1TBJA

H141a mutant of rat liver arginase i
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLAGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Probing the role of the hyper-reactive histidine residue of arginase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 114
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2004-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1tbjA00
2PLLA 4Q3RA 4CEVA 1RLAA 1D3VA 4HXQA 4Q3VA 4I06A 1GQ7A 3MFVA 4FCIA 4MYLA 4Q40A 4IE1A 3THHA 3SL0A 1P8RA 1HQGA 1TA1A 1CEVA 2PHOA 4ITYA 1P8SA 4RHMA 3TF3A 1WVAA 4RLAA 1T4SA 3LP7A 3TH7A 3KV2A 4IE2A 4Q42A 1T5FA 4Q41A 4GSZA 4MYNA 3GN0A 3E6VA 4GWDA 4IXUA 3THEA 2RLAA 1T4TA 1P8QA 4HZEA 4MXRA 1PQ3A 4RHKA 1T5GA 4IU4A 4RHLA 4IU0A 4Q3SA 5HJ9A 3LP4A 1P8NA 1TBLA 4IU1A 3M1RA 3MJLA 3NIOA 1P8OA 1GQ6A 3E8ZA 4RHJA 4FCKA 1T4PA 4DZ4A 3SKKA 1WVBA 3PZLA 4GWCA 2PHAA 1HQFA 1XFKA 1HQHA 2EIVA 3CEVA 2EF5A 3E9BA 3THJA 3NIQA 4Q3TA 4RHIA 3F80A 3E6KA 3E8QA 4GSMA 2A0MA 1WOHA 1TBHA 1HQ5A 2CEVA 5HJAA 3RLAA 3GMZA 1HQXA 1WOIA 3NIPA 3MMRA 5CEVA 1WOGA 5RLAA 4MYKA 1TBJA 4HWWA 1P8PA 2EF4A 3DJ8A 4G3HA 3SL1A 1ZPGA 4Q3QA 3LHLA 4RHQA 4Q3RC 1T4RA 4IE3A 4GSVA 4IU5A 1ZPEA 1P8MA 2AEBA 1R1OA 4Q3UA 4MYFA 4Q3PA 3SJTA 3MFWA 4IXVA 2ZAVA
chains in the Genus database with same CATH superfamily
2PLLA 4Q3RA 5DC7A 4CEVA 1RLAA 1D3VA 4HXQA 4Q3VA 5G3WA 2VQWG 4I06A 4CQFA 1GQ7A 3MFVA 5ICNB 4FCIA 4MYLA 4Q40A 3EZTA 3MZ6A 2V5WA 4IE1A 4ZUMA 3THHA 3SL0A 1P8RA 1HQGA 3EW8A 4BZ9A 1TA1A 1CEVA 2PHOA 3MAXA 1P8SA 4ITYA 4RHMA 1T69A 3TF3A 5EFNA 1WVAA 2VCGA 1VKGA 4RLAA 1C3PA 5G0XA 1T4SA 3LP7A 4QA0A 3TH7A 3KV2A 4IE2A 4Q42A 1T5FA 1T67A 4Q41A 4GSZA 4MYNA 3GN0A 3E6VA 4GWDA 4IXUA 5EEMA 3THEA 2RLAA 5THTA 5A2SA 1T4TA 4CBTA 1P8QA 5G1AA 1C3RA 4HZEA 5EENA 4QA6A 5FCWA 1T64A 4MXRA 4QA3A 4RN0A 1PQ3A 4BZ5A 4RHKA 1T5GA 5EFGA 4IU4A 4RHLA 3EZPA 4IU0A 4Q3SA 5D1CA 5EFHA 1ZZ1A 3C10A 3LP4A 1P8NA 5EFKB 1TBLA 5HJ9A 5G0YA 5DC6A 4IU1A 5EF7A 3M1RA 5D1BA 5DC8A 3MJLA 5THUA 3NIOA 2V5XA 1P8OA 3Q9CA 4BZ8A 1GQ6A 3E8ZA 4RHJA 3C0YA 3MZ4A 4FCKA 5EEKA 1T4PA 4DZ4A 1ZZ3A 5THVA 3SKKA 3MZ7A 1WVBA 3PZLA 5G1CA 4ZUQA 4GWCA 5G0IA 2PHAA 1HQFA 1XFKA 1HQHA 2EIVA 1C3SA 5G10A 4CBYA 3CEVA 3ZNSA 4QA4A 2VQOA 4LXZA 2EF5A 3E9BA 3F07A 3THJA 2GH6A 3ZNRA 3NIQA 4Q3TA 4RHIA 3SFHA 3F80A 3E6KA 3E8QA 5EEFA 4GSMA 2A0MA 5IWGA 3Q9FA 1WOHA 1TBHA 1HQ5A 5IX0A 2CEVA 2VQMA 5G0HA 4A69A 4BKXB 5HJAA 3RLAA 3GMZA 4ZUNA 1HQXA 5LI3A 1WOIA 3F06A 3NIPA 5G17A 3SFFA 2VQQA 3MMRA 5EF8A 3MENA 5EFBD 5CEVA 1WOGA 5RLAA 3F0RA 4MYKA 4ZURA 1TBJA 5G12A 4HWWA 5DC5A 2VQVA 3MZ3A 5FUEA 5G0JA 1P8PA 1ZZ0A 5EEIA 2EF4A 3DJ8A 4G3HA 3SL1A 1ZPGA 5D1DA 3RQDA 4Q3QA 4QA2A 5G11A 4LY1A 4BZ6A 3LHLA 4RHQA 5THSA 4Q3RC 1T4RA 3Q9EA 4IE3A 5G1BA 4GSVA 4IU5A 4QA1A 2VQJA 5EFJD 3Q9BA 1ZPEA 1P8MA 2AEBA 4QA7A 4ZUPA 5G0GA 5JI5A 1R1OA 4ZUOA 4Q3UA 4MYFA 4Q3PA 3SJTA 3MFWA 4BZ7A 3C0ZA 3EWFA 4IXVA 4QA5A 4RN1A 5G13A 1W22A 5BWZA 2ZAVA 4RN2A
chains in the Genus database with same CATH topology
2PLLA 4Q3RA 4CEVA 1RLAA 1D3VA 4HXQA 4Q3VA 4I06A 1GQ7A 3MFVA 4FCIA 4MYLA 4Q40A 4IE1A 3THHA 3SL0A 1P8RA 1HQGA 1TA1A 1CEVA 2PHOA 4ITYA 1P8SA 4RHMA 3TF3A 1WVAA 4RLAA 1T4SA 3LP7A 3TH7A 3KV2A 4IE2A 4Q42A 1T5FA 4Q41A 4GSZA 4MYNA 3GN0A 3E6VA 4GWDA 4IXUA 3THEA 2RLAA 1T4TA 1P8QA 4HZEA 4MXRA 1PQ3A 4RHKA 1T5GA 4IU4A 4RHLA 4IU0A 4Q3SA 5HJ9A 3LP4A 1P8NA 1TBLA 4IU1A 3M1RA 3MJLA 3NIOA 1P8OA 1GQ6A 3E8ZA 4RHJA 4FCKA 1T4PA 4DZ4A 3SKKA 1WVBA 3PZLA 4GWCA 2PHAA 1HQFA 1XFKA 1HQHA 2EIVA 3CEVA 2EF5A 3E9BA 3THJA 3NIQA 4Q3TA 4RHIA 3F80A 3E6KA 3E8QA 4GSMA 2A0MA 1WOHA 1TBHA 1HQ5A 2CEVA 5HJAA 3RLAA 3GMZA 1HQXA 1WOIA 3NIPA 3MMRA 5CEVA 1WOGA 5RLAA 4MYKA 1TBJA 4HWWA 1P8PA 2EF4A 3DJ8A 4G3HA 3SL1A 1ZPGA 4Q3QA 3LHLA 4RHQA 4Q3RC 1T4RA 4IE3A 4GSVA 4IU5A 1ZPEA 1P8MA 2AEBA 1R1OA 4Q3UA 4MYFA 4Q3PA 3SJTA 3MFWA 4IXVA 2ZAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLL A;  4Q3R A;  4CEV A;  1RLA A;  1D3V A;  4HXQ A;  4Q3V A;  4I06 A;  1GQ7 A;  3MFV A;  4FCI A;  4MYL A;  4Q40 A;  4IE1 A;  3THH A;  3SL0 A;  1P8R A;  1HQG A;  1TA1 A;  1CEV A;  2PHO A;  4ITY A;  1P8S A;  4RHM A;  3TF3 A;  1WVA A;  4RLA A;  1T4S A;  3LP7 A;  3TH7 A;  3KV2 A;  4IE2 A;  4Q42 A;  1T5F A;  4Q41 A;  4GSZ A;  4MYN A;  3GN0 A;  3E6V A;  4GWD A;  4IXU A;  3THE A;  2RLA A;  1T4T A;  1P8Q A;  4HZE A;  4MXR A;  1PQ3 A;  4RHK A;  1T5G A;  4IU4 A;  4RHL A;  4IU0 A;  4Q3S A;  5HJ9 A;  3LP4 A;  1P8N A;  1TBL A;  4IU1 A;  3M1R A;  3MJL A;  3NIO A;  1P8O A;  1GQ6 A;  3E8Z A;  4RHJ A;  4FCK A;  1T4P A;  4DZ4 A;  3SKK A;  1WVB A;  3PZL A;  4GWC A;  2PHA A;  1HQF A;  1XFK A;  1HQH A;  2EIV A;  3CEV A;  2EF5 A;  3E9B A;  3THJ A;  3NIQ A;  4Q3T A;  4RHI A;  3F80 A;  3E6K A;  3E8Q A;  4GSM A;  2A0M A;  1WOH A;  1TBH A;  1HQ5 A;  2CEV A;  5HJA A;  3RLA A;  3GMZ A;  1HQX A;  1WOI A;  3NIP A;  3MMR A;  5CEV A;  1WOG A;  5RLA A;  4MYK A;  1TBJ A;  4HWW A;  1P8P A;  2EF4 A;  3DJ8 A;  4G3H A;  3SL1 A;  1ZPG A;  4Q3Q A;  3LHL A;  4RHQ A;  4Q3R C;  1T4R A;  4IE3 A;  4GSV A;  4IU5 A;  1ZPE A;  1P8M A;  2AEB A;  1R1O A;  4Q3U A;  4MYF A;  4Q3P A;  3SJT A;  3MFW A;  4IXV A;  2ZAV A; 
#chains in the Genus database with same CATH topology
 2PLL A;  4Q3R A;  5DC7 A;  4CEV A;  1RLA A;  1D3V A;  4HXQ A;  4Q3V A;  5G3W A;  2VQW G;  4I06 A;  4CQF A;  1GQ7 A;  3MFV A;  5ICN B;  4FCI A;  4MYL A;  4Q40 A;  3EZT A;  3MZ6 A;  2V5W A;  4IE1 A;  4ZUM A;  3THH A;  3SL0 A;  1P8R A;  1HQG A;  3EW8 A;  4BZ9 A;  1TA1 A;  1CEV A;  2PHO A;  3MAX A;  1P8S A;  4ITY A;  4RHM A;  1T69 A;  3TF3 A;  5EFN A;  1WVA A;  2VCG A;  1VKG A;  4RLA A;  1C3P A;  5G0X A;  1T4S A;  3LP7 A;  4QA0 A;  3TH7 A;  3KV2 A;  4IE2 A;  4Q42 A;  1T5F A;  1T67 A;  4Q41 A;  4GSZ A;  4MYN A;  3GN0 A;  3E6V A;  4GWD A;  4IXU A;  5EEM A;  3THE A;  2RLA A;  5THT A;  5A2S A;  1T4T A;  4CBT A;  1P8Q A;  5G1A A;  1C3R A;  4HZE A;  5EEN A;  4QA6 A;  5FCW A;  1T64 A;  4MXR A;  4QA3 A;  4RN0 A;  1PQ3 A;  4BZ5 A;  4RHK A;  1T5G A;  5EFG A;  4IU4 A;  4RHL A;  3EZP A;  4IU0 A;  4Q3S A;  5D1C A;  5EFH A;  1ZZ1 A;  3C10 A;  3LP4 A;  1P8N A;  5EFK B;  1TBL A;  5HJ9 A;  5G0Y A;  5DC6 A;  4IU1 A;  5EF7 A;  3M1R A;  5D1B A;  5DC8 A;  3MJL A;  5THU A;  3NIO A;  2V5X A;  1P8O A;  3Q9C A;  4BZ8 A;  1GQ6 A;  3E8Z A;  4RHJ A;  3C0Y A;  3MZ4 A;  4FCK A;  5EEK A;  1T4P A;  4DZ4 A;  1ZZ3 A;  5THV A;  3SKK A;  3MZ7 A;  1WVB A;  3PZL A;  5G1C A;  4ZUQ A;  4GWC A;  5G0I A;  2PHA A;  1HQF A;  1XFK A;  1HQH A;  2EIV A;  1C3S A;  5G10 A;  4CBY A;  3CEV A;  3ZNS A;  4QA4 A;  2VQO A;  4LXZ A;  2EF5 A;  3E9B A;  3F07 A;  3THJ A;  2GH6 A;  3ZNR A;  3NIQ A;  4Q3T A;  4RHI A;  3SFH A;  3F80 A;  3E6K A;  3E8Q A;  5EEF A;  4GSM A;  2A0M A;  5IWG A;  3Q9F A;  1WOH A;  1TBH A;  1HQ5 A;  5IX0 A;  2CEV A;  2VQM A;  5G0H A;  4A69 A;  4BKX B;  5HJA A;  3RLA A;  3GMZ A;  4ZUN A;  1HQX A;  5LI3 A;  1WOI A;  3F06 A;  3NIP A;  5G17 A;  3SFF A;  2VQQ A;  3MMR A;  5EF8 A;  3MEN A;  5EFB D;  5CEV A;  1WOG A;  5RLA A;  3F0R A;  4MYK A;  4ZUR A;  1TBJ A;  5G12 A;  4HWW A;  5DC5 A;  2VQV A;  3MZ3 A;  5FUE A;  5G0J A;  1P8P A;  1ZZ0 A;  5EEI A;  2EF4 A;  3DJ8 A;  4G3H A;  3SL1 A;  1ZPG A;  5D1D A;  3RQD A;  4Q3Q A;  4QA2 A;  5G11 A;  4LY1 A;  4BZ6 A;  3LHL A;  4RHQ A;  5THS A;  4Q3R C;  1T4R A;  3Q9E A;  4IE3 A;  5G1B A;  4GSV A;  4IU5 A;  4QA1 A;  2VQJ A;  5EFJ D;  3Q9B A;  1ZPE A;  1P8M A;  2AEB A;  4QA7 A;  4ZUP A;  5G0G A;  5JI5 A;  1R1O A;  4ZUO A;  4Q3U A;  4MYF A;  4Q3P A;  3SJT A;  3MFW A;  4BZ7 A;  3C0Z A;  3EWF A;  4IXV A;  4QA5 A;  4RN1 A;  5G13 A;  1W22 A;  5BWZ A;  2ZAV A;  4RN2 A; 
#chains in the Genus database with same CATH homology
 2PLL A;  4Q3R A;  4CEV A;  1RLA A;  1D3V A;  4HXQ A;  4Q3V A;  4I06 A;  1GQ7 A;  3MFV A;  4FCI A;  4MYL A;  4Q40 A;  4IE1 A;  3THH A;  3SL0 A;  1P8R A;  1HQG A;  1TA1 A;  1CEV A;  2PHO A;  4ITY A;  1P8S A;  4RHM A;  3TF3 A;  1WVA A;  4RLA A;  1T4S A;  3LP7 A;  3TH7 A;  3KV2 A;  4IE2 A;  4Q42 A;  1T5F A;  4Q41 A;  4GSZ A;  4MYN A;  3GN0 A;  3E6V A;  4GWD A;  4IXU A;  3THE A;  2RLA A;  1T4T A;  1P8Q A;  4HZE A;  4MXR A;  1PQ3 A;  4RHK A;  1T5G A;  4IU4 A;  4RHL A;  4IU0 A;  4Q3S A;  5HJ9 A;  3LP4 A;  1P8N A;  1TBL A;  4IU1 A;  3M1R A;  3MJL A;  3NIO A;  1P8O A;  1GQ6 A;  3E8Z A;  4RHJ A;  4FCK A;  1T4P A;  4DZ4 A;  3SKK A;  1WVB A;  3PZL A;  4GWC A;  2PHA A;  1HQF A;  1XFK A;  1HQH A;  2EIV A;  3CEV A;  2EF5 A;  3E9B A;  3THJ A;  3NIQ A;  4Q3T A;  4RHI A;  3F80 A;  3E6K A;  3E8Q A;  4GSM A;  2A0M A;  1WOH A;  1TBH A;  1HQ5 A;  2CEV A;  5HJA A;  3RLA A;  3GMZ A;  1HQX A;  1WOI A;  3NIP A;  3MMR A;  5CEV A;  1WOG A;  5RLA A;  4MYK A;  1TBJ A;  4HWW A;  1P8P A;  2EF4 A;  3DJ8 A;  4G3H A;  3SL1 A;  1ZPG A;  4Q3Q A;  3LHL A;  4RHQ A;  4Q3R C;  1T4R A;  4IE3 A;  4GSV A;  4IU5 A;  1ZPE A;  1P8M A;  2AEB A;  1R1O A;  4Q3U A;  4MYF A;  4Q3P A;  3SJT A;  3MFW A;  4IXV A;  2ZAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...