1TAWA

Bovine trypsin complexed to appi
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSTSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Crystal structures of bovine chymotrypsin and trypsin complexed to the inhibitor domain of Alzheimer's amyloid beta-protein precursor (APPI) and basic pancreatic trypsin inhibitor (BPTI): engineering of inhibitors with altered specificities.
pubmed rcsb
source organism Homo sapiens
molecule tags Complex (serine protease/inhibitor)
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tawA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tawA02
3MO9A 3BTDE 1P2OA 1SLVB 4JZEH 1LKBA 4B75A 3ZVBA 1WQVH 4TY7A 3TVJB 2ZDKA 1SPJA 1QFKH 2RA3A 3SUEA 2I6SA 1AZ8A 3BTWE 1PQ5A 1B5GH 1TGBA 1DWDH 4GHQA 1DXPA 3SV2H 2A5AA 1YF4A 2GV6A 1OP0A 3RC5A 3U8OH 3JZ1B 3ZZ6A 3G01A 3QK1A 3RU4D 2QGRA 2FEQH 2G8TA 1TMTH 1HAVB 1KLTA 3GY8A 5JDUB 2HLCA 4OS1A 1HCGA 1O31A 1WTHD 2WPMS 1O39A 1EAUA 3MNSA 1YCPM 2WPJS 3SV7A 2BY8X 3GDSA 1DUAA 1C5RA 4ABEA 2F9OA 1GJBB 1UVOA 2ODYB 4D7FA 4AB9A 4CR5A 1S82A 2WPLS 1MBMA 3A84A 1K21H 4TYDA 1CO7E 1GJ4H 1GL1A 3M61U 1C1VH 4RN6A 2ZCHP 1ZMLA 2FS8A 4BAQB 3TK9A 1GI0A 3VB4A 3BEFB 3LH1A 5DK1A 1GI3A 1K1JA 3BEIB 2Z3DA 3OTJE 3AAVA 1C9PA 1SLXB 2A7JA 3RXOA 1YGCH 5F03A 1V2VT 2Y80A 2Z9KA 1SB1H 1VR1H 1A7SA 1H8IH 1EKBB 1M9UA 1O2XA 3DD2H 2C8WB 1S84A 4K1TA 3PTNA 1FY3A 2B7DH 4H6TA 1Y5BT 1DPOA 4WH6A 1MKWH 3MH4A 3URCA 5C1YA 3R3GB 2XXLA 1MCTA 1K1LA 1Y5UT 2RDLA 4ZKRU 2F9BH 4D8NA 3MH7A 2VH0A 5AVDA 1BRUP 1WQSA 5F8ZA 3TPIZ 1O2IA 1GJ8B 1HAIH 2BX3A 1QJ7B 4AYYB 4AYVB 1Y8TA 3S7KB 1O2GH 3BSQA 5GIBA 1FLEE 4X8TH 1LQEA 1GBEA 2NWNA 2VGCB 2V6NA 3D65E 3ODFA 1ETTH 1N1LA 1TA2A 5PTPA 4AFSA 5EODA 1E38B 4ABDA 3U98H 3LGWA 1FN6A 3RXRA 5JBAS 1UO6A 3SUGA 3SJ8A 2QN5T 2ANYA 2GCHF 3QWCH 4X0WU 5DP5A 5E8EH 2PTCE 1HAZB 3T29A 1TGNA 2BY6X 5SGAE 1O5CB 2LNCA 3OU0A 1T8NA 2O8WA 2G51A 1GBIA 1NC6A 3A7XA 1CT0E 2PKSC 4CRFA 1E36B 1HPGA 3A8BA 1OSSA 1QY6A 2F3CE 1FY5A 1D3TB 4IBLH 1TBZH 4Y79A 4FU7A 3V7TA 2SFAA 1A3BH 4KKDA 1FI8A 1OKXA 3D23A 4X6PA 2R0KA 2OC7A 1N6YA 1V2TT 5EQSA 1T7CA 2ZFRH 2FYRA 1DX5M 1PQ7A 4Y10E 3ZV8A 1FY1A 1L4DA 1RTFB 1DVAH 3PMJA 1MTSA 2W26A 5DP6A 1WBGB 1W10U 1MTUA 4MPXA 3U69H 2ZP0H 1CA0C 4GLYA 4X1NU 3HK6B 5E2OA 3OX7U 2ZKSA 2QC2A 3RMLH 4IW4E 3RLYH 1L2EA 1C1OA 1C1QA 1A3EH 5A2MH 1N6XA 5K0HA 1Z6JH 2VIOA 4MPWA 5K7RA 1ZLRA 4K2YA 1Y5AT 3RXPA 1YLDA 4UD9H 4UFEH 1T8LA 1W7GH 4Y71A 3A8DA 2ZFTA 1UTKA 1AU8A 1EJMA 4LZ1H 1JBUH 2ALVA 1Z8GA 1V3XA 1EAWA 1FY4A 1O3GA 1ZR0A 4NWKA 1P11E 1C5TA 1ARCA 1L4ZA 2AFQB 2GX4A 4B73A 1FV9A 3P8FA 4O3TA 1U6QA 1UVUH 2O9QA 1BUIA 2ZTZA 2ASUB 2BM2A 3TGKE 2FO9A 1TABE 1VITG 4TY6A 2PLXA 5F6MA 1BTXA 2B0FA 3QGNB 1KDQA 2A7CA 2WPHS 2XBYA 1IOEA 5EXLA 1BBRE 2H9EH 4Y8XA 4X2WA 4I8KA 1CGJE 4NGAH 2YNBA 2G55A 5EU8A 2J38A 2ZU2A 3E6PH 3NZIA 1WU1A 1K2I1 3B9FH 1H1BA 3BTQE 4Y76A 2F9PA 4O03A 2GMTB 1GJDB 3HPTB 1BZXE 3HKJB 3EA9A 1C5LH 5EXNA 1O2PA 1GBFA 5A0CA 2FS9A 1C1PA 3TGIE 4NIVA 1UK3A 1ZRBA 5E0HA 4A6LA 2FTMA 2BVSH 3KF2A 5TCCA 1V2QT 2FWWA 2F83A 4BNRA 1DWCH 1OYTH 1NU9A 4MNVA 2FI4E 1C2DA 1TMUH 1XUGA 2STBE 2UUFB 3A7VA 2C90B 2Z3EA 3A80A 1P2MA 1NO9H 4X1QU 1TOMH 3MU5A 4YESB 5L2YH 1A61H 3RXBA 1QQ4A 4AORA 3ZVAA 2OC8A 1ZJDA 2FLBH 1P3EA 2VINA 1NT1A 4I8HA 4YLUA 1GBMA 1SGTA 1IQEA 1CA0B 2QYIA 3A83A 1ZYOA 1C5UA 1GCDA 1Z8JB 2SGQE 1CHGA 3SORA 2VIPA 4HI3A 1QA7A 5ESBA 4OS7A 1C1MA 3QUMP 2OLGA 2OUAA 3ZZDA 3HKIB 7GCHF 5GJ4B 3RXLA 2BOKA 2P3UB 2PGBB 4DCDA 3TH2H 3GCHB 3P6ZB 1XUIA 3ZZ9A 3SNCA 2NU0E 1CT2E 1C5OH 1Y3XA 2GVFA 1C1RA 1GI9B 1MD8A 1BHXF 3E0PB 4D7GA 2FX4A 4NA9H 3MWIU 1ZJKA 3MU4A 3QX5H 1CBWB 3U1JB 3A88A 1MBQA 2Q1JA 1O3JA 1TPSA 3RDZA 3BTEE 3DFLA 2ZHEH 4JCNA 2ANMH 1EJAA 1C9TA 3RXTA 1MTWA 4BANB 5ABWA 3VPKA 3SGAE 1L1GA 1EAXA 3NKKA 3B8JA 1GI6A 3LPRA 4ISNA 1RTLA 4AX9H 5LPFA 3UNRA 3SO3A 1TLDA 4D9QA 3Q00A 3QN7A 3RXCA 2IJOB 1YYY1 2P3TB 3SUDA 1BHXB 4ZHMU 1MZDA 2BD5A 2VVUA 3W94A 2BD7A 4FUEA 2SGDE 5T6DA 1DDJA 4AB8A 4F4OC 4ABJA 3HGPA 3F9FA 3BIUH 2QXIA 3A8AA 3Q77A 2CF9H 3ELAH 3PLKA 2CJIA 3JZ2B 1HV7A 2H9TH 2NU4E 1NRNH 1TGCA 2PV9B 3ATMA 4NFFA 3LONA 3WY8A 1BTUA 1HIAA 4FUBA 2FODA 4BXSA 2BZAA 3SBKA 3TNTA 1JRTA 1SG8B 4NFEA 2PWXA 2BLOA 1DWEH 5JYIA 3UIRA 3NUMA 5T6FA 3RXJA 1V2KT 1C2KA 1QBOA 3ZV9A 3HATH 1XVOA 1AY6H 1Y59T 1IQFA 3MFJA 1P04A 1VCWA 2PGQB 2BY7X 2KAIA 1UHBB 4WY3A 3SN8A 1H8DH 4ABBA 3UOUA 1QQUA 2GD4B 2GCTC 4KELA 1DLEA 3SI3H 4KTCA 3T26A 4LOYH 1S0RA 1A5GH 1C4Y2 1QB6A 3A7YA 1OWDA 4A5TS 1RIWC 6GCHG 1S81A 2VH6A 1HJAB 2XNIA 3SQEE 4WXVA 1GI1A 1KTSB 1EZQA 1AD8H 3F9EA 4DOQA 3M7QA 1TRYA 3VB5A 4I8LA 4OS5A 3ZVEA 1KLJH 1C4U2 3BTFE 3MYWA 3PLPA 1LVYA 1D6RA 8ESTE 4E06H 2ZU1A 2G4UA 3DFJA 1P8VC 2NU2E 1F0UA 3T25A 1DT2A 1NN6A 5CHAC 1TQ0B 2A7HA 1ZTLA 4U32A 1O3KA 1LCYA 1JRSA 1BTWA 1BTHH 5I46H 1KYNA 5C5NA 1CA8B 1MZAA 4IGDA 4ZKSU 1BRAA 3T2NA 1FY8E 2VWNA 4IMZA 1DWBH 3FAOA 4INLA 1Z1JA 1O2HA 3A81A 4UEHH 5IYTA 1GMHF 1IHTH 1O2YA 1F5RA 3IITA 3V0XA 5EXMA 4CRGA 4I33A 1HAYB 5JBCS 3BG8A 1HFDA 2TGTA 1IQGA 5AHGH 4DVAU 3VB6A 5FBEA 2SGFE 2GKVE 2VVVA 4K8BA 3EGKH 1GHAF 5BRRE 1PPZA 1P2JA 1INCA 1A1RA 4X1PU 1VITH 1PPGE 1QGFA 1ZMNA 3ZZ3A 3RMNH 3O8BA 2Y5HA 4AGKA 4OS4A 3RC6A 1UJ1A 3UWJH 1OP2A 4BXWA 3QGJA 2OC1A 3A86A 1PQ8A 1TX6A 4E05H 2VIQA 3VXFH 2WV4A 4Q80A 2HPPH 4YO9A 6CHAB 1O36A 1T8OA 3TJUA 1N8OC 1V2NT 2GDEH 4NG9H 3NCLA 1QJ6B 3K65B 4LZ4B 2ZPRA 3GDUA 1BIOA 3I78A 4J2YB 1RIWB 1FN8A 1DE7H 1GPZA 2ZDAH 3V13A 1SGFG 4ABFA 2HVXA 2R0LA 3ZZBA 4SGAE 1C5VA 1XUKA 2TGPZ 1LQDB 3UQOA 3BTGE 5JBTA 4Y11E 1UCYE 1BBRK 1GJAB 5DP7A 3SJIA 1GWAA 1G3DA 3QTVH 2WYGA 1UTPA 2P16A 1DLKB 3EE0B 4K8YA 1TE0A 1OOKB 2AIPA 3ENSB 4Y6DA 1XXDA 2GZ8A 5CHAB 2UUYA 5DP4A 2J92A 4B2CA 2BD3A 1IQKA 4DY7B 4MG3A 4WVPE 1HAHH 4FUGA 2BDBA 1C5SA 3A7ZA 2VGCC 4CRBA 3NPSA 2F9VA 3TJNA 3GCTF 4X8VH 1ZTKA 3M3TA 2FIRH 1AKSA 1O2VA 2UUJB 2Y7ZA 4CHAB 1GJ6A 1YPHE 2A5IA 1P57B 3PMHB 4KP0A 2LPRA 2BY5X 4BAKB 4UONA 4ABHA 1THPB 1TBQH 5EW2H 2GV7A 1CGIE 4AN7A 1YPJH 2BQWB 2ZF0H 1MTNB 1QURH 2PR3A 4BTUB 1C5XB 2OTVA 3M5NA 1YPEH 1BOQA 4ZAEA 3ZYDA 2QV1A 3BTHE 1EB1H 1HRTH 1LPGB 1FDPA 4JZFH 5CE1A 1ZOMA 2P3FH 3MI4A 4DJZB 1ELBA 1GHWH 3SV6A 1SMFE 1SGYE 1YPHC 2FX6A 1Z7KA 1NFXA 1GDQA 2BD8A 1LTOA 5EG4A 3GCNA 4X8UH 2BVXH 1VCPA 4WH8A 1KY9A 1FAKH 5JB9S 2TGDA 2ODPA 4GAWA 3W95A 4QT8C 1G36A 1N8OB 2AGIX 2J2UA 3V12A 2BDCA 1T4UH 3T27A 2ZGCA 4MDSA 2A31A 1K1MA 3KQDA 4ZXXH 1VJAU 5EOKA 3SU5A 4HZHA 1C1TA 4CBOA 1G37A 2AH4X 1UVTH 3ODDA 3SNEA 1WUNH 5HXFA 1LPKB 2D1JA 3KGPA 1DITH 1SGFA 3SU4A 1O37A 1ORFA 2Y5FA 1O3DA 1JXPA 3PTBA 2SGAA 2GCHG 3NWUA 1GCTB 3E91A 2JH6D 1D4PB 2PSYA 1CQQA 1O30A 2QIQA 1GBBA 1GMDF 1AFEH 1TNKA 3SJOA 1AWHB 3U8TH 1L1NA 8GCHF 1O3LA 4K60A 4K1EA 1GBCA 3MHWU 1E0FD 1WV7H 4RKJB 2ZA5A 3A89A 3OY6U 4ISIH 1YPGH 3LC3A 1NU7B 3ESTA 1O5FH 1UK2A 1UVSH 1GGDB 1BRCE 2BTCE 3S9AA 3FP8E 1HAXB 1K1OA 2A32A 1O2NA 1YLCA 1D3PB 2Y82A 1YM0A 4U2WA 5DO4H 1MCVA 4R8TB 1DICA 4Y7BA 4YT6H 1XUJA 1GMCF 3MO6A 1W11U 1AQ7A 4OGYA 1HYLA 1DM4B 1MUEB 4AZ2B 2GMTC 1SGDE 2GT7A 4I8GA 1VGCC 1TNJA 1SHYA 2BOHB 3ZZ7A 5FCRA 3FFGA 2J9NA 4ZMAH 3SHCH 2QF0A 2B9LA 3BG4B 4NA7A 1XUHA 2BDIA 1EPTC 2M5TA 1RS0A 4SGBE 4X6OA 2QXHA 1C2HA 1XXFA 4UFDH 2WPIS 1QTFA 3O8DA 1D6WA 1V2OT 1B0FA 3R0FA 5J4QA 1GHYH 1VCQA 1PPEE 2BQ6B 2A2QH 2OCVB 3KQBA 3GY3A 2QCYA 1L0ZA 2PUXB 3TJVA 1DY8A 3C1KA 1F0SA 1G32B 1O3IA 1P2NA 4X8SH 1TALA 3RLWH 4ASHA 4B1TA 1EZSC 2ZGJA 4X6NA 1H9IE 1NS3A 1HNEE 1YBWA 1OWHA 1EASA 1QR3E 1F5KU 1EXFA 4I31A 1P05A 3GCHC 4WWYA 1NRRH 2VIVA 1FPHH 1GBJA 1SGIB 1AGJA 2F9NA 3H7OA 8KME2 3MNBA 1QBVH 1AN1E 1O5AB 3K6YA 3S9BA 3UUZA 3QZQA 2ZGXH 1V2JT 2CGAA 1CBWC 1O2UA 1P06A 5LPRA 3F6UH 3TK6A 3TITA 1C5YB 1ELDE 1ZHPA 3S0NA 3MH5A 2H2ZA 3LDXH 1KDQB 2FI5E 1OWKA 2DE8A 1WTGH 1O5GH 1NFYA 1O3OA 3DT0H 1OX1A 1S85A 1HUTH 1QCPA 1FIZA 1RGQA 1BT7A 2FP7B 1T8MA 3M7TA 3RM0H 2HNTE 2ZFPH 5EGMA 1QL9A 1SGQE 3RP2A 4IS5A 2BZ6H 1O3HA 1NESE 2ZTXA 3GY2A 3K2UA 3SW2B 1HLTH 4DURA 2HPQH 3SNAA 4XSKU 3UR6A 1KXFA 3TJOA 3F9HA 1PPBH 3RXEA 1RRKA 1TONA 1ELVA 1SQAA 5DP8A 3U8RH 2FM2A 1BTZA 4Q7XA 3SZNA 3OY5U 2O8TA 4NA8A 4BTTB 5DP9A 2UWOA 2Z9IA 1VGCB 4GCHF 2Y81A 1LHDH 1ZTJA 5F8XA 2VJ1A 3GYMA 1C1NA 3UNSA 4MVNA 2Y7XA 4A7IB 1UMAH 2P59A 2ANWA 1DS2E 1GJ9B 1XUFA 1IQLA 1EPTB 2BLQA 3URDA 7GCHG 2GDDA 3O8CA 1GI5A 1TNLA 2BY9X 1NROH 2ZU4A 1GL0E 3PM3A 1O32A 2HWLB 2ZG0H 2BDAA 2BX4A 1Q3XA 5FAHA 3I29A 4JYVH 3SV8A 1G9IE 4M7GA 3H5CB 3TNSA 4MNWA 4ISHH 4INKA 1TRMA 2P8OC 1LHGH 2FLRH 5E0GA 1HAPH 1UCYK 1J16A 3UPEA 3LU9B 4WMFA 1TYNA 1BCUH 1WOFA 5A09A 2Z9GA 3VB7A 4I8JA 3ZZAA 3RXIA 3SUFA 4IC5A 1BMNH 1NRQH 1OP8A 3EYDA 2BQ7B 2ILNA 1W13U 1ESBA 1Z1IA 2A1DB 1MMJN 3A8CA 1BJUA 1HJAC 3RM2H 1YPLH 1OS8A 4JMYA 2BLWA 2G81E 5DGJA 4O3UA 2PUQH 3MU0A 3N7OA 3GISB 2AEIH 1BDAA 1SR5C 4NSYA 1KXBA 3GOVB 4ZXYH 1GHBF 2W7SA 2Y6TA 4X2YA 4YTAA 4JYUH 4CRDA 2R2MB 5EPNA 3Q3KA 4NZLA 1UTNA 1QB1A 2TIOA 1BB0B 2R2WU 3KQCA 2C4FH 7LPRA 4GVUA 1CGHA 4XDEA 1C4V2 1GVLA 3RXDA 2GTBA 4Y8YA 1RJXB 2ZU5A 3MTYA 1SFIA 1O3MA 5A0AE 1BQYA 4JZDH 1YC0A 1IQIA 3BIVH 1FONA 1LMWB 3LJJA 3CENA 2AMDA 3Q3YA 2V35A 1V2UT 1G30B 1H9HE 2BXTH 1MQ5A 3SNBA 2QF3A 2FOFA 5FCKA 1OPHB 1OYQA 1A4WH 1DUEA 1SOTA 3LGIA 1O2ZA 1YP9A 2XBWA 2XYAA 1Z8RA 1C2FA 3SHAH 1JIMA 3KNXA 2IPHA 2FZZA 3UTUH 1LHFH 4MTBA 2EI6A 4KTSA 1W7XH 1QL8A 3AW1A 4K3JA 1K1PA 1EOJA 1A5IA 3KCGH 1ELTA 3E16B 2ZIQH 3OYPA 1Y3VA 3M3SA 5C1UA 2KAIB 3AAUA 5TCAA 1J17T 4NSVA 4BAOB 4FVDA 4YM9A 1Q31A 2OQUA 2IN2A 4UE7H 2ZQ1A 1NTPA 2P8OB 2P93A 4B76A 6CHAC 2OBQA 4O9VA 3VGCC 3RU4T 1O3AA 3BTTE 1OWEA 2A0QB 2FOHA 2UWPA 1AB9C 1LVBA 4ZROA 1W0YH 3RC4A 1VJ9U 1EP6A 3RXGA 3O8RA 2IOTA 3M5OA 1A0LA 2J4IA 2ZPSA 3SU2A 1O34A 4JZ1A 1V6DA 4ZH8A 1ID5H 2TPIZ 1YPMH 4KGAA 3GDVA 3RXQA 3ZZ5A 4AFZA 2R9PA 2BB4A 3VFEA 1GMHG 3M5MA 3B23B 1GI8B 2ZGBH 3T5FH 2HRVA 3KN2A 3PYHA 5DKMA 2C8YB 1PFXC 4IN1A 3FZZA 3CS7A 1MAXA 4ABAA 1K22H 2C8ZB 2F91A 2FDAA 2XC4A 4NZQA 2XCNA 1SC8U 3Q76A 1GHAG 4RSPA 2Z7FE 1SHHB 4NWLA 2ZC9H 1HAOH 2ZO3H 2ULLA 1GDNA 1O5DH 2QAAA 2JKHA 3SU6A 4CR9A 3GY4A 4CHAC 1PPCE 1G3CA 1ELEE 1AVXA 4TPYA 4UFFH 1E35B 2PKAB 2SNWA 3AW0A 4XE4A 1D3QB 1NY22 1KIGH 3TU7H 3NXPA 1EOLA 1BTPA 1C5QA 1TAWA 2I6QA 1EZXC 3GY5A 4TWYA 1ETSH 5LGOA 1V2WT 1MTNC 2Q6DA 3MU1A 4PROA 1W3CA 2AS9A 2AGEX 1HXEH 1TX7A 1WAYB 2WYJA 1S0QA 5H4IB 5HM2A 1MKXK 1RTKA 2QXJA 1ZSJA 1WSSH 4WMDA 5FXLA 6LPRA 4DIIH 1O5BB 2ZDMA 4A1VA 3FP6E 1C5MD 1J9CH 2Z6BD 1YPKH 1QB9A 3LGVA 1BRBE 1MQ6A 2FESH 2JH0D 1LO6A 3A85A 3TLOA 1B0EA 4RKOB 1GJ5H 4K69A 2OQ5A 3DA9B 1HJ9A 1W2KH 2Y5GA 1NZQH 4X1SU 2ZFQH 4THNH 1MKXH 1F7ZA 4DGJA 2ZDNA 3ZZ8A 1KTTB 3VGCB 1FIWA 1T31A 1ZGIA 1GBTA 5GDSH 1AB9B 2SNVA 4X2VA 1RD3B 1P10A 2ZQ2A 3FP7E 1JIRA 5GCHF 3DUXH 3UY9A 1C1WH 1AI8H 1P9SA 3GCTG 3LH3A 1W0ZU 5E0JA 3UQVA 2VWLA 1O33A 1W14U 3RMMH 5E2PA 3U9AH 1YKTA 4YOJA 4ZKNU 3ZZ4A 1P9UA 3RXVA 5LH8A 1CHOF 2ESTE 3P8OA 4MPVA 4B2AA 1GCTC 3M37A 4FUIA 4U30A 3SU3A 1S6FA 3NK8A 1PYTC 4I7YH 1K28D 1BMAA 3LIWA 3SI4H 3SQHE 1O35A 4A1XA 4ISOA 1AKSB 4B74A 1AE5A 3S7HB 4ABIA 2FXRA 2ZZUH 4MPUA 1D9IA 1GBLA 4XBCA 4ZHLU 1PYTD 2WINI 1JOUB 2BYAX 3RUOA 3CP7A 1SBWA 4AG1A 4NIXA 1ACBE 5EW1H 1ANEA 4GHTA 1CE5A 2ZHFH 1GGDC 1BBRH 1TGSZ 3EDXB 5A8YA 1O2SA 2WUCA 2ZHWH 5B6OA 2ZI2H 4H6SB 1P09A 4Y0YE 1O0DH 4A1TA 1AUJA 1GDUA 1F5LA 1FAXA 4OS6A 3QO6A 5EQQA 1GBKA 2BD9A 2WPKS 3E0NB 2XC5A 3BTME 4NCYA 1W8BH 1EJNA 5CMXH 1SOZA 3BG4C 1AHTH 3ZVGA 1Y3WA 1TA6A 2RA0A 3STJA 1THRH 1EP5A 2VNTA 2STAE 1HAGE 3PV4A 2BLVA 2ZWLH 1LDTT 3T62A 4AOQA 5G4BA 1ZZZA 4J1YA 1W12U 1FQ3A 2ZPQA 1BMLA 3A82A 1Z6EA 3GY6A 2Z9LA 2F9UA 1HAVA 2YNAA 1GMDG 4CH2B 1TFXA 3P92A 3RXAA 3P70B 1G2LA 1WCZA 8GCHG 1NFWA 3F68H 4XFQA 1S6HA 5FPTA 2QXGA 3M35A 2A2XH 4GPGA 1QNJA 1O2WA 2EI8A 3ATLA 3LGYA 1MH0A 4E7RG 2BDYA 1FPCH 3EAJA 6ESTA 3I77A 2A4GA 2BHGA 1ANBA 1FZZA 3K9XB 1KLIH 3A87A 1MKWK 1O3CA 2BMGB 1O2RA 2WV5A 1AZZA 3GICB 1VZQH 3LOXA 5A8XA 1KXAA 2NU3E 3F9GA 2GGVB 2C3SA 1K1NA 1GMCG 3KQEA 2AIQA 1EAIA 3PO1B 1IQNA 2FOMB 1MTVA 4ESTE 2R3YA 1ZPBA 5HYOA 2H5CA 2YOLA 2W3IA 4X1RU 8LPRA 3H7TA 1O3BA 1V2PT 5FPYA 9LPRA 1BA8B 4XOJA 5EQRA 1RFNA 2ZGHA 1FXYA 1Z71A 1QA0A 1C2MA 1Q2WA 2D26C 3MH6A 5J4SA 3GYLB 1BMMH 3L33A 4IC6A 4FUCA 4YOIA 3BEUA 3A7WA 1G3EA 2VIWA 4D76A 2FYQA 1NPMA 2CF8H 4ZHAA 3S69A 3VEQB 4WXIA 3PMBB 7KMEH 1SI5H 2NU1E 2ZHQH 4FUDA 1BITA 1QIXB 1ELFA 3C27B 2Z94A 3RXSA 2ZECA 1DOJA 2VIDA 4FU8A 3EQ0H 4DW2U 2GZ9A 4ZKOU 5FX6A 3QZRA 4JYTA 1AIXH 1O3EA 2VVCA 1S5SA 3ZVCA 1J14A 1IQHA 3TK5A 1D3DB 1TOCB 1LVOA 2Z9JA 3MO3A 4JK5A 1FUJA 1O38A 1P12E 3ZZCA 3AASA 3T28A 1O3NA 1J8AA 3S9CA 2V0BA 1A46H 3EA8A 5AFZH 4Y8ZA 1EB2A 1EX3A 2ZTYA 2BD4A 1YCPK 1E37B 4AFQA 2GP9B 2ZHDA 1MD7A 5C2ZA 1PPHE 1LVMA 5ETXA 1TPAE 1NFUA 1SLWB 2ZU3A 1SGNE 2THFB 4GSOA 3D49H 3BF6H 3SV9A 1TRNA 4XBBA 1C2IA 5C20A 2AMPA 3UWIA 1OXGA 1QHRB 3QLPH 1GBHA 1TQ7B 1V2MT 3TH3H 3LJOA 1ZSLA 3P8GA 4XBDA 4CRAA 5C67A 2XTTB 4DG4A 4A92A 3RXFA 1MU8B 2C93B 4Q7YA 1YCPH 1HDTH 3SJKA 4BAMB 4JZIA 4DIHH 1O2LA 2P94A 1C5WB 4YOGA 2ZDLA 4BOHA 1X7AC 2CHAC 4GCHG 1P03A 1C2GA 3FANA 1K9OE 5L30H 2R3UA 2JETC 1ESTA 1AFQC 1SGPE 4AGJA 1AVWA 2A4OA 1ZGVA 1TIOA 1SGEE 3MNXA 5DPAA 2VB0A 1F0RA 4MQAA 1AUTC 5ESTE 2OBOA 3ATKA 5C3NA 1SFQB 1Y3YA 2CMYA 3M3VA 2BXUH 5LPEA 3RXHA 2CXVA 2ZFFH 4OS2A 3VXEH 3PWCA 1SL3A 2A4RA 3E90B 2AYWA 4HGCA 2W3KA 2B8OH 4HTCH 1KXDA 1ARBA 2CV3A 3ATIA 1NM6A 3OSYA 1IQMA 1TX8A 4GUXA 2DUCA 2O8UA 2WUBA 2V3HH 3MOCA 1EATA 4FVBA 1GBDA 5DG6A 5DJ7A 2ANKH 1EQ9A 2FI3E 2HNTC 3U1IB 3P95A 1FNIA 4CH8B 3RXKA 2W7UA 3GY7A 1GVZA 1SVPA 3SOSA 1DXWA 2C8XB 2CN0H 3SJ9A 1DY9A 1TBRH 3K6ZA 2PKSB 3LGUA 1B7XB 2EA3A 2VU8E 2ZCKP 1GHBG 3FZDA 3ITIA 1P2KA 1VITF 2D2DA 4X6MA 1A5HA 1XVMA 3QTOH 4IN2A 3P17H 3KHVA 1AO5A 5T6GA 1TNHA 2G5VA 5I25A 1ZMJA 1IAUA 3ATWA 4CRCA 1TNIA 2TBSA 3TIUA 1XX9A 3TGJE 2XCFA 5AF9H 2G00A 1EPTA 1JWTA 5AFYH 3ZYEA 1BTYA 4KTUA 1SQOA 5C5OA 5FBIA 3IG6B 1O3PB 1LHCH 1T32A 5GWZA 2H6MA 1P2QA 1UTQA 5JPMH 4NIYA 1UCYH 1DSUA 1H4WA 3UNQA 5EPYA 3MNCA 2JH5D 1QBNA 2FMJA 5TJXA 1P01A 1HGTH 4MLFB 2XBVA 1UK4A 3AVZA 1H9LB 2XWAA 4WMEA 2CHAB 4MNXA 3LC5A 4ISLA 2HNTF 2OP9A 3LKWA 2JETB 1L1JA 4NIWA 1F2SE 1AFQB 2BDGA 4TPIZ 1GHXH 1O2JA 2ALPA 1G3BA 1GHVH 2ZDVH 3LT3A 2FTLE 4INHA 1GBAA 5JB8S 4H4FA 1TMBH 3SNDA 3M7UA 2J95A 3V3MA 1HBTH 1GG6C 3L6PA 1A0HB 1KSNA 3PB1E 2AGGX 3PMAB 1JMOH 2QY0B 2ZNKH 4Z0KA 2DE9A 4WF8A 2EEKA 2UWLA 2ZCLP 1UTLM 3QDZB 5DP3A 3E3TA 1C1SA 2HALA 3BN9A 5L6NH 1NRSH 2XW9A 3ZVDA 4FUHA 3PWBA 1HIAB 2VWOA 3VB3A 5GXPA 4X2XA 1ZRKA 4YZUA 1QRXA 1PQAA 1Y3UA 1V2RT 1DFPA 2FOBA 2PFEA 2P95A 1E34B 3M36A 1GI4A 2B5TB 1PJPA 1A2CH 1G2MA 1QJ1B 2D8WA 2GZ7A 3SU1A 1ANDA 4CREA 3DHKH 1ETRH 1GJCB 2BDHA 1O2TA 1ZPCA 2Q6GA 2Q6FA 1HJ8A 1A0JA 1SSXA 4BTIB 1P0SH 1BJVA 4UDWH 3E1XB 5HMAA 2VWMA 5C1XA 2QA9E 1MU6B 1O3FA 1QRZA 5HGGA 2ODQA 4E7NA 4Y0ZE 1V2ST 1F0TA 1ZPZA 3IWMA 1C2EA 1TPOA 3SGQE 1MAYA 2SGEE 3BTKE 1XM1A 4YT7H 2A45B 4ZUHA 1TNGA 2G5NA 2PHBA 2HOBA 3E8LA 2EC9H 5A0BA 3RXUA 4FU9A 3FVFB 1UTMA 2GT8A 1XKAC 1V2LT 1WYKA 4R0IA 4BAHB 3PROA 3HK3B 1OWJA 1SLUB 2FPZA 5A8ZA 1UHBA 3RXMA 1LKAA 2W5EA 4VGCC 3L3TA 1AVGH 4AG2A 2K1QA 2OINA 1ABIH 1O5EH 2A5KA 1Z8IB 2OC0A 5FPSA 7ESTE 1LPZB 3CS0A 1CU1A 2OD3B 1TPPA 1CSOE 3UR9A 1C5NH 2BD2A 4WJG2 1O2MA 3SGBE 3UREA 5L2ZH 1XKBC 1GG6B 4F49A 1XMNB 2AERH 1UTOA 1PPFE 3KIDU 1QRWA 5FHTA 1TWXB 2H5DA 4CBNA 5F8TA 1T4VH 1S83A 5HM9A 3HGNA 3M5LA 4YLQH 1K1IA 1QL7A 2BVRH 2UUKB 4ABGA 4D9RA 3UOPA 6GCHF 2ZFSA 1ZHMA 2HGTH 2RCEA 4HFPB 2XWBI 2O8MA 1HB0B 1J15A 4TWWA 4K5ZA 3TH4H 5GPIB 2XC0A 4H42U 5GCHG 1GJ7B 4AFUA 1P3CA 3P8NA 1P02A 3PLBA 1GVKB 1SQTA 1RXPA 1SGCA 4MNYA 3UFAA 3STIA 1ZSKA 1KXEA 2RG3A 2SGPE 3BV9B 1EUFA 1CT4E 1UVPA 3D62A 2G4TA 5T3HA 1C5PA 4JK6A 1DANH 2PKAA 1UTJA 1GHZA 1ELGA 1CHOG 2FOEA 3LGTA 1CVWH 1HXFH 3EA7A 2H9HA 3KEEA 4LK4A 3F1SB 1C1UH 1FMGA 1GI7B 1SGRE 2EI7A 4B2BA 1O2QA 2V3OH 1O2KA 1OWIA 4FXGH 3A7TA 2A4QA 4IMQA 1EZUC 2J34A 2OXSA 2G52A 1ESAA 2FOAA 4U01A 4DT7B 4Q7ZA 4I32A 4FUFA 1IHSH 2PW8H 4UFGH 4B71A 2XRCA 2XBXA 2O8LA 4K1SA 5JBBS 3RMOH 1THSH 2GCTB 1P2IA 1FJSA 2J94A 3SU0A 4LXBH 1O2OA 1C2JA 5IDKA 1AE8H 1LHEH 2TGAA 1IQJA 1KXCA 1C2LA 2ZEBA 1AWFH 2Z3CA 1TB6H 3PO1C 1ELCA 4Z6AH 4FUJA 4VGCB 4Q2KA 2FOGA 5FX5A 2FOCA 3ZVFA 1ANCA 1F92A 3MU8A 1ELAA 2AMQA 3MMGA 1NRPH 3RU4E 1ABJH 1ZHRA 4Y7AA 1GI2A 4O97A 1TGTA 3KL6A 1C5ZB 1AMHA 2PSXA 2PTNA 2TRMA 5BPEA 3GCOA 9ESTA 3Q3XA 1DSTA 4OGXA 2H1UA
chains in the Genus database with same CATH superfamily
3MO9A 3BTDE 1P2OA 1SLVB 4JZEH 5C17A 1LKBA 4B75A 3ZVBA 1WQVH 4TY7A 3TVJB 2QF5A 2ZDKA 1SPJA 1QFKH 2RA3A 3SUEA 2I6SA 1AZ8A 3BTWE 1PQ5A 1B5GH 1TGBA 1DWDH 4GHQA 1DXPA 3SV2H 2A5AA 1YF4A 2GV6A 1OP0A 3RC5A 3U8OH 3JZ1B 3ZZ6A 3G01A 3QK1A 3RU4D 2QGRA 2FEQH 2G8TA 1TMTH 1HAVB 1KLTA 3GY8A 5JDUB 2HLCA 4OS1A 1HCGA 1O31A 1WTHD 2WPMS 1O39A 1EAUA 3MNSA 1YCPM 2WPJS 3SV7A 2BY8X 3GDSA 1DUAA 1K0HA 1C5RA 4ABEA 2F9OA 1GJBB 1UVOA 2ODYB 4D7FA 4AB9A 4CR5A 1S82A 2WPLS 1MBMA 3A84A 1K21H 4TYDA 1CO7E 2K0QA 1GJ4H 1GL1A 3M61U 1C1VH 4RN6A 2ZCHP 1ZMLA 2FS8A 4BAQB 3TK9A 1GI0A 4M9FA 3VB4A 3BEFB 3LH1A 5DK1A 1GI3A 1K1JA 3BEIB 2Z3DA 3OTJE 3AAVA 1C9PA 1SLXB 2A7JA 3RXOA 1YGCH 5F03A 1V2VT 3NRLA 2Y80A 2Z9KA 2QF4A 1SB1H 1VR1H 1A7SA 1H8IH 1EKBB 1M9UA 1O2XA 3DD2H 2C8WB 1S84A 4K1TA 3PTNA 1FY3A 2B7DH 4H6TA 1Y5BT 1DPOA 4WH6A 1MKWH 3MH4A 3URCA 5C1YA 3R3GB 2XXLA 1MCTA 1K1LA 1Y5UT 2RDLA 4ZKRU 2F9BH 5B6LA 4D8NA 3MH7A 2VH0A 5AVDA 1BRUP 1WQSA 5F8ZA 3TPIZ 1O2IA 1GJ8B 1HAIH 2BX3A 1QJ7B 4AYYB 4AYVB 1Y8TA 3S7KB 1O2GH 3BSQA 5GIBA 1FLEE 4X8TH 1LQEA 1GBEA 2NWNA 2WPDD 2VGCB 2V6NA 3D65E 3ODFA 1ETTH 1N1LA 1TA2A 1S6LA 5PTPA 4AFSA 5EODA 1E38B 4ABDA 3U98H 3LGWA 1FN6A 4B6FA 3RXRA 5JBAS 1UO6A 3SUGA 3SJ8A 2QN5T 2ANYA 2GCHF 3QWCH 4X0WU 5DP5A 1QZ8A 5E8EH 2PTCE 1HAZB 3T29A 1TGNA 2BY6X 5SGAE 1O5CB 2LNCA 3OU0A 2HVYB 1T8NA 2O8WA 2G51A 2XOKD 1GBIA 1NC6A 3A7XA 1CT0E 2PKSC 4CRFA 1E36B 1HPGA 3A8BA 4RI0A 1OSSA 1QY6A 2F3CE 1FY5A 1D3TB 4IBLH 1TBZH 4FOUC 4Y79A 4FU7A 3V7TA 2SFAA 1A3BH 4KKDA 1FI8A 1WXRA 1OKXA 3D23A 4X6PA 3WWBA 2R0KA 2OC7A 1N6YA 1V2TT 5EQSA 1T7CA 2ZFRH 2FYRA 1DX5M 1PQ7A 4Y10E 3SZEA 3ZV8A 1FY1A 1L4DA 1RTFB 1DVAH 3PMJA 1MTSA 2W26A 5DP6A 1WBGB 1W10U 1MTUA 4MPXA 3U69H 2ZP0H 1CA0C 4GLYA 4X1NU 3HK6B 5E2OA 2CK3D 3OX7U 2ZKSA 2QC2A 3RMLH 4IW4E 2PP6A 3RLYH 1L2EA 1C1OA 1C1QA 1A3EH 5A2MH 1N6XA 5K0HA 1Z6JH 2VIOA 4MPWA 5K7RA 1ZLRA 4K2YA 1Y5AT 3RXPA 1YLDA 3N7EA 4UD9H 4UFEH 1T8LA 1W7GH 4Y71A 3A8DA 2ZFTA 1UTKA 1AU8A 1EJMA 1H8ED 4LZ1H 1JBUH 2ALVA 1Z8GA 1V3XA 1EAWA 1FY4A 1O3GA 1ZR0A 4NWKA 1P11E 1C5TA 1ARCA 1L4ZA 2AFQB 2GX4A 4B73A 1FV9A 3P8FA 2WHXA 4O3TA 1U6QA 1UVUH 2O9QA 3FO8D 1BUIA 2ZTZA 2ASUB 2BM2A 3TGKE 2FO9A 1TABE 1VITG 4TY6A 2PLXA 5F6MA 5C0TA 1BTXA 2B0FA 3QGNB 1KDQA 2A7CA 2WPHS 2XBYA 1IOEA 5EXLA 1BBRE 2H9EH 4Y8XA 4X2WA 3W1EA 4I8KA 1CGJE 4NGAH 2YNBA 2G55A 5EU8A 2J38A 2ZU2A 3E6PH 3NZIA 1WU1A 1K2I1 3B9FH 1H1BA 3BTQE 4Y76A 2F9PA 4O03A 2GMTB 1GJDB 3HPTB 1BZXE 3HKJB 3EA9A 1C5LH 5EXNA 1O2PA 1GBFA 5A0CA 2FS9A 4FETA 1C1PA 3TGIE 4NIVA 1UK3A 1ZRBA 5E0HA 4A6LA 2FTMA 2BVSH 3KF2A 5TCCA 1V2QT 2FWWA 2F83A 2LP6A 4BNRA 1DWCH 1OYTH 1NU9A 4MNVA 3WWFA 2FI4E 4YXWD 1C2DA 1TMUH 1XUGA 2STBE 2UUFB 4Z1MD 3A7VA 2C90B 2M2AA 2Z3EA 2QE7D 3A80A 1P2MA 1NO9H 4X1QU 1TOMH 3MU5A 4YESB 5L2YH 1A61H 3RXBA 1QQ4A 4AORA 3ZVAA 2OC8A 1ZJDA 2FLBH 1P3EA 2VINA 1NT1A 4I8HA 4YLUA 1GBMA 1SGTA 1IQEA 1CA0B 2QYIA 3A83A 1ZYOA 1C5UA 1GCDA 1Z8JB 2SGQE 1CHGA 2J97A 3SORA 2VIPA 4HI3A 1QA7A 5ESBA 4OS7A 1C1MA 3FN8A 3QUMP 2OLGA 2OUAA 3ZZDA 3HKIB 7GCHF 5GJ4B 3RXLA 2BOKA 2P3UB 5EJLA 2PGBB 4DCDA 3TH2H 3GCHB 3P6ZB 1XUIA 3ZZ9A 3SNCA 2GVFA 1CT2E 1C5OH 1Y3XA 2NU0E 1C1RA 1GI9B 1MD8A 1BHXF 3E0PB 4D7GA 2FX4A 4NA9H 3MWIU 1ZJKA 2EY4C 3MU4A 3QX5H 1CBWB 3U1JB 3A88A 1MBQA 2Q1JA 1O3JA 1TPSA 3RDZA 4ACBA 3BTEE 3DFLA 2ZHEH 4JCNA 2ANMH 1EJAA 2L6OA 1C9TA 3RXTA 1MTWA 4BANB 5ABWA 3VPKA 2JDID 3SGAE 1L1GA 1EAXA 3NKKA 3B8JA 1GI6A 3LPRA 4ISNA 1RTLA 4AX9H 5LPFA 3UNRA 3SO3A 4TSFD 1TLDA 4D9QA 3Q00A 3QN7A 3RXCA 2IJOB 1YYY1 2P3TB 3SUDA 1H8HD 1BHXB 4ZHMU 1MZDA 2BD5A 2VVUA 3W94A 2BD7A 4FUEA 2SGDE 5T6DA 1DDJA 4ACAA 4AB8A 4F4OC 4ABJA 3HGPA 3F9FA 1E1QD 3KYFA 3BIUH 2QXIA 3A8AA 3Q77A 2CF9H 3ELAH 3PLKA 3F0OA 2CJIA 3JZ2B 1HV7A 2H9TH 2NU4E 1NRNH 1TGCA 2PV9B 2EQNA 3ATMA 4NFFA 3LONA 3WY8A 1BTUA 1HIAA 4FUBA 2FODA 4BXSA 2BZAA 3SBKA 3TNTA 1JRTA 1SG8B 2L74A 4NFEA 2PWXA 2BLOA 1DWEH 5JYIA 3UIRA 3NUMA 5T6FA 3RXJA 1V2KT 1C2KA 1QBOA 3DCLA 3ZV9A 3HATH 1XVOA 1AY6H 1Y59T 1IQFA 3MFJA 1P04A 1VCWA 2PGQB 2BY7X 2KAIA 1UHBB 4WY3A 3SN8A 1H8DH 4ABBA 3UOUA 1QQUA 2GD4B 2GCTC 4KELA 1DLEA 3SI3H 4KTCA 3T26A 4LOYH 1S0RA 1A5GH 3F2FA 1C4Y2 1QB6A 3A7YA 1OWDA 4A5TS 1RIWC 6GCHG 1S81A 2VH6A 1HJAB 2XNIA 3SQEE 4WXVA 1GI1A 1KTSB 1EZQA 3PV2A 1AD8H 3F9EA 4DOQA 3M7QA 1TRYA 3VB5A 4I8LA 4OS5A 3ZVEA 1KLJH 1C4U2 3BTFE 3MYWA 3PLPA 1LVYA 1D6RA 8ESTE 4E06H 2ZU1A 2G4UA 3DFJA 1P8VC 2NU2E 1F0UA 3T25A 1DT2A 1NN6A 5CHAC 1TQ0B 2A7HA 1ZTLA 4U32A 2KX4A 1O3KA 1LCYA 1JRSA 1BTWA 1BTHH 5I46H 1KYNA 5C5NA 1CA8B 5HIYA 1MZAA 4IGDA 4ZKSU 1BRAA 3T2NA 1FY8E 2VWNA 4IMZA 1DWBH 3FAOA 4INLA 1Z1JA 1O2HA 3A81A 4UEHH 5IYTA 1GMHF 1IHTH 1O2YA 1F5RA 3IITA 3V0XA 1VKYA 5EXMA 4CRGA 4I33A 1HAYB 5JBCS 3BG8A 3DSPA 1HFDA 2TGTA 1IQGA 5AHGH 4DVAU 3VB6A 5FBEA 2SGFE 2GKVE 2VVVA 4K8BA 3EGKH 1GHAF 2KFWA 5KGOA 5BRRE 1PPZA 1P2JA 1INCA 3AK5A 1A1RA 4X1PU 1VITH 1PPGE 1QGFA 1ZMNA 3ZZ3A 3RMNH 3O8BA 2Y5HA 4AGKA 4OS4A 3RC6A 1UJ1A 4HG6A 3UWJH 1OP2A 4BXWA 3QGJA 2OC1A 3A86A 1PQ8A 1TX6A 4E05H 2VIQA 3VXFH 2WV4A 4Q80A 2HPPH 4YO9A 6CHAB 1O36A 1T8OA 3TJUA 1N8OC 1V2NT 2GDEH 4NG9H 3NCLA 1QJ6B 3K65B 4LZ4B 2ZPRA 3GDUA 1BIOA 3I78A 4J2YB 1MABB 1RIWB 1FN8A 1DE7H 1GPZA 2ZDAH 3V13A 1SGFG 4RT0A 4ABFA 2HVXA 2R0LA 3ZZBA 4SGAE 1C5VA 1XUKA 2TGPZ 1LQDB 3UQOA 3BTGE 5JBTA 3DSOA 4Y11E 1UCYE 1BBRK 1GJAB 5DP7A 3SJIA 1GWAA 3KYGA 1G3DA 2W6JD 3QTVH 2WYGA 1UTPA 2P16A 1DLKB 3EE0B 4K8YA 1TE0A 1OOKB 2AIPA 3ENSB 4Y6DA 1XXDA 2GZ8A 5CHAB 2UUYA 5DP4A 2J92A 4B2CA 2BD3A 1IQKA 4DY7B 4MG3A 4WVPE 1HAHH 4FUGA 2BDBA 1C5SA 3A7ZA 2VGCC 4CRBA 3NPSA 2F9VA 3TJNA 3GCTF 4X8VH 1ZTKA 3M3TA 2FIRH 1AKSA 1O2VA 2UUJB 2Y7ZA 4CHAB 1GJ6A 1YPHE 2A5IA 1P57B 3PMHB 4KP0A 2LPRA 2BY5X 4BAKB 4UONA 5CHBA 4ABHA 2RDEA 1THPB 1TBQH 5EW2H 2GV7A 1CGIE 4AN7A 1YPJH 2BQWB 2ZF0H 1MTNB 1QURH 2PR3A 4I86A 4BTUB 1C5XB 2OTVA 5FL7D 3M5NA 1YPEH 1BOQA 4ZAEA 3ZYDA 2QV1A 3BTHE 1EB1H 2F4LA 1HRTH 5EJZA 1LPGB 1FDPA 4JZFH 5CE1A 1ZOMA 2P3FH 3MI4A 2J5UA 4DJZB 1ELBA 1GHWH 3SV6A 1SMFE 1SGYE 1YPHC 2FX6A 1Z7KA 1NFXA 4TT3D 1GDQA 2BD8A 1LTOA 5EG4A 3GCNA 4X8UH 2BVXH 1VCPA 4WH8A 1KY9A 1FAKH 5JB9S 3F2HA 2TGDA 2ODPA 4GAWA 3W95A 4QT8C 1G36A 1N8OB 2AGIX 2J2UA 3V12A 2BDCA 3PV5A 1T4UH 3T27A 2ZGCA 1YLNA 2A31A 1K1MA 4MDSA 3KQDA 4ZXXH 1VJAU 5EOKA 3SU5A 4HZHA 1C1TA 4CBOA 1G37A 2AH4X 1UVTH 3ODDA 3SNEA 1WUNH 5F53A 5HXFA 1LPKB 3F0PA 2D1JA 3KGPA 1DITH 1SGFA 3SU4A 1O37A 1ORFA 2Y5FA 1O3DA 1JXPA 3OEED 3PTBA 2SGAA 2GCHG 3NWUA 1GCTB 3E91A 3ZIAD 2JH6D 1D4PB 2PSYA 1CQQA 2IPQX 1O30A 2QIQA 1GBBA 1GMDF 1AFEH 1TNKA 3SJOA 1AWHB 3U8TH 1L1NA 8GCHF 1O3LA 4K60A 5DSFA 4K1EA 1GBCA 3MHWU 1E0FD 1WV7H 4RKJB 2ZA5A 3A89A 3OY6U 4ISIH 1YPGH 3LC3A 1NU7B 3ESTA 1O5FH 1UK2A 1UVSH 1GGDB 1BRCE 2BTCE 3S9AA 3FP8E 1HAXB 1K1OA 2A32A 1O2NA 1YLCA 1D3PB 2Y82A 1YM0A 4U2WA 5DO4H 1MCVA 4R8TB 1DICA 4Y7BA 4YT6H 1XUJA 1GMCF 3MO6A 1W11U 1AQ7A 4OGYA 1HYLA 1DM4B 1MUEB 4AZ2B 2GMTC 1SGDE 1E79D 2GT7A 4I8GA 1VGCC 1TNJA 1SHYA 2BOHB 3ZZ7A 5FCRA 3FFGA 2J9NA 2OK5A 4ZMAH 3SHCH 2QF0A 2B9LA 3BG4B 4NA7A 1XUHA 2BDIA 1EPTC 3OE7D 2M5TA 1RS0A 4SGBE 4X6OA 2QXHA 1C2HA 1XXFA 4UFDH 2WPIS 1QTFA 3O8DA 1D6WA 1V2OT 1B0FA 3R0FA 5J4QA 1GHYH 1VCQA 1PPEE 2BQ6B 2A2QH 2OCVB 3KQBA 3GY3A 2QCYA 1L0ZA 2PUXB 3TJVA 1DY8A 3C1KA 1F0SA 1G32B 1O3IA 1P2NA 4X8SH 1TALA 3RLWH 4ASHA 4B1TA 1EZSC 2ZGJA 4X6NA 1H9IE 4F55A 1NS3A 1HNEE 1YBWA 1OWHA 1EASA 1QR3E 4Q63A 1F5KU 1EXFA 4I31A 2KCAA 1P05A 3GCHC 4WWYA 1NRRH 2VIVA 1FPHH 1GBJA 1SGIB 1AGJA 2F9NA 3H7OA 8KME2 3MNBA 1QBVH 1AN1E 1O5AB 3K6YA 3S9BA 3UUZA 3QZQA 2ZGXH 1V2JT 2CGAA 1CBWC 1O2UA 1P06A 5LPRA 3F6UH 3TK6A 3TITA 1C5YB 1ELDE 1ZHPA 3S0NA 3MH5A 2H2ZA 3LDXH 1KDQB 2FI5E 1OWKA 2DE8A 1WTGH 1O5GH 1NFYA 1O3OA 3DT0H 1OX1A 1S85A 1HUTH 1QCPA 3UB0A 1FIZA 1RGQA 1BT7A 2FP7B 1T8MA 3M7TA 3RM0H 5HKKD 2HNTE 2ZFPH 2YMSB 5EGMA 1QL9A 1SGQE 3RP2A 4IS5A 2BZ6H 1O3HA 1NESE 2ZTXA 3GY2A 3K2UA 3SW2B 1HLTH 4DURA 2HPQH 3SNAA 4XSKU 3UR6A 1KXFA 3TJOA 2VBCA 3F9HA 1PPBH 3RXEA 3EE7A 4ZCNA 1RRKA 1TONA 1ELVA 1SQAA 5DP8A 3U8RH 2FM2A 1BTZA 4Q7XA 3SZNA 3OY5U 2O8TA 4NA8A 4BTTB 5DP9A 2UWOA 2W6ID 2Z9IA 5T1VA 1VGCB 4GCHF 2Y81A 4Q4LA 1LHDH 1ZTJA 2AHME 5F8XA 2VJ1A 3GYMA 1C1NA 3UNSA 4MVNA 2Y7XA 4A7IB 1UMAH 2P59A 2ANWA 1DS2E 1GJ9B 1XUFA 1IQLA 1EPTB 2BLQA 3URDA 7GCHG 2GDDA 3O8CA 1GI5A 1TNLA 2BY9X 1NROH 2ZU4A 1GL0E 3PM3A 1O32A 2HWLB 2ZG0H 2BDAA 2BX4A 1Q3XA 5FAHA 3I29A 4JYVH 3SV8A 1G9IE 4M7GA 3H5CB 3TNSA 4MNWA 1W0JD 4INKA 4ISHH 1TRMA 2P8OC 2JIZD 2K8IA 1LHGH 2FLRH 5E0GA 1HAPH 1UCYK 1J16A 3UPEA 3LU9B 4WMFA 1TYNA 1BCUH 1WOFA 5A09A 2Z9GA 3VB7A 4I8JA 3ZZAA 3RXIA 3SUFA 4IC5A 1BMNH 1NRQH 1OP8A 2JJ2D 3EYDA 2BQ7B 2ILNA 1W13U 1ESBA 1Z1IA 2A1DB 1MMJN 3A8CA 1BJUA 1HJAC 2JJ1D 3RM2H 1YPLH 1OS8A 4JMYA 2BLWA 2G81E 5DGJA 4O3UA 2PUQH 3MU0A 3N7OA 3GISB 2AEIH 1BDAA 1SR5C 4NSYA 1KXBA 3GOVB 4ZXYH 1GHBF 2W7SA 2Y6TA 4X2YA 4YTAA 4JYUH 4CRDA 2R2MB 5EPNA 3Q3KA 4NZLA 1UTNA 1QB1A 2TIOA 1BB0B 2R2WU 3KQCA 2C4FH 7LPRA 4GVUA 1CGHA 4XDEA 1C4V2 1GVLA 3RXDA 2GTBA 4P02A 3SYJA 4Y8YA 1RJXB 2ZU5A 3MTYA 1SFIA 1O3MA 5A0AE 1BQYA 4JZDH 1YC0A 1IQIA 3BIVH 1FONA 1LMWB 3LJJA 3CENA 2AMDA 3Q3YA 2V35A 1V2UT 1G30B 1H9HE 2BXTH 1MQ5A 3SNBA 2QF3A 2FOFA 5FCKA 1OPHB 4F48B 1OYQA 1A4WH 1DUEA 1SOTA 3LGIA 1O2ZA 1YP9A 2XBWA 2XYAA 3N7DA 1Z8RA 1C2FA 3SHAH 1JIMA 3KNXA 2IPHA 2FZZA 3UTUH 1LHFH 4MTBA 2EI6A 4KTSA 1W7XH 1QL8A 3AW1A 4K3JA 1K1PA 1EOJA 1A5IA 3KCGH 1ELTA 3E16B 2ZIQH 3OYPA 1Y3VA 2GJGA 3M3SA 5C1UA 2KAIB 3AAUA 5TCAA 1J17T 3PRDA 4NSVA 4BAOB 4FVDA 4YM9A 1Q31A 2OQUA 2IN2A 4UE7H 2ZQ1A 1NTPA 4XRNA 2P8OB 2P93A 4B76A 6CHAC 2OBQA 4O9VA 3VGCC 3RU4T 1O3AA 3BTTE 2V3MA 1OWEA 2A0QB 2FOHA 2UWPA 1AB9C 1LVBA 4ZROA 1W0YH 3RC4A 1VJ9U 1EP6A 3RXGA 3O8RA 2IOTA 3M5OA 1A0LA 2J4IA 2ZPSA 3OTPA 3DSGA 3SU2A 1O34A 4JZ1A 1V6DA 4ZH8A 1ID5H 2TPIZ 1YPMH 4KGAA 4P00A 3GDVA 3RXQA 3ZZ5A 4AFZA 2R9PA 2BB4A 3VFEA 1GMHG 3M5MA 3B23B 1GI8B 2ZGBH 3T5FH 2HRVA 3KN2A 3PYHA 5DKMA 2C8YB 1EFRD 1PFXC 4IN1A 3FZZA 3CS7A 1MAXA 4ABAA 5EJ1A 1K22H 2C8ZB 2F91A 2FDAA 2XC4A 4NZQA 2XCNA 1SC8U 3Q76A 1GHAG 4RSPA 2Z7FE 1SHHB 4NWLA 2ZC9H 1HAOH 2ZO3H 2ULLA 1GDNA 1O5DH 2QAAA 2JKHA 3SU6A 4CR9A 3GY4A 4CHAC 1PPCE 1G3CA 1ELEE 1AVXA 4TPYA 3PRBA 4UFFH 1E35B 2PKAB 2SNWA 3AW0A 4XE4A 1D3QB 1NY22 1KIGH 3TU7H 3NXPA 1EOLA 1BTPA 1C5QA 1TAWA 2I6QA 1EZXC 3GY5A 4TWYA 1ETSH 5LGOA 1V2WT 1MTNC 2Q6DA 3MU1A 4DT4A 4PROA 1W3CA 2AS9A 2AGEX 1HXEH 1TX7A 1WAYB 2WYJA 1S0QA 5H4IB 5HM2A 1MKXK 1RTKA 2QXJA 1ZSJA 1WSSH 4WMDA 5FXLA 6LPRA 4DIIH 1O5BB 2ZDMA 4A1VA 3FP6E 1C5MD 1J9CH 2Z6BD 1YPKH 1QB9A 3LGVA 1BRBE 1MQ6A 2FESH 2JH0D 1LO6A 3A85A 3TLOA 1B0EA 4RKOB 1GJ5H 4K69A 2OQ5A 3DA9B 1HJ9A 1W2KH 3OEHD 2Y5GA 1NZQH 4X1SU 2ZFQH 4THNH 3WW7A 1MKXH 1F7ZA 4DGJA 2ZDNA 3ZZ8A 1KTTB 3VGCB 1FIWA 1T31A 1ZGIA 1GBTA 5GDSH 1AB9B 2SNVA 4X2VA 1RD3B 1P10A 2ZQ2A 3FP7E 3N99A 1JIRA 1SQRA 5GCHF 3DUXH 3UY9A 1C1WH 1AI8H 1P9SA 5C0UA 3GCTG 3LH3A 1W0ZU 5E0JA 3UQVA 2VWLA 1O33A 1W14U 3RMMH 5E2PA 3U9AH 1YKTA 4YOJA 4ZKNU 3ZZ4A 1P9UA 2J98A 3RXVA 5LH8A 1UW7A 1CHOF 2ESTE 3P8OA 4MPVA 4B2AA 1GCTC 3M37A 4FUIA 4U30A 3SU3A 1S6FA 3NK8A 1PYTC 4I7YH 3MQKC 1K28D 1BMAA 3LIWA 3SI4H 3SQHE 1O35A 4A1XA 4ISOA 1AKSB 4B74A 1AE5A 3S7HB 4ABIA 2FXRA 2ZZUH 4MPUA 1D9IA 1GBLA 4XBCA 4ZHLU 1PYTD 5EIYA 2WINI 1JOUB 2BYAX 2V7QD 3RUOA 3CP7A 1SBWA 4AG1A 4NIXA 1ACBE 5EW1H 1ANEA 4GHTA 1CE5A 2ZHFH 1GGDC 1BBRH 1TGSZ 3EDXB 5A8YA 3VG8A 1O2SA 2WUCA 2ZHWH 5B6OA 2ZI2H 4H6SB 1P09A 4Y0YE 1O0DH 4A1TA 1AUJA 1GDUA 1F5LA 1FAXA 2KCYA 4OS6A 3QO6A 5EQQA 1GBKA 2BD9A 2WPKS 3E0NB 2XC5A 3BTME 4NCYA 1W8BH 1EJNA 5CMXH 1SOZA 3BG4C 1AHTH 3ZVGA 1KMHB 1Y3WA 1TA6A 2RA0A 3STJA 1THRH 1EP5A 2VNTA 2STAE 1HAGE 3PV4A 2BLVA 2ZWLH 1LDTT 3T62A 4AOQA 4RT1A 5G4BA 3KQ5A 1ZZZA 4J1YA 1W12U 1FQ3A 2ZPQA 1YWUA 1BMLA 3A82A 1Z6EA 3GY6A 2Z9LA 2F9UA 1HAVA 2YNAA 1GMDG 4CH2B 1WDIA 1TFXA 3P92A 3RXAA 3P70B 1G2LA 1WCZA 8GCHG 1NFWA 3F68H 4XFQA 1S6HA 5FPTA 2QXGA 3M35A 2A2XH 4GPGA 1QNJA 1O2WA 2EI8A 3ATLA 3LGYA 1MH0A 4E7RG 2BDYA 1FPCH 3EAJA 6ESTA 3I77A 2A4GA 2BHGA 1ANBA 1FZZA 3K9XB 1KLIH 3A87A 1MKWK 1O3CA 2BMGB 1O2RA 2WV5A 1AZZA 3GICB 1VZQH 3LOXA 5A8XA 1KXAA 2NU3E 3F9GA 2GGVB 2C3SA 1K1NA 1GMCG 3KQEA 2AIQA 1EAIA 3PO1B 1IQNA 2FOMB 1MTVA 4AC9A 4ESTE 2R3YA 1ZPBA 5HYOA 2H5CA 2YOLA 2W3IA 4X1RU 8LPRA 3H7TA 1BMFD 1O3BA 1V2PT 5FPYA 2WV9A 9LPRA 1BA8B 4XOJA 5EQRA 1RFNA 2ZGHA 1FXYA 1Z71A 1QA0A 1C2MA 2HLDD 2YMSC 1Q2WA 2D26C 3MH6A 5J4SA 3GYLB 1BMMH 3L33A 4IC6A 1COWD 4FUCA 4YOIA 3BEUA 3A7WA 1G3EA 2VIWA 2YMSD 4D76A 2FYQA 1NPMA 2CF8H 4ZHAA 3S69A 3VEQB 4WXIA 3PMBB 7KMEH 1SI5H 2NU1E 2ZHQH 5KECA 4FUDA 1BITA 1QIXB 1ELFA 2WZQA 2Z94A 3C27B 3RXSA 2ZECA 1DOJA 2VIDA 4FU8A 3EQ0H 4DW2U 2GZ9A 4ZKOU 5FX6A 3QZRA 4JYTA 1AIXH 1O3EA 2VVCA 1S5SA 3ZVCA 1J14A 1IQHA 3TK5A 1D3DB 1TOCB 1LVOA 2Z9JA 3MO3A 4JK5A 1FUJA 1O38A 1P12E 3ZZCA 3AASA 3T28A 1O3NA 1J8AA 3S9CA 2V0BA 1A46H 1SKYE 3EA8A 5AFZH 4Y8ZA 1EB2A 1EX3A 2ZTYA 1W0KD 2BD4A 1YCPK 1E37B 4AFQA 2GP9B 2ZHDA 1MD7A 5C2ZA 1PPHE 1LVMA 5ETXA 1TPAE 5DN6D 1NFUA 1SLWB 2ZU3A 1SGNE 2THFB 4GSOA 3D49H 3BF6H 3SV9A 1TRNA 4XBBA 1C2IA 5C20A 2AMPA 2KM0A 3UWIA 1OXGA 1QHRB 3QLPH 1GBHA 1TQ7B 1V2MT 3TH3H 3LJOA 1ZSLA 3P8GA 3H09A 4XBDA 4CRAA 5C67A 2XTTB 4DG4A 4A92A 3RXFA 1MU8B 2C93B 4Q7YA 1YCPH 1HDTH 3SJKA 4BAMB 1E1RD 2F43B 4JZIA 2RFKC 4DIHH 1O2LA 2P94A 1C5WB 4YOGA 2ZDLA 4BOHA 1X7AC 2CHAC 4GCHG 1P03A 1C2GA 3FANA 1K9OE 5L30H 2R3UA 2JETC 1ESTA 1AFQC 1SGPE 4AGJA 1AVWA 2A4OA 1ZGVA 1TIOA 1SGEE 3MNXA 5DPAA 2VB0A 1F0RA 4MQAA 1AUTC 5ESTE 2OBOA 3ATKA 5C3NA 1SFQB 1Y3YA 2CMYA 3M3VA 2BXUH 5LPEA 3RXHA 2CXVA 2ZFFH 4OS2A 3VXEH 3PWCA 1SL3A 2A4RA 3E90B 2AYWA 4HGCA 2W3KA 2B8OH 4HTCH 1KXDA 1ARBA 2CV3A 3ATIA 4XD7D 3FOAA 1NM6A 3OSYA 1IQMA 1TX8A 4GUXA 2DUCA 2O8UA 2WUBA 2V3HH 3MOCA 1EATA 4FVBA 1GBDA 5DG6A 5DJ7A 2ANKH 1EQ9A 2FI3E 2HNTC 3U1IB 3P95A 1FNIA 4CH8B 3RXKA 2W7UA 3GY7A 1GVZA 1SVPA 3SOSA 1DXWA 2C8XB 2CN0H 3SJ9A 1DY9A 1TBRH 3K6ZA 2PKSB 3LGUA 1B7XB 2KCPA 2EA3A 2VU8E 2ZCKP 1GHBG 3FZDA 3ITIA 1P2KA 1VITF 2D2DA 4X6MA 1A5HA 1XVMA 3QTOH 1YY3A 4IN2A 3P17H 3KHVA 1AO5A 5T6GA 1TNHA 2G5VA 5I25A 1ZMJA 3F3BA 1IAUA 3ATWA 4CRCA 1TNIA 2TBSA 3TIUA 1XX9A 3TGJE 2XCFA 5AF9H 2G00A 1EPTA 1JWTA 5AFYH 3ZYEA 1BTYA 3OAAD 4KTUA 1SQOA 5C5OA 5FBIA 3IG6B 3CNRA 1O3PB 1LHCH 1T32A 5GWZA 2H6MA 1P2QA 1UTQA 5JPMH 4NIYA 1UCYH 1DSUA 1H4WA 3UNQA 2IJD1 5EPYA 3MNCA 2JH5D 1QBNA 2FMJA 5TJXA 1P01A 1HGTH 4MLFB 3F2GA 2XBVA 1UK4A 3AVZA 1H9LB 2XWAA 4WMEA 2CHAB 4MNXA 5IK2D 3LC5A 4ISLA 2HNTF 2OP9A 3LKWA 3GS9A 2JETB 1L1JA 4NIWA 1F2SE 1AFQB 2BDGA 4TPIZ 1GHXH 1O2JA 2ALPA 1G3BA 1GHVH 2ZDVH 3LT3A 2FTLE 4INHA 4OM9A 1GBAA 5JB8S 4H4FA 1TMBH 3SNDA 3M7UA 2J95A 3V3MA 1HBTH 1GG6C 3L6PA 1A0HB 1KSNA 2KR7A 2AGGX 3PB1E 1JMOH 2QY0B 3PMAB 2ZNKH 4Z0KA 2DE9A 4WF8A 2EEKA 3FKSD 2UWLA 2ZCLP 1UTLM 3QDZB 5DP3A 3E3TA 1C1SA 2HALA 2KCOA 3BN9A 5L6NH 1NRSH 2XW9A 3ZVDA 4FUHA 3PWBA 1HIAB 2VWOA 3VB3A 5GXPA 4X2XA 1ZRKA 4YZUA 1QRXA 1PQAA 1Y3UA 1V2RT 3OFND 1DFPA 2FOBA 2PFEA 2P95A 1E34B 3M36A 1GI4A 2B5TB 5KEDA 1PJPA 1A2CH 1G2MA 1QJ1B 2D8WA 2GZ7A 3SU1A 1ANDA 4CREA 3DHKH 1ETRH 1GJCB 2BDHA 1O2TA 1ZPCA 2Q6GA 2Q6FA 1HJ8A 1A0JA 1SSXA 4BTIB 1P0SH 1BJVA 4UDWH 3E1XB 5HMAA 2VWMA 5C1XA 2QA9E 1MU6B 1O3FA 1QRZA 5HGGA 2ODQA 4E7NA 4Y0ZE 1V2ST 1F0TA 1ZPZA 3IWMA 1C2EA 1TPOA 3SGQE 1MAYA 2SGEE 3BTKE 1XM1A 4YT7H 2A45B 4ZUHA 1OHHD 1TNGA 2G5NA 2PHBA 2KZ4A 2HOBA 3E8LA 2EC9H 5A0BA 3RXUA 4FU9A 3FVFB 1UTMA 2LELA 2GT8A 1XKAC 1V2LT 1WYKA 4R0IA 4BAHB 3PROA 3HK3B 1OWJA 1SLUB 2FPZA 5A8ZA 1UHBA 3RXMA 1LKAA 2W5EA 4VGCC 3L3TA 1AVGH 2WSSD 4AG2A 2K1QA 2OINA 1ABIH 1O5EH 2A5KA 1Z8IB 2OC0A 5FPSA 7ESTE 1LPZB 3CS0A 1CU1A 2OD3B 1TPPA 1CSOE 3UR9A 1C5NH 2BD2A 4WJG2 1O2MA 3SGBE 3UREA 5L2ZH 1XKBC 1GG6B 4F49A 1XMNB 2AERH 1UTOA 1PPFE 3KIDU 1QRWA 5FHTA 1TWXB 5C94A 2H5DA 4CBNA 5F8TA 1T4VH 1S83A 5HM9A 3HGNA 3UAIC 3M5LA 4YLQH 1K1IA 1QL7A 2BVRH 2UUKB 4ASUD 4ABGA 4D9RA 3UOPA 6GCHF 2ZFSA 1ZHMA 2HGTH 2RCEA 4HFPB 2XWBI 2O8MA 1HB0B 1J15A 4TWWA 4K5ZA 3TH4H 5GPIB 2XC0A 4H42U 5GCHG 1GJ7B 4AFUA 1P3CA 3P8NA 1P02A 3PLBA 1GVKB 1SQTA 1RXPA 1SGCA 4MNYA 3UFAA 3STIA 1ZSKA 1KXEA 2RG3A 2SGPE 3BV9B 1EUFA 1CT4E 1UVPA 3D62A 2G4TA 5T3HA 1C5PA 4JK6A 1DANH 2PKAA 1UTJA 1GHZA 1ELGA 1CHOG 2FOEA 5GNDA 3LGTA 1CVWH 1HXFH 3EA7A 2H9HA 3KEEA 4LK4A 3F1SB 1C1UH 1FMGA 1GI7B 1SGRE 2EI7A 4B2BA 4B6EA 1O2QA 2V3OH 1O2KA 1OWIA 2XNDD 4FXGH 3A7TA 2A4QA 1NBME 4IMQA 1EZUC 2J34A 2OXSA 2G52A 1ESAA 2FOAA 1FX0B 2J98B 4U01A 4DT7B 4Q7ZA 4I32A 4FUFA 1IHSH 2PW8H 4UFGH 4B71A 2XRCA 2XBXA 2O8LA 4K1SA 5JBBS 3RMOH 1THSH 2GCTB 5CDFE 1P2IA 1FJSA 2J94A 3SU0A 4LXBH 5HIZA 1O2OA 1C2JA 5IDKA 1AE8H 1LHEH 2TGAA 1IQJA 1KXCA 1C2LA 2ZEBA 1AWFH 2Z3CA 1TB6H 3PO1C 1ELCA 4Z6AH 4FUJA 4VGCB 4Q2KA 2FOGA 5FX5A 2FOCA 3ZVFA 1ANCA 1F92A 3MU8A 1ELAA 2AMQA 3MMGA 1NRPH 1NBMD 3RU4E 1ABJH 1ZHRA 4Y7AA 1GI2A 4O97A 1TGTA 3KL6A 1C5ZB 1AMHA 2PSXA 2PTNA 2TRMA 5BPEA 3GCOA 3U28C 9ESTA 3Q3XA 1DSTA 4OGXA 2H1UA
chains in the Genus database with same CATH topology
3MO9A 3BTDE 1P2OA 1SLVB 4JZEH 1LKBA 4B75A 3ZVBA 1WQVH 4TY7A 3TVJB 2ZDKA 1SPJA 1QFKH 2RA3A 3SUEA 2I6SA 1AZ8A 3BTWE 1PQ5A 1B5GH 1TGBA 1DWDH 4GHQA 1DXPA 3SV2H 2A5AA 1YF4A 2GV6A 1OP0A 3RC5A 3U8OH 3JZ1B 3ZZ6A 3G01A 3QK1A 3RU4D 2QGRA 2FEQH 2G8TA 1TMTH 1HAVB 1KLTA 3GY8A 5JDUB 2HLCA 4OS1A 1HCGA 1O31A 1WTHD 2WPMS 1O39A 1EAUA 3MNSA 1YCPM 2WPJS 3SV7A 2BY8X 3GDSA 1DUAA 1C5RA 4ABEA 2F9OA 1GJBB 1UVOA 2ODYB 4D7FA 4AB9A 4CR5A 1S82A 2WPLS 1MBMA 3A84A 1K21H 4TYDA 1CO7E 1GJ4H 1GL1A 3M61U 1C1VH 4RN6A 2ZCHP 1ZMLA 2FS8A 4BAQB 3TK9A 1GI0A 3VB4A 3BEFB 3LH1A 5DK1A 1GI3A 1K1JA 3BEIB 2Z3DA 3OTJE 3AAVA 1C9PA 1SLXB 2A7JA 3RXOA 1YGCH 5F03A 1V2VT 2Y80A 2Z9KA 1SB1H 1VR1H 1A7SA 1H8IH 1EKBB 1M9UA 1O2XA 3DD2H 2C8WB 1S84A 4K1TA 3PTNA 1FY3A 2B7DH 4H6TA 1Y5BT 1DPOA 4WH6A 1MKWH 3MH4A 3URCA 5C1YA 3R3GB 2XXLA 1MCTA 1K1LA 1Y5UT 2RDLA 4ZKRU 2F9BH 4D8NA 3MH7A 2VH0A 5AVDA 1BRUP 1WQSA 5F8ZA 3TPIZ 1O2IA 1GJ8B 1HAIH 2BX3A 1QJ7B 4AYYB 4AYVB 1Y8TA 3S7KB 1O2GH 3BSQA 5GIBA 1FLEE 4X8TH 1LQEA 1GBEA 2NWNA 2VGCB 2V6NA 3D65E 3ODFA 1ETTH 1N1LA 1TA2A 5PTPA 4AFSA 5EODA 1E38B 4ABDA 3U98H 3LGWA 1FN6A 3RXRA 5JBAS 1UO6A 3SUGA 3SJ8A 2QN5T 2ANYA 2GCHF 3QWCH 4X0WU 5DP5A 5E8EH 2PTCE 1HAZB 3T29A 1TGNA 2BY6X 5SGAE 1O5CB 2LNCA 3OU0A 1T8NA 2O8WA 2G51A 1GBIA 1NC6A 3A7XA 1CT0E 2PKSC 4CRFA 1E36B 1HPGA 3A8BA 1OSSA 1QY6A 2F3CE 1FY5A 1D3TB 4IBLH 1TBZH 4Y79A 4FU7A 3V7TA 2SFAA 1A3BH 4KKDA 1FI8A 1OKXA 3D23A 4X6PA 2R0KA 2OC7A 1N6YA 1V2TT 5EQSA 1T7CA 2ZFRH 2FYRA 1DX5M 1PQ7A 4Y10E 3ZV8A 1FY1A 1L4DA 1RTFB 1DVAH 3PMJA 1MTSA 2W26A 5DP6A 1WBGB 1W10U 1MTUA 4MPXA 3U69H 2ZP0H 1CA0C 4GLYA 4X1NU 3HK6B 5E2OA 3OX7U 2ZKSA 2QC2A 3RMLH 4IW4E 3RLYH 1L2EA 1C1OA 1C1QA 1A3EH 5A2MH 1N6XA 5K0HA 1Z6JH 2VIOA 4MPWA 5K7RA 1ZLRA 4K2YA 1Y5AT 3RXPA 1YLDA 4UD9H 4UFEH 1T8LA 1W7GH 4Y71A 3A8DA 2ZFTA 1UTKA 1AU8A 1EJMA 4LZ1H 1JBUH 2ALVA 1Z8GA 1V3XA 1EAWA 1FY4A 1O3GA 1ZR0A 4NWKA 1P11E 1C5TA 1ARCA 1L4ZA 2AFQB 2GX4A 4B73A 1FV9A 3P8FA 4O3TA 1U6QA 1UVUH 2O9QA 1BUIA 2ZTZA 2ASUB 2BM2A 3TGKE 2FO9A 1TABE 1VITG 4TY6A 2PLXA 5F6MA 1BTXA 2B0FA 3QGNB 1KDQA 2A7CA 2WPHS 2XBYA 1IOEA 5EXLA 1BBRE 2H9EH 4Y8XA 4X2WA 4I8KA 1CGJE 4NGAH 2YNBA 2G55A 5EU8A 2J38A 2ZU2A 3E6PH 3NZIA 1WU1A 1K2I1 3B9FH 1H1BA 3BTQE 4Y76A 2F9PA 4O03A 2GMTB 1GJDB 3HPTB 1BZXE 3HKJB 3EA9A 1C5LH 5EXNA 1O2PA 1GBFA 5A0CA 2FS9A 1C1PA 3TGIE 4NIVA 1UK3A 1ZRBA 5E0HA 4A6LA 2FTMA 2BVSH 3KF2A 5TCCA 1V2QT 2FWWA 2F83A 4BNRA 1DWCH 1OYTH 1NU9A 4MNVA 2FI4E 1C2DA 1TMUH 1XUGA 2STBE 2UUFB 3A7VA 2C90B 2Z3EA 3A80A 1P2MA 1NO9H 4X1QU 1TOMH 3MU5A 4YESB 5L2YH 1A61H 3RXBA 1QQ4A 4AORA 3ZVAA 2OC8A 1ZJDA 2FLBH 1P3EA 2VINA 1NT1A 4I8HA 4YLUA 1GBMA 1SGTA 1IQEA 1CA0B 2QYIA 3A83A 1ZYOA 1C5UA 1GCDA 1Z8JB 2SGQE 1CHGA 3SORA 2VIPA 4HI3A 1QA7A 5ESBA 4OS7A 1C1MA 3QUMP 2OLGA 2OUAA 3ZZDA 3HKIB 7GCHF 5GJ4B 3RXLA 2BOKA 2P3UB 2PGBB 4DCDA 3TH2H 3GCHB 3P6ZB 1XUIA 3ZZ9A 3SNCA 2NU0E 1CT2E 1C5OH 1Y3XA 2GVFA 1C1RA 1GI9B 1MD8A 1BHXF 3E0PB 4D7GA 2FX4A 4NA9H 3MWIU 1ZJKA 3MU4A 3QX5H 1CBWB 3U1JB 3A88A 1MBQA 2Q1JA 1O3JA 1TPSA 3RDZA 3BTEE 3DFLA 2ZHEH 4JCNA 2ANMH 1EJAA 1C9TA 3RXTA 1MTWA 4BANB 5ABWA 3VPKA 3SGAE 1L1GA 1EAXA 3NKKA 3B8JA 1GI6A 3LPRA 4ISNA 1RTLA 4AX9H 5LPFA 3UNRA 3SO3A 1TLDA 4D9QA 3Q00A 3QN7A 3RXCA 2IJOB 1YYY1 2P3TB 3SUDA 1BHXB 4ZHMU 1MZDA 2BD5A 2VVUA 3W94A 2BD7A 4FUEA 2SGDE 5T6DA 1DDJA 4AB8A 4F4OC 4ABJA 3HGPA 3F9FA 3BIUH 2QXIA 3A8AA 3Q77A 2CF9H 3ELAH 3PLKA 2CJIA 3JZ2B 1HV7A 2H9TH 2NU4E 1NRNH 1TGCA 2PV9B 3ATMA 4NFFA 3LONA 3WY8A 1BTUA 1HIAA 4FUBA 2FODA 4BXSA 2BZAA 3SBKA 3TNTA 1JRTA 1SG8B 4NFEA 2PWXA 2BLOA 1DWEH 5JYIA 3UIRA 3NUMA 5T6FA 3RXJA 1V2KT 1C2KA 1QBOA 3ZV9A 3HATH 1XVOA 1AY6H 1Y59T 1IQFA 3MFJA 1P04A 1VCWA 2PGQB 2BY7X 2KAIA 1UHBB 4WY3A 3SN8A 1H8DH 4ABBA 3UOUA 1QQUA 2GD4B 2GCTC 4KELA 1DLEA 3SI3H 4KTCA 3T26A 4LOYH 1S0RA 1A5GH 1C4Y2 1QB6A 3A7YA 1OWDA 4A5TS 1RIWC 6GCHG 1S81A 2VH6A 1HJAB 2XNIA 3SQEE 4WXVA 1GI1A 1KTSB 1EZQA 1AD8H 3F9EA 4DOQA 3M7QA 1TRYA 3VB5A 4I8LA 4OS5A 3ZVEA 1KLJH 1C4U2 3BTFE 3MYWA 3PLPA 1LVYA 1D6RA 8ESTE 4E06H 2ZU1A 2G4UA 3DFJA 1P8VC 2NU2E 1F0UA 3T25A 1DT2A 1NN6A 5CHAC 1TQ0B 2A7HA 1ZTLA 4U32A 1O3KA 1LCYA 1JRSA 1BTWA 1BTHH 5I46H 1KYNA 5C5NA 1CA8B 1MZAA 4IGDA 4ZKSU 1BRAA 3T2NA 1FY8E 2VWNA 4IMZA 1DWBH 3FAOA 4INLA 1Z1JA 1O2HA 3A81A 4UEHH 5IYTA 1GMHF 1IHTH 1O2YA 1F5RA 3IITA 3V0XA 5EXMA 4CRGA 4I33A 1HAYB 5JBCS 3BG8A 1HFDA 2TGTA 1IQGA 5AHGH 4DVAU 3VB6A 5FBEA 2SGFE 2GKVE 2VVVA 4K8BA 3EGKH 1GHAF 5BRRE 1PPZA 1P2JA 1INCA 1A1RA 4X1PU 1VITH 1PPGE 1QGFA 1ZMNA 3ZZ3A 3RMNH 3O8BA 2Y5HA 4AGKA 4OS4A 3RC6A 1UJ1A 3UWJH 1OP2A 4BXWA 3QGJA 2OC1A 3A86A 1PQ8A 1TX6A 4E05H 2VIQA 3VXFH 2WV4A 4Q80A 2HPPH 4YO9A 6CHAB 1O36A 1T8OA 3TJUA 1N8OC 1V2NT 2GDEH 4NG9H 3NCLA 1QJ6B 3K65B 4LZ4B 2ZPRA 3GDUA 1BIOA 3I78A 4J2YB 1RIWB 1FN8A 1DE7H 1GPZA 2ZDAH 3V13A 1SGFG 4ABFA 2HVXA 2R0LA 3ZZBA 4SGAE 1C5VA 1XUKA 2TGPZ 1LQDB 3UQOA 3BTGE 5JBTA 4Y11E 1UCYE 1BBRK 1GJAB 5DP7A 3SJIA 1GWAA 1G3DA 3QTVH 2WYGA 1UTPA 2P16A 1DLKB 3EE0B 4K8YA 1TE0A 1OOKB 2AIPA 3ENSB 4Y6DA 1XXDA 2GZ8A 5CHAB 2UUYA 5DP4A 2J92A 4B2CA 2BD3A 1IQKA 4DY7B 4MG3A 4WVPE 1HAHH 4FUGA 2BDBA 1C5SA 3A7ZA 2VGCC 4CRBA 3NPSA 2F9VA 3TJNA 3GCTF 4X8VH 1ZTKA 3M3TA 2FIRH 1AKSA 1O2VA 2UUJB 2Y7ZA 4CHAB 1GJ6A 1YPHE 2A5IA 1P57B 3PMHB 4KP0A 2LPRA 2BY5X 4BAKB 4UONA 4ABHA 1THPB 1TBQH 5EW2H 2GV7A 1CGIE 4AN7A 1YPJH 2BQWB 2ZF0H 1MTNB 1QURH 2PR3A 4BTUB 1C5XB 2OTVA 3M5NA 1YPEH 1BOQA 4ZAEA 3ZYDA 2QV1A 3BTHE 1EB1H 1HRTH 1LPGB 1FDPA 4JZFH 5CE1A 1ZOMA 2P3FH 3MI4A 4DJZB 1ELBA 1GHWH 3SV6A 1SMFE 1SGYE 1YPHC 2FX6A 1Z7KA 1NFXA 1GDQA 2BD8A 1LTOA 5EG4A 3GCNA 4X8UH 2BVXH 1VCPA 4WH8A 1KY9A 1FAKH 5JB9S 2TGDA 2ODPA 4GAWA 3W95A 4QT8C 1G36A 1N8OB 2AGIX 2J2UA 3V12A 2BDCA 1T4UH 3T27A 2ZGCA 4MDSA 2A31A 1K1MA 3KQDA 4ZXXH 1VJAU 5EOKA 3SU5A 4HZHA 1C1TA 4CBOA 1G37A 2AH4X 1UVTH 3ODDA 3SNEA 1WUNH 5HXFA 1LPKB 2D1JA 3KGPA 1DITH 1SGFA 3SU4A 1O37A 1ORFA 2Y5FA 1O3DA 1JXPA 3PTBA 2SGAA 2GCHG 3NWUA 1GCTB 3E91A 2JH6D 1D4PB 2PSYA 1CQQA 1O30A 2QIQA 1GBBA 1GMDF 1AFEH 1TNKA 3SJOA 1AWHB 3U8TH 1L1NA 8GCHF 1O3LA 4K60A 4K1EA 1GBCA 3MHWU 1E0FD 1WV7H 4RKJB 2ZA5A 3A89A 3OY6U 4ISIH 1YPGH 3LC3A 1NU7B 3ESTA 1O5FH 1UK2A 1UVSH 1GGDB 1BRCE 2BTCE 3S9AA 3FP8E 1HAXB 1K1OA 2A32A 1O2NA 1YLCA 1D3PB 2Y82A 1YM0A 4U2WA 5DO4H 1MCVA 4R8TB 1DICA 4Y7BA 4YT6H 1XUJA 1GMCF 3MO6A 1W11U 1AQ7A 4OGYA 1HYLA 1DM4B 1MUEB 4AZ2B 2GMTC 1SGDE 2GT7A 4I8GA 1VGCC 1TNJA 1SHYA 2BOHB 3ZZ7A 5FCRA 3FFGA 2J9NA 4ZMAH 3SHCH 2QF0A 2B9LA 3BG4B 4NA7A 1XUHA 2BDIA 1EPTC 2M5TA 1RS0A 4SGBE 4X6OA 2QXHA 1C2HA 1XXFA 4UFDH 2WPIS 1QTFA 3O8DA 1D6WA 1V2OT 1B0FA 3R0FA 5J4QA 1GHYH 1VCQA 1PPEE 2BQ6B 2A2QH 2OCVB 3KQBA 3GY3A 2QCYA 1L0ZA 2PUXB 3TJVA 1DY8A 3C1KA 1F0SA 1G32B 1O3IA 1P2NA 4X8SH 1TALA 3RLWH 4ASHA 4B1TA 1EZSC 2ZGJA 4X6NA 1H9IE 1NS3A 1HNEE 1YBWA 1OWHA 1EASA 1QR3E 1F5KU 1EXFA 4I31A 1P05A 3GCHC 4WWYA 1NRRH 2VIVA 1FPHH 1GBJA 1SGIB 1AGJA 2F9NA 3H7OA 8KME2 3MNBA 1QBVH 1AN1E 1O5AB 3K6YA 3S9BA 3UUZA 3QZQA 2ZGXH 1V2JT 2CGAA 1CBWC 1O2UA 1P06A 5LPRA 3F6UH 3TK6A 3TITA 1C5YB 1ELDE 1ZHPA 3S0NA 3MH5A 2H2ZA 3LDXH 1KDQB 2FI5E 1OWKA 2DE8A 1WTGH 1O5GH 1NFYA 1O3OA 3DT0H 1OX1A 1S85A 1HUTH 1QCPA 1FIZA 1RGQA 1BT7A 2FP7B 1T8MA 3M7TA 3RM0H 2HNTE 2ZFPH 5EGMA 1QL9A 1SGQE 3RP2A 4IS5A 2BZ6H 1O3HA 1NESE 2ZTXA 3GY2A 3K2UA 3SW2B 1HLTH 4DURA 2HPQH 3SNAA 4XSKU 3UR6A 1KXFA 3TJOA 3F9HA 1PPBH 3RXEA 1RRKA 1TONA 1ELVA 1SQAA 5DP8A 3U8RH 2FM2A 1BTZA 4Q7XA 3SZNA 3OY5U 2O8TA 4NA8A 4BTTB 5DP9A 2UWOA 2Z9IA 1VGCB 4GCHF 2Y81A 1LHDH 1ZTJA 5F8XA 2VJ1A 3GYMA 1C1NA 3UNSA 4MVNA 2Y7XA 4A7IB 1UMAH 2P59A 2ANWA 1DS2E 1GJ9B 1XUFA 1IQLA 1EPTB 2BLQA 3URDA 7GCHG 2GDDA 3O8CA 1GI5A 1TNLA 2BY9X 1NROH 2ZU4A 1GL0E 3PM3A 1O32A 2HWLB 2ZG0H 2BDAA 2BX4A 1Q3XA 5FAHA 3I29A 4JYVH 3SV8A 1G9IE 4M7GA 3H5CB 3TNSA 4MNWA 4ISHH 4INKA 1TRMA 2P8OC 1LHGH 2FLRH 5E0GA 1HAPH 1UCYK 1J16A 3UPEA 3LU9B 4WMFA 1TYNA 1BCUH 1WOFA 5A09A 2Z9GA 3VB7A 4I8JA 3ZZAA 3RXIA 3SUFA 4IC5A 1BMNH 1NRQH 1OP8A 3EYDA 2BQ7B 2ILNA 1W13U 1ESBA 1Z1IA 2A1DB 1MMJN 3A8CA