1TAEA

Structural rearrangement accompanying nad+ synthesis within a bacterial dna ligase crystal
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
321
structure length
321
Chain Sequence
b'QPLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFPPEEAETV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase, NAD-dependent
publication title Structural rearrangement accompanying NAD+ synthesis within a bacterial DNA ligase crystal.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 104
structure length 321
sequence length 321
chains with identical sequence B, C, D
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1taeA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 1taeA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1taeA02
2CFMA 4LFBB 3W1GA 3TY9A 1TA8A 4GKKB 4EFEA 1XNQB 3GB8B 1XNRB 4DR5B 4DV2B 4LFCB 5FPRA 4EQ5A 4DV4B 1IBMB 4TOIA 4B3TB 4X64B 1XMQB 3W5OA 1N36B 4B3RB 4DUYB 4UCOA 4JV5B 4OX9B 4LF5B 1FJGB 1XDNA 4LH7A 2UXDB 4DR7B 3BA8A 2VQEB 1N33B 3NBYB 3S24A 4JI4B 4KHPB 1TAEA 2OWOA 3GJXB 2UUCB 5D1OA 1CKNA 5DISC 3RTXA 3JSNA 1X9NA 4PZ6A 4JI7B 3BA9A 3BABA 1I94B 1IBKB 4B3MB 4LF7B 1CKOA 3NC0B 4DR6B 1XK5A 1V9PA 1P8LA 1J5EB 4JYAB 4LF4B 2HVSA 4JI3B 5BR8B 2UU9B 4DV6B 2HIVA 3T1HB 1N34B 2UUBB 4UFZA 4DV5B 4LH6A 3KYHC 3PN1A 4NXMB 2ZM6B 5D1OB 4DV0B 1CKNB 4B3SB 3TY5A 1ZAUA 2UUAB 3RR5A 4PZ7A 3BAAA 2HVQA 3VNNA 4EEQA 4DR1B 4LF9B 4NXNB 5LMNB 1HNZB 4UCTA 3GDEA 3W1BA 1FVIA 4DRFA 4DR4B 5D1PA 1N32B 4LFAB 1A0IA 2HHHB 2HIXA 4DR2B 1DGSA 4JI2B 3T1YB 4UCUA 2UXCB 4K0KB 2UXBB 4JI0B 1B04A 3UQ8A 1VS0A 5FPOA 2VUGA 2Q2TA 1HR0B 4JI5B 5IWAB 4E6NA 1XMOB 1HNXB 4CC5A 4UCSA 2VQFB 5LMUB 4CC6A 3JSLA 4YY3B 4GLXA 1IBLB 4DV1B 4UCVA 3OTOB 1CKMA 4X62B 2E5LB 4JI6B 3NBZB 4JI8B 3SGIA 3L2PA 4GKJB 4DV3B 4LF8B 2F4VB 1P16A 4DV7B 4EFBA 4AQYB 4DR3B 3TY8A 2Q2UA 4LF6B 4X66B 4DUZB 1S68A 4UCRA 3QWUA 4PZ8A 4YHHB 1HNWB 4JI1B 2HVRA 4X65B
chains in the Genus database with same CATH superfamily
3W7XA 3SYOA 1M0TA 3W1GA 5EIBC 2CNUA 2ZGIA 2ZQMA 5EWFA 1M7JA 4O3OA 5EC2C 4B3TB 2A9HA 1PV0A 4G27B 3BHPA 1N4CA 4C5AA 2IJHA 2Q8VA 1FS0G 2W6PA 2JEIA 4ECYA 3K3VA 3GTMA 3HBLA 1FXKB 4ZI7B 4X65H 3T9BA 1BS3A 2CAZC 2UUCB 5IY5B 2W9CA 2OIGA 3F5TA 3PO2G 1BQ0A 5AG2A 5C8YB 4FZ0A 3T9CA 1MA1A 1WLEA 1KBHA 5A2QW 2B9ZA 3OM3B 5FNVA 2GPWA 2ZXWB 5GONA 4RQFA 1AN7A 3H9VA 4LWSA 5BWRA 3T5KA 2P4KA 3JYCA 3VQVA 4J41A 5B1AB 3CSWA 3PN1A 1K97A 5CBGA 2UUCH 4TV9A 4DV0B 3JAWA 5KG2A 3B09A 4Q44A 3LWBA 1S76D 2QA4V 2K1EA 1NR7A 1QR8A 3Q1KA 3DAAA 2A3QA 3RBZA 4EEQA 1H2NA 4FS1A 1M57C 3BFRA 3SYAA 3MR5A 1PD3A 3SPCA 5CA1A 2JDIG 4RNMA 2XCAA 1JR9A 2E5LO 4JI6O 4QIWA 2KG7A 1DGSA 1W2BU 1PP9H 1MNGA 1NI8A 2QR4A 1GN3A 3N2GA 5D5QA 3E8GA 1AP6A 1B04A 4DV3O 1N8RW 3ZHTA 4DV0H 4A3IG 4ZOLB 5IWAB 2VOBA 2WDTA 3ASNB 1VQ5V 2W0XA 3JD4A 4PDMA 1PNKA 2DW4A 4X66O 4IR1A 4YIPA 2DMXA 4X9QA 4ASUG 4FFNA 5K1XA 2C35B 5KFJA 3M99B 5CA1F 2XCPA 2RGRA 3ETEA 1FFTB 4DV1B 2J6TA 4U3FH 1ZL8B 4QIWF 1BQZA 2JEJA 3F5WC 3SGIA 4MV7A 3MWMA 3HKBB 4B3MO 5H5NA 4YR0A 5IE9A 4P2ZA 2EJ7A 3CCRV 1GGOA 1N56A 4J9QA 4J7JA 3B40A 4AQYB 1R73A 1O75A 5IWAH 2Q6AA 2IJIA 1HW7A 2DQ0A 3QTCA 4TV9B 2FPPB 5DGIA 1RJQA 3ZRWB 2WYOA 2C28A 4GX1A 2R93G 2PTMA 2X6AA 5DG8A 5LOVB 2UXDO 2F1MA 3VBBA 1UJWB 2Y69C 4BWAA 5KT4A 5EZYB 1NVPD 4O7YA 1TWGA 3CRAA 4JAUA 2HVKC 3AEIA 1KJ8A 2QWQB 4AQYH 3V6JA 2HGSA 4PHZA 4NKGB 3CCSV 1K4CC 4JV0A 1VQ4V 3TETA 5IDJA 1S0VA 1Y1VA 5KT7A 3K03A 5BR8O 3TQTA 4OX9B 2YIBA 4JASA 4LF5B 1MZBA 3ORRA 4PDBA 3N2KB 1Q82W 3CRMA 2Q4PA 1JA8A 4KHPB 1KKDA 4RZQA 1JX9A 1CKNA 3JZ6A 1JXLA 1OV9A 1TWFA 4A3CG 1I2KA 1M57B 5KHHA 1IBKB 4ZHQA 5KX5A 5EBWC 4Q20A 5I5XA 4FFLA 4ECXA 4HN2A 3T4ZA 4ED2A 2BCCH 3ASOC 4OX9H 4LF5H 2WSSG 2XC9A 1N34B 4MA5A 1RYRA 2IU0A 2ZKOA 2CTQA 4YAJB 3CYOA 1SESA 5KFNA 2KQXA 2Q67A 2XGPA 2C2RA 4TQRA 4LF6O 2V9WA 3FYEB 2CH7B 1XILA 1ZX3A 4QE9A 3RR5A 2CQYA 2R7ZA 2JJ2G 2F95B 4F6RB 4I7HA 3TIGA 2ZR3A 1T3NA 1TVKB 4EGJA 2JS3A 4JYBA 2ZJTA 4TM5A 1YXBA 2W9BA 2XT9A 5JH7B 1JVMA 4R6ZA 4BBRG 4IIJF 1BSMA 4PDRA 1DV1A 5LYJF 2ODTX 1S0MA 3UT5A 3RGXA 4Q8EA 5H6RA 4TQDA 4JI2B 4FBTA 1HDJA 3Q8SB 2WTFA 4ED1A 3L72H 3K58A 2GUZA 1P84F 2AXTZ 4FLWA 1HR0B 3HOVG 1F7YA 4F4LA 4I9QA 1BHAA 1G4YB 1ULZA 4ZIBA 3B8NA 4W4KA 2UVUA 3K9SA 4FFOA 4LCUC 2YXLA 4CH3A 3N42B 2EIMC 5IYBO 1IBLB 1XREA 2CNVA 4KFMA 4ZHQB 2Y69B 2R7KA 3OTOB 3T9DA 1XEQA 4JI2H 4QWCA 3R23A 2FTKA 2WE6A 2WAMA 2R7ZG 1HR0H 1SETA 4I50B 2R8GA 1KU9A 1GN4A 1S5LZ 2XUMA 2BSKB 3I4MG 4MW3A 2OTLV 3GTLA 3JD1A 4ZKIA 5ITZA 5IT9N 1Q8IA 1XHZA 1N36O 1M1KW 4YQWA 3ABUA 5BWUA 1Z5WA 3U55A 3V4SA 4O3QA 3ZBHA 2AZ0A 1IBLH 2JEUA 4Q4CA 3OAAG 5KG4A 4FM9A 3OTOH 4PDLA 5IP9G 3ZHSA 2A79B 3OMIB 3LQSA 2KKWA 4QE7A 4U3JB 2W8KA 4CZZA 2Y48A 1JFFB 2BOCC 3CE2A 4RAZA 1PNLA 4DR5B 4EB6A 3HKCB 5E1AC 1J5EO 3ASOB 4JI0O 2ZCEA 3RYFA 1Z2NX 2FB5A 4OPAA 4I9WA 3A0RA 1QLEC 4CS4A 1W96A 2W6NA 4Q43A 2YYAA 5KFBA 3GJXB 3OW2U 3CMAV 3V6KA 3D3QA 4FLZA 1X9NA 1GMGA 4YP3A 4DR5H 2RMKB 5KUKA 4XYMB 3NC0B 1CKOA 4Q45A 4DRXB 1KQSU 2OT5A 3EXAA 4J9YB 2R84A 1KUQA 5KFDA 5DQHA 1SCUB 2V4DA 4TQSA 2YW2A 5KFFA 4IWYA 4PA4A 4FPPA 2IBKA 1S9FA 2ARHA 5FJ8G 1V54C 5J2UB 3VA7A 4DL3A 5EWGA 2Q7DA 3RB4A 1K7DA 1DF5A 1H2SB 3CC7V 2IW5A 3FAVB 4YY3O 2EIMB 1F51A 5D1PA 1YITV 4NZMA 3G71V 3WO0A 2GQSA 2QKAA 3H01A 4B3TO 5LGUA 4JV2A 3IC7A 2Y0SE 3T5JA 2DWCA 1FKAH 4O82A 4FLXA 2VQDA 4O7SA 5I5VA 4O3SA 3N44B 4CC5A 3OMAB 3AG2C 3SJQC 1T94A 2UVWA 1HNWO 2B63G 2ZDHA 4O81A 4IGGA 1KECA 4FLYA 3T5HA 1KJIA 3M8AA 3JCZA 2A1HA 3ZHQA 2PI5A 2RGVA 5T14A 2HJDA 1AUXA 4JZ2A 2R82A 1LNQA 2Q0OC 4PELA 4ED0A 4FE2A 3MD0A 3SI8A 3R65A 4BW9A 4TUYB 1IOWA 4IYIA 1QLEB 5L3FA 4EEYA 4R50A 3D3IA 4CKEA 5I5WA 3MR2A 1AROP 3DTGA 1XNRB 3FMAA 3KAJA 2ITCC 1NVPB 4O2BF 4OXSA 3JALA 5JVLA 5LGNA 4DUYB 2UU9O 4DQNA 4B7KA 3ZN0A 2YEVA 1VQ9V 2E75B 1N33B 2Q7EA 3CVZA 4R7RA 3UYYA 1V54B 3DC5A 3RTXA 3T1CA 2H3OA 3MHSC 1XNRH 3L71H 4DV1O 4F50A 4LF7B 3TXSA 3K5MA 2YS7A 1JIHA 2Q9LA 5LHIA 4KL1A 3OE7G 1P8LA 1VF7A 2N74A 2GLTA 1RPOA 4JTCB 2HVSA 4DUYH 5KFSA 2YRWA 3T1HB 5LL6b 3AG7A 1UFIA 1GSHA 2Q7HA 4F4ZA 4WFEA 3E35A 5KG0A 2UUAH 2GTSA 2BTOA 1ET0A 4R7CA 4QW8A 4NXMB 1H2MA 2CNQA 1ZAUA 4BXXG 4CKCA 3ZS8C 3E86A 4YBZB 3OT7A 5KAFZ 1SQQH 4M7EA 3HOUG 5JUMA 2JA5A 4WFGA 3AG2B 4HQ6A 4LF7H 5LMNB 1E79G 1HNZB 3VQWA 1IDSA 4IYHA 4GX0A 5BMVA 1A9XA 2FE3A 1AR4A 4O7ZA 4DRFA 1YJ9V 4LFAB 3SJCC 4DK0A 4MA0A 3U11A 3T1HH 2YDEA 1L0NH 5LBQA 3RIZA 3F7VC 4X1KB 2GDSA 2HJWA 2F4VO 3H4BA 4DV7O 4BY7G 2YS8A 4NXMH 4Q4DA 2WLIA 2EBOA 1VS0A 5IYZF 4A3MG 2OIEA 2CUGA 2VR1A 5KFVA 4OPHA 1HNXB 1L2ZA 3HKEB 5LMNH 4KHPO 1HNZH 5LL6Y 4A2BA 5L3BA 1R3JC 3CD6V 4WBNB 1E4EA 1M0WA 5L3EA 3LUTB 5JQGA 1F4NA 4MV3A 4JUZA 2F43G 1Z5VA 4LFBO 3K5HA 1IBKO 3PO3G 4GKKO 1A48A 3F8NA 2NLJC 5BWXA 1K3EA 3CPWU 3ZRXA 1RP3B 3H0GG 2H8PC 2ALZA 1K4DC 1HNXH 1N34O 1GRJA 1XMQO 1BZKA 2ZR2A 1WPBA 2JGDA 4H44B 4EGQA 4CHIA 2BQRA 5I5YA 3SE7A 4IRKA 5BYAA 2ILMA 3SYPA 1M90W 2FYUH 3TIIA 3WG7C 4MVUA 3U9TA 1K33A 3QG5A 4DXWA 1ZHQA 2N04A 1I7NA 1NTZH 1H38A 2C00A 3AK1A 4HYKA 2ZNJA 1R3LC 1SZXA 1RSOA 5FLMG 1BCCH 1WJZA 2ATLA 2F23A 1DLBA 1OJHA 1U96A 2E74B 1ZWIC 3IGAC 1KP2A 3SR2C 3HT5A 1E1QG 4JV5B 1IXMA 1S72V 2XAGA 4JI4B 3GTQA 5BZBA 1E4EB 2HDKA 5DQIA 5JQGB 1I94H 2ODMA 2VPSA 4GC6A 3D8CA 3CMEV 5I5TA 2ZDQA 4Q0YA 2R72A 4LF9O 1G6UA 1GM8A 1S0NA 2DZDA 5HNEA 3KHHA 3W7WA 4QJFA 4ECUA 2VA3A 4DR6B 3GIPA 1K73W 1XL4A 3K5IA 1EFRG 1M93A 4JV5H 3E5NA 3AK2A 4PA9A 2X6BA 4TV8B 1KJ9A 5LHHA 4JI4H 3GTGA 4K0KO 1P49A 5IT9W 3RT3C 3OR6C 5IYBG 5EK0A 4B3SB 4DAAA 1NR1A 4JI5O 4O84A 2YIDA 4LSXA 4IWXA 4PZ7A 1SQPH 2Y0SA 1Y14B 1XMOO 3M9NB 2R8IA 2EX3A 3LULA 2FK1A 4ZQIA 5EYPA 1TGOA 2V5AA 5KAIZ 4UCTA 3CJHB 2YXYA 4DR6H 1IYEA 5LP6A 3GTJA 4RB3C 1Q7YW 2VS0A 4HNTA 2P6JA 4O4LA 1Y4MA 5C1PA 2XASA 1ZSPA 3IN5A 3ZHUA 3ETJA 2HHHB 1W93A 4WHXA 1PL0A 4XDJA 4GKJO 5IJ0B 4A3KG 4X1YB 2DYSC 3OD4A 3CCUV 5J2TA 4MVOA 1UC9A 4B3SH 1V51A 3STZC 3SNOA 1KC7A 2GSMB 4HNVA 1M6VA 1XQ8A 5EBMC 4P30A 4WD3A 4JZGA 1BXRA 2EJRA 2GTAA 5H6QA 4O4HA 4UUJC 2B1IA 2BTQB 5LXTF 4YHHO 4JAVA 1VAJA 5L3GA 4O4LF 3WG7B 5JVDA 1AILA 2ASDA 3JATB 2HHHH 4JF3A 1XUQA 1OHHG 1K83A 5J2TF 1MOFA 3WWIA 1NU1H 4TT3G 4J9ZB 4DO2A 3STLC 1VIBA 2QM7A 4F4YA 1E1RG 3ABTA 2QK4A 4NTYA 5KFOA 4HNUA 3ZRSA 1PX2A 1RYSA 2HJFC 3RN4A 3VQYA 1FXKA 1VEWA 4ZI7A 3RAXA 2ZDIC 2QKSA 1WP7A 1XNQB 2AQ4A 4AHCA 5C8YA 4B3RH 4YJ2B 1IBMB 2JEFA 4M9UA 3BG5A 3RYIB 1QBZA 3U0ZA 3T9FA 3W5OA 2FP4B 3RB3A 1KUTA 2W9AA 1FJGB 3DSQA 3WWHA 4ZI7F 3ZMSA 2X0LA 5C44G 3L9DA 5B3SB 3AW8A 1NBMG 1MMMA 1RM1C 1Q86W 2ZD9A 1WNSA 1XNQH 5C8YF 2QB5A 3LSUA 1IBMH 4J9PA 4JI3H 4JTAB 4O86A 4RUAA 1WRVA 3H1LH 2CGNA 3LDDA 4DW0A 5KA5A 4JYAB 4LF4B 2WLKA 1N32O 2WLJA 2LFSA 4QW9A 1ORQC 2A06H 1FJGH 4YJ3A 1PKXA 3BQ2A 3T1YO 2DYSB 5I5SA 2ITDC 3TY5A 1XL6A 4ZOLA 2DYRB 3RF2A 2XCLA 3JAKB 4UV8A 1XDCA 3RBEA 4DR4H 2OTJV 3WFVA 1IX9A 3MFIA 4MV1A 4K8XA 2JS5A 3PW2A 2YRXA 3M9OB 2CTRA 4NZNA 3HKZA 4JYAH 4LF4H 3H4DA 4C2MA 5KFIA 2XAJA 1URFA 1ZL8A 2YU9A 3ETHA 4ED8A 2UXCB 3HKBA 2DPIA 2UXBB 3GVMA 1BMFG 3NGDA 3RW0A 4ZOLF 3DGEA 4ME6A 3GV7B 3DTFA 3C0FB 3SJAC 4GX2A 2VUMA 2YZLA 1N33O 5KG3A 3ZRWA 1XHXA 2RQ6A 2ZE6A 4DYLA 4IR9A 5LMUB 5LOVA 3E83A 4I4TA 4NYKA 2P90A 1YHQV 2NU8B 1Y1WA 1CKMA 1YIJV 2OYQA 1FFXA 3ETDA 5EZYA 3CC4V 5FNVF 5GONF 2UXCH 4WCEV 3JASB 4UXNA 4LF8B 5DMXA 3VPDA 2UXBH 5CAEB 2R9AA 4YJ3B 2W6OA 4C5BA 4DR3B 5CM0A 4L8JA 1P7BA 1UC8A 4TV9F 3T54A 1GKFA 5LMUH 2JGUA 3G8CA 3ZMVA 4X20B 3QVNA 3ZEDA 3J7AK 2NVXA 2KB1A 2VQEO 3N2KA 4CS3A 5EDWA 3LSQA 3VOTA 1VQ8V 5I47A 3SPHA 2NNUA 3FKIA 4RAYA 1V55C 1J95A 3X2QC 4HNAB 1GM7A 5EZYF 2ZINA 4DV4H 1RM1B 1THZA 2EIKC 1S77D 3TY9A 3OUSA 4LF8H 2IP4A 4P9OA 4X64H 4DV2B 4DR3H 3DC6A 2WLNA 3B2EE 4LFAO 3KCYA 4U7CA 2VUMG 4QGPA 3I12A 4HZ3A 2JA6A 5DLGA 2ASLA 5F9LA 2WLHA 1NKDA 1FXHA 3U9SA 1S97A 2UUBO 3LP8A 4DV5O 4EYHB 3S24A 4D7SA 2YZNA 1W0JG 1RJPA 5KFHA 4ECTA 2V7QG 4I4TB 3MJFA 2DLNA 3JSNA 2CH7A 3KAKA 3L74H 3SYQA 4F6RA 3CQZA 4DV2H 1FFXB 1AUVA 1TVKA 4YB8B 3BABA 5HFMA 4CE5A 3FB6C 1IYDA 5JH7A 4E4EA 2IU3A 4MTEA 3HB9A 4XYLB 5E25A 3MFHA 1B3QA 4DV6B 4DR2O 1RJRA 4MW8A 3R9RA 3UFXB 4DL5A 1EZJA 5L1LA 5IYCO 3Q8RB 1OCZC 1D2DA 3MR6A 1RPRA 4OGQB 1ZUQA 3EFFK 2JVDA 4GCZA 3LDCA 4FGRA 3BAAA 2Q69A 3UCSC 2CGOA 4DR1B 4QWAA 4XZ3B 4MTFA 4DK1A 2HGWA 2O03A 2RNBA 4CKBA 5F2VO 3O9OA 5JH7F 2UVVA 4U7OA 3FD9A 3UO2A 3MWEA 1H8HG 2SCUB 4DV6H 5KFZA 3GB7C 2ZT9B 4JI8O 2R92A 3SJBC 2E2IA 4LC1A 3UQ8A 3N43B 1OZ0A 2B1GA 4I50A 4GT1A 2YZGA 5JQWA 2BSKA 3RB6A 4DR1H 2VQFB 1DF4A 3IC9A 2R7LA 4DIMA 1CEZA 3APOA 5JJJB 4ZHQF 5KX5F 5K2MA 4RUCA 3F7YC 1V55B 4EG0A 4PA3A 3X2QB 1Y1VG 4U3JA 4BIUA 5CB4B 1SA0B 4YAKB 4NTWA 4ABMA 2EIKB 1JFFA 2FKLA 5C93A 1WSCA 3ZN1A 2XAFA 3RYCB 4LFCO 4I50F 4DUZH 3HKCA 4BAYA 3ETQA 4BWSC 1NZ6A 5K1PA 5KFCA 3GIMA 1VF6C 2VQFH 5C3EG 2LGQA 3Q4HB 1SEIA 4JI1B 3A0HZ 3MWDA 3GILA 2VWKA 2JJ1G 5L9XA 4XX0B 1DTOA 4ECQA 3P3NA 2V4RA 2R92G 1L1FA 2QM4A 2DN9A 2CDYA 3D36C 3GB8B 3E8FA 3I5DA 4GUNA 4IL6Z 3T7AA 4W4LA 4TOIA 1Q6UA 3LDEA 4DRXA 3FFQA 1QVGU 4HR7A 4NB5A 4UB8Z 5BPHA 5DGAA 2MK3A 4ECRA 3JARB 3ABMC 4DL2A 4JI1H 4PI2A 1OCZB 3G80A 4O4IB 2FLLA 3CCLV 4L1KA 3E22B 5DGHA 5DISC 1I7FA 3GTKA 1U97A 5J2UA 2ZE8A 3V4ZA 4X89A 3LMLA 4JI7B 3J80N 3BPZA 4IIJB 1BGWA 3HKDB 5F9NA 3T5LA 1VQ6V 3PW5A 3FAVA 3H1HH 4R8CA 3PJSK 3K9AA 2OLSA 1E4FT 4FBUA 2WPDG 3D36A 4AYBA 3GTPA 3K06A 4BR6A 1K1SA 4EKWA 4CMFA 1SQGA 3H40A 2ZM6B 3APQA 4JV1A 4A5UB 2YICA 3ZMZA 1UPGA 2WLMA 2Z5UA 4PDVA 4JI7H 4J9RA 4NXNB 3GLKA 4MSWC 3GDEA 3M7MX 2W71A 1YF2A 4A3GG 1A0IA 2H94A 3K0GA 1WH2A 4K35A 2C22A 4C7UA 3PW7A 2ZM6H 2LQTA 2WA3A 1AI5A 4NXNH 1QU7A 2ZDGA 1ZTEA 4PWQA 4PA6A 4TUYA 2FKXA 4CC6A 1YI2V 3BVOA 5BY1A 4J11A 1YDXA 3CHXA 4JGSA 5FD5A 1I6UA 4B7EA 3P32A 3N27A 5L3DA 4X65O 4X62B 4YXWG 4X88A 1NH2D 1QQCA 3VPBA 5I60A 4FFRA 3BQ0A 1KYOF 5EOYA 2K9PA 4O2AB 3SPGA 3G67A 2Z02A 2Q2UA 3HOXG 1PM9A 4QPJA 2PI4A 4MV4A 4TUYF 5C1OA 2M6YA 1ROPA 3ABMB 1FPOA 1QR9A 3JZIA 3G6XA 1K92A 1SZTA 4X62H 2UUCO 2PUSA 3EYYA 2DOSA 3TXQA 5CR5A 2ADPA 1NT2B 4IZOA 5IJ9B 5BWTA 1G8MA 5CA0B 4EQ5A 1RK5A 3KKYA 1H2KA 1EKVA 3E8HA 4IRDA 2QEXV 1MABG 2FMLA 1XDNA 2E2HA 4DR7B 1NS1A 3WB2A 2W70A 3GWOA 1VQNV 1VBHA 5DG7A 2LO1A 1SF9A 4DV0O 1SQFA 1S0OA 1AP5A 1M5IA 5GW7A 2X7RB 2EINC 3Q2OA 4JYYA 2W6JG 3BA9A 3KCXA 1DAAA 4O3PA 4Z2WA 4O7VA 2KSWA 1Y74B 1TUBB 3I4NG 4JAAA 3H3VH 3J7AU 4DR7H 4ECSA 2CK3G 4X1KA 3KYHC 4D6TH 5D1OB 1PPJH 3UO3A 2UUAB 5IWAO 4RQEA 4R8UB 3QQMA 4Q8FA 1G1XB 3GV8B 3HKEA 4O4JB 4BIOA 4H37A 4WBNA 2JIZG 4PD4F 2FJZA 2HKOA 4KUMA 3K5NA 4ED3A 3HPLC 1R3KC 4M0JA 4UCUA 1EM1A 3JD0A 3HOWG 3ZJZA 5FPOA 4AQYO 2A0LA 3UM7A 2FB9A 4E6NA 1VQLV 4UCSA 1YJNV 4C5CA 4UVBA 2GV9A 4FZ1A 2AGPA 4LR3A 1OBGA 4WFAV 3BACA 3A0BZ 3OSPA 2PBZA 3A2FA 1GSOA 4UCVA 2R7NA 4G2KA 5JWPA 3OSNA 4F4XA 1KD1W 1WA8B 4JI6B 5JJNB 2E5LB 2RDIA 4FFPA 5IP7G 4DV3B 4ED6A 4QSHA 1I08A 1ZLZA 4FFBB 4MT8A 4H0LB 3S3WA 1Z2OX 3DXRB 4IHJB 1KTAA 4X66B 1TWHA 1N0NA 1CQJB 2I80A 2RJZA 5FLXN 4OX9O 4LF5O 3QWUA 1R9TA 2YXHA 4MVRA 4CMDA 1BJTA 2R6FA 2HVRA 3HKZE 2ADQB 2LJ2A 2HG8A 3G6EV 2VRZA 5BMVF 2E5LH 4JI6H 2RCVA 4GYCB 1IURA 2RDJA 2EINB 4DV3H 4O3RA 3C3SA 4NLGA 5IYCG 4QWBA 3WWJA 4HAMA 3MHHC 3SPJA 3E2EA 3HOYG 4QPKA 2NUAB 4X66H 2JA5G 4TV8A 2UXDB 2HHFB 3NBYB 5KFGA 2BQ3A 2P7TC 2JA7A 2WLLB 1LR1A 3QZ7A 3WNZA 5EC1C 5JQGF 4B3MH 5KG7A 4TVIA 1EN5A 1B6SA 4U7NA 1I94B 3CJHA 5KFQA 3ABLC 4UUGA 1NTMH 1NTKH 1AI6A 2RN9A 4LNUB 5BR8B 2IM9A 2UXDH 4JI2O 2ZNIA 3HB3B 5IJ0A 2X0SA 5KT2A 4X1YA 1US6A 2AHZA 1HR0O 5BYBA 1H2LA 1SRYA 2M7WA 2Z04A 1NJIW 1YCIA 3OGIB 2QF7A 2BTQA 3VOUA 3WB0A 1CS0A 4WFHA 5C5JA 5B1BC 1FVIA 1IBLO 1B6QA 3JD2A 5BR8H 3JATA 3OTOO 2ZE5A 1TUEB 4PI0A 3AX6A 3PZPA 1LUVA 1Y66A 4GZRB 3AG1C 2EJ0A 4BIZA 3R5FA 2KSDA 2ETNA 3FB5C 1VP7A 4Z1MG 4N21A 1EUDB 5B66Z 1Y67A 5B3SC 3BRCA 4K6NA 3FB7C 1G2WA 5LA6A 1P4RA 5EBLC 5KLVH 4RB0A 1IVSA 2NN4A 3QO5A 3J80W 2EJ2A 3NBZB 1MSDA 5KG1A 4ED7A 1YTFD 2N05A 2EIJC 4DR5O 1SC5B 4LF6H 4B08A 2UXNA 4YJ2A 4RCNA 1R1BA 1NH2B 5KMGB 4ZBMA 1HWYA 1KP3A 5LHGA 3RYIA 3RYHB 2DAAA 2DYRC 3KREA 4PZ8A 3EHBB 3JAMW 1JX4A 4X1IB 1WAZA 5J9PC 1XOUA 2IJJA 1JCHA 5LP6F 2QGNA 4J0MA 1TA8A 5LGTA 3GIKA 2PVPA 4PA7A 1SQXH 2VWJA 4YJ2F 4A3EG 2Y4UA 5A9GA 1N0JA 3ABLB 3RWRD 1N36B 2COIA 4B3RB 3ABKC 2MCTA 4UCOA 3CCQV 4TSFG 2YWVA 5KFRA 1BT8A 4O4HF 1K5SA 2EJ3A 3EPIA 1I1MA 4X8AA 1FKAO 4MV6A 5LA6B 3DTUB 5JVDF 3CXCU 2AU0A 2JA8G 4IRCA 3JAKA 3K59A 4J9SA 4K8ZA 5CN0A 3VPCA 3ZMTA 4RUEA 2YIBD 1L8DA 5B1BB 4MAMA 4Q6GA 1J5EB 2V4QA 1N36H 1I1KA 4JI3B 4O7LA 3KHGA 1S03G 1M9NA 2HR3A 3OFNG 2HIVA 2I8CA 3K5LA 5H9CA 1VKZA 2FK3A 1GYFA 2E76B 3AG1B 3B8MA 4I55B 1AI7A 1IOVA 5IYDG 3OUZA 2HVQA 2W6IG 3K3WA 3K5OA 3S3XA 3U54A 2BQUA 2WAQA 5KG5A 1J5EH 3W1BA 4RO2A 1VARA 4DR4B 3L73H 3I56V 2NU6B 3TINA 4JI0H 1EN4A 2ZDIA 3K3PA 4GX5A 3JASA 4QWEA 2EIJB 2FPGB 1CP9A 3KZIZ 3QO8A 4RAIA 1JMKC 2R87A 5DM6V 2YL2A 2CW7A 4AILC 3RBDA 3H20A 5GTHZ 4I0XB 1ENVA 4CH6A 2W57A 1WB8A 4PJ0Z 3CP1A 1PNMA 4X20A 2AHYA 5HV6A 1S5JA 1H8EG 3R5XA 2YIAA 3E8BA 4YY3B 4ICGA 4G3IA 4AYBE 3J81N 1I7LA 2DE0X 4HNAA 1CPYA 3K79A 3QNEA 3U10A 5TISZ 1XNRO 1C3OA 4YJ3F 3CRQA 1PK8A 3K57A 1VQMV 2JRIA 1VQ7V 1VBGA 1GO3F 2R9RB 2GBOA 4EBCA 1SKVA 1D5AA 3ABKB 4DUYO 3ETGA 4GLWA 1O9GA 3MDSA 1HNWB 4DW1A 3FDSA 4YY3H 4D7TA 2UUAO 3CCJV 5KFLA 4CH4A 4FLUA 1CQIB 1WR2A 2JEGA 1VQKV 3ICXA 3CC2V 3SPIA 4XDLA 4B3TH 1MSWD 3L70H 4UVCA 4ECZA 1EKPA 1YZBA 4DV4B 4LF7O 3QF7A 4LSAA 2QYZA 4X64B 2QM8A 2HFEC 3T99A 1Y76B 3AYHB 2LGWA 4EYIB 3T1HO 1HNWH 1VMGA 3BA8A 1M4UA 1TAEA 3Q8PB 5LOVF 4NXMO 2OWOA 2VA2A 4I4TF 1KMIZ 2ATKC 2R93A 2P06A 1I1LA 5LMNO 1HNZO 1YSCA 1GAXA 3B4SA 3L75H 2EULA 2GQRA 1I2LA 2QWPB 4XBFA 5CBHA 3FYIB 2YZMA 3H1KH 2UU9B 4NZOA 1AR1B 1C30A 2ABJA 2J9GA 5DGBA 5CMUA 4QWDA 3IFXA 4LH6A 3OR7C 4LP8A 2QWOB 5KFKA 3TGUH 2DIKA 2V58A 2W9CB 5FLXW 4RZRA 1Y1WG 1F4MA 1JPXA 4FM2A 1HNXO 3VNNA 3TQ1A 4MV9A 1V4YA 3TW7A 3G8DA 2B5UA 1OWTA 5FL7G 3N6RA 1SQBH 1SQVH 2FMAA 1I5XA 3BCCH 3OMNB 2P0AA 3MR3A 5FNVB 2PN1A 2XNDG 5GONB 2L35A 5KT6A 2UU9H 4LWSB 3CEIA 3GWKC 2NU9B 5CB4A 1SA0A 2EZPA 1JLLB 2COGA 5KKNB 3PR5B 4FMTA 3RYCA 3JAWB 2D3OW 1BHBA 4TWKA 5KS8A 3G6VA 1UNNC 3FKIG 2DPJA 3OHBA 4DV1H 4E2LA 3Q4HA 2PY5A 1AJPA 3OUFA 3RV4A 5CA1B 4YR3A 2Y4TA 2JA6G 2AZ2A 2KG7B 5CB4F 1I94O 4J42A 4UB6Z 1ZQ7A 3N2GB 2F4VB 3M9MB 4DV7B 5DG9A 4MVZA 2YI9A 1MG1A 3K04A 1YTFB 5EWEA 3BY6A 1I3QA 3W7UA 3BEHA 1SERA 2Q5ZA 4FM1A 4DUZB 4MS2A 4JV5O 3TW6A 3JARA 4UV9A 1COWG 2X6CA 2NU7B 4JI4O 2WB1E 4J7ZA 4O4IA 4QNHB 3E22A 5HBRB 2CFMA 4LFBB 4A93G 5K3WA 1SFOA 2F4VH 4GKKB 3MAQA 4DV7H 4MVSA 1JDBB 5FPRA 1X59A 4IIJA 3HKDA 5LYJA 4DR6O 2LFRA 2FLNA 4K3AA 1XMQB 4KHPH 5KUMA 1EYZA 4J9OA 4LH7A 1BGYH 2E3CA 2YUAA 5KA6A 4BY1G 4O4IF 3HR0A 3W7TA 1B33N 2IMWP 4B3SO 2YC0A 4LFBH 3G6YA 1IBKH 3ZRVA 3G6BA 5JJEB 5KFAA 4GKKH 4PZ6A 2HG5C 1VQOV 2DJVA 5BWWA 1R6KA 3HOZG 3KALA 4PV1B 3N40P 5FR9A 1V9PA 1YVWA 1N34H 3ML0A 1XMQH 4EBDA 1MZFA 2HHHO 1HP8A 1DIKA 2YS6A 3TK1A 4Y8VB 1Q81W 2L6LA 2W0FC 1CKNB 2RDCA 5JCOC 2PF4E 1JKJB 2YI8A 3GIDA 1S3JA 1VF6A 3SDLA 3V6HA 4LF9B 5KT5A 5KX5B 2I87A 2FK2A 5KFYA 2CTPA 2XD4A 3PVXA 2QSAA 1E4GT 2WA4A 5LYJB 5KT3A 3E89A 4TQFA 4JXUA 3IJ4A 3RGBA 5B1NA 3R5HA 2M05A 3CRRA 3RB0A 1Q3EA 4K0KB 1B6RA 1OCRC 4FFKA 4MTGA 5KFXA 2IJKA 4J80A 2YCHA 2C2EA 4O2AA 4B3RO 4RNOA 3OGCC 2IBZH 4JI5B 3THOA 1A3GA 1GSAA 3VMMA 3AK3A 4MVQA 4FJCC 3I55V 4RB1A 1XMOB 2AGQA 2J6UA 3JAMN 5J2UF 4LF9H 4NYEA 2ZE7A 4FFMA 3KG2A 3L4KA 2UVRA 3DF7A 1GTOA 1IXBA 4WFFA 4KP4A 4IAJA 2W9BB 2Q0AA 3B77A 5JCOA 4FLVA 3T9AA 4U6PA 5KFPA 1L0LH 3UT5B 2AGOA 1GM9A 3L2PA 4GKJB 4RNNA 3Q8QB 4K0KH 1XNQO 1P16A 5IJ9A 1ZHSA 4ETSA 2GUZB 1BL8A 3PFFA 4O2AF 5CA0A 1IBMO 1M56C 4JI3O 2W7OA 4JI5H 1K34A 4O7TA 2LW7A 5KHIA 3TY8A 1XMOH 2XAHA 1K1QA 2HEPA 1S68A 3CRCA 4UCRA 1FJGO 4YHHB 5KG6A 3GIIA 2D2CB 3NUAA 3GQCA 3K08A 2VPQA 1RFYA 4RB2C 4GKJH 5IYDO 2CZGA 1AJNA 4MTDA 1GN2A 3GIQA 3SYCA 1KB9F 3ZHRA 4DR4O 5CA0F 2B63A 4BW5A 3HO8A 1GK9A 1OBDA 3L4JA 3R66A 5ITZB 2COJA 1Y74A 4LF4O 1TUBA 4JYAO 3AG4C 4YHHH 2W8LA 3IG0A 5L1IA 2YSUB 3OHAA 2LW1A 3H1JH 2PZSA 3N8DA 4A3JG 5D1OA 2V59A 1Z2PX 1K5QA 4R8UA 1R3IC 5BXZA 1XBLA 3UZOA 4EB6B 4O4JA 5D5PA 5KFWA 3J81W 1KKCA 4I5SA 3G4SV 4BBSG 5H2FZ 2CTWA 2IH3C 2F66C 1CXZB 3ZMUA 2DWDC 3RYFB 1XI1A 4MTOA 2QTOA 4UFZA 2UXCO 3QFFA 2FLPA 1I50A 2UXBO 1OCRB 2UXXA 3OUUA 3RAQA 1T5EA 1B06A 3TEKA 2AGAA 1K8AW 3T2MA 4O4JF 5LMUO 3PR4A 2EIYA 1P7GA 1KT8A 2XAQA 1Q90D 1N32B 2BOBC 2F93B 3WO1A 1RK6A 2HIXA 1WA8A 4DV4O 3T1YB 5DECA 4LF8O 1EHIA 3CB2A 1QVFU 3P30A 4O2BA 4X64O 1LUWA 4DR3O 3RFCA 1EBOA 1M56B 3H1IH 4JPRA 2W6MA 3UZBA 4FFBA 3ZIAG 2ZIOA 5L1JA 2CKZB 3DXRA 4IHJA 2XOKG 3TCUA 4P9PA 1FYJA 2PGGA 1QHTA 1VF5B 3JD3A 2HP8A 2P4VA 2A7WA 1N32H 4O83A 3M4IA 4NR1A 1EN6A 5CBFA 5FD6A 5KFMA 5A2QN 3T1YH 2WB1A 2MW2B 2Y0PA 1FD9A 2R9IA 4DV2O 4J9MA 3IAYA 4G28B 3QZ8A 1YJWV 4IHJF 5HFLA 1KBLA 4XDKA 1A0GA 1WN7A 3AG4B 3P3PA 4H13B 3LNMB 3RVYA 2WAQE 1OCCC 2W7PA 2ASJA 2Q7GA 4J10A 2HHFA 1TWAA 1Q6IA 2WLLA 3CCEV 4WBNF 2R8JA 2ZIMA 4EBEA 1Q6HA 4APMA 3U0GA 4N23A 1JDEA 2WWWA 4EFEA 1K9MW 1Y6XA 3UKMA 4CBCA 2DABA 2XHBA 2PMZE 1EZ1A 4FK5C 4O2BB 1N33H 1GO3E 1T36A 1Z2GA 4LNUA 4DV6O 3EPGA 2IH1C 2QE7G 5IYZA 3TJTA 2VQEB 1BNCA 2CE4A 3H0GA 5H80A 1QCEA 3K0DA 3C90A 5C4XG 1S10A 1AB3A 4DR1O 5KFUA 4FS2A 3ZX6A 4B3MB 4F4WA 1XK5A 2RF4A 4HBNA 2JK5C 4YIOA 3JALB 2W6QA 2X5RA 1TWCA 2FPIB 4Z1VA 2YEVB 3W7SA 2UUBB 1GLVA 2G38A 2VQEH 4ECWA 4DV5B 3PW4A 3OEEG 4J9KA 4DLKA 1EKFA 4HYOA 1MZEA 1CE8A 4DL6A 3OTFA 4DUZO 4NTXA 4LBEC 2P22C 1KJJA 4J9NA 1X4TA 2VQFO 4L87A 1I5YA 4LFAH 5DAAA 1F23A 3KXYT 2QWRB 1AVMA 3OEHG 1N48A 3RFRA 4DR2B 2OCCC 2FL4A 4KXRA 3RV3A 1AI4A 2UUBH 4DV5H 1OCOC 3AG3C 3BQ1A 3VQXA 5GTIZ 1WCMA 5E79Z 4O7RA 4J7KA 2PYLA 4TV8F 5IYZB 1WB7A 1IZ3A 4WF9V 2Q2TA 3GIJA 3CX5F 3GV5B 4CH5A 5KMGA 2GHYA 3CXHF 3RYHA 3KHLA 1H2GA 2QTSA 3T4DA 2AW9A 1SYXB 2P5OA 2XTAA 1OCCB 5BMVB 3JRWA 4JI1O 3FKSG 3LNNA 4X1IA 5EIBD 4GLXA 2CW8A 3N6XA 4QIWE 4DL7A 2BR0A 4DR2H 1GH6A 4JI8B 2PYJA 5D8DA 1JOYA 4CS2A 4AI8A 4O7NA 4EFBA 2WLIB 1DV2A 2JA7G 4FU0A 1W0KG 2V1DA 5L1KA 2R86A 3RUPA 4O3NA 2EILC 4FM0A 5KFTA 2Q68A 3A8TA 4LF6B 4A3FG 1KC8W 3T9EA 2QWNB 2Z3YA 5LP6C 4FIPC 5DEDA 3NR7A 1FAFA 4FLTA 3FX7A 4ECVA 2P67A 1Q5OA 3RGZA 4O7WA 3CS5A 4JI8H 3RVZA 4RU9A 1WCMG 2R7MA 4JI7O 4LFCB 1GN6A 4RUFA 2R70A 2QDOA 2JGDB 5L3CA 4H33A 2HLDG 2OCHA 1NQTA 1VQPV 3ORQA 4A3LG 5KHKA 5KHGA 5KFEA 3WU2Z 2ZM6O 4I55A 5LA6F 1JQ0A 3JRXA 4J9LA 5DQGA 1JJOA 4WFBV 5B5EZ 5LXTA 4I7ZB 3CCVV 1O9HA 4LFCH 4NXNO 1RSOB 3KHRA 4UVAA 3PW0A 1KEEA 2R85A 2JEXA 2OCCB 1WP8A 4MVMA 1OCOB 1I0HA 1R6NA 3AG3B 2XGQA 4RWUA 3BJYA 1FXKC 3CWBH 2J6SA 4A3BG 3CSXA 4I55F 1QNMA 4JTDB 2NVYA 5IY5C 2XIGA 1A32A 3QO7A 5BPFA 1AR5A 4F6EA 1Q43A 2GPSA 2EZOA 2Z0AA 3HXLA 4I0XA 2Y4RA 1JJ2U 4QJFB 2HVJC 3CCMV 2Q73A 2IA6A 1EZVH 1W59A 3RJ0A 2ZXWC 2R8HA 1PL4A 3O65A 4X62O 4A3DG 1R6TA 3ZHVA 5B1AC 4JI0B 4GC7A 2Y0IA 2QJ1A 2VUGA 4PBCA 2DQ3A 4IT5A 2EILB 4FVMA 3KTMA 2R8KA 3GTOA 3ZCCA 4YR2A 2DWEC 5EYPB 3NXSA 1BE3H 5DLFA 1DK1A 4MV8A 5LXTB 1S5HC 4DL4A 5LP6B 3WB1A 3JSLA 5CA3A 4O4LB 2O57A 2QKCA 2BE3A 2W6ZA 3LSSA 1AJQA 1SS3A 1FXVA 1EUCB 3FB8C 3JZFA 3N41B 5J2TB 5KHJA 2HGXA 3JCUZ 2C2DA 3C3TA 3ASNC 2C2AA 2OH2A 2PMZA 2LP7A 5DN6G 2NR5A 3CEBA 4O4HB 1Y76A 1KJQA 1YEWA 5CE8A 1QLNA 3EVKA 1ZETA 4DR7O 1WPXA 4NVPA 4E4TA 5I5UA 4A2AA 1D5NA 5JVDB 5BWVA 4JYCA 4MTXA 5B1OA 4X65B 4LMYA
chains in the Genus database with same CATH topology
3E22A 2PUSA 3EYYA 2CFMA 4LFBB 3QG5A 3W1GA 1M0TA 5EIBC 1ZHQA 1NT2B 2F4VH 4GKKB 3MAQA 4DV7H 5IJ9B 5FPRA 2ZNJA 4IIJA 5CA0B 4EQ5A 3HKDA 5LYJA 4B3TB 1RSOA 3BHPA 1XMQB 3SR2C 4KHPH 4JV5B 1XDNA 4LH7A 2E3CA 3WB2A 4DR7B 4JI4B 3K3VA 4ZI7B 4X65H 2CAZC 1SQFA 2UUCB 4LFBH 5JQGB 1M5IA 1I94H 1IBKH 2VPSA 5JJEB 4GKKH 4PZ6A 4Q0YA 5C8YB 2R72A 1G6UA 3BA9A 3KALA 4DR6B 3N40P 5A2QW 1V9PA 2KSWA 1N34H 1XMQH 1TUBB 5FNVA 1AN7A 5GONA 1M93A 4JV5H 4TV8B 4DR7H 3VQVA 4X1KA 4JI4H 3KYHC 3PN1A 1P49A 5IT9W 2UUCH 5D1OB 4TV9A 4DV0B 3JAWA 4B3SB 1CKNB 5JCOC 2UUAB 4LSXA 4PZ7A 2YI8A 2EX3A 4EEQA 4LF9B 5EYPA 1TGOA 3HKEA 4O4JB 4UCTA 5KX5B 4DR6H 4WBNA 5LP6A 4RB3C 5CA1A 4O4LA 1E4GT 5LYJB 2HHHB 4TQFA 3K5NA 1DGSA 3RGBA 4UCUA 1Q3EA 5D5QA 5IJ0B 3N2GA 4K0KB 4X1YB 1B04A 5J2TA 4DV0H 4B3SH 5FPOA 2YCHA 4O2AA 4ZOLB 3THOA 4JI5B 5IWAB 2VOBA 1XQ8A 4E6NA 2WDTA 4RB1A 1XMOB 4LF9H 4UCSA 4O4HA 3L4KA 2BTQB 3DF7A 5K1XA 4IAJA 2GV9A 4LR3A 2Q0AA 4FLVA 5JCOA 2RGRA 4DV1B 5JVDA 3A2FA 4UCVA 2HHHH 3JATB 3UT5B 5JJNB 4JI6B 2E5LB 3SGIA 3MWMA 4MV7A 3HKBB 4K0KH 3L2PA 4GKJB 4DV3B 1P16A 5IJ9A 1ZHSA 4ETSA 4AQYB 5CA0A 1O75A 4JI5H 5IWAH 4FFBB 1HW7A 5KHIA 3TY8A 3QTCA 1XMOH 4TV9B 1Z2OX 4IHJB 4X66B 2WYOA 2HEPA 1S68A 4UCRA 2PTMA 2RJZA 3QWUA 5LOVB 4YHHB 1BJTA 2F1MA 2HVRA 3VQYA 4ZI7A 4BWAA 2E5LH 4JI6H 4GYCB 5EZYB 4RB2C 4GKJH 4DV3H 1XNQB 4MTDA 4AHCA 5C8YA 4AQYH 2HGSA 4B3RH 4PHZA 4YJ2B 1IBMB 3L4JA 3RYIB 5ITZB 3U0ZA 3W5OA 1TUBA 4X66H 4OX9B 2YIBA 4LF5B 1FJGB 4YHHH 1MZBA 3DSQA 4TV8A 2UXDB 3IG0A 3NBYB 4PDBA 3N2KB 2PZSA 4KHPB 4RZQA 5D1OA 1Z2PX 1CKNA 4B3MH 1XNQH 1WNSA 4EB6B 5KHHA 1I94B 1IBKB 4O4JA 5D5PA 4ZHQA 5KX5A 3J81W 1IBMH 4JI3H 4JYAB 2F66C 4LF4B 4LNUB 5BR8B 4OX9H 3RYFB 1XI1A 2IM9A 4LF5H 1FJGH 2UXDH 4YJ3A 1N34B 4UFZA 2ZNIA 5IJ0A 4X1YA 1T5EA 3TY5A 4ZOLA 3RF2A 3RR5A 3JAKB 2F95B 4F6RB 4I7HA 4DR4H 1TVKB 2BTQA 4K8XA 2ZJTA 2JS5A 3WB0A 5JH7B 1FVIA 4JYAH 4LF4H 1N32B 2F93B 5BR8H 3JATA 3UT5A 2HIXA 3RGXA 4TQDA 4PI0A 4JI2B 3T1YB 2UXCB 3HKBA 2UXBB 3CB2A 4O2BA 3K58A 1HR0B 4FLWA 4FFBA 2ZIOA 3C0FB 3SJAC 4I9QA 1XHXA 4IHJA 2RQ6A 4ZIBA 2PGGA 3BRCA 5LMUB 1QHTA 5LOVA 2YXLA 5LA6A 4I4TA 4CH3A 3N42B 1N32H 1IBLB 3M4IA 4ZHQB 4RB0A 3J80W 3OTOB 1CKMA 5FD6A 3NBZB 2OYQA 4JI2H 1FFXA 3T1YH 5EZYA 2UXCH 3JASB 4LF8B 2WE6A 2UXBH 2R9AA 4YJ3B 4LF6H 4B08A 4DR3B 1HR0H 4I50B 4YJ2A 3IAYA 1KU9A 5KMGB 4L8JA 3RYIA 5ITZA 3RYHB 1Q8IA 1XHZA 5LMUH 1WN7A 2JGUA 4PZ8A 4X20B 3JAMW 3ZEDA 3J7AK 1Z5WA 2Q7GA 4X1IB 3N2KA 4CS3A 1IBLH 4FM9A 3OTOH 2ZIMA 4RAYA 4HNAB 2KKWA 4U3JB 4APMA 4J0MA 2ZINA 4DV4H 1JFFB 3TY9A 1TA8A 4LF8H 4EFEA 4RAZA 4DR5B 4X64H 2XHBA 4DV2B 4DR3H 4EB6A 2VWJA 3B2EE 3HKCB 4O2BB 1N33H 3RWRD 1N36B 4B3RB 2MCTA 4LNUA 4UCOA 2ZCEA 3RYFA 1Z2NX 5IYZA 2VQEB 3S24A 4CS4A 4D7SA 3GJXB 4I4TB 5LA6B 3JSNA 3KAKA 4FLZA 1X9NA 3JAKA 3K59A 4K8ZA 4F6RA 4DR5H 4DV2H 1FFXB 1TVKA 3BABA 4B3MB 1CKOA 3NC0B 2YIBD 1L8DA 4DRXB 1XK5A 4HBNA 5JH7A 4Q6GA 1J5EB 1N36H 4MTEA 3JALB 4JI3B 1S03G 4DV6B 2HIVA 3K5LA 2V4DA 2UUBB 2VQEH 4DV5B 1GYFA 4I55B 5J2UB 3OTFA 2JVDA 2P22C 3BAAA 2HVQA 1X4TA 3K5OA 1H2SB 4DR1B 4LFAH 4DK1A 2O03A 1J5EH 3W1BA 4DR4B 5D1PA 3KXYT 4JI0H 4DV6H 3RFRA 4DR2B 2UUBH 4DV5H 3SJBC 3JASA 3VQXA 2PYLA 3UQ8A 3N43B 1FKAH 5IYZB 4FLXA 1JMKC 4I50A 2Q2TA 2CW7A 4CH5A 5KMGA 4AILC 3H20A 3N44B 3RYHA 4CC5A 2VQFB 4DR1H 4CH6A 1SYXB 2P5OA 2W57A 4X20A 5BMVB 1S5JA 3LNNA 2YIAA 4X1IA 5EIBD 4YY3B 4GLXA 5JJJB 2CW8A 3N6XA 4FLYA 4DR2H 4HNAA 4U3JA 4JI8B 5CB4B 1SA0B 2PYJA 3U10A 1JFFA 4CS2A 4EFBA 3RYCB 2RGVA 4DUZH 3K57A 3HKCA 4BWSC 3ETQA 5K1PA 4FM0A 2VQFH 1SKVA 4LF6B 1D5AA 4BW9A 4TUYB 1O9GA 1HNWB 5LP6C 1SEIA 4JI1B 4YY3H 4D7TA 4FLTA 2VWKA 4CH4A 1Q5OA 4FLUA 3RGZA 2QM4A 3ICXA 4JI8H 4B3TH 3GB8B 1XNRB 3FMAA 3KAJA 4LFCB 4DV4B 4TOIA 3QF7A 4DRXA 3FFQA 4LSAA 2R70A 4X64B 3JALA 4DUYB 1HNWH 3JARB 4JI1H 3BA8A 1N33B 1M4UA 4PI2A 2Q7EA 3CVZA 4R7RA 1TAEA 5KHGA 4O4IB 5KHKA 3E22B 2OWOA 4I55A 1KMIZ 1I7FA 5DISC 5J2UA 3RTXA 1JJOA 5LXTA 1XNRH 3LMLA 1O9HA 4JI7B 4LFCH 3BPZA 4IIJB 4LF7B 1BGWA 3HKDB 3K5MA 4KL1A 1P8LA 1VF7A 2HVSA 1E4FT 4DUYH 2UU9B 3T1HB 5LL6b 2Q7HA 2UUAH 4LH6A 1SQGA 2BTOA 3CSXA 4NXMB 2ZM6B 5FLXW 1ZAUA 3ZS8C 2XIGA 4FM2A 3VNNA 4M7EA 1Q43A 4JI7H 4MV9A 4NXNB 3HXLA 4LF7H 5LMNB 1HNZB 3GDEA 3VQWA 3M7MX 5BMVA 2FE3A 3RJ0A 5FNVB 4DRFA 5GONB 4LFAB 3SJCC 4DK0A 1A0IA 2UU9H 3U11A 3T1HH 3RIZA 5CB4A 1SA0A 4X1KB 1WH2A 4JI0B 4NXMH 2ZM6H 3RYCA 1VS0A 3JAWB 2QJ1A 2VUGA 4FVMA 1HNXB 1L2ZA 4NXNH 5EYPB 3HKEB 5LMNH 4DV1H 1HNZH 4TUYA 4A2BA 4CC6A 5LXTB 4WBNB 5LP6B 3WB1A 2PY5A 3CHXA 3JSLA 1M0WA 5CA1B 5FD5A 1I6UA 5JQGA 4O4LB 4X62B 1Z5VA 1QQCA 3N2GB 2F4VB 3F8NA 3N41B 4DV7B 5J2TB 5KHJA 5EOYA 2YI9A 4O2AB 1HNXH 2Q2UA 1WPBA 4FM1A 4DUZB 4O4HB 1YEWA 3JARA 4NVPA 4A2AA 5JVDB 4O4IA 4X65B 4LMYA 4X62H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFM A;  4LFB B;  3W1G A;  3TY9 A;  1TA8 A;  4GKK B;  4EFE A;  1XNQ B;  3GB8 B;  1XNR B;  4DR5 B;  4DV2 B;  4LFC B;  5FPR A;  4EQ5 A;  4DV4 B;  1IBM B;  4TOI A;  4B3T B;  4X64 B;  1XMQ B;  3W5O A;  1N36 B;  4B3R B;  4DUY B;  4UCO A;  4JV5 B;  4OX9 B;  4LF5 B;  1FJG B;  1XDN A;  4LH7 A;  2UXD B;  4DR7 B;  3BA8 A;  2VQE B;  1N33 B;  3NBY B;  3S24 A;  4JI4 B;  4KHP B;  1TAE A;  2OWO A;  3GJX B;  2UUC B;  5D1O A;  1CKN A;  5DIS C;  3RTX A;  3JSN A;  1X9N A;  4PZ6 A;  4JI7 B;  3BA9 A;  3BAB A;  1I94 B;  1IBK B;  4B3M B;  4LF7 B;  1CKO A;  3NC0 B;  4DR6 B;  1XK5 A;  1V9P A;  1P8L A;  1J5E B;  4JYA B;  4LF4 B;  2HVS A;  4JI3 B;  5BR8 B;  2UU9 B;  4DV6 B;  2HIV A;  3T1H B;  1N34 B;  2UUB B;  4UFZ A;  4DV5 B;  4LH6 A;  3KYH C;  3PN1 A;  4NXM B;  2ZM6 B;  5D1O B;  4DV0 B;  1CKN B;  4B3S B;  3TY5 A;  1ZAU A;  2UUA B;  3RR5 A;  4PZ7 A;  3BAA A;  2HVQ A;  3VNN A;  4EEQ A;  4DR1 B;  4LF9 B;  4NXN B;  5LMN B;  1HNZ B;  4UCT A;  3GDE A;  3W1B A;  1FVI A;  4DRF A;  4DR4 B;  5D1P A;  1N32 B;  4LFA B;  1A0I A;  2HHH B;  2HIX A;  4DR2 B;  1DGS A;  4JI2 B;  3T1Y B;  4UCU A;  2UXC B;  4K0K B;  2UXB B;  4JI0 B;  1B04 A;  3UQ8 A;  1VS0 A;  5FPO A;  2VUG A;  2Q2T A;  1HR0 B;  4JI5 B;  5IWA B;  4E6N A;  1XMO B;  1HNX B;  4CC5 A;  4UCS A;  2VQF B;  5LMU B;  4CC6 A;  3JSL A;  4YY3 B;  4GLX A;  1IBL B;  4DV1 B;  4UCV A;  3OTO B;  1CKM A;  4X62 B;  2E5L B;  4JI6 B;  3NBZ B;  4JI8 B;  3SGI A;  3L2P A;  4GKJ B;  4DV3 B;  4LF8 B;  2F4V B;  1P16 A;  4DV7 B;  4EFB A;  4AQY B;  4DR3 B;  3TY8 A;  2Q2U A;  4LF6 B;  4X66 B;  4DUZ B;  1S68 A;  4UCR A;  3QWU A;  4PZ8 A;  4YHH B;  1HNW B;  4JI1 B;  2HVR A;  4X65 B; 
#chains in the Genus database with same CATH topology
 3W7X A;  3SYO A;  1M0T A;  3W1G A;  5EIB C;  2CNU A;  2ZGI A;  2ZQM A;  5EWF A;  1M7J A;  4O3O A;  5EC2 C;  4B3T B;  2A9H A;  1PV0 A;  4G27 B;  3BHP A;  1N4C A;  4C5A A;  2IJH A;  2Q8V A;  1FS0 G;  2W6P A;  2JEI A;  4ECY A;  3K3V A;  3GTM A;  3HBL A;  1FXK B;  4ZI7 B;  4X65 H;  3T9B A;  1BS3 A;  2CAZ C;  2UUC B;  5IY5 B;  2W9C A;  2OIG A;  3F5T A;  3PO2 G;  1BQ0 A;  5AG2 A;  5C8Y B;  4FZ0 A;  3T9C A;  1MA1 A;  1WLE A;  1KBH A;  5A2Q W;  2B9Z A;  3OM3 B;  5FNV A;  2GPW A;  2ZXW B;  5GON A;  4RQF A;  1AN7 A;  3H9V A;  4LWS A;  5BWR A;  3T5K A;  2P4K A;  3JYC A;  3VQV A;  4J41 A;  5B1A B;  3CSW A;  3PN1 A;  1K97 A;  5CBG A;  2UUC H;  4TV9 A;  4DV0 B;  3JAW A;  5KG2 A;  3B09 A;  4Q44 A;  3LWB A;  1S76 D;  2QA4 V;  2K1E A;  1NR7 A;  1QR8 A;  3Q1K A;  3DAA A;  2A3Q A;  3RBZ A;  4EEQ A;  1H2N A;  4FS1 A;  1M57 C;  3BFR A;  3SYA A;  3MR5 A;  1PD3 A;  3SPC A;  5CA1 A;  2JDI G;  4RNM A;  2XCA A;  1JR9 A;  2E5L O;  4JI6 O;  4QIW A;  2KG7 A;  1DGS A;  1W2B U;  1PP9 H;  1MNG A;  1NI8 A;  2QR4 A;  1GN3 A;  3N2G A;  5D5Q A;  3E8G A;  1AP6 A;  1B04 A;  4DV3 O;  1N8R W;  3ZHT A;  4DV0 H;  4A3I G;  4ZOL B;  5IWA B;  2VOB A;  2WDT A;  3ASN B;  1VQ5 V;  2W0X A;  3JD4 A;  4PDM A;  1PNK A;  2DW4 A;  4X66 O;  4IR1 A;  4YIP A;  2DMX A;  4X9Q A;  4ASU G;  4FFN A;  5K1X A;  2C35 B;  5KFJ A;  3M99 B;  5CA1 F;  2XCP A;  2RGR A;  3ETE A;  1FFT B;  4DV1 B;  2J6T A;  4U3F H;  1ZL8 B;  4QIW F;  1BQZ A;  2JEJ A;  3F5W C;  3SGI A;  4MV7 A;  3MWM A;  3HKB B;  4B3M O;  5H5N A;  4YR0 A;  5IE9 A;  4P2Z A;  2EJ7 A;  3CCR V;  1GGO A;  1N56 A;  4J9Q A;  4J7J A;  3B40 A;  4AQY B;  1R73 A;  1O75 A;  5IWA H;  2Q6A A;  2IJI A;  1HW7 A;  2DQ0 A;  3QTC A;  4TV9 B;  2FPP B;  5DGI A;  1RJQ A;  3ZRW B;  2WYO A;  2C28 A;  4GX1 A;  2R93 G;  2PTM A;  2X6A A;  5DG8 A;  5LOV B;  2UXD O;  2F1M A;  3VBB A;  1UJW B;  2Y69 C;  4BWA A;  5KT4 A;  5EZY B;  1NVP D;  4O7Y A;  1TWG A;  3CRA A;  4JAU A;  2HVK C;  3AEI A;  1KJ8 A;  2QWQ B;  4AQY H;  3V6J A;  2HGS A;  4PHZ A;  4NKG B;  3CCS V;  1K4C C;  4JV0 A;  1VQ4 V;  3TET A;  5IDJ A;  1S0V A;  1Y1V A;  5KT7 A;  3K03 A;  5BR8 O;  3TQT A;  4OX9 B;  2YIB A;  4JAS A;  4LF5 B;  1MZB A;  3ORR A;  4PDB A;  3N2K B;  1Q82 W;  3CRM A;  2Q4P A;  1JA8 A;  4KHP B;  1KKD A;  4RZQ A;  1JX9 A;  1CKN A;  3JZ6 A;  1JXL A;  1OV9 A;  1TWF A;  4A3C G;  1I2K A;  1M57 B;  5KHH A;  1IBK B;  4ZHQ A;  5KX5 A;  5EBW C;  4Q20 A;  5I5X A;  4FFL A;  4ECX A;  4HN2 A;  3T4Z A;  4ED2 A;  2BCC H;  3ASO C;  4OX9 H;  4LF5 H;  2WSS G;  2XC9 A;  1N34 B;  4MA5 A;  1RYR A;  2IU0 A;  2ZKO A;  2CTQ A;  4YAJ B;  3CYO A;  1SES A;  5KFN A;  2KQX A;  2Q67 A;  2XGP A;  2C2R A;  4TQR A;  4LF6 O;  2V9W A;  3FYE B;  2CH7 B;  1XIL A;  1ZX3 A;  4QE9 A;  3RR5 A;  2CQY A;  2R7Z A;  2JJ2 G;  2F95 B;  4F6R B;  4I7H A;  3TIG A;  2ZR3 A;  1T3N A;  1TVK B;  4EGJ A;  2JS3 A;  4JYB A;  2ZJT A;  4TM5 A;  1YXB A;  2W9B A;  2XT9 A;  5JH7 B;  1JVM A;  4R6Z A;  4BBR G;  4IIJ F;  1BSM A;  4PDR A;  1DV1 A;  5LYJ F;  2ODT X;  1S0M A;  3UT5 A;  3RGX A;  4Q8E A;  5H6R A;  4TQD A;  4JI2 B;  4FBT A;  1HDJ A;  3Q8S B;  2WTF A;  4ED1 A;  3L72 H;  3K58 A;  2GUZ A;  1P84 F;  2AXT Z;  4FLW A;  1HR0 B;  3HOV G;  1F7Y A;  4F4L A;  4I9Q A;  1BHA A;  1G4Y B;  1ULZ A;  4ZIB A;  3B8N A;  4W4K A;  2UVU A;  3K9S A;  4FFO A;  4LCU C;  2YXL A;  4CH3 A;  3N42 B;  2EIM C;  5IYB O;  1IBL B;  1XRE A;  2CNV A;  4KFM A;  4ZHQ B;  2Y69 B;  2R7K A;  3OTO B;  3T9D A;  1XEQ A;  4JI2 H;  4QWC A;  3R23 A;  2FTK A;  2WE6 A;  2WAM A;  2R7Z G;  1HR0 H;  1SET A;  4I50 B;  2R8G A;  1KU9 A;  1GN4 A;  1S5L Z;  2XUM A;  2BSK B;  3I4M G;  4MW3 A;  2OTL V;  3GTL A;  3JD1 A;  4ZKI A;  5ITZ A;  5IT9 N;  1Q8I A;  1XHZ A;  1N36 O;  1M1K W;  4YQW A;  3ABU A;  5BWU A;  1Z5W A;  3U55 A;  3V4S A;  4O3Q A;  3ZBH A;  2AZ0 A;  1IBL H;  2JEU A;  4Q4C A;  3OAA G;  5KG4 A;  4FM9 A;  3OTO H;  4PDL A;  5IP9 G;  3ZHS A;  2A79 B;  3OMI B;  3LQS A;  2KKW A;  4QE7 A;  4U3J B;  2W8K A;  4CZZ A;  2Y48 A;  1JFF B;  2BOC C;  3CE2 A;  4RAZ A;  1PNL A;  4DR5 B;  4EB6 A;  3HKC B;  5E1A C;  1J5E O;  3ASO B;  4JI0 O;  2ZCE A;  3RYF A;  1Z2N X;  2FB5 A;  4OPA A;  4I9W A;  3A0R A;  1QLE C;  4CS4 A;  1W96 A;  2W6N A;  4Q43 A;  2YYA A;  5KFB A;  3GJX B;  3OW2 U;  3CMA V;  3V6K A;  3D3Q A;  4FLZ A;  1X9N A;  1GMG A;  4YP3 A;  4DR5 H;  2RMK B;  5KUK A;  4XYM B;  3NC0 B;  1CKO A;  4Q45 A;  4DRX B;  1KQS U;  2OT5 A;  3EXA A;  4J9Y B;  2R84 A;  1KUQ A;  5KFD A;  5DQH A;  1SCU B;  2V4D A;  4TQS A;  2YW2 A;  5KFF A;  4IWY A;  4PA4 A;  4FPP A;  2IBK A;  1S9F A;  2ARH A;  5FJ8 G;  1V54 C;  5J2U B;  3VA7 A;  4DL3 A;  5EWG A;  2Q7D A;  3RB4 A;  1K7D A;  1DF5 A;  1H2S B;  3CC7 V;  2IW5 A;  3FAV B;  4YY3 O;  2EIM B;  1F51 A;  5D1P A;  1YIT V;  4NZM A;  3G71 V;  3WO0 A;  2GQS A;  2QKA A;  3H01 A;  4B3T O;  5LGU A;  4JV2 A;  3IC7 A;  2Y0S E;  3T5J A;  2DWC A;  1FKA H;  4O82 A;  4FLX A;  2VQD A;  4O7S A;  5I5V A;  4O3S A;  3N44 B;  4CC5 A;  3OMA B;  3AG2 C;  3SJQ C;  1T94 A;  2UVW A;  1HNW O;  2B63 G;  2ZDH A;  4O81 A;  4IGG A;  1KEC A;  4FLY A;  3T5H A;  1KJI A;  3M8A A;  3JCZ A;  2A1H A;  3ZHQ A;  2PI5 A;  2RGV A;  5T14 A;  2HJD A;  1AUX A;  4JZ2 A;  2R82 A;  1LNQ A;  2Q0O C;  4PEL A;  4ED0 A;  4FE2 A;  3MD0 A;  3SI8 A;  3R65 A;  4BW9 A;  4TUY B;  1IOW A;  4IYI A;  1QLE B;  5L3F A;  4EEY A;  4R50 A;  3D3I A;  4CKE A;  5I5W A;  3MR2 A;  1ARO P;  3DTG A;  1XNR B;  3FMA A;  3KAJ A;  2ITC C;  1NVP B;  4O2B F;  4OXS A;  3JAL A;  5JVL A;  5LGN A;  4DUY B;  2UU9 O;  4DQN A;  4B7K A;  3ZN0 A;  2YEV A;  1VQ9 V;  2E75 B;  1N33 B;  2Q7E A;  3CVZ A;  4R7R A;  3UYY A;  1V54 B;  3DC5 A;  3RTX A;  3T1C A;  2H3O A;  3MHS C;  1XNR H;  3L71 H;  4DV1 O;  4F50 A;  4LF7 B;  3TXS A;  3K5M A;  2YS7 A;  1JIH A;  2Q9L A;  5LHI A;  4KL1 A;  3OE7 G;  1P8L A;  1VF7 A;  2N74 A;  2GLT A;  1RPO A;  4JTC B;  2HVS A;  4DUY H;  5KFS A;  2YRW A;  3T1H B;  5LL6 b;  3AG7 A;  1UFI A;  1GSH A;  2Q7H A;  4F4Z A;  4WFE A;  3E35 A;  5KG0 A;  2UUA H;  2GTS A;  2BTO A;  1ET0 A;  4R7C A;  4QW8 A;  4NXM B;  1H2M A;  2CNQ A;  1ZAU A;  4BXX G;  4CKC A;  3ZS8 C;  3E86 A;  4YBZ B;  3OT7 A;  5KAF Z;  1SQQ H;  4M7E A;  3HOU G;  5JUM A;  2JA5 A;  4WFG A;  3AG2 B;  4HQ6 A;  4LF7 H;  5LMN B;  1E79 G;  1HNZ B;  3VQW A;  1IDS A;  4IYH A;  4GX0 A;  5BMV A;  1A9X A;  2FE3 A;  1AR4 A;  4O7Z A;  4DRF A;  1YJ9 V;  4LFA B;  3SJC C;  4DK0 A;  4MA0 A;  3U11 A;  3T1H H;  2YDE A;  1L0N H;  5LBQ A;  3RIZ A;  3F7V C;  4X1K B;  2GDS A;  2HJW A;  2F4V O;  3H4B A;  4DV7 O;  4BY7 G;  2YS8 A;  4NXM H;  4Q4D A;  2WLI A;  2EBO A;  1VS0 A;  5IYZ F;  4A3M G;  2OIE A;  2CUG A;  2VR1 A;  5KFV A;  4OPH A;  1HNX B;  1L2Z A;  3HKE B;  5LMN H;  4KHP O;  1HNZ H;  5LL6 Y;  4A2B A;  5L3B A;  1R3J C;  3CD6 V;  4WBN B;  1E4E A;  1M0W A;  5L3E A;  3LUT B;  5JQG A;  1F4N A;  4MV3 A;  4JUZ A;  2F43 G;  1Z5V A;  4LFB O;  3K5H A;  1IBK O;  3PO3 G;  4GKK O;  1A48 A;  3F8N A;  2NLJ C;  5BWX A;  1K3E A;  3CPW U;  3ZRX A;  1RP3 B;  3H0G G;  2H8P C;  2ALZ A;  1K4D C;  1HNX H;  1N34 O;  1GRJ A;  1XMQ O;  1BZK A;  2ZR2 A;  1WPB A;  2JGD A;  4H44 B;  4EGQ A;  4CHI A;  2BQR A;  5I5Y A;  3SE7 A;  4IRK A;  5BYA A;  2ILM A;  3SYP A;  1M90 W;  2FYU H;  3TII A;  3WG7 C;  4MVU A;  3U9T A;  1K33 A;  3QG5 A;  4DXW A;  1ZHQ A;  2N04 A;  1I7N A;  1NTZ H;  1H38 A;  2C00 A;  3AK1 A;  4HYK A;  2ZNJ A;  1R3L C;  1SZX A;  1RSO A;  5FLM G;  1BCC H;  1WJZ A;  2ATL A;  2F23 A;  1DLB A;  1OJH A;  1U96 A;  2E74 B;  1ZWI C;  3IGA C;  1KP2 A;  3SR2 C;  3HT5 A;  1E1Q G;  4JV5 B;  1IXM A;  1S72 V;  2XAG A;  4JI4 B;  3GTQ A;  5BZB A;  1E4E B;  2HDK A;  5DQI A;  5JQG B;  1I94 H;  2ODM A;  2VPS A;  4GC6 A;  3D8C A;  3CME V;  5I5T A;  2ZDQ A;  4Q0Y A;  2R72 A;  4LF9 O;  1G6U A;  1GM8 A;  1S0N A;  2DZD A;  5HNE A;  3KHH A;  3W7W A;  4QJF A;  4ECU A;  2VA3 A;  4DR6 B;  3GIP A;  1K73 W;  1XL4 A;  3K5I A;  1EFR G;  1M93 A;  4JV5 H;  3E5N A;  3AK2 A;  4PA9 A;  2X6B A;  4TV8 B;  1KJ9 A;  5LHH A;  4JI4 H;  3GTG A;  4K0K O;  1P49 A;  5IT9 W;  3RT3 C;  3OR6 C;  5IYB G;  5EK0 A;  4B3S B;  4DAA A;  1NR1 A;  4JI5 O;  4O84 A;  2YID A;  4LSX A;  4IWX A;  4PZ7 A;  1SQP H;  2Y0S A;  1Y14 B;  1XMO O;  3M9N B;  2R8I A;  2EX3 A;  3LUL A;  2FK1 A;  4ZQI A;  5EYP A;  1TGO A;  2V5A A;  5KAI Z;  4UCT A;  3CJH B;  2YXY A;  4DR6 H;  1IYE A;  5LP6 A;  3GTJ A;  4RB3 C;  1Q7Y W;  2VS0 A;  4HNT A;  2P6J A;  4O4L A;  1Y4M A;  5C1P A;  2XAS A;  1ZSP A;  3IN5 A;  3ZHU A;  3ETJ A;  2HHH B;  1W93 A;  4WHX A;  1PL0 A;  4XDJ A;  4GKJ O;  5IJ0 B;  4A3K G;  4X1Y B;  2DYS C;  3OD4 A;  3CCU V;  5J2T A;  4MVO A;  1UC9 A;  4B3S H;  1V51 A;  3STZ C;  3SNO A;  1KC7 A;  2GSM B;  4HNV A;  1M6V A;  1XQ8 A;  5EBM C;  4P30 A;  4WD3 A;  4JZG A;  1BXR A;  2EJR A;  2GTA A;  5H6Q A;  4O4H A;  4UUJ C;  2B1I A;  2BTQ B;  5LXT F;  4YHH O;  4JAV A;  1VAJ A;  5L3G A;  4O4L F;  3WG7 B;  5JVD A;  1AIL A;  2ASD A;  3JAT B;  2HHH H;  4JF3 A;  1XUQ A;  1OHH G;  1K83 A;  5J2T F;  1MOF A;  3WWI A;  1NU1 H;  4TT3 G;  4J9Z B;  4DO2 A;  3STL C;  1VIB A;  2QM7 A;  4F4Y A;  1E1R G;  3ABT A;  2QK4 A;  4NTY A;  5KFO A;  4HNU A;  3ZRS A;  1PX2 A;  1RYS A;  2HJF C;  3RN4 A;  3VQY A;  1FXK A;  1VEW A;  4ZI7 A;  3RAX A;  2ZDI C;  2QKS A;  1WP7 A;  1XNQ B;  2AQ4 A;  4AHC A;  5C8Y A;  4B3R H;  4YJ2 B;  1IBM B;  2JEF A;  4M9U A;  3BG5 A;  3RYI B;  1QBZ A;  3U0Z A;  3T9F A;  3W5O A;  2FP4 B;  3RB3 A;  1KUT A;  2W9A A;  1FJG B;  3DSQ A;  3WWH A;  4ZI7 F;  3ZMS A;  2X0L A;  5C44 G;  3L9D A;  5B3S B;  3AW8 A;  1NBM G;  1MMM A;  1RM1 C;  1Q86 W;  2ZD9 A;  1WNS A;  1XNQ H;  5C8Y F;  2QB5 A;  3LSU A;  1IBM H;  4J9P A;  4JI3 H;  4JTA B;  4O86 A;  4RUA A;  1WRV A;  3H1L H;  2CGN A;  3LDD A;  4DW0 A;  5KA5 A;  4JYA B;  4LF4 B;  2WLK A;  1N32 O;  2WLJ A;  2LFS A;  4QW9 A;  1ORQ C;  2A06 H;  1FJG H;  4YJ3 A;  1PKX A;  3BQ2 A;  3T1Y O;  2DYS B;  5I5S A;  2ITD C;  3TY5 A;  1XL6 A;  4ZOL A;  2DYR B;  3RF2 A;  2XCL A;  3JAK B;  4UV8 A;  1XDC A;  3RBE A;  4DR4 H;  2OTJ V;  3WFV A;  1IX9 A;  3MFI A;  4MV1 A;  4K8X A;  2JS5 A;  3PW2 A;  2YRX A;  3M9O B;  2CTR A;  4NZN A;  3HKZ A;  4JYA H;  4LF4 H;  3H4D A;  4C2M A;  5KFI A;  2XAJ A;  1URF A;  1ZL8 A;  2YU9 A;  3ETH A;  4ED8 A;  2UXC B;  3HKB A;  2DPI A;  2UXB B;  3GVM A;  1BMF G;  3NGD A;  3RW0 A;  4ZOL F;  3DGE A;  4ME6 A;  3GV7 B;  3DTF A;  3C0F B;  3SJA C;  4GX2 A;  2VUM A;  2YZL A;  1N33 O;  5KG3 A;  3ZRW A;  1XHX A;  2RQ6 A;  2ZE6 A;  4DYL A;  4IR9 A;  5LMU B;  5LOV A;  3E83 A;  4I4T A;  4NYK A;  2P90 A;  1YHQ V;  2NU8 B;  1Y1W A;  1CKM A;  1YIJ V;  2OYQ A;  1FFX A;  3ETD A;  5EZY A;  3CC4 V;  5FNV F;  5GON F;  2UXC H;  4WCE V;  3JAS B;  4UXN A;  4LF8 B;  5DMX A;  3VPD A;  2UXB H;  5CAE B;  2R9A A;  4YJ3 B;  2W6O A;  4C5B A;  4DR3 B;  5CM0 A;  4L8J A;  1P7B A;  1UC8 A;  4TV9 F;  3T54 A;  1GKF A;  5LMU H;  2JGU A;  3G8C A;  3ZMV A;  4X20 B;  3QVN A;  3ZED A;  3J7A K;  2NVX A;  2KB1 A;  2VQE O;  3N2K A;  4CS3 A;  5EDW A;  3LSQ A;  3VOT A;  1VQ8 V;  5I47 A;  3SPH A;  2NNU A;  3FKI A;  4RAY A;  1V55 C;  1J95 A;  3X2Q C;  4HNA B;  1GM7 A;  5EZY F;  2ZIN A;  4DV4 H;  1RM1 B;  1THZ A;  2EIK C;  1S77 D;  3TY9 A;  3OUS A;  4LF8 H;  2IP4 A;  4P9O A;  4X64 H;  4DV2 B;  4DR3 H;  3DC6 A;  2WLN A;  3B2E E;  4LFA O;  3KCY A;  4U7C A;  2VUM G;  4QGP A;  3I12 A;  4HZ3 A;  2JA6 A;  5DLG A;  2ASL A;  5F9L A;  2WLH A;  1NKD A;  1FXH A;  3U9S A;  1S97 A;  2UUB O;  3LP8 A;  4DV5 O;  4EYH B;  3S24 A;  4D7S A;  2YZN A;  1W0J G;  1RJP A;  5KFH A;  4ECT A;  2V7Q G;  4I4T B;  3MJF A;  2DLN A;  3JSN A;  2CH7 A;  3KAK A;  3L74 H;  3SYQ A;  4F6R A;  3CQZ A;  4DV2 H;  1FFX B;  1AUV A;  1TVK A;  4YB8 B;  3BAB A;  5HFM A;  4CE5 A;  3FB6 C;  1IYD A;  5JH7 A;  4E4E A;  2IU3 A;  4MTE A;  3HB9 A;  4XYL B;  5E25 A;  3MFH A;  1B3Q A;  4DV6 B;  4DR2 O;  1RJR A;  4MW8 A;  3R9R A;  3UFX B;  4DL5 A;  1EZJ A;  5L1L A;  5IYC O;  3Q8R B;  1OCZ C;  1D2D A;  3MR6 A;  1RPR A;  4OGQ B;  1ZUQ A;  3EFF K;  2JVD A;  4GCZ A;  3LDC A;  4FGR A;  3BAA A;  2Q69 A;  3UCS C;  2CGO A;  4DR1 B;  4QWA A;  4XZ3 B;  4MTF A;  4DK1 A;  2HGW A;  2O03 A;  2RNB A;  4CKB A;  5F2V O;  3O9O A;  5JH7 F;  2UVV A;  4U7O A;  3FD9 A;  3UO2 A;  3MWE A;  1H8H G;  2SCU B;  4DV6 H;  5KFZ A;  3GB7 C;  2ZT9 B;  4JI8 O;  2R92 A;  3SJB C;  2E2I A;  4LC1 A;  3UQ8 A;  3N43 B;  1OZ0 A;  2B1G A;  4I50 A;  4GT1 A;  2YZG A;  5JQW A;  2BSK A;  3RB6 A;  4DR1 H;  2VQF B;  1DF4 A;  3IC9 A;  2R7L A;  4DIM A;  1CEZ A;  3APO A;  5JJJ B;  4ZHQ F;  5KX5 F;  5K2M A;  4RUC A;  3F7Y C;  1V55 B;  4EG0 A;  4PA3 A;  3X2Q B;  1Y1V G;  4U3J A;  4BIU A;  5CB4 B;  1SA0 B;  4YAK B;  4NTW A;  4ABM A;  2EIK B;  1JFF A;  2FKL A;  5C93 A;  1WSC A;  3ZN1 A;  2XAF A;  3RYC B;  4LFC O;  4I50 F;  4DUZ H;  3HKC A;  4BAY A;  3ETQ A;  4BWS C;  1NZ6 A;  5K1P A;  5KFC A;  3GIM A;  1VF6 C;  2VQF H;  5C3E G;  2LGQ A;  3Q4H B;  1SEI A;  4JI1 B;  3A0H Z;  3MWD A;  3GIL A;  2VWK A;  2JJ1 G;  5L9X A;  4XX0 B;  1DTO A;  4ECQ A;  3P3N A;  2V4R A;  2R92 G;  1L1F A;  2QM4 A;  2DN9 A;  2CDY A;  3D36 C;  3GB8 B;  3E8F A;  3I5D A;  4GUN A;  4IL6 Z;  3T7A A;  4W4L A;  4TOI A;  1Q6U A;  3LDE A;  4DRX A;  3FFQ A;  1QVG U;  4HR7 A;  4NB5 A;  4UB8 Z;  5BPH A;  5DGA A;  2MK3 A;  4ECR A;  3JAR B;  3ABM C;  4DL2 A;  4JI1 H;  4PI2 A;  1OCZ B;  3G80 A;  4O4I B;  2FLL A;  3CCL V;  4L1K A;  3E22 B;  5DGH A;  5DIS C;  1I7F A;  3GTK A;  1U97 A;  5J2U A;  2ZE8 A;  3V4Z A;  4X89 A;  3LML A;  4JI7 B;  3J80 N;  3BPZ A;  4IIJ B;  1BGW A;  3HKD B;  5F9N A;  3T5L A;  1VQ6 V;  3PW5 A;  3FAV A;  3H1H H;  4R8C A;  3PJS K;  3K9A A;  2OLS A;  1E4F T;  4FBU A;  2WPD G;  3D36 A;  4AYB A;  3GTP A;  3K06 A;  4BR6 A;  1K1S A;  4EKW A;  4CMF A;  1SQG A;  3H40 A;  2ZM6 B;  3APQ A;  4JV1 A;  4A5U B;  2YIC A;  3ZMZ A;  1UPG A;  2WLM A;  2Z5U A;  4PDV A;  4JI7 H;  4J9R A;  4NXN B;  3GLK A;  4MSW C;  3GDE A;  3M7M X;  2W71 A;  1YF2 A;  4A3G G;  1A0I A;  2H94 A;  3K0G A;  1WH2 A;  4K35 A;  2C22 A;  4C7U A;  3PW7 A;  2ZM6 H;  2LQT A;  2WA3 A;  1AI5 A;  4NXN H;  1QU7 A;  2ZDG A;  1ZTE A;  4PWQ A;  4PA6 A;  4TUY A;  2FKX A;  4CC6 A;  1YI2 V;  3BVO A;  5BY1 A;  4J11 A;  1YDX A;  3CHX A;  4JGS A;  5FD5 A;  1I6U A;  4B7E A;  3P32 A;  3N27 A;  5L3D A;  4X65 O;  4X62 B;  4YXW G;  4X88 A;  1NH2 D;  1QQC A;  3VPB A;  5I60 A;  4FFR A;  3BQ0 A;  1KYO F;  5EOY A;  2K9P A;  4O2A B;  3SPG A;  3G67 A;  2Z02 A;  2Q2U A;  3HOX G;  1PM9 A;  4QPJ A;  2PI4 A;  4MV4 A;  4TUY F;  5C1O A;  2M6Y A;  1ROP A;  3ABM B;  1FPO A;  1QR9 A;  3JZI A;  3G6X A;  1K92 A;  1SZT A;  4X62 H;  2UUC O;  2PUS A;  3EYY A;  2DOS A;  3TXQ A;  5CR5 A;  2ADP A;  1NT2 B;  4IZO A;  5IJ9 B;  5BWT A;  1G8M A;  5CA0 B;  4EQ5 A;  1RK5 A;  3KKY A;  1H2K A;  1EKV A;  3E8H A;  4IRD A;  2QEX V;  1MAB G;  2FML A;  1XDN A;  2E2H A;  4DR7 B;  1NS1 A;  3WB2 A;  2W70 A;  3GWO A;  1VQN V;  1VBH A;  5DG7 A;  2LO1 A;  1SF9 A;  4DV0 O;  1SQF A;  1S0O A;  1AP5 A;  1M5I A;  5GW7 A;  2X7R B;  2EIN C;  3Q2O A;  4JYY A;  2W6J G;  3BA9 A;  3KCX A;  1DAA A;  4O3P A;  4Z2W A;  4O7V A;  2KSW A;  1Y74 B;  1TUB B;  3I4N G;  4JAA A;  3H3V H;  3J7A U;  4DR7 H;  4ECS A;  2CK3 G;  4X1K A;  3KYH C;  4D6T H;  5D1O B;  1PPJ H;  3UO3 A;  2UUA B;  5IWA O;  4RQE A;  4R8U B;  3QQM A;  4Q8F A;  1G1X B;  3GV8 B;  3HKE A;  4O4J B;  4BIO A;  4H37 A;  4WBN A;  2JIZ G;  4PD4 F;  2FJZ A;  2HKO A;  4KUM A;  3K5N A;  4ED3 A;  3HPL C;  1R3K C;  4M0J A;  4UCU A;  1EM1 A;  3JD0 A;  3HOW G;  3ZJZ A;  5FPO A;  4AQY O;  2A0L A;  3UM7 A;  2FB9 A;  4E6N A;  1VQL V;  4UCS A;  1YJN V;  4C5C A;  4UVB A;  2GV9 A;  4FZ1 A;  2AGP A;  4LR3 A;  1OBG A;  4WFA V;  3BAC A;  3A0B Z;  3OSP A;  2PBZ A;  3A2F A;  1GSO A;  4UCV A;  2R7N A;  4G2K A;  5JWP A;  3OSN A;  4F4X A;  1KD1 W;  1WA8 B;  4JI6 B;  5JJN B;  2E5L B;  2RDI A;  4FFP A;  5IP7 G;  4DV3 B;  4ED6 A;  4QSH A;  1I08 A;  1ZLZ A;  4FFB B;  4MT8 A;  4H0L B;  3S3W A;  1Z2O X;  3DXR B;  4IHJ B;  1KTA A;  4X66 B;  1TWH A;  1N0N A;  1CQJ B;  2I80 A;  2RJZ A;  5FLX N;  4OX9 O;  4LF5 O;  3QWU A;  1R9T A;  2YXH A;  4MVR A;  4CMD A;  1BJT A;  2R6F A;  2HVR A;  3HKZ E;  2ADQ B;  2LJ2 A;  2HG8 A;  3G6E V;  2VRZ A;  5BMV F;  2E5L H;  4JI6 H;  2RCV A;  4GYC B;  1IUR A;  2RDJ A;  2EIN B;  4DV3 H;  4O3R A;  3C3S A;  4NLG A;  5IYC G;  4QWB A;  3WWJ A;  4HAM A;  3MHH C;  3SPJ A;  3E2E A;  3HOY G;  4QPK A;  2NUA B;  4X66 H;  2JA5 G;  4TV8 A;  2UXD B;  2HHF B;  3NBY B;  5KFG A;  2BQ3 A;  2P7T C;  2JA7 A;  2WLL B;  1LR1 A;  3QZ7 A;  3WNZ A;  5EC1 C;  5JQG F;  4B3M H;  5KG7 A;  4TVI A;  1EN5 A;  1B6S A;  4U7N A;  1I94 B;  3CJH A;  5KFQ A;  3ABL C;  4UUG A;  1NTM H;  1NTK H;  1AI6 A;  2RN9 A;  4LNU B;  5BR8 B;  2IM9 A;  2UXD H;  4JI2 O;  2ZNI A;  3HB3 B;  5IJ0 A;  2X0S A;  5KT2 A;  4X1Y A;  1US6 A;  2AHZ A;  1HR0 O;  5BYB A;  1H2L A;  1SRY A;  2M7W A;  2Z04 A;  1NJI W;  1YCI A;  3OGI B;  2QF7 A;  2BTQ A;  3VOU A;  3WB0 A;  1CS0 A;  4WFH A;  5C5J A;  5B1B C;  1FVI A;  1IBL O;  1B6Q A;  3JD2 A;  5BR8 H;  3JAT A;  3OTO O;  2ZE5 A;  1TUE B;  4PI0 A;  3AX6 A;  3PZP A;  1LUV A;  1Y66 A;  4GZR B;  3AG1 C;  2EJ0 A;  4BIZ A;  3R5F A;  2KSD A;  2ETN A;  3FB5 C;  1VP7 A;  4Z1M G;  4N21 A;  1EUD B;  5B66 Z;  1Y67 A;  5B3S C;  3BRC A;  4K6N A;  3FB7 C;  1G2W A;  5LA6 A;  1P4R A;  5EBL C;  5KLV H;  4RB0 A;  1IVS A;  2NN4 A;  3QO5 A;  3J80 W;  2EJ2 A;  3NBZ B;  1MSD A;  5KG1 A;  4ED7 A;  1YTF D;  2N05 A;  2EIJ C;  4DR5 O;  1SC5 B;  4LF6 H;  4B08 A;  2UXN A;  4YJ2 A;  4RCN A;  1R1B A;  1NH2 B;  5KMG B;  4ZBM A;  1HWY A;  1KP3 A;  5LHG A;  3RYI A;  3RYH B;  2DAA A;  2DYR C;  3KRE A;  4PZ8 A;  3EHB B;  3JAM W;  1JX4 A;  4X1I B;  1WAZ A;  5J9P C;  1XOU A;  2IJJ A;  1JCH A;  5LP6 F;  2QGN A;  4J0M A;  1TA8 A;  5LGT A;  3GIK A;  2PVP A;  4PA7 A;  1SQX H;  2VWJ A;  4YJ2 F;  4A3E G;  2Y4U A;  5A9G A;  1N0J A;  3ABL B;  3RWR D;  1N36 B;  2COI A;  4B3R B;  3ABK C;  2MCT A;  4UCO A;  3CCQ V;  4TSF G;  2YWV A;  5KFR A;  1BT8 A;  4O4H F;  1K5S A;  2EJ3 A;  3EPI A;  1I1M A;  4X8A A;  1FKA O;  4MV6 A;  5LA6 B;  3DTU B;  5JVD F;  3CXC U;  2AU0 A;  2JA8 G;  4IRC A;  3JAK A;  3K59 A;  4J9S A;  4K8Z A;  5CN0 A;  3VPC A;  3ZMT A;  4RUE A;  2YIB D;  1L8D A;  5B1B B;  4MAM A;  4Q6G A;  1J5E B;  2V4Q A;  1N36 H;  1I1K A;  4JI3 B;  4O7L A;  3KHG A;  1S03 G;  1M9N A;  2HR3 A;  3OFN G;  2HIV A;  2I8C A;  3K5L A;  5H9C A;  1VKZ A;  2FK3 A;  1GYF A;  2E76 B;  3AG1 B;  3B8M A;  4I55 B;  1AI7 A;  1IOV A;  5IYD G;  3OUZ A;  2HVQ A;  2W6I G;  3K3W A;  3K5O A;  3S3X A;  3U54 A;  2BQU A;  2WAQ A;  5KG5 A;  1J5E H;  3W1B A;  4RO2 A;  1VAR A;  4DR4 B;  3L73 H;  3I56 V;  2NU6 B;  3TIN A;  4JI0 H;  1EN4 A;  2ZDI A;  3K3P A;  4GX5 A;  3JAS A;  4QWE A;  2EIJ B;  2FPG B;  1CP9 A;  3KZI Z;  3QO8 A;  4RAI A;  1JMK C;  2R87 A;  5DM6 V;  2YL2 A;  2CW7 A;  4AIL C;  3RBD A;  3H20 A;  5GTH Z;  4I0X B;  1ENV A;  4CH6 A;  2W57 A;  1WB8 A;  4PJ0 Z;  3CP1 A;  1PNM A;  4X20 A;  2AHY A;  5HV6 A;  1S5J A;  1H8E G;  3R5X A;  2YIA A;  3E8B A;  4YY3 B;  4ICG A;  4G3I A;  4AYB E;  3J81 N;  1I7L A;  2DE0 X;  4HNA A;  1CPY A;  3K79 A;  3QNE A;  3U10 A;  5TIS Z;  1XNR O;  1C3O A;  4YJ3 F;  3CRQ A;  1PK8 A;  3K57 A;  1VQM V;  2JRI A;  1VQ7 V;  1VBG A;  1GO3 F;  2R9R B;  2GBO A;  4EBC A;  1SKV A;  1D5A A;  3ABK B;  4DUY O;  3ETG A;  4GLW A;  1O9G A;  3MDS A;  1HNW B;  4DW1 A;  3FDS A;  4YY3 H;  4D7T A;  2UUA O;  3CCJ V;  5KFL A;  4CH4 A;  4FLU A;  1CQI B;  1WR2 A;  2JEG A;  1VQK V;  3ICX A;  3CC2 V;  3SPI A;  4XDL A;  4B3T H;  1MSW D;  3L70 H;  4UVC A;  4ECZ A;  1EKP A;  1YZB A;  4DV4 B;  4LF7 O;  3QF7 A;  4LSA A;  2QYZ A;  4X64 B;  2QM8 A;  2HFE C;  3T99 A;  1Y76 B;  3AYH B;  2LGW A;  4EYI B;  3T1H O;  1HNW H;  1VMG A;  3BA8 A;  1M4U A;  1TAE A;  3Q8P B;  5LOV F;  4NXM O;  2OWO A;  2VA2 A;  4I4T F;  1KMI Z;  2ATK C;  2R93 A;  2P06 A;  1I1L A;  5LMN O;  1HNZ O;  1YSC A;  1GAX A;  3B4S A;  3L75 H;  2EUL A;  2GQR A;  1I2L A;  2QWP B;  4XBF A;  5CBH A;  3FYI B;  2YZM A;  3H1K H;  2UU9 B;  4NZO A;  1AR1 B;  1C30 A;  2ABJ A;  2J9G A;  5DGB A;  5CMU A;  4QWD A;  3IFX A;  4LH6 A;  3OR7 C;  4LP8 A;  2QWO B;  5KFK A;  3TGU H;  2DIK A;  2V58 A;  2W9C B;  5FLX W;  4RZR A;  1Y1W G;  1F4M A;  1JPX A;  4FM2 A;  1HNX O;  3VNN A;  3TQ1 A;  4MV9 A;  1V4Y A;  3TW7 A;  3G8D A;  2B5U A;  1OWT A;  5FL7 G;  3N6R A;  1SQB H;  1SQV H;  2FMA A;  1I5X A;  3BCC H;  3OMN B;  2P0A A;  3MR3 A;  5FNV B;  2PN1 A;  2XND G;  5GON B;  2L35 A;  5KT6 A;  2UU9 H;  4LWS B;  3CEI A;  3GWK C;  2NU9 B;  5CB4 A;  1SA0 A;  2EZP A;  1JLL B;  2COG A;  5KKN B;  3PR5 B;  4FMT A;  3RYC A;  3JAW B;  2D3O W;  1BHB A;  4TWK A;  5KS8 A;  3G6V A;  1UNN C;  3FKI G;  2DPJ A;  3OHB A;  4DV1 H;  4E2L A;  3Q4H A;  2PY5 A;  1AJP A;  3OUF A;  3RV4 A;  5CA1 B;  4YR3 A;  2Y4T A;  2JA6 G;  2AZ2 A;  2KG7 B;  5CB4 F;  1I94 O;  4J42 A;  4UB6 Z;  1ZQ7 A;  3N2G B;  2F4V B;  3M9M B;  4DV7 B;  5DG9 A;  4MVZ A;  2YI9 A;  1MG1 A;  3K04 A;  1YTF B;  5EWE A;  3BY6 A;  1I3Q A;  3W7U A;  3BEH A;  1SER A;  2Q5Z A;  4FM1 A;  4DUZ B;  4MS2 A;  4JV5 O;  3TW6 A;  3JAR A;  4UV9 A;  1COW G;  2X6C A;  2NU7 B;  4JI4 O;  2WB1 E;  4J7Z A;  4O4I A;  4QNH B;  3E22 A;  5HBR B;  2CFM A;  4LFB B;  4A93 G;  5K3W A;  1SFO A;  2F4V H;  4GKK B;  3MAQ A;  4DV7 H;  4MVS A;  1JDB B;  5FPR A;  1X59 A;  4IIJ A;  3HKD A;  5LYJ A;  4DR6 O;  2LFR A;  2FLN A;  4K3A A;  1XMQ B;  4KHP H;  5KUM A;  1EYZ A;  4J9O A;  4LH7 A;  1BGY H;  2E3C A;  2YUA A;  5KA6 A;  4BY1 G;  4O4I F;  3HR0 A;  3W7T A;  1B33 N;  2IMW P;  4B3S O;  2YC0 A;  4LFB H;  3G6Y A;  1IBK H;  3ZRV A;  3G6B A;  5JJE B;  5KFA A;  4GKK H;  4PZ6 A;  2HG5 C;  1VQO V;  2DJV A;  5BWW A;  1R6K A;  3HOZ G;  3KAL A;  4PV1 B;  3N40 P;  5FR9 A;  1V9P A;  1YVW A;  1N34 H;  3ML0 A;  1XMQ H;  4EBD A;  1MZF A;  2HHH O;  1HP8 A;  1DIK A;  2YS6 A;  3TK1 A;  4Y8V B;  1Q81 W;  2L6L A;  2W0F C;  1CKN B;  2RDC A;  5JCO C;  2PF4 E;  1JKJ B;  2YI8 A;  3GID A;  1S3J A;  1VF6 A;  3SDL A;  3V6H A;  4LF9 B;  5KT5 A;  5KX5 B;  2I87 A;  2FK2 A;  5KFY A;  2CTP A;  2XD4 A;  3PVX A;  2QSA A;  1E4G T;  2WA4 A;  5LYJ B;  5KT3 A;  3E89 A;  4TQF A;  4JXU A;  3IJ4 A;  3RGB A;  5B1N A;  3R5H A;  2M05 A;  3CRR A;  3RB0 A;  1Q3E A;  4K0K B;  1B6R A;  1OCR C;  4FFK A;  4MTG A;  5KFX A;  2IJK A;  4J80 A;  2YCH A;  2C2E A;  4O2A A;  4B3R O;  4RNO A;  3OGC C;  2IBZ H;  4JI5 B;  3THO A;  1A3G A;  1GSA A;  3VMM A;  3AK3 A;  4MVQ A;  4FJC C;  3I55 V;  4RB1 A;  1XMO B;  2AGQ A;  2J6U A;  3JAM N;  5J2U F;  4LF9 H;  4NYE A;  2ZE7 A;  4FFM A;  3KG2 A;  3L4K A;  2UVR A;  3DF7 A;  1GTO A;  1IXB A;  4WFF A;  4KP4 A;  4IAJ A;  2W9B B;  2Q0A A;  3B77 A;  5JCO A;  4FLV A;  3T9A A;  4U6P A;  5KFP A;  1L0L H;  3UT5 B;  2AGO A;  1GM9 A;  3L2P A;  4GKJ B;  4RNN A;  3Q8Q B;  4K0K H;  1XNQ O;  1P16 A;  5IJ9 A;  1ZHS A;  4ETS A;  2GUZ B;  1BL8 A;  3PFF A;  4O2A F;  5CA0 A;  1IBM O;  1M56 C;  4JI3 O;  2W7O A;  4JI5 H;  1K34 A;  4O7T A;  2LW7 A;  5KHI A;  3TY8 A;  1XMO H;  2XAH A;  1K1Q A;  2HEP A;  1S68 A;  3CRC A;  4UCR A;  1FJG O;  4YHH B;  5KG6 A;  3GII A;  2D2C B;  3NUA A;  3GQC A;  3K08 A;  2VPQ A;  1RFY A;  4RB2 C;  4GKJ H;  5IYD O;  2CZG A;  1AJN A;  4MTD A;  1GN2 A;  3GIQ A;  3SYC A;  1KB9 F;  3ZHR A;  4DR4 O;  5CA0 F;  2B63 A;  4BW5 A;  3HO8 A;  1GK9 A;  1OBD A;  3L4J A;  3R66 A;  5ITZ B;  2COJ A;  1Y74 A;  4LF4 O;  1TUB A;  4JYA O;  3AG4 C;  4YHH H;  2W8L A;  3IG0 A;  5L1I A;  2YSU B;  3OHA A;  2LW1 A;  3H1J H;  2PZS A;  3N8D A;  4A3J G;  5D1O A;  2V59 A;  1Z2P X;  1K5Q A;  4R8U A;  1R3I C;  5BXZ A;  1XBL A;  3UZO A;  4EB6 B;  4O4J A;  5D5P A;  5KFW A;  3J81 W;  1KKC A;  4I5S A;  3G4S V;  4BBS G;  5H2F Z;  2CTW A;  2IH3 C;  2F66 C;  1CXZ B;  3ZMU A;  2DWD C;  3RYF B;  1XI1 A;  4MTO A;  2QTO A;  4UFZ A;  2UXC O;  3QFF A;  2FLP A;  1I50 A;  2UXB O;  1OCR B;  2UXX A;  3OUU A;  3RAQ A;  1T5E A;  1B06 A;  3TEK A;  2AGA A;  1K8A W;  3T2M A;  4O4J F;  5LMU O;  3PR4 A;  2EIY A;  1P7G A;  1KT8 A;  2XAQ A;  1Q90 D;  1N32 B;  2BOB C;  2F93 B;  3WO1 A;  1RK6 A;  2HIX A;  1WA8 A;  4DV4 O;  3T1Y B;  5DEC A;  4LF8 O;  1EHI A;  3CB2 A;  1QVF U;  3P30 A;  4O2B A;  4X64 O;  1LUW A;  4DR3 O;  3RFC A;  1EBO A;  1M56 B;  3H1I H;  4JPR A;  2W6M A;  3UZB A;  4FFB A;  3ZIA G;  2ZIO A;  5L1J A;  2CKZ B;  3DXR A;  4IHJ A;  2XOK G;  3TCU A;  4P9P A;  1FYJ A;  2PGG A;  1QHT A;  1VF5 B;  3JD3 A;  2HP8 A;  2P4V A;  2A7W A;  1N32 H;  4O83 A;  3M4I A;  4NR1 A;  1EN6 A;  5CBF A;  5FD6 A;  5KFM A;  5A2Q N;  3T1Y H;  2WB1 A;  2MW2 B;  2Y0P A;  1FD9 A;  2R9I A;  4DV2 O;  4J9M A;  3IAY A;  4G28 B;  3QZ8 A;  1YJW V;  4IHJ F;  5HFL A;  1KBL A;  4XDK A;  1A0G A;  1WN7 A;  3AG4 B;  3P3P A;  4H13 B;  3LNM B;  3RVY A;  2WAQ E;  1OCC C;  2W7P A;  2ASJ A;  2Q7G A;  4J10 A;  2HHF A;  1TWA A;  1Q6I A;  2WLL A;  3CCE V;  4WBN F;  2R8J A;  2ZIM A;  4EBE A;  1Q6H A;  4APM A;  3U0G A;  4N23 A;  1JDE A;  2WWW A;  4EFE A;  1K9M W;  1Y6X A;  3UKM A;  4CBC A;  2DAB A;  2XHB A;  2PMZ E;  1EZ1 A;  4FK5 C;  4O2B B;  1N33 H;  1GO3 E;  1T36 A;  1Z2G A;  4LNU A;  4DV6 O;  3EPG A;  2IH1 C;  2QE7 G;  5IYZ A;  3TJT A;  2VQE B;  1BNC A;  2CE4 A;  3H0G A;  5H80 A;  1QCE A;  3K0D A;  3C90 A;  5C4X G;  1S10 A;  1AB3 A;  4DR1 O;  5KFU A;  4FS2 A;  3ZX6 A;  4B3M B;  4F4W A;  1XK5 A;  2RF4 A;  4HBN A;  2JK5 C;  4YIO A;  3JAL B;  2W6Q A;  2X5R A;  1TWC A;  2FPI B;  4Z1V A;  2YEV B;  3W7S A;  2UUB B;  1GLV A;  2G38 A;  2VQE H;  4ECW A;  4DV5 B;  3PW4 A;  3OEE G;  4J9K A;  4DLK A;  1EKF A;  4HYO A;  1MZE A;  1CE8 A;  4DL6 A;  3OTF A;  4DUZ O;  4NTX A;  4LBE C;  2P22 C;  1KJJ A;  4J9N A;  1X4T A;  2VQF O;  4L87 A;  1I5Y A;  4LFA H;  5DAA A;  1F23 A;  3KXY T;  2QWR B;  1AVM A;  3OEH G;  1N48 A;  3RFR A;  4DR2 B;  2OCC C;  2FL4 A;  4KXR A;  3RV3 A;  1AI4 A;  2UUB H;  4DV5 H;  1OCO C;  3AG3 C;  3BQ1 A;  3VQX A;  5GTI Z;  1WCM A;  5E79 Z;  4O7R A;  4J7K A;  2PYL A;  4TV8 F;  5IYZ B;  1WB7 A;  1IZ3 A;  4WF9 V;  2Q2T A;  3GIJ A;  3CX5 F;  3GV5 B;  4CH5 A;  5KMG A;  2GHY A;  3CXH F;  3RYH A;  3KHL A;  1H2G A;  2QTS A;  3T4D A;  2AW9 A;  1SYX B;  2P5O A;  2XTA A;  1OCC B;  5BMV B;  3JRW A;  4JI1 O;  3FKS G;  3LNN A;  4X1I A;  5EIB D;  4GLX A;  2CW8 A;  3N6X A;  4QIW E;  4DL7 A;  2BR0 A;  4DR2 H;  1GH6 A;  4JI8 B;  2PYJ A;  5D8D A;  1JOY A;  4CS2 A;  4AI8 A;  4O7N A;  4EFB A;  2WLI B;  1DV2 A;  2JA7 G;  4FU0 A;  1W0K G;  2V1D A;  5L1K A;  2R86 A;  3RUP A;  4O3N A;  2EIL C;  4FM0 A;  5KFT A;  2Q68 A;  3A8T A;  4LF6 B;  4A3F G;  1KC8 W;  3T9E A;  2QWN B;  2Z3Y A;  5LP6 C;  4FIP C;  5DED A;  3NR7 A;  1FAF A;  4FLT A;  3FX7 A;  4ECV A;  2P67 A;  1Q5O A;  3RGZ A;  4O7W A;  3CS5 A;  4JI8 H;  3RVZ A;  4RU9 A;  1WCM G;  2R7M A;  4JI7 O;  4LFC B;  1GN6 A;  4RUF A;  2R70 A;  2QDO A;  2JGD B;  5L3C A;  4H33 A;  2HLD G;  2OCH A;  1NQT A;  1VQP V;  3ORQ A;  4A3L G;  5KHK A;  5KHG A;  5KFE A;  3WU2 Z;  2ZM6 O;  4I55 A;  5LA6 F;  1JQ0 A;  3JRX A;  4J9L A;  5DQG A;  1JJO A;  4WFB V;  5B5E Z;  5LXT A;  4I7Z B;  3CCV V;  1O9H A;  4LFC H;  4NXN O;  1RSO B;  3KHR A;  4UVA A;  3PW0 A;  1KEE A;  2R85 A;  2JEX A;  2OCC B;  1WP8 A;  4MVM A;  1OCO B;  1I0H A;  1R6N A;  3AG3 B;  2XGQ A;  4RWU A;  3BJY A;  1FXK C;  3CWB H;  2J6S A;  4A3B G;  3CSX A;  4I55 F;  1QNM A;  4JTD B;  2NVY A;  5IY5 C;  2XIG A;  1A32 A;  3QO7 A;  5BPF A;  1AR5 A;  4F6E A;  1Q43 A;  2GPS A;  2EZO A;  2Z0A A;  3HXL A;  4I0X A;  2Y4R A;  1JJ2 U;  4QJF B;  2HVJ C;  3CCM V;  2Q73 A;  2IA6 A;  1EZV H;  1W59 A;  3RJ0 A;  2ZXW C;  2R8H A;  1PL4 A;  3O65 A;  4X62 O;  4A3D G;  1R6T A;  3ZHV A;  5B1A C;  4JI0 B;  4GC7 A;  2Y0I A;  2QJ1 A;  2VUG A;  4PBC A;  2DQ3 A;  4IT5 A;  2EIL B;  4FVM A;  3KTM A;  2R8K A;  3GTO A;  3ZCC A;  4YR2 A;  2DWE C;  5EYP B;  3NXS A;  1BE3 H;  5DLF A;  1DK1 A;  4MV8 A;  5LXT B;  1S5H C;  4DL4 A;  5LP6 B;  3WB1 A;  3JSL A;  5CA3 A;  4O4L B;  2O57 A;  2QKC A;  2BE3 A;  2W6Z A;  3LSS A;  1AJQ A;  1SS3 A;  1FXV A;  1EUC B;  3FB8 C;  3JZF A;  3N41 B;  5J2T B;  5KHJ A;  2HGX A;  3JCU Z;  2C2D A;  3C3T A;  3ASN C;  2C2A A;  2OH2 A;  2PMZ A;  2LP7 A;  5DN6 G;  2NR5 A;  3CEB A;  4O4H B;  1Y76 A;  1KJQ A;  1YEW A;  5CE8 A;  1QLN A;  3EVK A;  1ZET A;  4DR7 O;  1WPX A;  4NVP A;  4E4T A;  5I5U A;  4A2A A;  1D5N A;  5JVD B;  5BWV A;  4JYC A;  4MTX A;  5B1O A;  4X65 B;  4LMY A; 
#chains in the Genus database with same CATH homology
 3E22 A;  2PUS A;  3EYY A;  2CFM A;  4LFB B;  3QG5 A;  3W1G A;  1M0T A;  5EIB C;  1ZHQ A;  1NT2 B;  2F4V H;  4GKK B;  3MAQ A;  4DV7 H;  5IJ9 B;  5FPR A;  2ZNJ A;  4IIJ A;  5CA0 B;  4EQ5 A;  3HKD A;  5LYJ A;  4B3T B;  1RSO A;  3BHP A;  1XMQ B;  3SR2 C;  4KHP H;  4JV5 B;  1XDN A;  4LH7 A;  2E3C A;  3WB2 A;  4DR7 B;  4JI4 B;  3K3V A;  4ZI7 B;  4X65 H;  2CAZ C;  1SQF A;  2UUC B;  4LFB H;  5JQG B;  1M5I A;  1I94 H;  1IBK H;  2VPS A;  5JJE B;  4GKK H;  4PZ6 A;  4Q0Y A;  5C8Y B;  2R72 A;  1G6U A;  3BA9 A;  3KAL A;  4DR6 B;  3N40 P;  5A2Q W;  1V9P A;  2KSW A;  1N34 H;  1XMQ H;  1TUB B;  5FNV A;  1AN7 A;  5GON A;  1M93 A;  4JV5 H;  4TV8 B;  4DR7 H;  3VQV A;  4X1K A;  4JI4 H;  3KYH C;  3PN1 A;  1P49 A;  5IT9 W;  2UUC H;  5D1O B;  4TV9 A;  4DV0 B;  3JAW A;  4B3S B;  1CKN B;  5JCO C;  2UUA B;  4LSX A;  4PZ7 A;  2YI8 A;  2EX3 A;  4EEQ A;  4LF9 B;  5EYP A;  1TGO A;  3HKE A;  4O4J B;  4UCT A;  5KX5 B;  4DR6 H;  4WBN A;  5LP6 A;  4RB3 C;  5CA1 A;  4O4L A;  1E4G T;  5LYJ B;  2HHH B;  4TQF A;  3K5N A;  1DGS A;  3RGB A;  4UCU A;  1Q3E A;  5D5Q A;  5IJ0 B;  3N2G A;  4K0K B;  4X1Y B;  1B04 A;  5J2T A;  4DV0 H;  4B3S H;  5FPO A;  2YCH A;  4O2A A;  4ZOL B;  3THO A;  4JI5 B;  5IWA B;  2VOB A;  1XQ8 A;  4E6N A;  2WDT A;  4RB1 A;  1XMO B;  4LF9 H;  4UCS A;  4O4H A;  3L4K A;  2BTQ B;  3DF7 A;  5K1X A;  4IAJ A;  2GV9 A;  4LR3 A;  2Q0A A;  4FLV A;  5JCO A;  2RGR A;  4DV1 B;  5JVD A;  3A2F A;  4UCV A;  2HHH H;  3JAT B;  3UT5 B;  5JJN B;  4JI6 B;  2E5L B;  3SGI A;  3MWM A;  4MV7 A;  3HKB B;  4K0K H;  3L2P A;  4GKJ B;  4DV3 B;  1P16 A;  5IJ9 A;  1ZHS A;  4ETS A;  4AQY B;  5CA0 A;  1O75 A;  4JI5 H;  5IWA H;  4FFB B;  1HW7 A;  5KHI A;  3TY8 A;  3QTC A;  1XMO H;  4TV9 B;  1Z2O X;  4IHJ B;  4X66 B;  2WYO A;  2HEP A;  1S68 A;  4UCR A;  2PTM A;  2RJZ A;  3QWU A;  5LOV B;  4YHH B;  1BJT A;  2F1M A;  2HVR A;  3VQY A;  4ZI7 A;  4BWA A;  2E5L H;  4JI6 H;  4GYC B;  5EZY B;  4RB2 C;  4GKJ H;  4DV3 H;  1XNQ B;  4MTD A;  4AHC A;  5C8Y A;  4AQY H;  2HGS A;  4B3R H;  4PHZ A;  4YJ2 B;  1IBM B;  3L4J A;  3RYI B;  5ITZ B;  3U0Z A;  3W5O A;  1TUB A;  4X66 H;  4OX9 B;  2YIB A;  4LF5 B;  1FJG B;  4YHH H;  1MZB A;  3DSQ A;  4TV8 A;  2UXD B;  3IG0 A;  3NBY B;  4PDB A;  3N2K B;  2PZS A;  4KHP B;  4RZQ A;  5D1O A;  1Z2P X;  1CKN A;  4B3M H;  1XNQ H;  1WNS A;  4EB6 B;  5KHH A;  1I94 B;  1IBK B;  4O4J A;  5D5P A;  4ZHQ A;  5KX5 A;  3J81 W;  1IBM H;  4JI3 H;  4JYA B;  2F66 C;  4LF4 B;  4LNU B;  5BR8 B;  4OX9 H;  3RYF B;  1XI1 A;  2IM9 A;  4LF5 H;  1FJG H;  2UXD H;  4YJ3 A;  1N34 B;  4UFZ A;  2ZNI A;  5IJ0 A;  4X1Y A;  1T5E A;  3TY5 A;  4ZOL A;  3RF2 A;  3RR5 A;  3JAK B;  2F95 B;  4F6R B;  4I7H A;  4DR4 H;  1TVK B;  2BTQ A;  4K8X A;  2ZJT A;  2JS5 A;  3WB0 A;  5JH7 B;  1FVI A;  4JYA H;  4LF4 H;  1N32 B;  2F93 B;  5BR8 H;  3JAT A;  3UT5 A;  2HIX A;  3RGX A;  4TQD A;  4PI0 A;  4JI2 B;  3T1Y B;  2UXC B;  3HKB A;  2UXB B;  3CB2 A;  4O2B A;  3K58 A;  1HR0 B;  4FLW A;  4FFB A;  2ZIO A;  3C0F B;  3SJA C;  4I9Q A;  1XHX A;  4IHJ A;  2RQ6 A;  4ZIB A;  2PGG A;  3BRC A;  5LMU B;  1QHT A;  5LOV A;  2YXL A;  5LA6 A;  4I4T A;  4CH3 A;  3N42 B;  1N32 H;  1IBL B;  3M4I A;  4ZHQ B;  4RB0 A;  3J80 W;  3OTO B;  1CKM A;  5FD6 A;  3NBZ B;  2OYQ A;  4JI2 H;  1FFX A;  3T1Y H;  5EZY A;  2UXC H;  3JAS B;  4LF8 B;  2WE6 A;  2UXB H;  2R9A A;  4YJ3 B;  4LF6 H;  4B08 A;  4DR3 B;  1HR0 H;  4I50 B;  4YJ2 A;  3IAY A;  1KU9 A;  5KMG B;  4L8J A;  3RYI A;  5ITZ A;  3RYH B;  1Q8I A;  1XHZ A;  5LMU H;  1WN7 A;  2JGU A;  4PZ8 A;  4X20 B;  3JAM W;  3ZED A;  3J7A K;  1Z5W A;  2Q7G A;  4X1I B;  3N2K A;  4CS3 A;  1IBL H;  4FM9 A;  3OTO H;  2ZIM A;  4RAY A;  4HNA B;  2KKW A;  4U3J B;  4APM A;  4J0M A;  2ZIN A;  4DV4 H;  1JFF B;  3TY9 A;  1TA8 A;  4LF8 H;  4EFE A;  4RAZ A;  4DR5 B;  4X64 H;  2XHB A;  4DV2 B;  4DR3 H;  4EB6 A;  2VWJ A;  3B2E E;  3HKC B;  4O2B B;  1N33 H;  3RWR D;  1N36 B;  4B3R B;  2MCT A;  4LNU A;  4UCO A;  2ZCE A;  3RYF A;  1Z2N X;  5IYZ A;  2VQE B;  3S24 A;  4CS4 A;  4D7S A;  3GJX B;  4I4T B;  5LA6 B;  3JSN A;  3KAK A;  4FLZ A;  1X9N A;  3JAK A;  3K59 A;  4K8Z A;  4F6R A;  4DR5 H;  4DV2 H;  1FFX B;  1TVK A;  3BAB A;  4B3M B;  1CKO A;  3NC0 B;  2YIB D;  1L8D A;  4DRX B;  1XK5 A;  4HBN A;  5JH7 A;  4Q6G A;  1J5E B;  1N36 H;  4MTE A;  3JAL B;  4JI3 B;  1S03 G;  4DV6 B;  2HIV A;  3K5L A;  2V4D A;  2UUB B;  2VQE H;  4DV5 B;  1GYF A;  4I55 B;  5J2U B;  3OTF A;  2JVD A;  2P22 C;  3BAA A;  2HVQ A;  1X4T A;  3K5O A;  1H2S B;  4DR1 B;  4LFA H;  4DK1 A;  2O03 A;  1J5E H;  3W1B A;  4DR4 B;  5D1P A;  3KXY T;  4JI0 H;  4DV6 H;  3RFR A;  4DR2 B;  2UUB H;  4DV5 H;  3SJB C;  3JAS A;  3VQX A;  2PYL A;  3UQ8 A;  3N43 B;  1FKA H;  5IYZ B;  4FLX A;  1JMK C;  4I50 A;  2Q2T A;  2CW7 A;  4CH5 A;  5KMG A;  4AIL C;  3H20 A;  3N44 B;  3RYH A;  4CC5 A;  2VQF B;  4DR1 H;  4CH6 A;  1SYX B;  2P5O A;  2W57 A;  4X20 A;  5BMV B;  1S5J A;  3LNN A;  2YIA A;  4X1I A;  5EIB D;  4YY3 B;  4GLX A;  5JJJ B;  2CW8 A;  3N6X A;  4FLY A;  4DR2 H;  4HNA A;  4U3J A;  4JI8 B;  5CB4 B;  1SA0 B;  2PYJ A;  3U10 A;  1JFF A;  4CS2 A;  4EFB A;  3RYC B;  2RGV A;  4DUZ H;  3K57 A;  3HKC A;  4BWS C;  3ETQ A;  5K1P A;  4FM0 A;  2VQF H;  1SKV A;  4LF6 B;  1D5A A;  4BW9 A;  4TUY B;  1O9G A;  1HNW B;  5LP6 C;  1SEI A;  4JI1 B;  4YY3 H;  4D7T A;  4FLT A;  2VWK A;  4CH4 A;  1Q5O A;  4FLU A;  3RGZ A;  2QM4 A;  3ICX A;  4JI8 H;  4B3T H;  3GB8 B;  1XNR B;  3FMA A;  3KAJ A;  4LFC B;  4DV4 B;  4TOI A;  3QF7 A;  4DRX A;  3FFQ A;  4LSA A;  2R70 A;  4X64 B;  3JAL A;  4DUY B;  1HNW H;  3JAR B;  4JI1 H;  3BA8 A;  1N33 B;  1M4U A;  4PI2 A;  2Q7E A;  3CVZ A;  4R7R A;  1TAE A;  5KHG A;  4O4I B;  5KHK A;  3E22 B;  2OWO A;  4I55 A;  1KMI Z;  1I7F A;  5DIS C;  5J2U A;  3RTX A;  1JJO A;  5LXT A;  1XNR H;  3LML A;  1O9H A;  4JI7 B;  4LFC H;  3BPZ A;  4IIJ B;  4LF7 B;  1BGW A;  3HKD B;  3K5M A;  4KL1 A;  1P8L A;  1VF7 A;  2HVS A;  1E4F T;  4DUY H;  2UU9 B;  3T1H B;  5LL6 b;  2Q7H A;  2UUA H;  4LH6 A;  1SQG A;  2BTO A;  3CSX A;  4NXM B;  2ZM6 B;  5FLX W;  1ZAU A;  3ZS8 C;  2XIG A;  4FM2 A;  3VNN A;  4M7E A;  1Q43 A;  4JI7 H;  4MV9 A;  4NXN B;  3HXL A;  4LF7 H;  5LMN B;  1HNZ B;  3GDE A;  3VQW A;  3M7M X;  5BMV A;  2FE3 A;  3RJ0 A;  5FNV B;  4DRF A;  5GON B;  4LFA B;  3SJC C;  4DK0 A;  1A0I A;  2UU9 H;  3U11 A;  3T1H H;  3RIZ A;  5CB4 A;  1SA0 A;  4X1K B;  1WH2 A;  4JI0 B;  4NXM H;  2ZM6 H;  3RYC A;  1VS0 A;  3JAW B;  2QJ1 A;  2VUG A;  4FVM A;  1HNX B;  1L2Z A;  4NXN H;  5EYP B;  3HKE B;  5LMN H;  4DV1 H;  1HNZ H;  4TUY A;  4A2B A;  4CC6 A;  5LXT B;  4WBN B;  5LP6 B;  3WB1 A;  2PY5 A;  3CHX A;  3JSL A;  1M0W A;  5CA1 B;  5FD5 A;  1I6U A;  5JQG A;  4O4L B;  4X62 B;  1Z5V A;  1QQC A;  3N2G B;  2F4V B;  3F8N A;  3N41 B;  4DV7 B;  5J2T B;  5KHJ A;  5EOY A;  2YI9 A;  4O2A B;  1HNX H;  2Q2U A;  1WPB A;  4FM1 A;  4DUZ B;  4O4H B;  1YEW A;  3JAR A;  4NVP A;  4A2A A;  5JVD B;  4O4I A;  4X65 B;  4LMY A;  4X62 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...