1TBHA

H141d mutant of rat liver arginase i
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLDGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Probing the role of the hyper-reactive histidine residue of arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 101
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1tbhA00
4Q3QA 4IXVA 3MFVA 3F80A 4GSZA 5HJ9A 4IE2A 1P8RA 1P8PA 4Q42A 4IXUA 4RHJA 4Q3RA 3M1RA 4Q3UA 4Q41A 1T4TA 3TF3A 1WOGA 4MYNA 1P8SA 4IE3A 4FCKA 3KV2A 1WVBA 3E6VA 4MYLA 4RHMA 3THHA 4Q3SA 4ITYA 5RLAA 4I06A 4IU1A 3SJTA 3THEA 1T4SA 4IU4A 4IE1A 1GQ6A 1P8NA 4DZ4A 3GMZA 3CEVA 1TBHA 4G3HA 3LP7A 4Q40A 2CEVA 4Q3RC 3SKKA 2PHOA 1R1OA 1RLAA 4Q3TA 1P8MA 1XFKA 5HJAA 3THJA 3DJ8A 3GN0A 2A0MA 3SL0A 4GSMA 4IU0A 3E8ZA 2AEBA 3E6KA 4HZEA 1P8OA 1HQFA 4RHQA 4MYKA 2EF5A 4GSVA 3MMRA 1WOHA 3MJLA 3TH7A 1ZPGA 1WOIA 3NIQA 4IU5A 1HQHA 1TBJA 3SL1A 4RHLA 1CEVA 4MYFA 2PLLA 3E9BA 4HWWA 2EF4A 1HQGA 1WVAA 2PHAA 3RLAA 2RLAA 2EIVA 4MXRA 3PZLA 2ZAVA 3LHLA 4GWDA 3NIOA 4RHKA 1TA1A 1T4PA 4FCIA 4GWCA 1HQ5A 3LP4A 4HXQA 1GQ7A 1PQ3A 4RHIA 1TBLA 1T5GA 1HQXA 1P8QA 4Q3PA 1ZPEA 4RLAA 1T5FA 1D3VA 1T4RA 4Q3VA 3MFWA 4CEVA 5CEVA 3NIPA 3E8QA
chains in the Genus database with same CATH superfamily
4Q3QA 5G17A 4IXVA 5FUEA 4BKXB 3MFVA 4BZ5A 3F80A 4GSZA 5HJ9A 4IE2A 1P8RA 1P8PA 4Q42A 3F06A 4ZUPA 4IXUA 1T69A 4LY1A 4RHJA 4Q3RA 3M1RA 4Q3UA 5DC6A 5EENA 4Q41A 1T4TA 3TF3A 5EEKA 1WOGA 4QA1A 1C3PA 4MYNA 1P8SA 4IE3A 4FCKA 4QA6A 3KV2A 1ZZ0A 5G1CA 4ZUOA 1WVBA 5THVA 2VQMA 3MZ6A 3E6VA 1T64A 4MYLA 5THTA 4BZ7A 5G1AA 4CBTA 4RHMA 3THHA 4Q3SA 5IX0A 5LI3A 4ITYA 5EFHA 5RLAA 4I06A 3EZPA 4IU1A 3SJTA 1T4SA 4IU4A 4IE1A 1GQ6A 1P8NA 4QA3A 5G12A 3GMZA 5THSA 4DZ4A 3CEVA 5EFKB 1TBHA 4ZUNA 3Q9FA 5G13A 5ICNB 5BWZA 4G3HA 5EEIA 3LP7A 4Q40A 2CEVA 4Q3RC 2V5XA 5DC8A 3SKKA 2PHOA 1R1OA 1RLAA 4Q3TA 1P8MA 1XFKA 2VQWG 1C3RA 5EFGA 5HJAA 1ZZ1A 3THJA 3DJ8A 3EZTA 2A0MA 3GN0A 3EW8A 3SL0A 4RN0A 3MENA 5A2SA 5D1DA 3RQDA 5DC7A 4GSMA 4IU0A 4QA0A 3E8ZA 5EF8A 2AEBA 3F07A 3E6KA 4HZEA 1P8OA 1HQFA 4RHQA 5G0HA 5G3WA 4MYKA 5EFNA 5G11A 5EF7A 2EF5A 4GSVA 5D1CA 3MMRA 1WOHA 3MJLA 4ZURA 3TH7A 3C0YA 4QA2A 1ZPGA 3F0RA 4RN2A 1WOIA 4QA7A 3NIQA 4IU5A 5FCWA 5IWGA 5EEMA 1HQHA 1TBJA 3MAXA 4BZ9A 5JI5A 2VQVA 1ZZ3A 3ZNRA 3SL1A 4RHLA 1CEVA 4MYFA 2PLLA 3EWFA 3E9BA 1VKGA 4HWWA 4CQFA 2EF4A 2GH6A 3SFFA 1HQGA 3C0ZA 1W22A 1WVAA 5G10A 2PHAA 2VQQA 3RLAA 4ZUQA 2VQOA 5G0YA 2RLAA 4QA4A 5G0IA 3MZ3A 2EIVA 4MXRA 3Q9BA 5DC5A 3PZLA 5G0JA 4RN1A 1T67A 2ZAVA 2V5WA 3LHLA 4GWDA 3NIOA 4RHKA 1TA1A 2VQJA 1T4PA 3MZ7A 4FCIA 4GWCA 4LXZA 1C3SA 1HQ5A 3LP4A 4HXQA 1GQ7A 5D1BA 1PQ3A 4RHIA 1TBLA 1T5GA 5EEFA 5EFBD 1HQXA 3C10A 4A69A 1P8QA 4Q3PA 1ZPEA 4ZUMA 4RLAA 5EFJD 2VCGA 3Q9CA 5G0XA 1T5FA 3MZ4A 5G0GA 3SFHA 4BZ8A 4BZ6A 1D3VA 4CBYA 1T4RA 4Q3VA 3MFWA 5THUA 3THEA 3ZNSA 4CEVA 5G1BA 3Q9EA 4QA5A 5CEVA 3NIPA 3E8QA
chains in the Genus database with same CATH topology
4Q3QA 4IXVA 3MFVA 3F80A 4GSZA 5HJ9A 4IE2A 1P8RA 1P8PA 4Q42A 4IXUA 4RHJA 4Q3RA 3M1RA 4Q3UA 4Q41A 1T4TA 3TF3A 1WOGA 4MYNA 1P8SA 4IE3A 4FCKA 3KV2A 1WVBA 3E6VA 4MYLA 4RHMA 3THHA 4Q3SA 4ITYA 5RLAA 4I06A 4IU1A 3SJTA 3THEA 1T4SA 4IU4A 4IE1A 1GQ6A 1P8NA 4DZ4A 3GMZA 3CEVA 1TBHA 4G3HA 3LP7A 4Q40A 2CEVA 4Q3RC 3SKKA 2PHOA 1R1OA 1RLAA 4Q3TA 1P8MA 1XFKA 5HJAA 3THJA 3DJ8A 3GN0A 2A0MA 3SL0A 4GSMA 4IU0A 3E8ZA 2AEBA 3E6KA 4HZEA 1P8OA 1HQFA 4RHQA 4MYKA 2EF5A 4GSVA 3MMRA 1WOHA 3MJLA 3TH7A 1ZPGA 1WOIA 3NIQA 4IU5A 1HQHA 1TBJA 3SL1A 4RHLA 1CEVA 4MYFA 2PLLA 3E9BA 4HWWA 2EF4A 1HQGA 1WVAA 2PHAA 3RLAA 2RLAA 2EIVA 4MXRA 3PZLA 2ZAVA 3LHLA 4GWDA 3NIOA 4RHKA 1TA1A 1T4PA 4FCIA 4GWCA 1HQ5A 3LP4A 4HXQA 1GQ7A 1PQ3A 4RHIA 1TBLA 1T5GA 1HQXA 1P8QA 4Q3PA 1ZPEA 4RLAA 1T5FA 1D3VA 1T4RA 4Q3VA 3MFWA 4CEVA 5CEVA 3NIPA 3E8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q3Q A;  4IXV A;  3MFV A;  3F80 A;  4GSZ A;  5HJ9 A;  4IE2 A;  1P8R A;  1P8P A;  4Q42 A;  4IXU A;  4RHJ A;  4Q3R A;  3M1R A;  4Q3U A;  4Q41 A;  1T4T A;  3TF3 A;  1WOG A;  4MYN A;  1P8S A;  4IE3 A;  4FCK A;  3KV2 A;  1WVB A;  3E6V A;  4MYL A;  4RHM A;  3THH A;  4Q3S A;  4ITY A;  5RLA A;  4I06 A;  4IU1 A;  3SJT A;  3THE A;  1T4S A;  4IU4 A;  4IE1 A;  1GQ6 A;  1P8N A;  4DZ4 A;  3GMZ A;  3CEV A;  1TBH A;  4G3H A;  3LP7 A;  4Q40 A;  2CEV A;  4Q3R C;  3SKK A;  2PHO A;  1R1O A;  1RLA A;  4Q3T A;  1P8M A;  1XFK A;  5HJA A;  3THJ A;  3DJ8 A;  3GN0 A;  2A0M A;  3SL0 A;  4GSM A;  4IU0 A;  3E8Z A;  2AEB A;  3E6K A;  4HZE A;  1P8O A;  1HQF A;  4RHQ A;  4MYK A;  2EF5 A;  4GSV A;  3MMR A;  1WOH A;  3MJL A;  3TH7 A;  1ZPG A;  1WOI A;  3NIQ A;  4IU5 A;  1HQH A;  1TBJ A;  3SL1 A;  4RHL A;  1CEV A;  4MYF A;  2PLL A;  3E9B A;  4HWW A;  2EF4 A;  1HQG A;  1WVA A;  2PHA A;  3RLA A;  2RLA A;  2EIV A;  4MXR A;  3PZL A;  2ZAV A;  3LHL A;  4GWD A;  3NIO A;  4RHK A;  1TA1 A;  1T4P A;  4FCI A;  4GWC A;  1HQ5 A;  3LP4 A;  4HXQ A;  1GQ7 A;  1PQ3 A;  4RHI A;  1TBL A;  1T5G A;  1HQX A;  1P8Q A;  4Q3P A;  1ZPE A;  4RLA A;  1T5F A;  1D3V A;  1T4R A;  4Q3V A;  3MFW A;  4CEV A;  5CEV A;  3NIP A;  3E8Q A; 
#chains in the Genus database with same CATH topology
 4Q3Q A;  5G17 A;  4IXV A;  5FUE A;  4BKX B;  3MFV A;  4BZ5 A;  3F80 A;  4GSZ A;  5HJ9 A;  4IE2 A;  1P8R A;  1P8P A;  4Q42 A;  3F06 A;  4ZUP A;  4IXU A;  1T69 A;  4LY1 A;  4RHJ A;  4Q3R A;  3M1R A;  4Q3U A;  5DC6 A;  5EEN A;  4Q41 A;  1T4T A;  3TF3 A;  5EEK A;  1WOG A;  4QA1 A;  1C3P A;  4MYN A;  1P8S A;  4IE3 A;  4FCK A;  4QA6 A;  3KV2 A;  1ZZ0 A;  5G1C A;  4ZUO A;  1WVB A;  5THV A;  2VQM A;  3MZ6 A;  3E6V A;  1T64 A;  4MYL A;  5THT A;  4BZ7 A;  5G1A A;  4CBT A;  4RHM A;  3THH A;  4Q3S A;  5IX0 A;  5LI3 A;  4ITY A;  5EFH A;  5RLA A;  4I06 A;  3EZP A;  4IU1 A;  3SJT A;  1T4S A;  4IU4 A;  4IE1 A;  1GQ6 A;  1P8N A;  4QA3 A;  5G12 A;  3GMZ A;  5THS A;  4DZ4 A;  3CEV A;  5EFK B;  1TBH A;  4ZUN A;  3Q9F A;  5G13 A;  5ICN B;  5BWZ A;  4G3H A;  5EEI A;  3LP7 A;  4Q40 A;  2CEV A;  4Q3R C;  2V5X A;  5DC8 A;  3SKK A;  2PHO A;  1R1O A;  1RLA A;  4Q3T A;  1P8M A;  1XFK A;  2VQW G;  1C3R A;  5EFG A;  5HJA A;  1ZZ1 A;  3THJ A;  3DJ8 A;  3EZT A;  2A0M A;  3GN0 A;  3EW8 A;  3SL0 A;  4RN0 A;  3MEN A;  5A2S A;  5D1D A;  3RQD A;  5DC7 A;  4GSM A;  4IU0 A;  4QA0 A;  3E8Z A;  5EF8 A;  2AEB A;  3F07 A;  3E6K A;  4HZE A;  1P8O A;  1HQF A;  4RHQ A;  5G0H A;  5G3W A;  4MYK A;  5EFN A;  5G11 A;  5EF7 A;  2EF5 A;  4GSV A;  5D1C A;  3MMR A;  1WOH A;  3MJL A;  4ZUR A;  3TH7 A;  3C0Y A;  4QA2 A;  1ZPG A;  3F0R A;  4RN2 A;  1WOI A;  4QA7 A;  3NIQ A;  4IU5 A;  5FCW A;  5IWG A;  5EEM A;  1HQH A;  1TBJ A;  3MAX A;  4BZ9 A;  5JI5 A;  2VQV A;  1ZZ3 A;  3ZNR A;  3SL1 A;  4RHL A;  1CEV A;  4MYF A;  2PLL A;  3EWF A;  3E9B A;  1VKG A;  4HWW A;  4CQF A;  2EF4 A;  2GH6 A;  3SFF A;  1HQG A;  3C0Z A;  1W22 A;  1WVA A;  5G10 A;  2PHA A;  2VQQ A;  3RLA A;  4ZUQ A;  2VQO A;  5G0Y A;  2RLA A;  4QA4 A;  5G0I A;  3MZ3 A;  2EIV A;  4MXR A;  3Q9B A;  5DC5 A;  3PZL A;  5G0J A;  4RN1 A;  1T67 A;  2ZAV A;  2V5W A;  3LHL A;  4GWD A;  3NIO A;  4RHK A;  1TA1 A;  2VQJ A;  1T4P A;  3MZ7 A;  4FCI A;  4GWC A;  4LXZ A;  1C3S A;  1HQ5 A;  3LP4 A;  4HXQ A;  1GQ7 A;  5D1B A;  1PQ3 A;  4RHI A;  1TBL A;  1T5G A;  5EEF A;  5EFB D;  1HQX A;  3C10 A;  4A69 A;  1P8Q A;  4Q3P A;  1ZPE A;  4ZUM A;  4RLA A;  5EFJ D;  2VCG A;  3Q9C A;  5G0X A;  1T5F A;  3MZ4 A;  5G0G A;  3SFH A;  4BZ8 A;  4BZ6 A;  1D3V A;  4CBY A;  1T4R A;  4Q3V A;  3MFW A;  5THU A;  3THE A;  3ZNS A;  4CEV A;  5G1B A;  3Q9E A;  4QA5 A;  5CEV A;  3NIP A;  3E8Q A; 
#chains in the Genus database with same CATH homology
 4Q3Q A;  4IXV A;  3MFV A;  3F80 A;  4GSZ A;  5HJ9 A;  4IE2 A;  1P8R A;  1P8P A;  4Q42 A;  4IXU A;  4RHJ A;  4Q3R A;  3M1R A;  4Q3U A;  4Q41 A;  1T4T A;  3TF3 A;  1WOG A;  4MYN A;  1P8S A;  4IE3 A;  4FCK A;  3KV2 A;  1WVB A;  3E6V A;  4MYL A;  4RHM A;  3THH A;  4Q3S A;  4ITY A;  5RLA A;  4I06 A;  4IU1 A;  3SJT A;  3THE A;  1T4S A;  4IU4 A;  4IE1 A;  1GQ6 A;  1P8N A;  4DZ4 A;  3GMZ A;  3CEV A;  1TBH A;  4G3H A;  3LP7 A;  4Q40 A;  2CEV A;  4Q3R C;  3SKK A;  2PHO A;  1R1O A;  1RLA A;  4Q3T A;  1P8M A;  1XFK A;  5HJA A;  3THJ A;  3DJ8 A;  3GN0 A;  2A0M A;  3SL0 A;  4GSM A;  4IU0 A;  3E8Z A;  2AEB A;  3E6K A;  4HZE A;  1P8O A;  1HQF A;  4RHQ A;  4MYK A;  2EF5 A;  4GSV A;  3MMR A;  1WOH A;  3MJL A;  3TH7 A;  1ZPG A;  1WOI A;  3NIQ A;  4IU5 A;  1HQH A;  1TBJ A;  3SL1 A;  4RHL A;  1CEV A;  4MYF A;  2PLL A;  3E9B A;  4HWW A;  2EF4 A;  1HQG A;  1WVA A;  2PHA A;  3RLA A;  2RLA A;  2EIV A;  4MXR A;  3PZL A;  2ZAV A;  3LHL A;  4GWD A;  3NIO A;  4RHK A;  1TA1 A;  1T4P A;  4FCI A;  4GWC A;  1HQ5 A;  3LP4 A;  4HXQ A;  1GQ7 A;  1PQ3 A;  4RHI A;  1TBL A;  1T5G A;  1HQX A;  1P8Q A;  4Q3P A;  1ZPE A;  4RLA A;  1T5F A;  1D3V A;  1T4R A;  4Q3V A;  3MFW A;  4CEV A;  5CEV A;  3NIP A;  3E8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...