3TB 2YIAA 4ZI7B 4ZHQA 4B3RB 4DR6H 1O75A 4A2BA 1HNXH 4HNAB 3U10A 5KHIA 4LF6H 1XK5A 1D5AA 1TUBB 3JALB 5CA0A 4O2BB 4RAZA 5LOVB 4UCTA 4D7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWO A;  3T1H B;  4LF5 B;  1TAE A;  3W1G A;  3GDE A;  5BR8 B;  4GKJ B;  1N32 B;  1X9N A;  2HVS A;  1HNW B;  3NBZ B;  4LF8 B;  4UCR A;  4X66 B;  2UUA B;  4X65 B;  4LFC B;  1DGS A;  3S24 A;  5FPO A;  2UUC B;  1HNZ B;  4LF7 B;  4DUZ B;  4DR4 B;  2UXB B;  1P16 A;  4UFZ A;  1VS0 A;  1B04 A;  4UCU A;  1V9P A;  1N34 B;  1IBM B;  3NC0 B;  4UCO A;  2VQF B;  3TY5 A;  5IWA B;  2ZM6 B;  5LMN B;  1IBK B;  4DRF A;  4TOI A;  1N36 B;  2UU9 B;  2CFM A;  3VNN A;  4JI2 B;  1HR0 B;  4DV5 B;  4UCT A;  2HIV A;  2E5L B;  3QWU A;  3L2P A;  5DIS C;  4JI8 B;  2VQE B;  4DV4 B;  1XMO B;  2Q2U A;  1A0I A;  4B3S B;  4JI6 B;  3T1Y B;  4DR6 B;  4DUY B;  5D1O A;  4B3M B;  1XDN A;  3GB8 B;  4DV6 B;  3JSN A;  4DR5 B;  4E6N A;  1N33 B;  3BAB A;  4AQY B;  4DR3 B;  4YHH B;  4JI0 B;  2HVR A;  1XNQ B;  1XMQ B;  4JI7 B;  2UXD B;  1TA8 A;  1CKN B;  4OX9 B;  4KHP B;  4JI3 B;  1HNX B;  2HHH B;  4LF6 B;  3RTX A;  4EEQ A;  4CC5 A;  4DR7 B;  4LF9 B;  2UUB B;  4PZ7 A;  1S68 A;  3BA9 A;  4GKK B;  3NBY B;  4X64 B;  2HVQ A;  4JI5 B;  3TY8 A;  3RR5 A;  4EFB A;  1XNR B;  1CKN A;  4LFA B;  3SGI A;  2F4V B;  1CKO A;  4DV7 B;  3W5O A;  4LH7 A;  1I94 B;  4NXM B;  3BAA A;  2UXC B;  2Q2T A;  4DV1 B;  3PN1 A;  3KYH C;  1IBL B;  3TY9 A;  4CC6 A;  4EQ5 A;  4LFB B;  4PZ6 A;  4NXN B;  3GJX B;  4EFE A;  3BA8 A;  2HIX A;  4DV0 B;  3JSL A;  4LH6 A;  4JI1 B;  4JYA B;  4JI4 B;  1CKM A;  4GLX A;  4DV2 B;  2VUG A;  4PZ8 A;  4DR1 B;  1FJG B;  4YY3 B;  5FPR A;  4K0K B;  1FVI A;  4B3T B;  4UCS A;  4DR2 B;  4UCV A;  3UQ8 A;  4LF4 B;  1P8L A;  4B3R B;  5D1O B;  3W1B A;  5LMU B;  4DV3 B;  1XK5 A;  1J5E B;  4JV5 B;  1ZAU A;  3OTO B;  5D1P A;  4X62 B; 
#chains in the Genus database with same CATH topology
 2OIG A;  2XGP A;  3N44 B;  2WA4 A;  4LF4 H;  1XBL A;  1KEE A;  1YZB A;  1M4U A;  4FFK A;  1KP2 A;  3S3X A;  3OMI B;  2ITD C;  2QM4 A;  3MHH C;  5KG6 A;  5IY5 B;  3M9O B;  3AG3 B;  3UO2 A;  3HXL A;  1M93 A;  2V5A A;  4O2A F;  1OCC C;  3TXS A;  3IN5 A;  1B04 A;  4FBU A;  4YHH O;  5BWR A;  1JFF A;  3TW6 A;  1XQ8 A;  4QSH A;  3Q1K A;  5BR8 O;  3AG2 C;  5JCO A;  2VQF B;  2BTQ B;  4QIW E;  4GC6 A;  4O3Q A;  1MZF A;  3O9O A;  1W96 A;  3K08 A;  2R92 G;  1HR0 B;  3R9R A;  3N40 P;  4DV5 B;  1SQF A;  5JH7 B;  5DG9 A;  2UXB H;  3FD9 A;  4ECU A;  1NR1 A;  3SYA A;  1A9X A;  2JA7 A;  3Q4H B;  1WA8 A;  4O81 A;  3BJY A;  1S77 D;  4DR6 B;  1NTZ H;  1HR0 O;  1Y1W G;  1LUV A;  4Q43 A;  5CM0 A;  3R23 A;  5L3B A;  5LGU A;  1OJH A;  2J6U A;  3EHB B;  2PVP A;  1RM1 C;  1GM9 A;  1US6 A;  2JGU A;  1IBK O;  4JUZ A;  4CBC A;  4ZOL F;  3T1H H;  1EN5 A;  1EYZ A;  3R5X A;  1K1S A;  4CKC A;  1KU9 A;  5C44 G;  5CB4 B;  1VQO V;  4BW9 A;  1K34 A;  1Q6U A;  3ZMZ A;  1VQ4 V;  1JQ0 A;  4NZM A;  5KT6 A;  3OEE G;  1P49 A;  3ASN C;  1ZUQ A;  3DTF A;  4UVC A;  4UUJ C;  1JPX A;  4KL1 A;  5KMG B;  2WYO A;  2PYJ A;  1X4T A;  1YIT V;  1K8A W;  3GID A;  2ATL A;  4NTY A;  1EZJ A;  4DV7 B;  4QIW A;  3F8N A;  4LF8 H;  3OAA G;  2A9H A;  2V4D A;  4X1I A;  1K9M W;  4LF5 O;  3N43 B;  3PN1 A;  2ZE5 A;  3OUZ A;  3MD0 A;  3JD0 A;  3VPD A;  1Y67 A;  4M7E A;  4LFB B;  1G4Y B;  4UVB A;  3J7A U;  1EUD B;  4MV7 A;  4DR4 H;  4OX9 O;  1VF6 C;  4RAY A;  1BS3 A;  3H1I H;  4FMT A;  5T14 A;  2UXN A;  5BMV F;  4ZOL A;  2DIK A;  3NUA A;  5L1K A;  3ZRS A;  2WB1 A;  4K6N A;  4FBT A;  4TWK A;  4YHH H;  2BQ3 A;  5FPR A;  4PDL A;  1GN6 A;  3G6X A;  4FFO A;  2E76 B;  2ZNJ A;  2DLN A;  3JZF A;  2H94 A;  1KC8 W;  1Q90 D;  5DM6 V;  4WBN A;  1M6V A;  3RB6 A;  3N8D A;  1YTF D;  4MTE A;  4MVZ A;  1LR1 A;  1H38 A;  4J9S A;  2E3C A;  4FLX A;  4Q0Y A;  2IA6 A;  5EWF A;  3JAS A;  4DV3 H;  4PA9 A;  2HVS A;  4MSW C;  1K1Q A;  4HYO A;  2VPQ A;  2IJK A;  5FR9 A;  1M57 B;  3M8A A;  3CRQ A;  3GQC A;  4FGR A;  4X65 B;  5EDW A;  2VR1 A;  4Z1V A;  4I4T B;  3CCS V;  2DAA A;  3TK1 A;  1H2K A;  1V51 A;  4HN2 A;  4LF7 B;  2CTW A;  4B3S O;  4UFZ A;  2VS0 A;  4U6P A;  5IYZ F;  3ABL C;  2QSA A;  3FB7 C;  1G1X B;  2EIJ C;  3M9N B;  3DC6 A;  4TQS A;  3H4B A;  3RBE A;  2GBO A;  1SFO A;  2ZM6 B;  3LNN A;  3HKC A;  1N36 O;  2HJW A;  1RJP A;  4UV9 A;  1PM9 A;  2FKX A;  3K59 A;  4DV4 O;  5BY1 A;  2VQE O;  1B6S A;  5D5Q A;  5F9L A;  1J5E H;  4NR1 A;  4HYK A;  5KG0 A;  4DUZ O;  2YXY A;  5JQG F;  4JI6 B;  2QWO B;  4YAK B;  5JWP A;  4HQ6 A;  2ZR2 A;  1WCM A;  2JK5 C;  1S0M A;  1XDN A;  2UXD O;  3CHX A;  2GTA A;  2AHZ A;  3U0Z A;  4O83 A;  1WAZ A;  2HHH O;  3DC5 A;  4FLU A;  1UFI A;  4E6N A;  5CBH A;  2WTF A;  1BE3 H;  1QLN A;  3OT7 A;  2HVR A;  1VF5 B;  5DQI A;  1YHQ V;  2UXD B;  1KP3 A;  1E79 G;  2Z5U A;  3KAL A;  3H1K H;  4TVI A;  2ILM A;  2HHH B;  3RYC A;  3KHR A;  4RNO A;  3AK3 A;  4IHJ A;  1AR4 A;  4DAA A;  3PW5 A;  5LMU O;  3FFQ A;  1SKV A;  1KC7 A;  3OGC C;  3TY8 A;  1COW G;  3HPL C;  2LW1 A;  1XNR B;  2WLH A;  4X1Y B;  2JIZ G;  3Q8Q B;  1GO3 E;  2X5R A;  1FJG O;  1NI8 A;  1F51 A;  1P7G A;  3RYF A;  4MA0 A;  2BSK B;  1JFF B;  2XC9 A;  3DXR A;  3WNZ A;  3AG1 C;  2ZM6 H;  1IDS A;  2W0F C;  3VQW A;  3TJT A;  4X1Y A;  2RQ6 A;  3LP8 A;  4DUY H;  2OTJ V;  4DR6 O;  5KHH A;  1XHZ A;  5DN6 G;  5B3S B;  4JI4 B;  3ZBH A;  1GO3 F;  1M0W A;  3VQV A;  4YR2 A;  2DJV A;  5IYZ B;  1W0J G;  4CH4 A;  4ZKI A;  3CC7 V;  4A3C G;  4X66 O;  1NT2 B;  2AGP A;  2X6A A;  2R72 A;  2DPI A;  4P9P A;  2QYZ A;  5KFK A;  2JJ2 G;  4KXR A;  1YVW A;  4Y8V B;  1KUQ A;  1OCO B;  4TUY B;  5L1I A;  3PZP A;  4DR1 H;  3W7T A;  2Y4R A;  5I5U A;  3JZ6 A;  3T9E A;  3JCU Z;  1OCZ B;  5L3E A;  4WHX A;  2YI8 A;  3K5L A;  4A3G G;  4YQW A;  4DR1 O;  3CJH B;  1QR8 A;  5J9P C;  3RAQ A;  3J81 N;  2FMA A;  5DED A;  4CH3 A;  2SCU B;  3QO5 A;  1XNR H;  3DTG A;  4ECR A;  3KKY A;  4LFB O;  3H9V A;  3J80 N;  1J5E O;  5BWW A;  4GCZ A;  5KFM A;  4I55 B;  2NU7 B;  3MFH A;  5L1L A;  3G6E V;  1EZ1 A;  1RK5 A;  4UCO A;  3TY5 A;  3JD4 A;  2DMX A;  1IBK B;  4I50 A;  2B1G A;  4I4T A;  1KJI A;  4C5C A;  1JJ2 U;  4J10 A;  2XCA A;  3K3W A;  1FKA O;  3QWU A;  3T5J A;  4X20 B;  1PK8 A;  3GVM A;  3T54 A;  4GLW A;  2WLI A;  3PVX A;  1ARO P;  5KG3 A;  2J9G A;  3K79 A;  2AGA A;  1Y1W A;  4J42 A;  3RGZ A;  2EIL C;  4RB0 A;  2Q5Z A;  4PDB A;  5JVD A;  3OR7 C;  1GM8 A;  1T36 A;  5BR8 H;  1XI1 A;  2X0S A;  3RV3 A;  3SPC A;  1S03 G;  3HKB B;  5C8Y A;  4DR3 B;  3STZ C;  1ULZ A;  4I55 F;  1DF5 A;  1ZSP A;  3VOT A;  1CQI B;  5IYD G;  4YXW G;  4WD3 A;  4EEY A;  5IE9 A;  2HVJ C;  2BCC H;  1GM7 A;  2P0A A;  3V6H A;  4I4T F;  3P3P A;  3WWI A;  1Y74 A;  3RWR D;  5KFI A;  4Q4D A;  3SYO A;  3U9S A;  2YZN A;  5KFY A;  3P32 A;  3THO A;  3T9B A;  3GIP A;  3Q8S B;  2YSU B;  2HP8 A;  2QWQ B;  2A0L A;  4DV5 H;  4LH7 A;  3BAA A;  1N34 O;  3TET A;  4U7N A;  5J2U A;  1VQK V;  1Q82 W;  2R7L A;  5JVD F;  2ODM A;  4O7N A;  3P3N A;  4NYE A;  2DQ0 A;  1Q6H A;  2RMK B;  2H3O A;  2O57 A;  4JYA B;  1JVM A;  1XEQ A;  4J0M A;  4PWQ A;  2CQY A;  2XGQ A;  3OUF A;  4MV6 A;  2NLJ C;  3JAR A;  4YY3 O;  2PYL A;  4K0K O;  4JI1 O;  4MS2 A;  3UQ8 A;  1OBG A;  5KHK A;  2OCC C;  4MVU A;  2GQR A;  1H2L A;  5LP6 C;  2IW5 A;  4X88 A;  3APQ A;  1QLE C;  4IL6 Z;  4BBR G;  4JYC A;  1G2W A;  3N6R A;  5EZY B;  1YJN V;  5J2T F;  2FK3 A;  1N48 A;  5KS8 A;  4DR4 O;  2AW9 A;  2FK2 A;  2XAG A;  3H1H H;  5KFS A;  5H80 A;  2GUZ B;  1SQB H;  2ASJ A;  2O03 A;  2EBO A;  4GKJ O;  1Q3E A;  1Q43 A;  2HEP A;  4JI0 H;  1MMM A;  4LF8 B;  1FJG H;  4UUG A;  4RNM A;  1K3E A;  3DF7 A;  3E22 B;  2ZJT A;  2W9A A;  4LNU B;  3VMM A;  1W93 A;  4NZN A;  1WH2 A;  1IXM A;  2B1I A;  5GON A;  4RCN A;  2Q7D A;  5FLX N;  1KD1 W;  5H2F Z;  1IYE A;  2W8L A;  2K1E A;  3D8C A;  4JI1 H;  1PD3 A;  4I7H A;  3RYI A;  1G8M A;  1JX9 A;  4L8J A;  2VQE B;  2FML A;  1F4N A;  4JV5 H;  1A0I A;  5I5X A;  2CDY A;  3T1Y O;  1THZ A;  4A3E G;  2Y0S A;  2UUC H;  4EG0 A;  5JJN B;  5KHJ A;  2UXX A;  3ABM B;  4NXM O;  3APO A;  2FB9 A;  2Z02 A;  2DYR B;  3B77 A;  4FPP A;  4IYI A;  2F4V H;  4GKJ H;  1IBM H;  2CTQ A;  4DK1 A;  4LFA O;  1BQ0 A;  4HNA A;  1M7J A;  2F95 B;  1EN6 A;  1XNQ O;  5KT4 A;  4N23 A;  3I55 V;  1WPX A;  1BGW A;  3HKE B;  2RDI A;  5JJJ B;  4TV9 B;  2ZQM A;  4JAV A;  4J9N A;  4A3F G;  4FVM A;  3AG4 B;  3BQ2 A;  1SRY A;  4C5A A;  5C93 A;  1JKJ B;  4WFF A;  3NBY B;  1VQ5 V;  2C2E A;  4N21 A;  1C3O A;  2NU9 B;  4WFB V;  4IZO A;  3ETE A;  4AQY O;  3QZ8 A;  5BWX A;  4I9Q A;  5KT3 A;  1F7Y A;  1SEI A;  2CUG A;  1YXB A;  2ADQ B;  2E74 B;  5KFB A;  3KRE A;  2P22 C;  4BR6 A;  3SI8 A;  4GX1 A;  1BNC A;  2DZD A;  2UU9 H;  4TV8 F;  2FKL A;  5DG7 A;  2P4V A;  4O4L B;  5BWV A;  1Y6X A;  2HHF B;  4DR1 B;  3CX5 F;  5B1N A;  4B3T B;  1FPO A;  2P90 A;  5KLV H;  2B63 G;  2YXH A;  1FXK C;  1JR9 A;  2P6J A;  3CME V;  1PV0 A;  3OSN A;  1HNX H;  2YU9 A;  3U10 A;  4QE9 A;  1VQ7 V;  4LC1 A;  2CNV A;  3JAL B;  1ZQ7 A;  3CCU V;  4F4Z A;  2MW2 B;  3BEH A;  4KFM A;  3FKI A;  2PY5 A;  3GWK C;  5KFW A;  2F23 A;  1S0N A;  2DPJ A;  1IBK H;  1DLB A;  4H0L B;  1AJQ A;  5KX5 B;  1L0L H;  3K06 A;  4X1K B;  4WFA V;  2PMZ E;  3H4D A;  2CE4 A;  2XAS A;  1IUR A;  2A79 B;  4NXM H;  1OCR B;  2R8G A;  2V9W A;  2QR4 A;  5IYB O;  3N2G B;  3E8B A;  1DGS A;  5JQG A;  2VRZ A;  5IYB G;  4LF9 O;  4JV5 O;  5K2M A;  1YCI A;  3SJC C;  4JF3 A;  2UXC H;  2WWW A;  5ITZ A;  1SQP H;  2YDE A;  2OCC B;  3G6Y A;  2HKO A;  1E4E B;  1SQG A;  3G8C A;  4A3D G;  1P4R A;  2QKA A;  1PP9 H;  1NVP D;  3RYH B;  2HJD A;  4D7T A;  5CA1 B;  2JEG A;  3Q4H A;  4O4H B;  4J9L A;  4DUZ H;  3OM3 B;  5DIS C;  2YIB D;  2PI5 A;  3V6K A;  4IHJ F;  4NZO A;  3FAV A;  3E83 A;  4A2A A;  2ASD A;  1VIB A;  3HR0 A;  2R7N A;  2X7R B;  4B3M B;  3ABL B;  4LFC O;  3U54 A;  4JI7 O;  3WWJ A;  3L9D A;  4DV6 B;  4IIJ A;  3MDS A;  2Q8V A;  1I2K A;  3T9A A;  5KFR A;  4LF5 H;  5I5T A;  2W7P A;  4E4T A;  1N0J A;  3IAY A;  2CW7 A;  3L70 H;  1WNS A;  3T4D A;  4JI7 B;  1UC8 A;  4YJ3 A;  1PX2 A;  4BXX G;  4CKE A;  2KG7 A;  4O2A B;  2C2D A;  2W6J G;  1E1Q G;  1NZ6 A;  1M9N A;  1VF7 A;  4GX2 A;  4O4J F;  1Y14 B;  4DV3 O;  2QWP B;  3TXQ A;  5IYD O;  3CE2 A;  5B66 Z;  1FYJ A;  4DR2 H;  2HJF C;  1WA8 B;  5EC2 C;  4MVS A;  3OHA A;  2HHH H;  4A3I G;  3TCU A;  1CKO A;  3QZ7 A;  3CQZ A;  5LYJ B;  3K5O A;  3TY9 A;  1HNX O;  5FNV B;  3ZMV A;  3GB7 C;  2QGN A;  3SDL A;  5BWT A;  1HNZ H;  2COG A;  2YS6 A;  3TIG A;  4ZI7 F;  2BSK A;  3KAJ A;  4LSX A;  4YJ3 F;  2EIN B;  2NVX A;  3JAM W;  3PO3 G;  4DR3 H;  2AXT Z;  4YY3 B;  1Q8I A;  3G71 V;  4K0K B;  4YAJ B;  4ED7 A;  1GTO A;  3LNM B;  3W1B A;  5KMG A;  1GGO A;  3VBB A;  2OT5 A;  5F9N A;  1K92 A;  5F2V O;  5L9X A;  3OTO B;  1O9H A;  3CJH A;  4PDV A;  2GV9 A;  1ET0 A;  2QE7 G;  3ORQ A;  1UNN C;  4JGS A;  3QNE A;  5EWE A;  4PA7 A;  4QE7 A;  3QO8 A;  5IP9 G;  5C5J A;  4JI5 H;  4JXU A;  1H8E G;  3GDE A;  5BR8 B;  1VQP V;  3FKI G;  2F1M A;  4EYI B;  1X59 A;  2GHY A;  5IYC G;  1AI6 A;  1ZET A;  3ZMU A;  1SQQ H;  3LUL A;  3L73 H;  3B4S A;  1ZWI C;  1Y76 B;  3Q8P B;  3M7M X;  3K03 A;  3CD6 V;  2WLM A;  1QVF U;  4FLT A;  2XAF A;  1WR2 A;  1JX4 A;  4O3S A;  2RDJ A;  4FFM A;  3CSX A;  4RQE A;  5BZB A;  2K9P A;  1CEZ A;  4TSF G;  4IRC A;  4F4W A;  4Q8F A;  3RVZ A;  3UT5 A;  2I80 A;  4UB6 Z;  3UCS C;  5CMU A;  3ETG A;  5EBL C;  5J2T B;  2IBZ H;  1N34 H;  2UXB O;  4YR0 A;  2YUA A;  3OGI B;  4O84 A;  2YL2 A;  2JEJ A;  4X64 H;  3CC4 V;  5KA6 A;  2W70 A;  3N42 B;  5KT2 A;  2LJ2 A;  2X6B A;  1A0G A;  1Q81 W;  1YI2 V;  2E2H A;  4IHJ B;  4DV7 O;  4LNU A;  1IZ3 A;  3RYC B;  1VAJ A;  5KFF A;  1CKN B;  5CN0 A;  4KHP B;  2R9A A;  3EFF K;  1R73 A;  1HDJ A;  5I5W A;  1IBL O;  4LF6 B;  4QJF A;  3RB4 A;  4LF9 B;  5KFO A;  3GTP A;  2E2I A;  2QM8 A;  2GUZ A;  4PA6 A;  5TIS Z;  4O4H A;  2JEU A;  4C2M A;  1T5E A;  1CKN A;  3T9C A;  2YCH A;  1FXH A;  3AEI A;  2DWE C;  4QWC A;  3K3P A;  1S0V A;  2P7T C;  2CH7 A;  5ITZ B;  3ICX A;  4DL7 A;  1QCE A;  1B6Q A;  2YIB A;  3RFC A;  3HKC B;  1Z2O X;  2QEX V;  4EYH B;  4JI1 B;  4PBC A;  2CTR A;  2UUB O;  2AGO A;  4BY7 G;  2ZIN A;  2KKW A;  1ENV A;  2PGG A;  2R87 A;  1H2G A;  1TWA A;  3GIQ A;  4QJF B;  1VQL V;  4ED2 A;  5B5E Z;  4UCS A;  5KG4 A;  2PZS A;  1LNQ A;  4J9P A;  2V58 A;  1S0O A;  5CA0 B;  1GN4 A;  3JAM N;  1FD9 A;  1MNG A;  3A8T A;  1JLL B;  5LL6 b;  5KFE A;  3K58 A;  1EUC B;  5LOV F;  4LF7 O;  4CH6 A;  2YIC A;  4AYB E;  3MR2 A;  2BTQ A;  5JQG B;  3N2K B;  2W9B A;  1L2Z A;  2OWO A;  1RSO B;  1RPR A;  2Q7G A;  2ZM6 O;  1BZK A;  5BMV A;  4PA4 A;  3GTM A;  4RQF A;  4LF9 H;  5LP6 A;  1X9N A;  1FFT B;  2YZM A;  1GSA A;  4DR5 O;  3GII A;  5LA6 B;  4MTF A;  4U3J B;  1Q86 W;  4MVR A;  3D36 C;  4F50 A;  1O9G A;  2QA4 V;  4ASU G;  4WBN F;  4B3M H;  4O4I A;  2BE3 A;  2OYQ A;  3AX6 A;  5H6R A;  4DV6 O;  1SYX B;  5DQH A;  3HOX G;  4X62 H;  1W0K G;  3D36 A;  1QBZ A;  4O2B F;  2CKZ B;  2CK3 G;  1DIK A;  3GTQ A;  3ABK B;  3T5H A;  3OHB A;  4DRF A;  1XMQ H;  1N36 B;  4TV9 F;  1VBH A;  2FP4 B;  1IYD A;  5I5Y A;  1YSC A;  2XCL A;  4JYY A;  1CE8 A;  3IJ4 A;  5JCO C;  2W6N A;  4PEL A;  3J80 W;  5I5S A;  1YF2 A;  3L71 H;  4DRX A;  1W2B U;  2Y69 C;  1NQT A;  3HKE A;  1I50 A;  3G6V A;  3VA7 A;  4B3R H;  5B1A B;  4K8X A;  4DR7 H;  4JV1 A;  3T1C A;  3ZRW A;  2YI9 A;  1IOV A;  2JA6 A;  1MA1 A;  2B9Z A;  3ZJZ A;  4O4I B;  4OPA A;  4YHH B;  2LP7 A;  1GN2 A;  2VQF H;  3SPG A;  2Z04 A;  4O4I F;  2W6Z A;  4LCU C;  4DV0 O;  1AB3 A;  3F5W C;  1GLV A;  1DF4 A;  1P7B A;  1HNX B;  4J9M A;  2F66 C;  3AG4 C;  3D3I A;  2Q0O C;  4PZ7 A;  1OCZ C;  2IH1 C;  2D3O W;  1FS0 G;  5LHG A;  3MWM A;  2L35 A;  2C28 A;  5KHG A;  3WWH A;  4BIZ A;  3BQ0 A;  2B63 A;  1Z2P X;  2EIY A;  2WA3 A;  1EKV A;  2ETN A;  1N33 O;  2ZE7 A;  3L72 H;  3CC2 V;  3A0R A;  2UXC B;  5KFC A;  3HOZ G;  2RN9 A;  4DL5 A;  5JH7 A;  1S97 A;  3RB3 A;  4W4K A;  3FKS G;  2EIK C;  2KSD A;  1M56 B;  4WBN B;  3PW0 A;  1XL4 A;  4E4E A;  5CA1 A;  2WAQ E;  5IWA H;  3SE7 A;  3IC7 A;  4O4J B;  4YIP A;  3ZIA G;  1VQ6 V;  5DGI A;  1V54 C;  4NYK A;  4AIL C;  2B5U A;  2VWK A;  2ODT X;  2EJ7 A;  1J5E B;  3OTO O;  2GTS A;  3E8G A;  3OEH G;  2W6I G;  5DGA A;  4DV5 O;  4NXN O;  2E5L O;  5IT9 N;  2EIM B;  4YBZ B;  4MTD A;  3B8M A;  5IDJ A;  4LF5 B;  4DV6 H;  1CPY A;  3OMA B;  1TAE A;  2W6P A;  2FLL A;  1R6T A;  1NU1 H;  2E75 B;  5LXT A;  3CSW A;  3BPZ A;  2E5L H;  3R66 A;  4QGP A;  2YEV A;  1AR1 B;  1KKC A;  3GLK A;  4FZ0 A;  2ZXW B;  5K1X A;  1E4E A;  1RPO A;  1NH2 B;  5J2U B;  5FPO A;  1AJP A;  3GV8 B;  1ZL8 B;  3J81 W;  2YXL A;  1HNZ B;  2EJ0 A;  5CA1 F;  3HOU G;  1TWG A;  3P30 A;  4JYA O;  3ZHS A;  5L3F A;  2DYS B;  5KG2 A;  3CCL V;  4FLW A;  1ZHS A;  5BYB A;  1I2L A;  1GYF A;  2JS3 A;  2XD4 A;  2Z3Y A;  3VNN A;  5BYA A;  1DK1 A;  4RAI A;  1HNW O;  1EFR G;  4R8C A;  3L2P A;  2HDK A;  2R7K A;  2YRW A;  4O86 A;  4J7K A;  2NNU A;  3UT5 B;  4DYL A;  2Q73 A;  4X1K A;  1Q5O A;  4YIO A;  4KHP H;  3BHP A;  2JA8 G;  4FFN A;  3CRR A;  3T9F A;  4O82 A;  2N05 A;  2VUM G;  4DV2 H;  4F4Y A;  3GTK A;  5KFU A;  3OSP A;  2KB1 A;  3RIZ A;  4TM5 A;  2HG8 A;  2ZIM A;  1KJQ A;  5KAF Z;  2C2A A;  3HB3 B;  1GRJ A;  2UVU A;  2A1H A;  5D5P A;  3A2F A;  4JI6 H;  4LFB H;  1I6U A;  3JCZ A;  2W71 A;  4RZR A;  3FYI B;  3QVN A;  4BIO A;  4I50 B;  2W0X A;  1S68 A;  1ZL8 A;  2PUS A;  1DV1 A;  1Q6I A;  2XTA A;  4JPR A;  3IGA C;  1GMG A;  1WJZ A;  2OH2 A;  3SJQ C;  4I55 A;  5I60 A;  2A06 H;  3X2Q B;  3CCQ V;  2ZT9 B;  3K5N A;  1RK6 A;  4K35 A;  2JA5 G;  3AK1 A;  1GH6 A;  1KQS U;  1I7L A;  5KFQ A;  4A3J G;  4RU9 A;  4CS2 A;  3AYH B;  5DG8 A;  5E1A C;  1XRE A;  4HR7 A;  4DR6 H;  1ZX3 A;  1R9T A;  4B3M O;  3B8N A;  5KG1 A;  4HNA B;  1VBG A;  5J2U F;  4LF6 H;  2W6O A;  2HG5 C;  3BG5 A;  4H33 A;  5LOV B;  1SZT A;  1XL6 A;  2I87 A;  2R7Z G;  4IRK A;  1YTF B;  4XZ3 B;  3KCX A;  2DN9 A;  2EJR A;  1L1F A;  5L3G A;  5IY5 C;  1GSH A;  3ASO C;  1DV2 A;  1NVP B;  1PNL A;  2BTO A;  2BOC C;  3LSU A;  4JTD B;  3K5M A;  1Z2N X;  1AI5 A;  4UCR A;  3T1H O;  4LF4 O;  2EIM C;  3OTO H;  4FS1 A;  2W8K A;  1CS0 A;  1YEW A;  1WP7 A;  2Q9L A;  1SZX A;  3CEB A;  4XDJ A;  4Z1M G;  4F6R A;  4Q8E A;  2LFR A;  2JS5 A;  3MWE A;  5J2T A;  1V55 C;  4H44 B;  4ZHQ F;  1F4M A;  5GW7 A;  4NTX A;  4PI0 A;  3WO1 A;  5DGB A;  2H8P C;  2W6Q A;  3G67 A;  3A0B Z;  3E8F A;  2COJ A;  4EBD A;  1JOY A;  1S5J A;  5DMX A;  2UXD H;  2FLP A;  2YW2 A;  4B3T O;  2UVR A;  3CCE V;  2WPD G;  1IOW A;  2HIV A;  4CMD A;  1SA0 A;  3CXH F;  3GWO A;  3T4Z A;  5KUK A;  4F4X A;  4JTC B;  3ZN0 A;  3MR5 A;  2R8K A;  5FL7 G;  1SER A;  4RB2 C;  5H9C A;  4QIW F;  4UB8 Z;  4JAS A;  4ZHQ B;  4RUF A;  2A7W A;  2RCV A;  2XAH A;  3BQ1 A;  1ORQ C;  1XHX A;  2DQ3 A;  4DL2 A;  5IT9 W;  1N0N A;  3C90 A;  3CRC A;  3S3W A;  2IP4 A;  1N33 B;  5KUM A;  2VWJ A;  4J7J A;  1WB7 A;  4JI4 O;  1XNQ B;  4J9O A;  2NN4 A;  4ABM A;  4MV3 A;  2ZD9 A;  3LSS A;  4PI2 A;  4LMY A;  2LFS A;  4A5U B;  4YJ2 B;  2GDS A;  4JI4 H;  2WAM A;  4CS4 A;  3RJ0 A;  2BQU A;  4XX0 B;  4O7Y A;  2QB5 A;  2FLN A;  3F5T A;  4EFB A;  1EBO A;  5A2Q N;  2GQS A;  5C1P A;  5EOY A;  3L75 H;  1I94 B;  3JAW A;  3OR6 C;  4G27 B;  1A48 A;  2PF4 E;  3PR4 A;  1BCC H;  1S5H C;  1G6U A;  5JVD B;  1RM1 B;  2OTL V;  3KYH C;  1EHI A;  1R3I C;  1WP8 A;  4CC6 A;  5IWA O;  2UUC O;  1F23 A;  2ZCE A;  3GJX B;  1OV9 A;  5L3C A;  4WFE A;  5HBR B;  1HR0 H;  3JZI A;  4KHP O;  1BMF G;  4GLX A;  3RB0 A;  3OFN G;  4GUN A;  5LP6 F;  3JD3 A;  3OD4 A;  3K0G A;  3BCC H;  1AIL A;  1K33 A;  3G6B A;  3GTJ A;  2EIK B;  1H2M A;  1N36 H;  4FM1 A;  1H2S B;  4EB6 A;  4MV9 A;  4GYC B;  4BIU A;  3O65 A;  3BFR A;  1KBL A;  2QK4 A;  3H3V H;  4JI8 H;  4JV5 B;  3T9D A;  1LUW A;  2QF7 A;  4M9U A;  3CXC U;  4ECW A;  1XOU A;  4JI2 O;  5CE8 A;  3HO8 A;  4MW8 A;  4QNH B;  4RO2 A;  1VEW A;  3IG0 A;  2XCP A;  4EBC A;  1EZV H;  1HNW B;  2RF4 A;  1RFY A;  1URF A;  4IYH A;  4ECX A;  2ABJ A;  1EKP A;  2LGW A;  5IYC O;  2ZDI A;  2YS8 A;  5E25 A;  3RT3 C;  3QO7 A;  2WLL A;  4TV8 B;  2XAQ A;  2M6Y A;  1QLE B;  4DUZ B;  3HT5 A;  5KFZ A;  1SCU B;  2JEI A;  2YID A;  4X1I B;  4FLV A;  3BAC A;  5IWA B;  4MT8 A;  3PR5 B;  1BGY H;  2UU9 B;  4X9Q A;  3VQX A;  4R7R A;  3VOU A;  3ZRW B;  2QWN B;  5CB4 A;  5KFT A;  4LR3 A;  2QM7 A;  4J11 A;  4ZOL B;  2GPW A;  1Y76 A;  2NUA B;  4MTO A;  4DV2 O;  3GIL A;  1HP8 A;  4WCE V;  2HLD G;  1BL8 A;  2M7W A;  2C35 B;  1I1K A;  3UM7 A;  5FLM G;  5D1O A;  4P30 A;  4IT5 A;  3EYY A;  1WLE A;  3N2G A;  3H1L H;  3ORR A;  4RB1 A;  1TWH A;  3ZHU A;  1AP5 A;  3ASN B;  1TA8 A;  2R92 A;  5JH7 F;  2NR5 A;  5IYZ A;  3W7X A;  2Q6A A;  2WLJ A;  4EGJ A;  1SA0 B;  4CC5 A;  2Q7H A;  4FK5 C;  4DLK A;  5KFP A;  4Q44 A;  3I56 V;  1VP7 A;  3QQM A;  1N32 H;  1RP3 B;  2V1D A;  2NU8 B;  3TQT A;  4JZ2 A;  1ZHQ A;  2HVQ A;  3C0F B;  3RR5 A;  5K1P A;  4IIJ F;  3J7A K;  2IU3 A;  4LWS B;  4LF7 H;  4JI2 H;  5EZY A;  4YJ2 F;  2XIG A;  1WSC A;  2AZ2 A;  4NXM B;  2HHF A;  2CW8 A;  2Y0S E;  2YYA A;  4AHC A;  3M9M B;  3UO3 A;  3EPG A;  4EQ5 A;  3L4J A;  4DV4 H;  5C3E G;  3KTM A;  1TWC A;  1L0N H;  3U11 A;  4R50 A;  1BHA A;  2HIX A;  4DV0 B;  2AU0 A;  2JRI A;  1S72 V;  2QKS A;  1HW7 A;  2R7Z A;  1JJO A;  2QTO A;  4BWS C;  5KAI Z;  2Y4T A;  1JA8 A;  1Z2G A;  5KT5 A;  5BWU A;  5LMN H;  4UCV A;  2W57 A;  1R3J C;  3RBZ A;  2R86 A;  1JIH A;  1VF6 A;  5EYP B;  5AG2 A;  4ECY A;  5KFX A;  4PD4 F;  4I50 F;  1OZ0 A;  3Q8R B;  3AW8 A;  3MJF A;  3CB2 A;  5D1P A;  1MZB A;  3JD2 A;  4K8Z A;  2ITC C;  3RF2 A;  4U7C A;  5EZY F;  1M0T A;  3SPI A;  2W6M A;  4J80 A;  1SF9 A;  5D8D A;  1GSO A;  2KSW A;  1N32 B;  4D6T H;  1MSD A;  2VOB A;  4A3L G;  1AI4 A;  2UUA B;  3VPC A;  4B3R O;  1UC9 A;  5KKN B;  4AYB A;  2AGQ A;  3RV4 A;  4J9Z B;  1JXL A;  1GAX A;  5BPH A;  3PW4 A;  2HGW A;  3DAA A;  4Z2W A;  5LP6 B;  5B1A C;  1SET A;  4ED1 A;  1RJQ A;  1EN4 A;  2FE3 A;  1IBM B;  3LSQ A;  2W9C A;  3TII A;  4TQF A;  4F4L A;  4TOI A;  2RNB A;  2CFM A;  1WN7 A;  2HFE C;  2FK1 A;  2CZG A;  2V59 A;  3K5H A;  2XOK G;  1IBM O;  5FNV F;  4BBS G;  5GON B;  4H37 A;  1VQ9 V;  2XHB A;  2Q2U A;  4ZQI A;  4GC7 A;  2ZE8 A;  3ZRV A;  2COI A;  3RBD A;  2JJ1 G;  4ECV A;  3AG2 B;  3SYQ A;  2EIJ B;  2JA7 G;  2IU0 A;  3JSN A;  3E35 A;  2ZDH A;  4NKG B;  3QF7 A;  1NH2 D;  1BHB A;  4FE2 A;  1OCC B;  4QW8 A;  4B08 A;  2WDT A;  3W7U A;  4IR9 A;  1MZE A;  1RJR A;  3JRX A;  2VA3 A;  4J41 A;  3VQY A;  1NR7 A;  4YB8 B;  5KFJ A;  4NXN H;  3WB0 A;  4RZQ A;  4J9R A;  2UUB B;  1H8H G;  2R8H A;  4MVO A;  3TQ1 A;  2XND G;  5B1O A;  4JI5 B;  1K83 A;  1AN7 A;  1ROP A;  1JDB B;  4FLY A;  3L74 H;  4TUY A;  3H01 A;  4APM A;  1OCO C;  1N56 A;  1PL0 A;  2DYR C;  4CKB A;  1MOF A;  5IP7 G;  4LSA A;  2JA5 A;  4FFB A;  3T2M A;  1S10 A;  2N74 A;  3LDD A;  1PL4 A;  1AUX A;  4EFE A;  3CWB H;  3OUU A;  1TVK B;  3RUP A;  4HNT A;  1V4Y A;  1I7F A;  3GTL A;  1NJI W;  1NTK H;  4ED6 A;  4JI8 O;  1U97 A;  1B6R A;  4XYM B;  5B1B B;  3PO2 G;  1FVI A;  1KT8 A;  4DR2 B;  2IJI A;  1R6K A;  3ETQ A;  4NB5 A;  4PV1 B;  4LF8 O;  4O3P A;  5LMU B;  3ZS8 C;  1A32 A;  1QU7 A;  4LP8 A;  3CCR V;  4FLZ A;  4ETS A;  2IH3 C;  1R6N A;  4I5S A;  3K9S A;  1SS3 A;  4X65 H;  3T5K A;  2R82 A;  2ZXW C;  3JAT A;  4BAY A;  4F6E A;  3PFF A;  3T1H B;  1R3K C;  3ML0 A;  3K04 A;  2PTM A;  3G8D A;  3N6X A;  3ETD A;  4I0X B;  4FS2 A;  4FIP C;  4JAA A;  2R93 G;  1XNQ H;  2P06 A;  3W7S A;  2ZR3 A;  3LML A;  2Q69 A;  2Q0A A;  4ICG A;  5IJ9 A;  1R1B A;  3G80 A;  4DR4 B;  2WB1 E;  4J9K A;  1P16 A;  2DAB A;  4G28 B;  1FXK B;  1V9P A;  5CBF A;  3I4N G;  3RFR A;  1AVM A;  3E2E A;  2JEF A;  4IWX A;  3CPW U;  3KZI Z;  2EIL B;  1QHT A;  4DW0 A;  2R6F A;  4RNN A;  2BQR A;  4JI7 H;  4C5B A;  3HKZ E;  4DL4 A;  1KUT A;  3HKD A;  5DGH A;  4JI8 B;  3HOY G;  1H2N A;  4DV1 H;  5EIB D;  2UUA H;  5HFM A;  3G4S V;  4FM0 A;  4BWA A;  1Y66 A;  4FFR A;  3JAR B;  4K3A A;  2DW4 A;  1P84 F;  2J6T A;  2ZIO A;  3ABK C;  4MV1 A;  2XUM A;  1EKF A;  4O2B A;  3K9A A;  4AQY B;  4IR1 A;  1N32 O;  2WLL B;  4TV8 A;  5CA3 A;  2EZP A;  2YRX A;  3FDS A;  3I12 A;  2ZGI A;  4O7S A;  2HGX A;  1I1L A;  5GON F;  3ZHQ A;  3UKM A;  4DV0 H;  3LUT B;  3E89 A;  4X62 O;  1M57 C;  2JEX A;  4FM9 A;  5CR5 A;  3SNO A;  3BA9 A;  4GKK B;  4CMF A;  5FD6 A;  4B7K A;  4YP3 A;  1I5Y A;  1KKD A;  3HB9 A;  4X64 B;  2R85 A;  5CA0 F;  1N4C A;  3OTF A;  3WG7 C;  2F93 B;  1XDC A;  4LFA B;  5HFL A;  5LBQ A;  2Q4P A;  3SGI A;  1AUV A;  4GKK O;  1KB9 F;  3W5O A;  3ABM C;  4HBN A;  1MSW D;  3V6J A;  3E8H A;  3HKZ A;  3PJS K;  2ZDQ A;  1YIJ V;  4U3F H;  4QWE A;  2EJ2 A;  4YJ3 B;  3T1Y H;  4CS3 A;  1V54 B;  5BXZ A;  5C8Y B;  4NXN B;  3KAK A;  5DEC A;  3FB6 C;  4DXW A;  3GIK A;  3WFV A;  2R8J A;  2FL4 A;  2VQE H;  3ZX6 A;  3E86 A;  3DXR B;  1QQC A;  2VUG A;  3R5H A;  3L4K A;  4PZ8 A;  4QWA A;  3N2K A;  3BVO A;  3CYO A;  1VAR A;  2YIA A;  5IJ9 B;  3AG1 B;  3T5L A;  4B3R B;  4XDL A;  4A2B A;  1YJW V;  5KHI A;  4NLG A;  1D5A A;  5CA0 A;  3LWB A;  1GN3 A;  4UCT A;  4L87 A;  4D7S A;  1I94 O;  1RYS A;  3VPB A;  1VKZ A;  4FFB B;  1ZLZ A;  4WFH A;  3BY6 A;  3N27 A;  3CMA V;  4JI5 O;  3PW2 A;  2G38 A;  4JI0 O;  3JD1 A;  5KG5 A;  2J6S A;  1S9F A;  3ZRX A;  4GKK H;  5LXT B;  4EKW A;  2F43 G;  4LFA H;  1DTO A;  2X0L A;  1K4D C;  5H5N A;  3K5I A;  4XBF A;  1VS0 A;  4DR3 O;  5LHI A;  2LGQ A;  3JRW A;  1NTM H;  2DE0 X;  2JDI G;  3FB5 C;  3FB8 C;  2PBZ A;  3TEK A;  2RJZ A;  5LMN B;  3V4S A;  1I08 A;  1I3Q A;  4JI2 B;  4FU0 A;  4MV4 A;  2ALZ A;  3TW7 A;  5LMN O;  3U9T A;  1M56 C;  2R9I A;  4B3S B;  3TGU H;  2Q7E A;  3WU2 Z;  3X2Q C;  5KFV A;  1Y1V G;  1AI7 A;  5K3W A;  1B3Q A;  2V4Q A;  4CZZ A;  1I7N A;  5DLF A;  2WLI B;  4YJ2 A;  4X20 A;  2ADP A;  1K5S A;  1V55 B;  3BAB A;  4E2L A;  3U0G A;  1TGO A;  3ZN1 A;  5DAA A;  3MR3 A;  2MCT A;  3AK2 A;  4OGQ B;  4JZG A;  3H1J H;  4DW1 A;  1M1K W;  1JMK C;  3NR7 A;  2WAQ A;  1VQ8 V;  1K5Q A;  4JI6 O;  4EEQ A;  4DR7 B;  4H13 B;  4Q20 A;  1Q7Y W;  2LW7 A;  3HKB A;  4CH5 A;  2CTP A;  1S3J A;  3KHG A;  3ASO B;  4FFP A;  2Q67 A;  4MTX A;  2CNU A;  1Y1V A;  1IX9 A;  5FJ8 G;  2W7O A;  2XAJ A;  2F4V B;  3T7A A;  3U55 A;  2ZE6 A;  2GSM B;  4Q6G A;  2VQD A;  1KJ9 A;  2Q2T A;  4A3B G;  4PA3 A;  4QWB A;  2VQF O;  1I0H A;  3ZCC A;  3OMN B;  5BPF A;  2D2C B;  3GTO A;  1HWY A;  2RDC A;  4OXS A;  4CHI A;  4OPH A;  2Y69 B;  2PI4 A;  2GLT A;  4DV2 B;  5EYP A;  3JAW B;  4PHZ A;  2IMW P;  1Y4M A;  2R9R B;  1FJG B;  3WO0 A;  3OW2 U;  3ABT A;  3DTU B;  2R7M A;  1K7D A;  4LF4 B;  4DIM A;  4MA5 A;  4GT1 A;  4O7T A;  1AR5 A;  2V7Q G;  3EXA A;  1D2D A;  5LA6 F;  4IAJ A;  5KFL A;  5KT7 A;  3JYC A;  3AG7 A;  1ZAU A;  1JDE A;  3SYP A;  5LGN A;  4WFG A;  4X62 B;  3N41 B;  5EBM C;  3C3S A;  4U7O A;  3FYE B;  3RW0 A;  5L3D A;  4HNU A;  5KFA A;  4FM2 A;  4U3J A;  2UXC O;  3GV7 B;  3SPJ A;  2JGD B;  3W1G A;  2JA6 G;  1DAA A;  2NU6 B;  1W59 A;  4DRX B;  1FXK A;  4X89 A;  3CRA A;  3RGX A;  3NBZ B;  5FNV A;  4X66 B;  1M5I A;  1RSO A;  4ZI7 A;  4IWY A;  3S24 A;  1M90 W;  1VQM V;  2W9B B;  4I7Z B;  1WRV A;  2UUC B;  4Q4C A;  4AI8 A;  4R8U A;  5A9G A;  3JAS B;  2UXB B;  4Q45 A;  4JV2 A;  1R3L C;  4A3M G;  4XYL B;  4UCU A;  1KTA A;  1FFX B;  2DOS A;  5LYJ A;  2FPG B;  3LDE A;  3ETJ A;  2AQ4 A;  2EX3 A;  4FZ1 A;  5LA6 A;  4PDR A;  5L1J A;  3M4I A;  2EIN C;  3DSQ A;  2L6L A;  2E5L B;  4JYA H;  4MVM A;  5JVL A;  2ZNI A;  1S76 D;  4MTG A;  4QWD A;  1C30 A;  4EB6 B;  1XMO B;  3HKD B;  2Y0I A;  4L1K A;  4YY3 H;  4K0K H;  2QTS A;  1AP6 A;  2QWR B;  3CCM V;  3STL C;  5H6Q A;  4O3N A;  2KG7 B;  4O2A A;  2LQT A;  1Z5V A;  1MG1 A;  4P9O A;  4MV8 A;  1I5X A;  1AJN A;  2QDO A;  2WLN A;  2R84 A;  2I8C A;  4O7L A;  4TUY F;  2DYS C;  4A3K G;  3AG3 C;  5LGT A;  4JI0 B;  4CE5 A;  3QG5 A;  5GTH Z;  1TVK A;  3SJB C;  1B33 N;  5EIB C;  1E4F T;  3H20 A;  3IFX A;  4ECZ A;  4OX9 B;  1OWT A;  4RUE A;  4JI3 B;  2W9C B;  1NS1 A;  1XIL A;  3SJA C;  5LYJ F;  5KA5 A;  3DGE A;  2EJ3 A;  1OCR C;  5IJ0 B;  2VUM A;  5C1O A;  3RYH A;  5I5V A;  4TQR A;  3BRC A;  5GTI Z;  4IRD A;  3E5N A;  4JI3 O;  2X6C A;  4X65 O;  5C4X G;  5JJE B;  5CAE B;  3D3Q A;  5E79 Z;  3ZMS A;  4JV0 A;  4MAM A;  1KYO F;  5DQG A;  3SPH A;  1PNK A;  3B2E E;  2UUB H;  4IIJ B;  3PW7 A;  4DL3 A;  4DV1 B;  1KJ8 A;  1Z5W A;  1IBL B;  4LF6 O;  4DQN A;  1MAB G;  2GPS A;  4J9Y B;  4DL6 A;  3ZED A;  3ZHV A;  2Q68 A;  4DV1 O;  5KFN A;  4ZBM A;  4JTA B;  2FPP B;  1N33 H;  1FKA H;  4ECT A;  2YZG A;  4TQD A;  4AQY H;  2KQX A;  2UVW A;  3KHH A;  2VA2 A;  1GKF A;  3EPI A;  3JAL A;  2FPI B;  4DV3 B;  2ASL A;  1A3G A;  4O4H F;  1IXB A;  3HBL A;  3UZO A;  1I1M A;  3NXS A;  4JI3 H;  2RGV A;  3H40 A;  2HR3 A;  4GZR B;  5EK0 A;  4LBE C;  2YS7 A;  5FLX W;  4GKJ B;  5LMU H;  1EM1 A;  4LWS A;  2P67 A;  2FYU H;  4LFC B;  3RAX A;  3R5F A;  2WE6 A;  1FFX A;  4HNV A;  3KG2 A;  2YWV A;  3ETH A;  2CAZ C;  1I94 H;  2RGR A;  2P5O A;  2QKC A;  4O7W A;  2ZKO A;  1TWF A;  1YJ9 V;  5EWG A;  2NVY A;  1IBL H;  1BSM A;  3NC0 B;  5DLG A;  3KXY T;  1T94 A;  5A2Q W;  3CCV V;  5LOV A;  3F7V C;  1QVG U;  2UU9 O;  4ME6 A;  4MW3 A;  1FAF A;  4O7V A;  3GIM A;  4DV7 H;  3C3T A;  2PN1 A;  4X8A A;  4PJ0 Z;  3MAQ A;  2BR0 A;  3RGB A;  4X66 H;  4DR7 O;  1PPJ H;  2FTK A;  2Y0P A;  3T1Y B;  3FX7 A;  4R7C A;  4UV8 A;  5EBW C;  1KJJ A;  2PMZ A;  3H0G A;  4B3T H;  3GB8 B;  4RWU A;  3K3V A;  1WB8 A;  2YC0 A;  1E4G T;  4WF9 V;  3WG7 B;  4W4L A;  1FXV A;  4EGQ A;  2A3Q A;  1K97 A;  3R65 A;  2C22 A;  5KFG A;  1SQV H;  1K4C C;  1N8R W;  3TIN A;  2XT9 A;  2AZ0 A;  3UFX B;  5CB4 F;  5KFD A;  3RTX A;  2FB5 A;  1IVS A;  3ZHT A;  2MK3 A;  3RYF B;  4TV9 A;  2ZDG A;  4NVP A;  2EUL A;  5BMV B;  2DWD C;  3H0G G;  1PKX A;  3RYI B;  1NKD A;  3GTG A;  3I5D A;  2VPS A;  2DWC A;  2F4V O;  3UYY A;  1U96 A;  3Q2O A;  3CCJ V;  4EBE A;  3E22 A;  3RVY A;  1OBD A;  2WLK A;  1J95 A;  5KG7 A;  4O3R A;  4ED3 A;  1WPB A;  1YDX A;  4JAU A;  3CS5 A;  4I0X A;  1BJT A;  3FAV B;  3JSL A;  4LH6 A;  3T99 A;  4RUA A;  1CKM A;  1TUB A;  1GK9 A;  4O7R A;  2EZO A;  3RN4 A;  2IM9 A;  5LL6 Y;  1PNM A;  4C7U A;  3OUS A;  4F6R B;  1VQN V;  2UUA O;  5D1O B;  1CQJ B;  1P8L A;  5CBG A;  2HVK C;  4FJC C;  4KP4 A;  3I4M G;  3JAK B;  2CGN A;  3SR2 C;  1JCH A;  5FD5 A;  2ARH A;  1TUE B;  2OCH A;  3NGD A;  4DR5 H;  3CVZ A;  4JYB A;  4NTW A;  4B3S H;  3GV5 B;  5KX5 F;  1HNZ O;  4RUC A;  5JQW A;  3SYC A;  2C00 A;  2OLS A;  1NBM G;  4IGG A;  3HOV G;  4M0J A;  4UVA A;  4ED0 A;  4B7E A;  5IJ0 A;  2ATK C;  5HNE A;  3F7Y C;  1T3N A;  2JVD A;  4X64 O;  3JAT B;  1K73 W;  2Y4U A;  2YZL A;  2R70 A;  4YR3 A;  1BQZ A;  3UZB A;  1SES A;  1SC5 B;  3CP1 A;  4ED8 A;  4O3O A;  1N34 B;  1HNW H;  4PDM A;  3MWD A;  3ABU A;  3W7W A;  4DUY O;  3B40 A;  3CEI A;  4ECS A;  4I9W A;  5KX5 A;  1KEC A;  1UPG A;  4J9Q A;  2QJ1 A;  1BXR A;  4J7Z A;  1XMO O;  3JAK A;  3LDC A;  4DV4 B;  4P2Z A;  1UJW B;  1QNM A;  2N04 A;  4LFC H;  5LXT F;  4O4J A;  4OX9 H;  4DUY B;  3M99 B;  3V4Z A;  4BW5 A;  3ZMT A;  1XMQ O;  1VMG A;  2C2R A;  4DR5 B;  1CXZ B;  2R93 A;  3HOW G;  3CRM A;  2OIE A;  5I47 A;  2V4R A;  4DK0 A;  4R8U B;  1ZTE A;  1XMQ B;  1Y74 B;  3MFI A;  4MVQ A;  1QR9 A;  3OE7 G;  3ZHR A;  2P4K A;  2FJZ A;  1BT8 A;  1D5N A;  4DO2 A;  4O4L A;  3MHS C;  2R8I A;  2LO1 A;  2JGD A;  3QTC A;  2CNQ A;  3A0H Z;  3WB2 A;  1XNR O;  1WCM G;  4GX5 A;  2HGS A;  4KUM A;  3IC9 A;  4GX0 A;  2IBK A;  4FFL A;  1SQX H;  5LHH A;  2IJJ A;  1L8D A;  1E1R G;  5C8Y F;  3FMA A;  4G2K A;  4QW9 A;  4O7Z A;  1XMO H;  1OHH G;  3B09 A;  3K57 A;  4G3I A;  1S5L Z;  1KMI Z;  4ZIB A;  4PZ6 A;  2Y48 A;  4TT3 G;  3MR6 A;  5EC1 C;  5JUM A;  3BA8 A;  4RB3 C;  2IJH A;  2WSS G;  2UVV A;  5B1B C;  2BOB C;  3EVK A;  4QPJ A;  4UXN A;  3KCY A;  4HZ3 A;  1CP9 A;  4XDK A;  2AHY A;  1B06 A;  2CH7 B;  2ZDI C;  3WB1 A;  3LQS A;  5B3S C;  1KBH A;  1XUQ A;  4DR2 O;  5HV6 A;  2M05 A;  3KHL A;  3QFF A;  4ZI7 B;  5KFH A;  4ZHQ A;  1RYR A;  2CGO A;  4R6Z A;  4ECQ A;  4O4L F;  1O75 A;  3GIJ A;  4QPK A;  4A93 G;  3K0D A;  4HAM A;  2Z0A A;  1XK5 A;  2YEV B;  1TUB B;  4RAZ A;  4O2B B;  4BY1 G; 
#chains in the Genus database with same CATH homology
 2PY5 A;  3N44 B;  4FFB B;  4LF4 H;  1IBK H;  1M4U A;  5KX5 B;  4X1K B;  4GKK H;  2BTO A;  4NXM H;  3K5M A;  5LXT B;  1Z2N X;  3OTO H;  4UCR A;  3N2G B;  2QM4 A;  1DGS A;  5JQG A;  4LFA H;  1YEW A;  3HXL A;  1M93 A;  4F6R A;  3SJC C;  2JS5 A;  1VS0 A;  1B04 A;  2UXC H;  5J2T A;  5ITZ A;  1JFF A;  1XQ8 A;  4PI0 A;  1SQG A;  5JCO A;  2BTQ B;  2VQF B;  2RJZ A;  5LMN B;  2UXD H;  1S5J A;  4JI2 B;  3RYH B;  4D7T A;  5CA1 B;  1HR0 B;  3N40 P;  4DV5 B;  1SQF A;  4O4H B;  5JH7 B;  1SA0 A;  2HIV A;  4DUZ H;  2UXB H;  5DIS C;  2YIB D;  4RB2 C;  4B3S B;  4A2A A;  4DR6 B;  2Q7E A;  4ZHQ B;  4B3M B;  1XHX A;  4IIJ A;  4DV6 B;  4LF5 H;  5IT9 W;  4YJ2 A;  1N33 B;  4X20 A;  3BAB A;  2VWJ A;  1TGO A;  3IAY A;  2CW7 A;  2MCT A;  2JGU A;  1XNQ B;  1WNS A;  4JI7 B;  3T1H H;  4YJ3 A;  1JMK C;  4O2A B;  4LMY A;  4PI2 A;  1KU9 A;  4EEQ A;  5CB4 B;  4BW9 A;  4YJ2 B;  4DR7 B;  4JI4 H;  3HKB A;  4CS4 A;  4CH5 A;  3RJ0 A;  1VF7 A;  1P49 A;  4EFB A;  4DR2 H;  2WYO A;  4KL1 A;  5KMG B;  2PYJ A;  1X4T A;  5EOY A;  2HHH H;  2F4V B;  1CKO A;  4DV7 B;  1I94 B;  3F8N A;  4LF8 H;  3JAW A;  2V4D A;  4X1I A;  5LYJ B;  3K5O A;  4Q6G A;  1G6U A;  5JVD B;  2Q2T A;  3KYH C;  3PN1 A;  3TY9 A;  3N43 B;  4M7E A;  4CC6 A;  4LFB B;  2ZCE A;  3GJX B;  5FNV B;  4MV7 A;  1HR0 H;  1HNZ H;  4DR4 H;  4RAY A;  4GLX A;  4ZOL A;  3KAJ A;  4LSX A;  4DV2 B;  5EYP A;  3JAW B;  4PHZ A;  1FJG B;  3JAM W;  4YHH H;  4YY3 B;  5FPR A;  1Q8I A;  4K0K B;  4DR3 H;  1N36 H;  4LF4 B;  2ZNJ A;  4FM1 A;  3W1B A;  5KMG A;  1H2S B;  4EB6 A;  4MV9 A;  4GYC B;  4IAJ A;  4JI8 H;  4WBN A;  4JV5 B;  1ZAU A;  3OTO B;  1O9H A;  4MTE A;  2GV9 A;  4X62 B;  3N41 B;  2E3C A;  4U3J A;  4FM2 A;  4JI5 H;  4FLX A;  4Q0Y A;  3W1G A;  3GDE A;  5BR8 B;  3IG0 A;  4DRX B;  3JAS A;  2F1M A;  4DV3 H;  2HVS A;  1HNW B;  3RGX A;  3NBZ B;  5FNV A;  4X66 B;  1M5I A;  4X65 B;  1RSO A;  4ZI7 A;  3S24 A;  4I4T B;  4TV8 B;  2UUC B;  4LF7 B;  3JAS B;  4DUZ B;  2UXB B;  4UFZ A;  3M7M X;  4UCU A;  1FFX B;  4X1I B;  5LYJ A;  4FLT A;  2EX3 A;  4FLV A;  5LA6 A;  3CSX A;  5IWA B;  2ZM6 B;  3M4I A;  3LNN A;  3HKC A;  2UU9 B;  3VQX A;  4R7R A;  3DSQ A;  3UT5 A;  3K59 A;  2E5L B;  5CB4 A;  4JYA H;  4LR3 A;  4ZOL B;  2ZNI A;  4EB6 B;  1XMO B;  5J2T B;  3HKD B;  5D5Q A;  1J5E H;  4YY3 H;  1N34 H;  4K0K H;  4JI6 B;  5D1O A;  4O2A A;  4X64 H;  1Z5V A;  1XDN A;  3N42 B;  3EYY A;  3CHX A;  3N2G A;  4RB1 A;  3U0Z A;  4E6N A;  4FLU A;  4IHJ B;  4LNU A;  4JI0 B;  3QG5 A;  2HVR A;  1TVK A;  3SJB C;  3H20 A;  5EIB C;  1E4F T;  3RYC B;  2UXD B;  1CKN B;  1TA8 A;  4OX9 B;  4KHP B;  2R9A A;  4JI3 B;  3KAL A;  5IYZ A;  3SJA C;  2HHH B;  3RYC A;  4LF6 B;  1SA0 B;  4CC5 A;  2Q7H A;  5IJ0 B;  4LF9 B;  4IHJ A;  3RYH A;  1N32 H;  3BRC A;  3FFQ A;  4O4H A;  1SKV A;  1ZHQ A;  2HVQ A;  3C0F B;  1T5E A;  3TY8 A;  3RR5 A;  5JJE B;  1XNR B;  5K1P A;  1CKN A;  2YCH A;  3J7A K;  4X1Y B;  4LF7 H;  4JI2 H;  5EZY A;  2XIG A;  3RYF A;  4NXM B;  2CW8 A;  1JFF B;  5ITZ B;  3B2E E;  3ICX A;  4IIJ B;  4AHC A;  2UUB H;  4DV1 B;  4EQ5 A;  1Z5W A;  1IBL B;  3L4J A;  2ZM6 H;  4DV4 H;  2YIB A;  3VQW A;  4X1Y A;  2RQ6 A;  3U11 A;  3HKC B;  1Z2O X;  4DUY H;  2HIX A;  5KHH A;  4DV0 B;  4JI1 B;  3ZED A;  1XHZ A;  1HW7 A;  4JI4 B;  2ZIN A;  1JJO A;  2KKW A;  1M0W A;  3VQV A;  4BWS C;  2PGG A;  5IYZ B;  1N33 H;  1FKA H;  4CH4 A;  4TQD A;  4AQY H;  5LMN H;  4UCS A;  4UCV A;  2PZS A;  1NT2 B;  2W57 A;  3JAL A;  5CA0 B;  2R72 A;  4DV3 B;  5LL6 b;  3K58 A;  5EYP B;  4CH6 A;  3CB2 A;  5D1P A;  1MZB A;  4TUY B;  4K8Z A;  3RF2 A;  4DR1 H;  2BTQ A;  5JQG B;  3N2K B;  1M0T A;  4JI3 H;  1L2Z A;  2OWO A;  2RGV A;  2Q7G A;  2YI8 A;  5BMV A;  3K5L A;  2KSW A;  5FLX W;  4LF9 H;  4GKJ B;  5LP6 A;  1N32 B;  5LMU H;  1X9N A;  2VOB A;  2UUA B;  4CH3 A;  1XNR H;  5LA6 B;  4U3J B;  4LFC B;  1O9G A;  2WE6 A;  1FFX A;  4B3M H;  4O4I A;  2CAZ C;  1I94 H;  2RGR A;  2OYQ A;  2P5O A;  1SYX B;  5LP6 B;  4X62 H;  4I55 B;  1IBL H;  2FE3 A;  1IBM B;  3NC0 B;  4UCO A;  3TY5 A;  3KXY T;  4TQF A;  5A2Q W;  1IBK B;  4DRF A;  1XMQ H;  5LOV A;  4TOI A;  1N36 B;  4I50 A;  2CFM A;  4I4T A;  1WN7 A;  4DV7 H;  3QWU A;  5JCO C;  4X20 B;  3MAQ A;  5GON B;  3RGB A;  3J80 W;  4X66 H;  2XHB A;  2Q2U A;  4DRX A;  3T1Y B;  3RGZ A;  4RB0 A;  3HKE A;  4B3T H;  4PDB A;  4B3R H;  3GB8 B;  4K8X A;  5JVD A;  4DR7 H;  3JSN A;  3K3V A;  2YI9 A;  3QF7 A;  1XI1 A;  5BR8 H;  1E4G T;  1S03 G;  3HKB B;  5C8Y A;  4O4I B;  4B08 A;  4YHH B;  4DR3 B;  2WDT A;  2VQF H;  3VQY A;  4NXN H;  1HNX B;  2F66 C;  3WB0 A;  3RTX A;  4RZQ A;  2UUB B;  3RYF B;  4PZ7 A;  4TV9 A;  4NVP A;  5BMV B;  3RYI B;  3RWR D;  3MWM A;  4JI5 B;  1AN7 A;  5KHG A;  4FLY A;  3THO A;  1Z2P X;  2VPS A;  4TUY A;  4APM A;  4DV5 H;  4LH7 A;  3BAA A;  2UXC B;  3E22 A;  5J2U A;  5JH7 A;  1WPB A;  4LSA A;  4FFB A;  4EFE A;  1TVK B;  1BJT A;  3JSL A;  4LH6 A;  4JYA B;  1I7F A;  4WBN B;  1CKM A;  1TUB A;  4J0M A;  2IM9 A;  5CA1 A;  5IWA H;  1FVI A;  4O4J B;  3JAR A;  4F6R B;  2PYL A;  4DR2 B;  3UQ8 A;  5D1O B;  1P8L A;  5KHK A;  3JAK B;  3ETQ A;  5LP6 C;  3SR2 C;  4AIL C;  5FD5 A;  5LMU B;  3ZS8 C;  2VWK A;  4FLZ A;  4DR5 H;  1J5E B;  3CVZ A;  4ETS A;  5EZY B;  4B3S H;  4X65 H;  3JAT A;  4MTD A;  3T1H B;  4LF5 B;  4DV6 H;  2PTM A;  1TAE A;  5LXT A;  2O03 A;  1Q3E A;  3BPZ A;  1Q43 A;  5IJ0 A;  2E5L H;  3N6X A;  2HEP A;  4JI0 H;  4LF8 B;  1FJG H;  2JVD A;  1XNQ H;  5K1X A;  3JAT B;  3LML A;  3DF7 A;  3E22 B;  2Q0A A;  5FPO A;  5J2U B;  2ZJT A;  4LNU B;  3J81 W;  2R70 A;  2YXL A;  5IJ9 A;  1HNZ B;  4DR4 B;  1WH2 A;  1P16 A;  1V9P A;  1N34 B;  5GON A;  3RFR A;  1HNW H;  4FLW A;  1ZHS A;  1QHT A;  1GYF A;  4JI7 H;  3VNN A;  4JI1 H;  4I7H A;  3HKD A;  3RYI A;  5KX5 A;  3L2P A;  2QJ1 A;  4JI8 B;  4L8J A;  2VQE B;  3JAK A;  4DV4 B;  5EIB D;  4DV1 H;  1A0I A;  3UT5 B;  2UUA H;  4JV5 H;  4X1K A;  1Q5O A;  4BWA A;  4FM0 A;  4LFC H;  3JAR B;  4O4J A;  3BHP A;  4OX9 H;  4KHP H;  4DUY B;  2UUC H;  2ZIO A;  5JJN B;  5KHJ A;  4DR5 B;  4DV2 H;  2F4V H;  4GKJ H;  1IBM H;  4O2B A;  4DK0 A;  4DK1 A;  4AQY B;  3RIZ A;  2ZIM A;  4TV8 A;  4HNA A;  2F95 B;  1XMQ B;  5D5P A;  3A2F A;  4JI6 H;  4LFB H;  1BGW A;  3HKE B;  1I6U A;  5JJJ B;  4TV9 B;  4DV0 H;  4FVM A;  4FM9 A;  4O4L A;  4I50 B;  1S68 A;  3BA9 A;  4GKK B;  5FD6 A;  3NBY B;  2PUS A;  3QTC A;  4X64 B;  3WB2 A;  3OTF A;  2F93 B;  4LFA B;  2HGS A;  4I9Q A;  3SGI A;  1SEI A;  3W5O A;  1L8D A;  3FMA A;  4HBN A;  4I55 A;  1XMO H;  2P22 C;  3K57 A;  1KMI Z;  4ZIB A;  4YJ3 B;  4CS3 A;  4NXN B;  4PZ6 A;  5C8Y B;  3KAK A;  3T1Y H;  3K5N A;  3BA8 A;  4RB3 C;  2UU9 H;  2VQE H;  1QQC A;  4O4L B;  2VUG A;  3L4K A;  4PZ8 A;  3WB1 A;  4DR1 B;  4CS2 A;  3N2K A;  5IJ9 B;  4B3T B;  2YIA A;  4ZI7 B;  4ZHQ A;  4B3R B;  4DR6 H;  1O75 A;  4A2B A;  1HNX H;  4HNA B;  3U10 A;  5KHI A;  4LF6 H;  1XK5 A;  1D5A A;  1TUB B;  3JAL B;  5CA0 A;  4O2B B;  4RAZ A;  5LOV B;  4UCT A;  4D7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...