1TC1A

A 1.4 angstrom crystal structure for the hypoxanthine phosphoribosyltransferase of trypanosoma cruzi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
184
structure length
175
Chain Sequence
YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 1.4 A crystal structure for the hypoxanthine phosphoribosyltransferase of Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
molecule keywords PROTEIN (HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE)
total genus 55
structure length 175
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tc1A00
3MJDA 4ZFNA 1OPRA 2PS1A 1UFRA 3O7MA 5ESXA 1U9YA 1I0IA 2H08A 4RAOA 1DQNA 2YZKA 3OHPA 1G9TA 1ECJA 1OROA 4QRIA 5JSQA 4KN6A 4Z1OA 1I0LA 2VFAA 3DAHA 3MBIA 1A95A 1ZN8A 4QYIB 4P83A 4RV4A 1L1RA 1NULA 1XTTA 4LZOA 4P82A 4RANA 2HCRA 2IGBA 4LYYA 1BD4A 4JITA 5HKLA 1CJBA 1XTVA 2H07A 2PRZA 3DEZA 4WMLA 2JKZA 1NONA 4P81A 3N2LA 1G2QA 3HVUA 4RADA 1UPUA 4PAWA 1QK3A 2EHJA 4RQAA 2XBUA 1STOA 1AO0A 3S5JA 1V9SA 5IAOA 1P19A 1O5OA 1QCDA 5IPFA 1U9ZA 4WN3A 1P17A 1ZN9A 4LZAA 4M0KA 4QYIA 1ECGA 2E55A 4MB6A 1I13A 5HIAA 1P18A 3GEPA 4P84A 4RQBA 1A96A 4P3KA 4RAQA 4LYGA 2DY0A 1G2PA 1HMPA 1JLRA 4RHTA 1XTUA 4S2UA 5E38A 2AEEA 1BD3A 1A3CA 5EUCA 1O57A 3LRTA 2FXVA 1QCCA 4RABA 1OREA 1DKUA 2WNSA 3LPNA 1W30A 5KAMA 1BZYA 1TC1A 3GGCA 3G6WA 5BQOA 3H83A 5KAPA 1YFZA 3ACCA 4JLSA 2GEBA 4RHXA 1QB7A 4RHYA 1G9SA 3QW4B 4FYMA 1XZ8A 1UPFA 1QK4A 1R3UA 1VDMA 4P86A 1DKRA 1ECFA 3EFHA 1J7JA 3ACDA 4LZNA 1ZN7A 4RHUA 1WD5A 3NAGA 1I14A 1P4AA 5K51A 3OZGA 4X44A 1ECCA 3OZFA 1PZMA 1I5EA 4PFQA 5BRNA 1VCHA 2JI4A 2JKYA 4RACA 1D6NA 1ECBA 1QB8A 3DMPA 4F8EA 4M0UA 1LH0A 1L1QA 3GGJA 4M0PA 2H06A 5BQPA 3KB8A 1DQPA 1TC2A 1HGXA 1XZNA 1DBRA 1A4XA 1Y0BA 5JV5A 1IBSA 5BSKA 1Z7GA 1MZVA 4X45A 1A97A 3M3HA 4IJQA 1QK5A 4TWBA 4OHCA 1GRVA 1VSTA 2PRYA 3ACBA 2JBHA 2P1ZA 5ESWA 1GPH1 4P80A 1A98A 1JLSA 2C4KA 1FSGA
chains in the Genus database with same CATH superfamily
1X7XA 1Y9AA 1BS9A 3F1KA 5IBPA 2GUWA 1QO7A 2QYSA 1JHMA 1U9YA 1JU9A 1ZH6A 3IDQA 1WB4A 3GPBA 4EFLA 1FDSA 1PS0A 1ECJA 3OIGA 2OO3A 4OMFG 4Q1EA 3QE4A 4XD7D 5AI5A 3LUGA 2PUCA 2A9KA 3ZCTA 3ZHSA 2H5JA 2WTNA 2VQDA 4IJUA 3PJDA 4OQPA 2E5FA 4FZRA 1EYZA 2BIFA 1F9EA 1ML3A 2IS6A 3FI0A 1P4SA 2AMVA 2R8XA 4C4RA 1R64A 2VHVA 5F1OA 1GPKA 4JV5B 5HKLA 3FLEA 1C7JA 4XGQA 2H7YA 3WAJA 1PW7A 4NMHA 4ZEOA 4MO2A 3VC3A 3BCSA 3T4EA 5LQKA 1UPUA 2JFUA 4HNGA 2B1IA 3QEAZ 3FBGA 5ED4A 1IN1A 4HD8A 2BM8A 2G0NA 3HHEA 4QOJA 3JYPA 1C4KA 1R8XA 4MP8A 3HV2A 3W1VA 4F2DA 3BTUA 2NSHA 1E0SA 3FNRA 1WE2A 2VDPB 4C0BA 5CFLA 4I5DA 2PUTA 2FSFA 3TIFA 5HIAA 2VJPA 3E0QA 2G36A 4FKMA 2Z2IA 3NS7A 5HW0A 2D00A 2HRZA 2VYCA 4QICA 3HCPA 3OPYI 5KYTA 2OVBA 1KVRA 3A1NA 2BEUB 1VE5A 1JA0A 1RLMA 2CLSA 4JLDA 4LSGA 1D0SA 1G8PA 3X2EA 5CEEA 3IT3A 5B1EA 3GDGA 5EP1A 5LYJA 3UJPA 3SE7A 1KU6A 1ZMBA 1JHPA 2QXTA 2YN2A 3HL4A 1OREA 1OX4A 4QODA 4QXMA 1T5TA 1KMIY 4PRZA 5HIMA 4LF7B 3R9WA 1Q3HA 2B1GA 4K2HA 3EIFA 3IJPA 2VHJA 5BQ3A 2D62A 2PLAA 3G6WA 4N7MA 2EDCA 2GYUA 4WL0A 1ZD4A 1ONBA 2V7VA 2YQZA 3UFBA 1Z88A 4R4JA 3ROMA 2BGNA 1EQ2A 1L5SA 4BQPA 4KR0A 1Z38A 3RIGA 3ID6C 4KYTA 5EE3A 3T0FA 4EHKA 4HT3B 2WEKA 2C78A 5C2JB 2AD5A 3HYCA 3BTOA 4U7GA 3BM5A 3OTHA 1WQ1R 2VP5A 4OGLA 5KQGA 1EGQA 5DWVA 4BWGA 4EY8A 3FF1A 1S9HA 2GYWA 3QVGA 1NVXQ 4FSHA 2ZBFA 1AJEA 3C8HA 3B8EA 3F6EX 4MV4A 2ZRHA 3IELA 2GFHA 4FWBA 5BSEA 3F46A 1UPXA 1PS8A 2I87A 2P9CA 3ZS9A 4W7SA 3T3OA 5BQ5A 1E69A 2JKYA 3LWZA 4GG1A 4JX8A 1MQSA 2YMPA 4RJKA 4EB6A 1QQBA 3NW9A 1V7QA 2ZSUA 3FKJA 5EJIA 3DHNA 3DWEX 5C8YF 3JR3A 4HL6A 3TPCA 1QHXA 1E2BA 4XJTA 1PFYA 1ZVMA 4TXLA 5KNBD 4PW0A 2MU1A 1C9DB 2C0QA 2O6LA 4GOKA 2M1ZA 4LYAA 4TQ9A 5J1TB 2H2IA 3A2NA 1QU2A 1WBDA 1VCMA 1IPEA 3PC7A 2HH9A 1U8TA 3T5AA 4JYCA 1DO0A 1WSWA 3E9MA 3F7MA 1DOZA 1T8UA 2J0VA 3L9XA 4O25A 2W6ZA 3HZHA 4JDPA 3KQLA 4ISCA 5IJ0A 1QANA 2RGXA 4GQIA 1Y1RA 1U2TA 4MRPA 1N2ZA 5ARCA 5CEFA 2CLKB 4S05A 5FR1A 4DIOA 1Z0UA 2AVDA 4R2IA 1GSIA 2WT9A 1V8PA 3IAUA 3LPDA 2LGJA 3S44A 2CNKA 1Q11A 1DTSA 4HMOA 4DDWA 4L4ZA 4JLAA 4BPBA 3ROPA 4MYCA 2YZ2A 4TRMA 2P2GA 2RD2A 4UXHA 4G0UA 3AJ9A 3K0HA 2PJUA 1FFEA 1PNRA 4OAPA 4QHSA 4NMMA 2B8EA 1PR5A 1Y1QA 4CMHA 5C3MA 1D1SA 3ROQA 3AUFA 1E89A 2ZDHA 4M6WA 3GJ7A 2A5JA 3HU5A 1YRLA 2ZJ4A 2HT1A 4C6HA 1NW4A 4C2UA 2YWEA 2G9NA 1RWPA 4UCFA 3OETA 3ZLUA 1JHUA 1L8LA 1VI2A 2CUNA 1EVLA 4ZXFA 1A5TA 1ZW1A 2ZT8A 2IHUA 4RMGA 1B6SA 2AF4C 3PRHA 4CQMD 1NNEA 2V7EA 4MR8A 4RADA 3HB9A 2IUUA 2RK6A 1XMIA 4ENWA 5CA1F 3KSAC 1E6UA 2C42A 3N7UA 4EA7A 2BH2A 2V6IA 2VJNA 3RS0A 4GSYA 2IEGA 1ONOA 5BOVA 1YQGA 4MUGA 4WECA 1IN7A 4EHLA 3UJAA 4BECA 3EA0A 4KDEA 1J22A 1HPLA 3P5SA 5HP4A 1B0UA 1YR1A 1QYVA 1VMKA 1NQVA 4FMCB 4QNMA 5SY6A 3S28A 2HW8A 3R2JA 5E7QA 5EE1A 3T7KA 1GSHA 1TK3A 4D98A 3R9KA 2GBFA 1KGSA 2EQBA 4W8GA 3LPMA 5E6SB 5KTPA 1KJQA 4AMVA 2WSYB 1K7XB 2C8JA 3IIJA 4DA4A 3JZAA 4Q9IA 5B3JA 4GVLA 3ZGXA 1I4EB 1T8PA 3ZNNA 2PX6A 3BG5A 3BBLA 4BNNA 2HZBA 4I4NA 3WGLA 1TM1E 4ZGWA 5A1JA 2DAPA 4YQZA 1TUEA 3K53A 4WRRA 4ZYXA 3WS7A 4QVGA 2A0YA 4YAWA 1A1SA 4Y2JA 4IM7A 3ZE1B 4JAVC 5BOSB 1GLVA 1H4VB 2GEBA 4KV9A 1UZLA 2WUDA 1G5HA 5K6RA 4YRBA 1SC1A 3H0EA 3Q0EA 3A6HA 3TCNA 1FY2A 1PKEA 4QJ5A 4JR2A 4C1NA 3WLAA 1M2VB 1Z3CA 1DC7A 3ED5A 3M5PA 3MS2A 3ZI0A 2CHVA 4NCBA 4Q3DA 2XRZA 3UHFA 3DCNA 3KSUA 4P5EA 3EJWA 4W1PA 4BFUA 2WTUA 2AFHE 1CY8A 3CRZA 1NPTO 5BRNA 5AM2A 2J9GA 1VRVA 5IXJA 1E4VA 5JYCA 4GM4A 1U0JA 2QN6A 1LUAA 4OHXA 1VPTA 2X5XA 4QLOA 4CG0A 2D3TA 1WA5A 4GS5A 1QGOA 4IIJF 5DHAA 3COVA 4XJSA 1L4EA 3KV1A 3NKVA 5KSWB 2O7QA 1D2EA 2NWQA 2ZTUA 1MAHA 3HA7A 3EXHA 3M4XA 3SHQA 3WLHA 4AU1A 1Z73A 1ZK2A 2J08A 5IYZA 4KAFA 4X1IA 1G6OA 1O94C 1SO8A 3HG7A 5CR9A 1CF2O 1UJCA 3V4LA 3ZBPA 1P6UA 1BOFA 1W4AA 1Y3IA 2P1ZA 3C43A 3FFXA 4QFMA 4D8VA 3EIUA 3C6ZA 4DT1B 2G63A 3AHEA 1SXJC 4PONA 4TTTS 1GRRA 4ZQEA 3KELA 3W5HA 1OVMA 4HB0A 3QH4A 4GOXA 1K4MA 3MTDA 4HGPA 3EUAA 3LC2O 5IAEA 2OORA 1LK5A 2P0AA 4RPGA 2JLCA 4Y9UA 4YRCA 2HF7A 5I7FA 3P8ZA 1CF4A 3G2LA 4NEGA 3D1VA 2YS7A 1ORRA 1RHKA 4ZO9A 2QUBA 4JOBA 4JP2A 3ZIUA 1TJ4A 1HO3A 2QWXA 2QR2A 2A9FA 4ZPXA 3SC2A 1JHRA 1G1MA 5DYNA 3RVPA 4DCNA 4M22A 4UPVA 1TEZA 1E6KA 3N86A 3ND7A 3RG8A 2DULA 2GSWA 2CDAA 4JYBA 2R79A 1ZUNA 5AVKA 4MAFA 2BFEB 3FBWA 1RACA 5IHXA 4BX8A 1ZH4A 2XD4A 4FEEA 5F7JA 1W47A 4ES6A 4MR9A 1LBQA 2WSIA 3B5EA 4PU0A 4Z53A 2P91A 2WFMA 3ZWYA 4F1WA 4BGEA 1VIMA 1BW9B 3DHEA 2W6PA 1WCYA 4JVNA 2GPAA 3NC4A 4R9NA 5FOUA 5FOXA 3W04A 4P4SA 4PGMA 2QAGC 3FNIA 4XWKA 1L8XA 1A96A 3OPXA 1Z4NA 5H7XA 4M46A 1UL1X 5U4QA 3M1LA 4DLRA 5DCLA 5E1BA 5B58C 3LQ2A 4AZ3B 4D9MA 3MPUA 3USES 3VPAA 2NADA 1E9AA 3LM8A 4K9OA 3NIFB 2W2VA 4XJXA 4ZAYA 5IBQA 4ZN6A 1R6XA 3BMQB 1FS4A 4ZVQA 5IKOA 1OXSC 1IOWA 1Z0KA 3RFTA 3IJEB 2VDOB 3K09A 3L1KA 1PJ3A 1FQOA 3Q1LA 3ZLTA 4LXGA 3T15A 4Z3DA 1MVOA 3EGDB 3LAWA 3Q7RA 3C6BA 4RHYA 4TS4A 1EG7A 2CNOA 4IMPA 5FYDA 1O5IA 3WRXA 4H3HB 2OHJA 1PGNA 1OLXA 2ZBDA 2XUPA 2J5RA 2O2GA 3U3ZA 4X7PA 4BYMA 2H1SA 2NO7A 3CEAA 3TD6A 5B4UA 1KJWA 1H3NA 2BMVA 4JOQA 1P3DA 4CLDA 4CZ2A 3W5CA 1NRIA 5C1BA 5M29A 3WLTA 2HNBA 3RGGA 1MD9A 1GUBA 2PGJA 3VNSA 1XRSB 4MJ3A 3GLSA 4XDGA 5FOQA 1FNMA 5CNKA 3H5WA 5FCDA 3MGGA 4AF7A 3U0BA 5F73A 5EWLA 3FVRA 4YCCA 4BP8A 4G0VA 1QB8A 1U3WA 2G40A 2WSMA 3AHHA 4RX1A 3V9AA 1NUAA 1SD5A 5EXTA 5KYGA 3O1JC 1JAYA 2UYQA 3KEFA 1KYIA 2P79A 4PRYA 1NM5A 4ADSG 4DR1B 1X9GA 3TW8B 3DEFA 2DPXA 3D5TA 3Q9LA 1MZVA 1RRPA 1A97A 3E03A 3ZU2A 5LQRA 2AQKA 3CW2A 3TTYA 3I4LA 4DA9A 2BPOA 3O2SB 4XLZA 4IIXA 3TQQA 4UC0A 1BE1A 4JT4A 5LP6B 5L7TA 5MFZA 1J00A 2ZVJA 2I6TA 2J07A 1VMIA 4D9CA 2QVBA 4BO9A 1A72A 3U7HB 1H4SA 1E3WA 2VKTA 3QBDA 2P9YA 2OUKA 4G63A 5DHSA 4B5KA 2FSHA 3A58B 4HWPA 4Q9AA 4U6QA 2KX7A 5ESXA 5JMTA 3DMHA 1MHPA 3TECE 1U0FA 3LTNC 1VLZA 4FBGA 4QOIA 4MW2A 4FYYA 4AWAA 2HHLA 2X1LA 1X9IA 5LYYA 2O3RA 2L2QA 4QTXA 3M3PA 2VZLA 3LCVB 4CCWA 3VNQA 4UEJA 4V38A 3ITDA 3LVQE 3LUCA 4TMVA 2V45A 4LKOA 3D4BA 2OSVA 5E9WA 4F6RB 9GPBA 1Q22A 1WBBA 3MJ4A 3VO1A 2OBFA 4NCNA 4JUIA 4KZPA 5P21A 4PQGA 2JKZA 3BAZA 4CLRB 4D8TA 2AG0A 1KSHA 1AVTA 4GOMD 1L4BA 4TSRA 5HFJA 1X39A 2VA8A 3S68A 1VHLA 4WUTA 4ZAVA 4ERXA 721PA 5BURA 4NAUA 2HU5A 4FN4A 1U3UA 5ILQA 3CNOA 3D2BA 4CT0A 4QJ4A 4F21A 2GR9A 2PA0A 4PZEA 1E9EA 4MLPA 1W93A 1G98A 4GLJA 5F2OA 4PX9A 3UW3A 3QBEA 2FPOA 5B3JC 2IHTA 4EBFA 4IDNA 1BHSA 1XAHA 5HRAA 2PAAA 3V4ZA 1YB2A 3BE8A 4JJAA 4EGQA 3UICA 1RIFA 2BM9A 2CY0A 3KQYA 1FFAA 3CLRD 1V5GA 4KW7A 2FW9A 2WJWA 4N3CA 2O14A 4TZKA 3DZKA 1AY0A 5ALOA 1V37A 2EFGA 2CE7A 5EOVA 3GHYA 3QVLA 4D4LA 3KQHA 1IUNA 4L72A 1Y1KE 1FYWA 5DWQA 1FMFA 3SJAA 1K3UB 3LCRA 3V32A 2N46A 1XWWA 2IGTA 3I2HA 3MD0A 2ZWPA 2D5LA 1E6MA 5DRTA 3VSBA 2AEJA 3ROXA 2CE2X 3PD0A 4KR9A 3NPAA 1M72A 1YRWA 3M1IA 1FUUA 1OYWA 3EVCA 4G26A 3I39X 4MVJE 1AKTA 2BHRA 2XUGA 5C5EA 5CBPA 3TLYA 1FB5A 3GVCA 3KDAA 4MA5A 4OJNA 2WRZA 3KLPX 3NORA 2PHZA 2ZUTA 3TSZA 3WGOA 4RIHA 4BUJA 4AKSA 4F4CA 4JXKA 2WKRA 3IKMB 4QU8A 1PT5A 2PH7A 1WU8A 8ADHA 1SZCA 3OBBA 4P3NA 2ORED 4MVJP 5JANA 4ATNA 2VG8A 3D6VA 3DBLB 1RBMA 1MLDA 3LLCA 4MJ7A 4WOKA 5AM0A 4L27A 2VSFA 1RWMA 2QQ0A 3C97A 3A06A 4P35A 4Q9DA 5E0OA 4CF5A 5AW8A 4BLWA 1FXUA 4KYUA 2TMGA 1VCHA 2Q5JA 3GAMA 5B2FA 1GQRA 1SUDA 3QOWA 2WK1A 3UMSA 4CCAA 3TTTA 5M34A 2PJZA 1QOPB 3EVFA 1XCPA 1GJRA 3BF8A 4R71A 4GDFA 2O57A 1XMQB 5EVJA 1VJRA 5BQPA 1AK1A 1XRJA 2O2IA 2PEZA 4UZFA 1SC3A 3NAQA 1E3DA 4CEJA 1OMOA 4BFLA 2G08A 1U6JA 2EGUA 2VRCA 3CG0A 4FTWA 3TE7A 1USIA 1FSSA 4ZZ3A 3OMXA 4C43A 1USWA 1EFVB 3U60B 1UODA 4FK8A 2C2KA 4I1YA 1YC2A 5LOVF 3MUEA 5AIAA 5E1MA 3U7FB 2C92A 1SBZA 1QFJA 3QX7A 2R7KA 4UHFA 4CRWB 5L4SA 2NNWB 1XO1A 2PQ0A 4I6GA 4DMUB 4U7JA 4F4JA 1YT5A 5JECA 2QAGA 2J8ZA 3ZWKA 1WKBA 1QAQA 2AXEA 2OY0A 1SKMA 3NIBA 1IOVA 2I29A 1XAGA 4I99A 3RAFC 1JE1A 4KQHA 1F2UA 1A9QA 4M7OA 4WLEA 3UJCA 2WKQA 2OAEA 5BXQC 4BO4A 4WZAA 1CR2A 3FVWA 3K35A 1L1EA 2F62A 4GRDA 3F73A 3ROZA 4B75A 1L0BA 4QNRA 2X8JA 1B23P 3HR7A 2PPLA 4P82A 1N4AA 4D97A 1MR3F 3FOWA 2A9PA 2NUTB 4ND7A 4NR0A 3T3MB 3M9WA 3CEJA 1EFVA 2Q9CA 2CB9A 4RVOA 2KSQA 4UHHA 3O8NA 4WLFA 5EFZA 3AFGA 1X80A 1T8RA 1ZXBA 5IN4A 3QNMA 3EZ7A 3RS8A 4CWAA 3A4VA 1WY5A 4MV6A 4KWIA 5K3FA 3AR8A 1XKTA 3H11A 1JIUA 4JEUA 1L5FA 3E8MA 4I3HA 2NPOA 2CBGA 3T12A 1Z5ZA 3SBOA 4UU8A 1UZMA 3AI2A 1CUDA 4JI0B 3VR5D 4HS9A 5FBZA 3ZU3A 3F49S 1OFTA 1RLOA 3RVSA 2Z9CA 4ZT2A 3ZE0B 4Y2TA 3U13A 2I8AA 3LV8A 2HLNA 1QR6A 5J5AA 1CWUA 4O02B 2VK1A 3MOIA 1MC1A 3B13B 3PHIA 4P33A 5L51A 5MGNA 2V3CC 4IWXA 4I36A 4ZQGA 4JVLA 2AI3A 2XNDD 1KFEB 4KYVA 3TOSA 1M1YE 4NZPA 1QCZA 2QV0A 5C1DA 3KS9A 2G72A 5IZCA 2IYPA 1SR8A 1Z5PA 1QAOA 4XIGS 2ALJA 2K5UA 4AWXA 1E3SA 5GZ1A 2G83A 3FDZB 5DN6A 4A15A 5ELMA 4HX5A 2NTEA 2AN3A 4Y7CA 5HIKA 3IYLW 3FYDA 2ZK7A 4P7GA 2XDWA 3LXMA 5L3QB 4Q9NA 5AVQA 2Y0PA 5LQDA 3H13A 1GYRA 3WYAA 4UTNA 3N87A 4C01A 5JTUA 1YR2A 8AT1A 2ZTVA 3AHFA 2G77B 5D8DA 1P2VA 4MMXB 2W8BB 2GZ3A 2JFWA 3GJSA 1RKVA 3ORRA 3ZNQA 4YLEA 4W1SA 1KU0A 1Q0UA 1HQYE 2C5SA 3GDFA 1SHLA 2IC5A 2JFVA 4RA6A 1E7MA 2B6NA 2R87A 3R75A 3WBBA 5HJ7A 3SX2A 4PZAA 2WP8J 1SUAA 3TDMA 4D02A 1Z5UA 3JVDA 5AM4A 4EABA 4XIFA 1TA4A 1G60A 3ON5A 3ADPA 2VDRB 1NN1A 4J0KA 3TRFA 1MOSA 4J4TA 2X3UA 4RV9A 4LMRA 4D3XA 3HDYA 3K31A 1P9NA 2PLFA 4E1VA 4L6IA 3MUFA 2Y27A 4KRXA 2BR3A 4KX5A 3W90A 4QTZA 5IT4A 2NU6B 4ZYWA 2XSZD 3PDWA 5CRIA 1HNNA 3HRHA 1KIAA 4Z0HO 3CE9A 4ENTA 2PTHA 3NCHA 4Q9KA 4CL3A 1MXFA 3V80A 1QU3A 3EUEA 1XL0A 4EMSA 3U2QA 3D4LA 3UMYA 3B20A 4U2CA 1QPZA 2WIGA 3ACBA 1UM9A 3E1GA 1PDOA 2GVNA 1NW5A 4XR9A 1SC9A 2WJVA 1AGPA 2Z3VA 1QV9A 5T8KA 5AQ1A 4WVFA 2AZXA 5LU9A 1UZAA 4J0EA 4KBGA 3HKEB 4M8KA 4ND3A 1IN6A 4IQ4A 4WT7A 2GKSA 1A4RA 3OMLA 3ICPA 3WGMA 1IRIA 4MV9A 3KYBA 3OCZA 1M1YA 5T3UA 3TQIA 1JDJA 2QRQA 2Y92A 1CRLA 4NENA 5KYXB 3J80A 3DAHA 1UAAA 1QIMA 2P2DA 4ML3A 1EBBA 2QMQA 4A0RA 1IHYA 2VOJA 1L7VC 1NBMA 2F43A 4ZVVA 2WSSD 1ZI6A 5DK4A 4JJIA 3I6IA 5DO9A 3ZI7A 1XVIA 2JK0A 4D3ZA 4HAWA 1N3IA 1R4ZA 3BIXA 3EF1A 3CB4A 1F20A 4TKZA 3AG5A 4JOSA 3SFZA 1FU8A 3QEMA 3UATA 4MKIA 1XXLA 1YONA 3E15A 1LC0A 1LJLA 3IO5A 4G4IA 2VF8A 4R2LA 4Z7NB 5K2OA 3K9WA 4MKRA 4RZ2A 1STOA 4B7AA 1XTIA 5CHEA 1Y7HA 1V35A 1EGVB 1EE2A 3UWMA 4CM1A 2JDID 3LP8A 4IGKA 3RDPA 2GEFA 2EW8A 1LW7A 1OAKA 2XQGA 1JDUA 2AN9A 4KUHA 2A5FA 3DFUA 4CQLA 2W00A 4CIVA 5CFNA 4HQNA 3W0LB 2AFIA 3TRJA 2H51A 2Q9BA 2GCNA 2C9DA 2XMDA 4P3KA 3I2IA 3W7BA 4RTJA 3TOZA 1YMQA 4KFRA 2IOQA 2P62A 4HLNA 3WGTA 2BGRA 1LQ2A 4RLFA 2CYCA 5FJJA 1C5KA 3GDOA 3RSCA 1SU6A 4QEDA 3GCZA 3P26A 1GVHA 2KMLA 4AYTA 1ZU5A 2IYUA 3QEMB 1MV8A 4BNYA 4CKCB 1A9XA 1RHJA 1YIDA 2VPZA 3EBOA 4MS3B 1YTLA 2EP8A 4AZ0A 4EG4A 5CH3A 3FNQA 3GF4A 3FDXA 3JQBC 2IYTA 1NXQA 3BJRA 4MPDA 4GPEA 1H9CA 2BEWB 1YL6A 3CUEF 1WULS 4G5GA 2HB6A 4Q3EA 1S3IA 2ZS8A 4GM1A 2XIQA 4H1UA 3TJRA 4BRZA 2IZ6A 1DQZA 3QM1A 4NJEA 3AR6A 1LCIA 2GHIA 4LUCA 4GGPA 4XWWA 4RVHA 4BLVA 2VH2A 3NOVA 4NFSA 1KO7A 4YP9A 1CLUA 1YI8A 2FE1A 4OHUA 1DAGA 2QM3A 3TF5A 4AJHA 1VG1A 1P5RA 3ZDEA 3N5CA 1O8BA 4KL8S 1SULA 4WUVA 1XOIA 3I52A 3BE4A 1BVHA 5CVVA 3L06A 4G1FA 1QQTA 4PBTA 1KR2A 4W9RA 1AQYA 1LNQA 2GDZA 3PZRA 5F1YA 3C3JA 3EWNA 3R5HA 3RFVA 3ENZA 3EVZA 2ZIAA 3MMPA 3RGWS 2HXGA 4C20A 3OLZA 4QIHA 1BKSB 1POXA 1XZFA 3WV5A 3UOGA 1CZLA 1ZW6A 3RC1A 3T1HB 3VUEA 3GJ0A 1R0SA 3LK6A 2Z0MA 4WEOA 4Q24A 1VGRA 1E2FA 3RVBA 1YZ3A 1TC2A 1EUYA 1HYEA 3SXJA 3IPXA 4BNGA 3KQOA 2QLNA 4MDHA 4GQBA 5KNLA 1N6LA 3K6SA 4R40A 2VJBA 3E3AA 1E2NA 1VB3A 4J0QA 5TEVA 5CCXA 4BNKA 5DXAA 1LX7A 3RBZA 3IT0A 2OL4A 3AJEA 4HZUA 1SC6A 2WYVA 1M5TA 2DB3A 1HEUA 2PL3A 3IBGA 4Y3UA 2A2ZA 4P3PA 1WCIB 3AI1A 4D5EA 4D3YA 1N9ZA 1GY8A 4XVHA 5H70A 5DGCA 1SEPA 5D3KA 1UFKA 2DQYA 4BMZA 1I1NA 1GL9B 5FPKA 5BRJA 2Q0XA 4L85A 4FDMA 4S12A 3KWFA 1ULZA 3FDZA 3PRKE 1MZPA 4PG6A 3MELA 5K0BA 4QGFA 2W0MA 1ZRSA 3L18A 4RZUA 3DVQX 4L8YA 4EGSA 1SQGA 1W8IA 2JFBA 421PA 4A2QA 2XDAA 3DSRA 3GELA 3NX4A 1BS1A 1J8VA 2QPAA 1WHTA 3JU3A 3OF3A 2JLUA 4LFAB 4ZAZA 4W5WA 2QRLA 2CLLB 3OT1A 3TUZC 1AG9A 3EH2A 3HKCA 4DWVA 3MT9A 2H18A 1UT5A 3ZGYA 2ZGVA 1BU8A 1ONPA 2H4FA 4XLTA 1KEUA 3SZGA 4YUXA 4YLGA 1WZNA 2VT7A 4FDUA 1GCUA 2H63A 2YUTA 3BVPA 1KQOA 2ZB4A 2WDZA 1PBNA 3D7SA 1PWZA 1CQWA 2WU1A 4GX5A 2HV8A 4X84A 4QJ3A 2VTEA 1SVIA 2AYZA 5AKHA 2GPWA 3F8TA 3A4NA 3WGUA 4CEHA 3OCUA 2GN9A 4JBNA 4Q3NA 3WNBA 3ZJTA 2F1HA 1W0JA 3E3OA 4TL8A 2NT4A 1SWWA 3BFKA 1S4MA 1NUUA 4HQ0A 3FJOA 1N5MA 3BD9A 5J3JA 4RABA 3ZWQA 4UBMA 4ZKEA 3ESAA 2FDRA 4R9VA 1FYXA 3OOEA 1FUKA 1P0PA 2APJA 4CM4B 5BOSA 1L4FA 4CEIA 5K0SA 3P4YA 4ZYLA 3TXAA 3U40A 3B82A 1TECE 3EAQA 1H6DA 3C6YA 4ERNA 1GPLA 4DV5B 1RHRA 1KVUA 4X66B 2X9LA 5AKYA 1B7GO 1H9AA 3AUYA 3D8HA 3G1UA 2WKWA 3EZXA 3TDKA 4TZTA 1HC7A 2GBPA 1JAZA 3IPRA 4OXNA 4BUCA 1D2RA 2WHYA 4RVGA 4E21A 5T7BA 3DZ8A 4YMIA 5COBA 3ZZMA 1P6XA 5H80A 5IULC 1VXOA 1WF3A 2OV1A 2BR4A 1V16A 2GARA 4IIYA 2ERYA 2RONA 2J67A 2ZIXB 3VYTB 4GMGA 3JWIA 2X3YA 7YASA 5AVUA 1ZA2A 4KWEA 2I3BA 1I24A 3HA2A 4A5SA 1ZNXA 1BMFA 3SKVA 2DWUA 3WV4A 1ZMXA 4E5UA 3RD5A 4KQ2A 1XNQB 2DQSA 1OGYA 3I9FA 2O05A 2GZAA 5A3SA 3SMQA 5CFOA 3R40A 4OH1A 3MOSA 4KK3A 3TG8A 1HLGA 1U28A 3QYAA 4UZEA 4C07A 2HQ1A 3G1WA 3EPKA 3N6XA 1CKEA 4TLAA 1EQAA 3LY9A 2ONJA 1TL7C 2PLNA 4OV6B 4ZZ0A 1U4SA 3DBIA 5AHOA 5K3OA 4D6YA 4TWBA 2EHDA 2V9ZA 3T5PA 4EWLA 4G0OA 3WTCA 1YZUA 3GYGA 3MFQA 3NEYA 4JVOA 1FUYB 4FCCA 4WOJA 4LNUB 5KWIA 1EINA 2IYAA 3P32A 4LZJA 3OWHA 2DFDA 3RK1A 5U4XA 1FJXA 1GV0A 1KAOA 4A2PA 3DB2A 3A9UA 3NBAA 2Q4BA 3ZI4A 2RIPA 4FGZA 5ITWA 1GSOA 5KYWB 1KJZA 3GEIA 5E1OA 5D01A 5D7NA 1CG6A 4O0MA 1P8AA 2BEKA 5L7YA 2Q2QA 2ZJ8A 4Y2XA 1AC5A 1J0XO 3ZJVA 1TYAE 2WD7A 5H4GA 1E63A 2R60A 1QP0A 1EFKA 3V9PA 2YFKA 1J2RA 2Z3ZA 3GA7A 4UUBA 3S2IA 4JLPA 3E5RA 4CIDA 1EFUA 3HXMA 2PQ2A 3RU9A 2EIXA 3HFSA 4TKLA 4H1HA 3ZHZA 1Y5IA 3UMGA 5GGXA 2EDAA 3HC7A 3DC2A 3KSRA 4LF9B 1N5RA 1DXQA 1WVMA 4X92A 2DHQA 3INNA 4BXOB 3L8GA 3CNLA 4PQFA 4DDHA 3PJFA 4JROA 4XPZA 3TVYA 1Z2DA 2BI8A 4AVYA 2W70A 2COUA 1PJLA 4NCHA 3U0VA 1M66A 3W6ZA 1KK0A 4GUAA 1QP4A 2C7QA 4MUKA 4WESA 1OJLA 3STHA 5SZKB 4XYLA 4MW7A 3WTBA 2OCBA 3C8MA 3I45A 1L7NA 1RPNA 2CC2A 3QLTA 4AZTA 4BLPA 3EDRA 1W5EA 2P0EA 2RB5A 1EVZA 4OUDA 1U1FA 1HDYA 3NT5A 2H1OA 3L02A 3NHRA 4UOQA 1LDMA 1J8MF 3PL5A 4A8TA 3OCYA 2EFJA 1VJ1A 4I8IA 3FPLA 3E3NA 2JCSA 1DRJA 1PZXA 4RMIA 4QVKA 2OYSA 2AOTA 1PTJC 5AH0A 1EFLA 4J3NA 221PA 4F6RA 1U0SY 2FX2A 3MAJA 3BQMB 3UW1A 4B2PA 1LZKA 1UBCA 4HWRA 4AF6A 3GQBB 4PGGA 3LHSA 2VTDA 2WPDD 4AJKA 4C78A 4X62B 3EVBA 1UJMA 2DECA 2P4EA 3LBAA 1Y1PA 4O4LF 4XGIA 3STVA 3T3HA 1M0TA 2VDLB 4FT4A 1S2IA 1I7PA 4TN5A 4EY4A 1DGQA 1B8OA 4BGIA 1YF3A 1GFZA 1CD5A 5AMXA 4DC0A 1J7KA 4MQLA 1WMFA 3BHMA 4DMRA 1FMLA 1GN9A 2HJHA 4B46A 1YQ9A 2I3AA 4M88A 3VR5A 5ADUS 5H1YA 1H2AS 1PFUA 4B8YA 1HM5A 1GA1A 3LL7A 4Q21A 4ZDWA 3WYBA 3I04A 3ICEA 4TTAA 3BREA 3EQ9A 4NBSA 4CCSA 4I50B 2V9PA 1Z29A 2FYTA 1XZAA 4XQCA 1I5OA 3QLVC 1YFLA 4OPMA 1J25A 2GM9A 4UOZA 4WBSA 3ERCA 3E5MA 1GZ4A 4GBED 3VI4B 4JBIA 2N0SA 4KO1S 4C2BA 1PT6A 4DBLC 4EI2A 1WUIS 4POAA 4E15A 1RLUA 3I09A 3DYBA 4OMCA 5BRAA 3VSCA 1GQ2A 3T5MA 2PT5A 3SM9A 2VR1A 1NRJB 1GSAA 1JDNA 3NATA 4E5VA 1UJ6A 2W43A 2ZZNA 1GNLA 1L5VA 1P7PA 1N2XA 4PVCA 1IK4A 1I1OA 5EN4A 1IEVA 1LJUA 3D6MA 5FWXB 1D6MA 1Z4IA 2JBHA 3IRVA 4JC4A 4QUGA 5FWDA 1J5EB 2FJ0A 2VHEA 2E21A 4LJ7A 5CH8A 4P80A 3OX1A 1D2HA 2JEYA 1BX3A 3FCEA 4GC9A 2PBRA 4G24A 2AFIE 1RRGA 2V59A 2WUVA 4L8VA 1E59A 1TCCA 1JTVA 2RHBA 2YXEA 4JHLA 5IJ9B 1U0TA 3WL8A 2YIDA 4DIDA 1UFVA 1Y48E 2H11A 5KDDA 4B6GA 2IOFK 1L5ZA 1WNTA 1E2GA 2Y1FA 2EJVA 3A26A 3JD0A 5A7FA 1KY3A 1AB5A 3OLWA 4F92B 3VKFA 4UXIA 1G55A 5I01A 2IY8A 3VJRA 4EI8A 2VT6A 4EW1A 2BRUC 3DV0A 1KDTA 5JPCA 1P1BA 5BQFA 1BCRA 1NWCA 2YY6A 3IHTA 5DBIA 5I9MA 1KDVA 5L4NA 1CRWG 1KMNA 3DEZA 1P1JA 3CFYA 2WA1A 3GUVA 2H5IA 1CY0A 2HL6A 3KU4A 2REQB 3N2LA 1UQRA 1YQWA 2P2YA 2PIDA 2CJXA 3ZX4A 2QNRA 5JNWA 3UG6A 4BZXA 1J8YF 1B42A 2WYIA 2W11A 2CXTA 2GYVA 3E6AA 1KO8A 3WNZA 4DKJA 1ZH0A 2G0TA 4U6NA 2GHTA 1BXGA 3HCWA 2CHEA 4OQNA 5CDFE 3DG9A 4BN4A 5LZ7A 4PFKA 3TS1A 4DMKA 2QL7A 2SCUB 2Q6IA 1T6XA 1EK5A 4ZCSA 4N0DA 3M1AA 2ZWOA 1JEQA 1KK3A 3OTQA 2QMZA 4Y0NA 4DTIA 2C07A 1B14A 1JHOA 4LXYA 1T91A 4U7PB 1SVSA 3IIKA 3O0DA 3TZCA 4RAQA 2NU7A 2XTAA 4GYJA 3CKKA 2C8KA 4LDAA 4Q9JA 1SPXA 3D4OA 5K3CA 2ZATA 4N48A 3CZ5A 4CF4A 4RY2A 3X3HA 2YDXA 2CXNA 3EODA 1RCFA 3OQNA 4B34A 2PK3A 5DT9A 4P7JA 1JBQA 1I7NA 3PGA1 4IHKA 3V46A 2Z98A 2BGLA 1FK8A 1ZSNA 3M6IA 5K3FB 3A27A 4Y9SA 3X1MA 4E03A 1K8XB 3JQRA 5IAGA 1JR3A 1LSUA 3NJRA 3AHJA 3UK2A 3W6UA 3QEOA 4EUKA 2BI4A 4TLMB 1VKZA 2NUTA 2XOEA 4D4MA 2OV2A 3GXBA 3CF4A 1GGMA 1W2HA 4LQDA 5LQSA 2PYZA 3NXKA 5EMHA 3A1VA 3ITKA 1Q83A 1KRWA 2IDJA 4YAJA 2XZTA 4KQWA 2RMKA 4WFKA 5J5VA 3L7DA 4CI0B 3QU2A 1I4TD 1EK1A 3VO8A 3GWZA 5EPOA 2OXCA 3TFOA 2ZM6B 4MGYR 5ALKA 1D7OA 1KMMA 1G7CA 3WGKA 1SXQA 1YVPA 5DYGA 2QYOA 1CUIA 1GDHA 1CV2A 4IUBS 3RWOA 1RFLA 2PZFA 5A1TA 2UZ3A 2BTQA 1X8LA 3MJSA 4GGMX 1CYEA 1M73E 3F6PA 1UXHA 1XQXA 4RACA 3Q15C 1EK2A 1HF3A 2JGKA 2Q6VA 3E1SA 1WNFA 4LZZA 1VSUA 4C4ZA 4M0UA 2P9TA 1OZAA 1IK6A 1OH5A 4INOA 1XQYA 3PL1A 1OFGA 3NWEA 1H4QA 1DWUA 3CVYA 4CEJB 2PRSA 2VJDA 2E4ZA 2YQ4A 4TSFA 4G41A 1A2KC 3CUTA 1PNQA 1EX9A 1B0PA 4O59O 5BNIA 4ZD6A 1E5LA 3AJDA 1Y8QA 3P9IA 3KXIA 1B15A 7ADHA 3KT0A 3QTBA 4Q48A 5HE9A 1CUJA 2ETXA 3EWIA 4HEA1 2VCEA 5ECYA 5FT9A 4E7PA 1L5KA 2NXWA 3SR4A 2KW5A 5K8UA 5H3LA 2BFAA 1J1IA 4JXXA 3BAFA 3CSUA 2WJ4A 3KT6A 3IUSA 5ALHA 3VGJA 2GMWA 4S2EA 3I2JA 2YXLA 5A9SB 1T3SA 5F4BA 2PL9A 2C2BA 4F56A 2Q6LA 3L4JA 4ARCA 5FNVA 2ZIZA 2JNWA 5A7GA 1K1EA 5I7HA 5AI4A 2OR3A 3SZ3A 3H8JA 4B3BA 5AHKA 3AT1A 4EITA 1ODJA 4MI6A 1CUZA 3MGAA 4FCWA 1ZJYA 3E22A 4CV2A 4ZHQB 4UATA 5GIPE 3ANNA 5TX7A 1JVNA 1L4NA 3W3AA 6ADHA 1PZNA 2HJ9A 5E9AA 2VHWA 2Q29A 3FWNA 4G97A 1XZBA 4GZ3A 5C1IA 5THXA 5BWLA 1VA4A 2BTOA 4IIJB 3RRZA 4DIFA 4QM7A 1Q7EA 4OK3A 4UMEA 3SS8A 3U48A 1UC9A 5JRDS 4EZEA 3WLJA 1J56A 4PO1A 4EJFA 3THXB 3K1TA 3BIWA 4I9FA 4LFBB 1UBEA 4N7JA 5LWHA 1VG0B 4BNIA 4PLZA 5I9IA 3IQGX 4RFSB 4OQDA 3VTKA 2CUKA 4GI1A 4JHXA 4XGRA 4BJ1A 3CGGA 1OILA 2IA5A 1N92A 2ID9A 3MT0A 1MNAA 5I4BA 3G7UA 3MS7A 2EW2A 3OY2A 1M74A 3GUUA 3H2ZA 3MMSA 5IAJA 2P67A 3U4CA 1WZIA 2FUNB 1ZCJA 4QXQA 1U2GC 1K6IA 1XRRA 2DUWA 3VSEA 1U8FO 3IIIA 1U5BA 2CV1A 3VR6A 2XT9A 3GFPA 2XW6A 3G2PA 4P32A 2CL6X 2FMXA 2XOXA 3MCTA 2TMDA 1ZK0A 4R8KA 2WIKA 3KQSA 3H6KA 2J3QA 3EGCA 4X3PA 1DIGA 3PEFA 1XZGA 2ZRFA 5FF9A 1U7HA 2UU9B 4F1JA 3DUFB 3PNLA 3WLFA 1FJ2A 1A27A 5BN4B 3FGPA 4XRRA 1G2IA 4ARVA 2HMYB 2FUCA 5A9SA 3SHVA 3VH3A 1KBZA 4IFTA 5DYTA 5HZGA 2VNHA 1X1BA 1YDMA 1LFDB 3FWZA 2P65A 1WZEA 4EHAA 4EB8A 1FMTA 1VKJA 2VDWB 4G8BA 5A62A 3LK7A 3IKJA 2GXUA 3B5IA 3ONFA 1PZMA 3DV0B 3N2KB 4G1MB 3ONWA 5DSTA 1S01A 4B2YA 4JKYA 4TWRA 4INJA 3PX7A 5IN5A 1E32A 5CB8A 3MWDB 1B74A 1Y4AE 3EVDA 1Y8QB 3HNRA 3EAGA 1H2XA 4Q3BA 3DL4A 1C4XA 2X2FA 2HYIC 3L9WA 1L5QA 3UWSA 4LOLA 2C5FA 5KU1A 3D0OA 3GOQA 1OV6A 4KXQA 4NAHA 2WWVD 1RADA 3IA2A 1DIOB 1FYVA 4HAZA 4QU9A 4FCVA 4BNTA 2VJMA 3M1YA 2H8GA 1ULHA 4AY3A 2GK6A 3DVAA 2C98A 4H0NA 1M2NA 1TNDA 2XGJA 4DCMA 1YU9A 4WINA 4R98A 3ZPXA 3BHIA 2BZGA 3IH5A 4D8YA 2LRHA 5TB5A 3DBHA 2TMYA 3OFSA 1DP4A 2JBAA 5TJHA 2PWYA 2VAWA 2VPXA 3B7PA 4Q6WA 4RD4A 1QS0B 3AFIA 2YMMA 4US0R 3HI4A 1IY1A 3C6MA 4PHGA 1TIBA 1E3JA 2J9FA 2O6HA 3QE0A 1E1MA 1A8QA 4ZZ1A 1R6DA 1NSFA 4AX8A 4JGBA 1KAHA 3I5MA 5BSMA 1VSBA 3DL2A 3VBEA 5J4YA 3H86A 3R0ZA 1FX1A 2G9VA 1Y82A 2C1EA 2C7BA 5CNIA 1E1CA 1NTOA 2B5VA 3DTTA 3EDMA 4IDPA 1PG0A 3RTGA 3WZ2A 4B6OA 3QVOA 3ZYCA 1LTKA 3GJXC 2W22A 2B4QA 3MQ4A 3CVXA 1VL6A 4AJPA 1PBTA 3S1LA 3OEEA 5IKPA 2FY8A 4XJVA 5IKEA 3BHNA 1VLVA 3D6AA 2OCYC 3VH2A 5ECGC 5JALA 1T5IA 2JLYA 5DMXA 5HZMA 3MTJA 1DXOA 3HO8A 4KCGA 3DL7A 1PR9A 3JQPA 1R8QA 1YK1A 2XYPA 2A58A 1FDUA 1QHIA 1CY6A 1XYVA 2B2CA 3FIUA 4DHEA 1X1RA 1Z8DA 4EG3A 4F85A 3ZW8A 3KPJA 1HMPA 2XCSB 3RRFA 4BNVA 3D0RA 4B09A 3UHPA 3V8EA 3JAMA 1KA9H 1J0EA 5EXPA 3U26A 3I61A 3UUGA 1BD3A 1A3CA 2H1CA 4MZDA 3GQVA 3BA6A 4D26A 2VC2B 2LTAA 3OO0A 2C58A 2QN3A 3WOVA 2YDYA 1DJLA 2FR1A 2W2LD 3BX1A 3KBBA 3WO1A 3GGCA 3KYJB 4EVIA 1GT6A 1AT1A 3NAZA 3U9LA 3BERA 16PKA 1NP6A 1EBUA 5F64A 2OOKA 4YRSA 3QW4B 3WGJA 1LDYA 2X22A 1F2TB 3ADKA 1PWXA 2RAPA 4XQ9A 5DHRA 4QXAA 3OEWA 5SYAA 3KTAB 4RYDA 4IEIA 4OD0A 4Q7EA 3N2EA 1QHGA 3NP7A 2X40A 4NDAA 3PKZA 2G1UA 2QP4A 4KDCA 2B94A 2QYHA 3P27A 3PE3A 4DLLA 1OLUB 3B1KA 4R9UC 2PT7A 1BEUB 1CJCA 1EPUA 4JQYA 2CLMB 3LS2A 5KWEA 1VYHA 4TZ0A 1T1RA 5AOBA 2OKGA 1LW6E 4MRSA 4K3VA 5JH7A 4E3ZA 2NPFA 3Q3CA 4LCJA 1UKBA 1U99A 4F8EA 2B99A 2I8LA 2HLDA 2RG1A 3B6JA 3FZGA 1MH9A 1G64A 1YO6A 3DOUA 3N0WA 3A7DA 1P6QA 1WSDA 1SOUA 2X15A 1CZRA 2G4VA 1W48A 2B4AA 2GBIA 3MCWA 2IXDA 2PX8A 3IEIA 4HFMA 4KFSA 4M99A 3F5MA 5JXWA 3WQHA 1EWRA 3CIFA 5TARA 3BXGA 3QTTA 4YJ3F 3L0ZA 2HO4A 4DOMA 2BFBB 3EIQA 3AEYA 3DR5A 2GN8A 2AR0A 4RZ3A 4TMTA 1HKHA 4UBJA 3SE0A 3FYTA 2X14A 2YBDA 2QN8A 5FLKA 4OBWA 1XEAA 3FKQA 2ZPTX 1XBTA 2A30A 3O8OA 3L4KA 4JT8A 4M60A 4EBBA 1KY2A 1OWMA 1KTVA 2FWAA 1QYDA 4WKGA 3HXOA 2VYQA 2YJ3A 2XVZA 2ZSBA 3A0RB 2PGAA 4IXTA 4LXQA 5AHXA 5HUJA 2G9UA 5C18A 1RQPA 1DIBA 2OCPA 3B3JA 1XALA 5AKXA 1I9GA 3H16A 1KS9A 2PUAA 3A1SA 5HF8A 1LJ8A 4FB4A 4CKEB 4PSUA 3L8ZA 1YB4A 4RCVA 2BMAA 2WM3A 5LDHA 1GKUB 2R6GA 4FYIA 1EWTA 3EGWA 1TMYA 1YB7A 3PCTA 3RS9A 2O0JA 3P2EA 3QKWA 3GN2A 3U7RA 1ZOLA 2OHIA 1A8IA 5K5EA 3TM5A 3X43A 4ZYTA 5JBQA 2H54A 5DBEX 3VVLA 4A6PA 3HWWA 3A04A 5D6NA 4QDJA 3V2GA 1VKHA 4BWVA 1GLGA 1AA9A 5IAOA 5JLJA 4PYIA 1XTBA 5A5FA 3JALB 2E87A 1KEEB 1SKAA 3HK2A 1JDBB 3FNHA 2BFNA 2I7TA 3HBNA 3OD5A 3BYZA 2JCVA 1T35A 2O1EA 3MGBA 4MRRA 3WAGA 1LZLA 3L6BA 1GRCA 5IKXA 1PDVA 3EXHB 2WY2D 1VQ1A 1ZL0A 1OTYA 4RDHA 5BSHA 4QL3A 3PUWA 1ICEA 3IQZA 3GLHB 3DLPX 4I2NA 3KJQA 5DNWA 3BRQA 3V5NA 1XDZA 1ZJZA 4GECA 2VNKA 3BK2A 3VDXA 1UINA 2R4UA 2YWCA 1PV2A 1RWQA 1XLWA 1NF9A 3LPNA 4KKVA 2BKUA 2R3SA 1NW3A 1O94D 1AKWA 3WHIA 1BZYA 2BVNA 1CERA 3SDSA 2HK8A 4JQOA 4OLJA 5E2BA 1HT3A 3K0SA 2HLHA 4QHYA 2AKYA 1UIMA 3MBOA 4FUQA 4N7RA 3TQFA 4CJXA 5BUCA 3FZNA 1K6XA 3U5ZB 3BRSA 2VAPA 2JI9A 4RNDB 3TB4A 3V1YA 2I4OA 4KIFA 2JIRA 3NTVA 1AQJA 1UC5B 5F3DA 5DF1A 1E0JA 3RVKA 2QORA 4DZRA 4AY6A 2QG9A 4DFDA 5B4TA 3ND8A 5LL6P 3REFA 5DHPA 2CCGA 1OFUA 1UF9A 3VR2D 2OM2A 1X7GA 5LP6C 3V8PA 3CNNA 2C5BA 1NVGA 2NXNA 2Q45A 3ABZA 2QHXA 5A05A 1NOKA 2Q0HA 3LL4A 3O5AA 4QOGA 5C7IO 3ANMA 2PE5A 4XTCS 5D5HA 3CUWA 4F86A 4MIEA 3X1DA 1T13A 1N5LA 1DG1G 4MGIR 2VLBA 4UQPA 2PU7A 2CV2A 3SBXA 4L5AA 4LJ4A 3IPCA 1W5TA 4UNSA 3RHFA 2C7PA 5AVXA 5JAIA 2G8LA 1P0IA 2ZUUA 3MWGA 4WV3A 1P60A 4O2RA 1Y4UA 1YC5A 3FZEA 4DM3A 2HN9A 1VCIA 1TMKA 2PWAA 3R6LA 1B6TA 1CUCA 3EHEA 1WCIA 4ZPJA 1DL5A 1YI0A 2YXBA 2Y6VA 3IDFA 4HDMB 2PUGA 5FOWA 1V5FA 1B73A 1O3YA 1V0JA 4AC9A 4KN5A 1GUDA 2BFCA 3LX5A 1XRQA 5BR1A 4NYMQ 5HS4A 4TM8A 1F12A 4LHXA 1CBUA 1CUUA 3KB2A 5JBNA 4JEMA 2H2WA 5LJIA 4HDRB 1V8DA 4RE6A 3HM9A 5CX4A 2C9BA 3BMQA 2NXCA 5JCJA 1YS6A 1JNYA 1UH5A 2QUAA 5IKMA 2IF0A 2FSSA 1KQNA 3D2LA 4CLXA 1KEZA 2Y66A 1KWKA 1JI0A 1PQWA 1VA5A 1KI2A 1L5RA 1L3IA 3N0VA 5H59A 3ZQ4A 1T9GS 1QF6A 4J75A 3HGQA 2O3UA 4GI7A 2EF1A 3AF4A 4G4SP 4LRYA 1JEDA 1CIJA 4RPCA 4Q3AA 1NQUA 1SKUA 2PA3A 3A6FA 5K8LA 4U2GA 3CVWA 1CETA 1GNVA 3H9EO 1P9WA 1SKYE 3Q98A 4LJLA 4AMYA 1BG6A 2XUHA 4YRIA 3L0DA 4JMLA 2MIIA 3UC5A 1KH1A 3EF3A 4RHFA 2I2DA 4D42A 4X5OA 1FYEA 4G9EA 3RS3A 5ICCA 3HVUA 2O1WA 4CMEA 2FZGA 3FFWA 3IV6A 2IV3A 1FQJA 4Q7LA 1OZHA 2JFOA 2MTBA 3CX3A 2OC4A 4EO7A 2AN4A 4YC7A 2ZWIA 4GLLA 4IDEA 3L7KA 3ZNPA 2RH5A 3AP2A 1SOVA 2C2YA 1MJHA 3LC1O 1UOQA 4NBLA 4ANFA 2Q50A 1IH8A 3IOCA 5ELLA 4C4PA 1TJYA 1LTQA 2DZDA 2PX5A 2VYND 2BD0A 2H8KA 3QJGA 4J49A 4MWZA 1SURA 2FSIA 3HR8A 4F6LA 3IVAA 1MTOA 1XD2A 3R3YA 2JFNA 4EPTA 2Q2VA 1U1IA 1JUDA 3SC2B 4M0LA 4BVKA 1BXZA 3LA8A 3QG5A 5JAMA 5LYJF 4W99A 1P72A 3PC8A 2R8YA 1NVBA 3LX8A 3V1NA 3V00A 1ESZA 4OXIA 3R77A 1DC6A 3TB6A 2HV9A 2AHRA 2PGIA 1AU9A 1FFBA 3LQYA 4R1NA 4AYWA 4EUHA 3TRHA 4O8CA 3ROEA 2X8JB 1DCKA 2XJ9A 2D3WA 3CZ9A 1R6UA 4FP9A 4L07A 4D46A 1N8SA 2J3DA 1T6BY 4GI3A 1G5TA 3LQQA 4JQZA 3SFVA 4X9XA 5J47A 3PNVA 3BMCA 2JLVA 3U7QA 1GZ5A 3CLVA 1W29A 4Y6OA 4IRUB 1G8SA 4YJ2B 4GXNA 4NX2A 2HTFA 4X1KB 3JQ9A 1H8HA 1E60A 2YRFA 3AIOA 1Q77A 3RV4A 1YACA 1VDMA 2ZJ6A 1J1ZA 2ZM5A 1MBZA 2O3TA 1KXJA 2QUHA 4OK6A 4K88A 3TEJA 1KFKB 5JUWA 3MYRA 4GPZA 4G65A 4LC1A 5B2ZA 5JCZA 1ZR2A 4HZUB 3KFLA 1WEHA 1JH8A 2HQOA 1KI4A 3GGOA 3RNOA 4DPLA 1NW9B 3IEUA 4PYKA 1RPTA 3KUCA 4LS3A 3UHJA 2AOWA 2IDMA 2QAIA 2Y99A 2B35A 2ZUDA 3QBJA 4MUBA 4RIFA 4YDHB 6GPBA 3IRUA 2ESRA 5LYJB 2C4UA 3QXHA 7GPBA 1JFVA 1GPJA 2J6HA 1RZ3A 3GZTB 3V1MA 3RBXA 5FBHA 2C3MA 4DDTA 2QEQA 5KWVA 2XB6A 4N01A 4ND5A 1HL3A 4UDXX 2H65A 4B4OA 5J9FA 4KWHA 1O9BA 3QE9Y 4AP5A 3LX6A 2FMFA 3ILXA 1UMCA 3TLZA 4Y18A 1XVTA 2OECA 1H94A 1U98A 4N9QA 5IK2A 3MB5A 4B3GA 1V25A 3AXTA 4IJKA 3NNDA 1A71A 3L8EA 1HUQA 2HJGA 5EJ5A 1NMEA 3N05A 3F74A 3LY5A 4PC3A 5D1NA 5FTJA 1I1QB 1LSJA 4B32A 2FPUA 2ILVA 2O59A 1H3EA 2ICAA 3S8MA 2WQ7A 4Y0VA 4DRYA 2A9VA 2VZEA 4J1TC 3MJFA 3MW8A 4Z9FA 4RTPA 1EZ1A 4AS3A 4OBEA 1ZN2A 1ONNA 3F8WA 4QTTB 2JGIA 4GNKA 4IEFB 5JD4A 1MG5A 5CYOA 5L40A 4WCVA 3I62A 4P38A 1GZVA 1XQ9A 2MSEB 1R9MA 4IGEA 3ZE7A 1ZK4A 4OKIA 4GPTA 1P31A 2A33A 2OWEA 4MXDA 2P4QA 4YP5A 3E9DA 4L9SA 4AJ1A 3WLKX 3IAS6 1WPRA 3EOAI 4LYYA 4U0KA 2BP7B 1HRKA 3ZWWA 2P2CA 2Z6VA 1NUQA 3SLRA 4L0DA 5TV2A 5A02A 1U31A 2JIQA 4WCFA 2IE0A 5G1OA 1NJ6A 1IIBA 5NLLA 5JH7F 1Z0DA 1RZVA 4EFKA 1MX3A 3SVZA 2ZT6A 2NU8A 4QFCA 1GCOA 3ADBA 1NJ5A 2YFYA 4PLGA 1DEOA 1FX0A 2JAPA 2XCLA 1RLIA 3QELB 5LZ9A 4TWIA 4UTVA 5A04A 4IOLA 3PT9A 4G1EB 2Z4TA 3PPWA 1SHZA 3R7SA 1IUKA 3GLTA 4F3CA 3JQQA 4V3CA 4OA8A 4AXXA 4QM6A 3CVJA 4MB6A 2FK8A 2I4NA 1T34A 3SQDA 3QVJA 1GTMA 1E9DA 4MP6A 1RXWA 2HMTA 4FJ1A 1AGYA 5KNBA 1X94A 1HV8A 3BPSA 3TM4A 1KI6B 5FTLA 2PWZA 3CG4A 1XCOA 4AZ3A 4I1PA 3DTYA 4XVCA 2V1XA 3W05A 4I1IA 3H99A 3LF2A 4C4OA 4RD0A 5TVKA 2VP2A 3WRWA 2IIVA 1SCKA 2WJZB 5BORA 3SF8B 2O52A 4IOKA 1T29A 1Z56C 2FGJA 3BTVA 4LBVA 1SY7A 5DSXA 2DGDA 3B2QA 4RIEA 3TZEA 2WSLA 3JVUA 2YYYA 3INYA 3KJNA 2I6QA 3KLOA 1R4MB 1XJCA 1XVUA 1T9KA 2BFEA 1Q7BA 3CLTD 1BDIA 1E3WB 1SVLA 1PTKA 3DMNA 1T2NA 2DR3A 3GUCA 3T1OA 5FEUA 5TPZD 4JP5A 1Q19A 2VQEB 1X80B 4YCBA 1Y8ZA 1FTYA 5FFFA 1VIYA 1I30A 1NBWB 3EAFA 4TL6A 2LIVA 3I01A 1P29A 2EJUA 4P36A 1X8XA 3P2IA 4PRKA 1RZUA 1WDTA 3DLBA 3C1AA 1QR2A 4PS0A 2GCOB 2VTVA 4Q5IA 5ICEA 4Q18A 1LH0A 4KH0A 5C80A 1CUVA 4GXRA 4NPHA 4E22A 4M0PA 3OSZA 3N6VA 1WDKA 1TRHA 1ZJ4A 1UXGA 2F2TA 2V6MA 3PQEA 4MQBA 1ADJA 5IS2A 1THTA 1HX7A 2XYGA 3G8DA 2B9EA 2G7MC 2QPLA 3EEYA 2J3LA 1QK5A 5AO9A 3PDCA 3NEPX 2FLWA 4CHTA 4WE3A 1ESEA 1IXKA 1QFZA 2NTYC 2OV6A 3DD5A 4JENA 3U1VA 4B43A 1N6RA 3OZSA 3AW9A 1TUBA 3FETA 4ER7A 3OFKA 4KIGA 1JYFA 4DLNA 2DBRA 1Z35A 2VJYA 4R0MA 3I04M 2JIMA 2HC9A 2F90A 4DYHA 4AZSA 3C1TA 1G6HA 2GILA 1OI3A 1EFTA 5DE3A 1JFTA 2Q6OA 4O2LA 3TAUA 3ZKWA 5LSAA 1KP2A 2IPXA 4Z1OA 2RBKA 1JEAA 2RJ3A 2BEUA 1UJBA 1ZKDA 2KWIA 3KAQA 4D9EA 4BTLA 1F7UA 1M7BA 3UWDA 1JR4A 1MPTA 4ZT7A 4C0JA 4TKUB 2ZT7A 3IPYA 4DLXA 1JZQA 1D8AA 5DBFA 1DXYA 1BWPA 3I1YA 1VJGA 3TL6A 3JXEA 4UUPA 2QF7A 3OOWA 3DH0A 4J9UE 3GLRA 2VHYA 4L6AA 3ORHA 4TYPA 2RGAA 2K2WA 2HQRA 3WO0A 4TRRA 1QK3A 1WSAA 4Q0MA 4QYXA 4W9NA 1UMDB 2Q5OA 3CWZA 2AS0A 4H3SA 4B7ZA 4Z9BA 2BEJA 3EQ2A 2Z1DA 2DJ5A 3KFVA 4UM8B 3AGPA 4E5DA 2WM2A 4NYMR 1ST3A 2BSXA 3OEHD 4LZAA 3TBHA 4FB5A 1DJQA 1PS9A 1SBQA 3P45A 5KNCA 4DC1A 1FW8A 3KVOA 4TT3D 3AF2A 5FI5A 3T0GA 1KS2A 1NMQA 1X1EA 1NKTA 3PICA 1VI6A 3P2MA 4FE3A 1A5BB 3KZOA 5T64A 3TMYA 2P6PA 4E94A 4Q7QA 5CFZA 4DUYB 4GPBA 4OO3A 3RUDA 3ZDDA 5KWJA 3I92A 4D99A 1XWIA 2IDKA 4GZ6A 3H11B 5DTQA 1GEEA 3BWYA 2PEYA 1WRBA 5KAMA 4YRLA 821PA 4DXDA 3G5TA 1RXCA 4B82A 5HXAA 4G4SO 3DW1X 2IXGA 3QPUA 3PDIB 5HR5A 4JSYA 2CF6A 4AJIA 4K6KA 3RSSA 1RQXA 1TOAA 2CFCA 3AX6A 3G9XA 1W0KD 4UARA 1C30B 4GM0A 3C85A 4P7FA 3VOSA 2GHQA 2E18A 1P9RA 2BLNA 5AKLA 1O5TA 3KKKA 2DXIA 3C7CB 1E2UA 5DHTA 4F12A 1AHHA 1HE8B 2GRUA 1GPDG 4YMWA 4UAJA 1EJ6A 1C7EA 1FSFA 1K9SA 4XIIA 1SA0B 3AONB 1A9RA 4XYEA 4GX0A 4ZT5A 1JYSA 4D0GA 4F06A 3H4VA 4JGGA 4PBRA 2GFQA 2WU0A 3RROA 4X61A 4FT2A 2DCMA 4WDRA 1ZD1A 1NE7A 3WMGA 1OWOA 3RW9A 1ULAA 3P4XA 1YQDA 3GI1A 3RT9A 4CV0A 5ILGA 4WVLA 4DIBA 2XV1A 4WFJA 3RFFA 1YULA 1QSGA 2WZDA 2PO7A 1UM8A 3GPDG 1XSEA 1OXXK 1AZTA 4I5IA 4EDFA 2GHRA 1XELA 1E92A 3GRKA 1W59A 3DEIA 6AT1A 3ZTYA 4K8OA 2PWPA 1KE1A 4PO8A 3TIXB 4UAUA 3LE8A 4PNPA 4BMVA 4EVQA 2RAFA 1E6EA 5G40A 1NMYA 2BH9A 1A98A 3LCJA 5E9QA 1OWPA 4U3JA 1US8A 3DAOA 3ESBA 1JKMA 4URVR 2ZXUA 2RHHA 2P75A 1JJIA 5K0CA 4AZ0B 5ADHA 3BWVA 1GRQA 2HIGA 1K5GA 2VXYA 4KE6A 2CUTA 4X41A 1OA1A 1SHUX 3OZWA 2ZJBA 4OQZA 4FR0A 4YRTA 1C0KA 1N9GB 2ZR7A 3IPAA 3MFYA 2LKDA 3S70A 2OCXA 4CG3A 1CJVC 2YV3A 4CKWA 5IDWA 1NT4A 1ZITA 3QKRB 3UOWA 3INGA 4OATA 5YASA 4ZDJA 4R41A 3FRHA 3KB6A 4MW1A 3VNVA 2VTBB 1J8FA 1G41A 2DE0X 3FGNA 1TJPB 2G5CA 2W58A 4Z6KA 3WICA 4MYSA 1KJNA 1OSNA 4LYFA 5FPPA 2VPPA 5BYAA 3UHAA 3B48A 4B81A 4K0RA 4H16A 3QOXA 2BBTA 3HJHA 1PFVA 3NT2A 2OD7A 3HPRA 3NC0C 1GG5A 1BHQ1 5JAOA 4RY8A 4ESHA 4XSGA 5IXSA 2PQ6A 1KDZA 2C4VA 2XVXA 2J5BA 2EARA 4YFYA 4BZZA 4YMUA 4RKWA 1Q0PA 1YR9A 2ECKA 1N5OX 1YU6A 2CDBA 2DLDA 2WUGA 3ZNOA 2HNKA 2IYQA 2QSUA 4EA8A 3OLYA 3PUYA 5A0FA 2Q5HA 3EC1A 3ZY6A 1NIJA 1T0BA 4PNHA 4V0SA 1S2NA 3A31A 2L69A 3LI2A 1RBQA 3NT4A 4OYRA 3RF7A 2AXPA 5B58T 2OO5C 4RQBA 3USCS 3ETHA 1EJBA 3F9RA 4CQMB 1DFHA 2PH1A 2ETVA 3FDJA 4IW3B 4KGZA 1JVSA 1E7QA 1T9ZA 2C7RA 1GRNA 4I9UA 4LGVA 3WKCA 4M7PA 4J2TA 2CDNA 2DUNA 2UVPA 4BBPA 5DTMA 1IJBA 2QX4A 5HE8A 2O8DB 2J0QA 1S5PA 3RC7A 3OU7A 1K8YB 2WWFA 1L4GA 2P7IA 3OUUA 3H5RA 3BIFA 3QHPA 4GMDA 4N0PA 1CJTC 4NBTA 1SZJG 4EP1A 3RWBA 5AVWA 5HMMA 5JQWA 4TWAA 5GY7A 1AN9A 1YCHA 4DLAA 5CX1A 4NOMA 2IS1A 3ITEA 3JS5A 2FQYA 4KU4A 5BP7A 5DGXA 4P86A 4NU0A 2BE9A 4FFVA 2AE1A 3JYOA 4PRLA 3W9UA 3ZHOA 1J2UA 1B43A 3T6KA 2R6HA 1H1LA 1RE1A 2VBFA 1H0RA 5AK5A 1N2EA 3OZGA 4DBZA 5TMPA 5JADA 4ZHSA 1OLSB 3IAAA 4YAKA 2W6MA 3TYXA 4LZWA 4OSPA 3EQZA 4BWYA 1BXRA 1N25A 2Y1WA 2NSLA 4ROTA 3OIDA 2F9FA 3WGVA 1U80A 3LDFA 3QTLA 4BAZA 3LT2A 1JILA 4XUEA 2UXBB 4KR3A 4G5QA 3C87A 1QO0D 4WKCA 8LDHA 1Z4JA 3DKKA 4LF6B 3ZDRA 3TLKA 3RAGA 2GLTA 1O9HA 5CG2A 1W0CA 1I51A 3R23A 2C3YA 2PXAA 5ALRA 1DPFA 3V2IA 3ZQ6A 4BLTA 4J0FA 3A14A 2ORIA 1Y8AA 1MDFA 3BD7A 5KTTA 2EL7A 4PAOA 4N5IX 1X2BA 2BRUA 1BDJA 3FMGA 5LJLA 2X4LA 2QX7A 4NZYA 3TRDA 4LOJA 4HNVA 2O3SA 3AL0C 3QKSA 2VDMB 2LD4A 1WSBA 2QUKA 2ZDQA 3BMOA 3I0MA 3Q7SA 2IFTA 3G9TA 3NHKA 4KQJA 2DF8A 1W5FA 4JL8A 4LJKA 1OLXB 3DAPA 4K26A 1YKSA 1TD1A 3ETEA 2BT4A 2WSSA 3OUTA 2YZ7A 5LA6A 2NNLD 4GE0A 5GJVC 1AUVA 5IF3A 2F43B 2XKKA 1QVVA 2GN0A 2CMDA 2IYWA 3ABOB 3A8TA 3E53A 3BXXA 4G3XA 2HCRA 2HF8A 1YB6A 1ZBDA 2F9LA 3IAFA 1T1SA 4GMXA 4OYYA 3KLMX 2OK7A 2V54A 3E81A 4JLMA 4TXMA 2Y1XA 2I33A 4KGDA 3KVRA 4CDRA 5F3RA 3P2YA 1MEJA 1WEKA 4ZK6A 2D4HA 4OQFA 4R0VA 5C1OA 1LVGA 3VKUA 2OFFA 4FHGA 5FTKA 2ZQ5A 3EYWA 3ZN2A 3VDRA 1HDZA 3HB4X 2I4LA 5JS8A 1NXXA 2FPRA 2WJHA 3ER6A 2AMJA 4WD3A 1SXHA 2O2DA 3UUEA 3IAM6 5DRYA 5LOVB 5FI0B 5KHLB 4CL0A 3ZG6A 5B7NA 1PL8A 1SKQA 1Z12A 3ER8A 4JS0A 1VL5A 2FHSA 1L5GB 2RGEA 4D81A 1JNXX 5EIAA 3WLMA 1N2IA 1U3CA 3KC2A 5EWMA 3VC2A 4Z7JA 2QMHA 3Q8KA 6REQA 1OKKD 4W5RA 2JLXA 4MKGA 2AOXA 3V4OA 2C4NA 4JGIA 2LDXA 5CX1B 5ALEA 4UPEA 1A7KA 4GSKA 4ZOBA 1KAGA 3NVKI 4JX9A 2O2XA 1Q44A 4JYPA 1JG3A 2GZRA 3HZOA 4LV8B 1K66A 3V7UA 5CA1B 5J2UF 1NATA 2AFHB 4P5DA 1UXIA 4KEAA 5KAPA 3W5VA 5C9ZA 2BGGA 3O8CA 4LBYA 1T6YA 2FEXA 5ABPA 3QY9A 1QF7A 1GZ6A 2WAMA 1YNOA 4BV8A 4EKGA 5K3BA 3ZLJA 3IFSA 4RTRA 3GEMA 3OE1A 4KBYA 2PUFA 1YA8A 3FUWA 3SDZA 5G0WA 1KIFA 1Z07A 2CVZA 4UU0A 4F3KA 1HSOA 5FBQB 4KPYA 3VTAA 3WSTA 3ZV5A 3K1ZA 4XOIA 1ABBA 4ZVPA 2B7CA 1ZVQA 1FNNA 2Z4RA 1V6AA 1IN8A 2VPIA 4PGAA 5FBLB 2XE6A 4ZYZA 5FULA 1OBVA 1NUPA 2RHOA 3E2MA 3QA3E 3UJ9A 4L5IA 1WVIA 4BFVA 1EVQA 1PR6A 2XAUA 1KC3A 4LZLA 1JLKA 1NYTA 3NEJA 1G0NA 2HQBA 2Q7XA 1QMPA 2XE4A 3C6QA 5DLYA 3ISTA 4HAYA 4A7PA 1GUFA 1PDWA 4B4WA 3L0CA 4CVNA 3GROA 2YXDA 3BFJA 4IIFA 3OKAA 2C3PA 4LY0A 3VX4A 1EUZA 4EQ6B 4JXZA 4TMWA 1U8ZA 2DSNA 2WHQA 4KQXA 5JE8A 4A0SA 5HNKA 1LRJA 5EESA 4TXNA 4X1YB 3KB8A 1EGHA 2JGEA 1JRLA 3EISA 3CXRA 3OAAD 3C3CA 1Z7GA 1HT1E 4CPDA 2D0DA 4QUAA 1CVRA 2Q3HA 1IB6A 2P2LA 4KXLA 2VBCA 5AI6A 3VR1A 4BZQA 1R9NA 3Q8XB 2NVBA 3T94A 4HDKA 2RJOA 3TR6A 5JVDF 3PUXA 1SELA 1D7AA 1DAHA 3PPVA 1Y6JA 1GPH1 4KP7A 4YIKA 5HMLA 4DARA 3PKJA 4LJRA 4X3OA 3FSEA 1OYOA 4FZ5A 5FUQA 4OKNA 4GWGA 1KFCB 1QGYA 2AX3A 3P20A 1KERA 3RASA 1PVOA 3RS2A 4QFBA 1XXHE 5DBHX 3AY3A 3L7MA 3UPUA 4GYKA 4C6SA 1ZRNA 1XVVA 1GTJ1 2W98A 1Z62A 2XB9A 1U9CA 3NWOA 1C0IA 2YW2A 3PD7A 1CFJA 3A1UA 4GXTA 1CZHA 4JUDX 2AQIA 1VLJA 3KE9A 3TD9A 4DQUA 3ONNA 1CHDA 4MICA 4UFNA 2RSLA 3A6GA 1NP3A 4ZCQA 3T5CA 4LBWA 3RYHB 5FIUA 3H5LA 4IO0A 2B21A 4OBBA 2HJVA 4NDNE 4RJJA 1BJRE 2R84A 3UUFA 3I6ZA 4IZHA 4J43A 3STUA 4BMPB 4A0FA 5FLXA 1PJQA 5IASA 4JFRA 4FDTA 4KO2S 1M7GA 1EEXB 3U3MA 3QXSA 2FPGB 1Z5WA 4DR6B 3EBLA 2OZPA 3WFZA 3DEAA 1FMCA 1PFGA 3GPCA 1P4RA 3DDNA 3JZMA 2IH4A 1QOZA 2IU6A 4BQEA 1W0KA 1QZUA 4D74A 3NUZA 1BN6A 1JXOA 2JD0A 3GA0A 5ALIA 4WOPA 2QRHA 2ERXA 1F8GA 2XXBA 4TVOA 3PQDA 4KR7A 2W90A 4RF3A 4ZVUA 5I7VA 4ICIA 3BRWD 2EL9A 3HP4A 1DDIA 3PNMA 3EGIA 3P9SA 1NBOA 2PRKA 2QX6A 3DWFA 5CT5A 2EKPA 5ESDA 2Q0SA 1GTG1 2PKQP 3EA5A 3HABA 2F3QA 4KTVE 4Q4HA 4ZU1X 1Q95A 3RC3A 5JZ9A 4NZZA 4BFYA 5U9CA 2B1JA 5LKRA 2GJ4A 1X8KA 3AM4A 1W0JD 3T7IA 3K2BA 2GD1O 2ATCA 2FFRA 3O31A 4W1RA 5B30A 2PLWA 5GZ6A 1NDUA 1Z4LA 1O95A 3AIMA 4MR8B 1NI3A 4GOOD 3NHPA 4I9GA 3S27A 7REQB 5KNCH 2A59A 1KFBB 3FMOB 4BO8A 1BIFA 1K3FA 5KJ1A 1DJOA 3SZUA 4Q1DA 3UCFA 2WNHA 5I9LA 4RXMA 1KPHA 3OIFA 3OUZA 4NCJA 1FX0B 4HG2A 2EC5A 4L2IB 4MYDA 1XTKA 1HE3A 1T15A 3L0IB 2V9CA 3IQFA 1HNWB 1WXHA 4L5CA 2B1RA 2NYAA 4CODB 2NG1A 3QLJA 1MTZA 1N2OA 3LQKA 3D7RA 1USVA 4K05A 3EFHA 2JJ2A 1G20A 5E2IA 5CD9A 5L3VA 3GGSA 4EYKA 1IHUA 1KZ7B 3FTNA 4OB7A 1G3UA 4QD3A 4G36A 5K0NA 1D3AA 1C9JA 1W9HA 5F3WB 4EQZA 3O91A 2JANA 3AM5A 3BRCA 2J0SA 3MAAC 3GEDA 1OB2A 4NHEA 1EDZA 4JJ4A 1SIBE 1MB3A 3CKMA 2P77A 1I7LA 2I4RA 3GG2A 2GEVA 4OXXA 4TGLA 1X92A 3H6HA 4GKVA 3HCFA 4J4HA 4WXEA 5AKJA 1HGXA 3RVOA 8MHTA 2ZIWB 4BMXA 2B98A 3AVQA 3ZUGA 2C94A 3QF7A 1XHFA 2B8TA 3AETB 1ORIA 4J7XA 4PHHA 4RTSA 3RYTC 1Y8CA 2IZ1A 1W88B 3LVBA 2HRDA 1IU9A 1GZUA 2E49A 3ZXUB 1G8KA 1W49A 2VUIB 2WJAA 4P4UA 3PUKA 5KYKA 3UMMA 3DR3A 3H4TA 4LQCA 5HF6A 3PFGA 3DE6X 2Q21A 2XNKA 2QZSA 3AMVA 3S4YA 2AZTA 4DV6B 2BTEA 1NI4B 1AO3A 3E61A 3RSOA 2ZJ1A 2ZRLA 4WN9A 5CB4A 1IXYA 3I6YA 2RHRA 5I7EA 1J1UA 4L3VA 4RVDA 3KJFA 3LECA 5E7JA 2KBEA 3BXFA 3HCDA 2X4IA 1V16B 2WWTA 4KWTA 4P83A 2GAJA 1GCIA 2XT0A 2NN3C 2WWWA 3A9TA 3QK7A 2JGFA 4Y1RA 5K09A 2V7GA 3FUCA 3GFTA 3QVVA 4HLUC 3AUKA 3MQ2A 2G09A 3H42B 2YUIA 1W4ZA 4OHMA 2JC3A 3REQA 3UA3A 1FIUA 1TM5E 1VHWA 1XZCA 2JHFA 4MCAA 5C81A 3ZY5A 2XKAA 1PZGA 2UXCB 2DFKB 2XBUA 5A4MS 3M2TA 4R3NA 4R51A 4Y2QA 5LLSA 5ILOA 1H93A 5JATA 4NS4A 4ZRDA 3U44A 3DKVA 4OSOA 1FP2A 2DFTA 2J4DA 2NT3A 3QMVA 4G5SA 4ZRNA 5EJ4A 4IYJA 4FHEA 2PR7A 2B5WA 2V96A 1VYUA 4RHEA 1L5NA 4JYAB 3H7IA 4BC1A 3E5HA 2I6GA 1PU2A 1IN5A 1YDHA 2DFNA 2ZJAA 3F6BX 1MB4A 1BOOA 1MJ5A 2RIRA 3JRWA 4PSVA 4AO7A 4AO8A 4HO1X 4PYOA 4RA9B 1FPMA 2P69A 5A6SB 2O5EA 4MB2A 2IVZA 4CKCA 1BN7A 1TX4B 1DQSA 3MCUA 2Z2ZA 1CY1A 1QFYA 1Y9EA 1F8FA 2CNBA 2WHEA 3BZBA 2JARA 3ZH9B 4UUNA 2HU7A 1FDTA 1G66A 1D04A 1GPUA 1V6CA 3B53X 4NYJQ 5J43A 1XMOB 3OJFA 4B80A 1KETA 3AR7A 1DKUA 2M9MA 1PVVA 4RESA 3T52A 4FW9A 3WGQA 4BLSA 3V1KA 4HGQA 3WBKA 5BV7A 3E9ZA 2IUSA 2H2AA 4M9SA 4ZI5A 2EX4A 2QN1A 5AICA 2MSLA 4MUIA 1DCFA 1H05A 1JECA 1SRRA 3G6KA 1VKOA 3GLHE 4OI4A 5LMUB 3ENNA 3WZMA 1JIQA 2HGZA 1X14A 4YHBA 2HHCA 1X38A 4X1YA 2X5JO 3WDKA 5DM70 1TVMA 4UE6A 1Q0LA 1G16A 1LBTA 4GHWA 4I4LA 2QNIA 3P7MA 4XX0A 1EA7A 5CCDA 1QVAA 2AN1A 4DJ5X 4B3TB 4N6GA 1NKSA 3IUNA 5JXIA 3AEQA 2YKGA 2YIJA 5C37A 3BD6A 4GPAA 4B3MB 2NUAA 1O4WA 2GYYA 1TB4A 3K9QO 4F9GA 4RXTA 3N7AA 1RQ7A 3H87A 2FF5A 2OENG 1YS2X 2PV0A 1VE9A 3BT7A 5JD5A 4IEEA 1JAHA 1JIXA 1MA0A 2X9QA 2E3JA 2EFHB 3HZRA 1GYQA 4MWSA 2X5KO 5DNDA 1DHTA 1Q12A 5F78A 5AW9A 2R6AA 4KPFC 4AUEA 4C9BA 3B1JA 3VR6H 4ND2A 4WH0A 1TU4A 1GAEO 1MC5A 2H2HA 5CB6A 2GB4A 2AYYA 5AOAA 1ZGHA 3MCZA 4R7GA 2CL7X 1GU0A 2JZCA 4B74A 3MAGA 3K0CA 4P5PA 3P0HA 4I4TF 4MUNA 4RVSA 1A77A 3KYDA 1J20A 4KN9S 5JSYA 3UWKA 4A0QA 5GP1A 2ZE7A 4BVLA 4O2AB 1NVMB 5JRJA 1DBVO 2ACWA 4YCDA 3EWAA 3R3SA 2ZBGA 1X87A 4HFRA 5TMDA 3GNQA 5TF0A 3SQOA 5BR4A 3RREA 3MTGA 4JB2A 9ATCA 2C8VA 5LZ4A 4KGVA 1C7RA 3JQ8B 1AS0A 5DOVA 5GINE 1I0LA 3JQGA 3KU1A 3IP5A 4GZ5A 3MD9A 3OIYA 4IHJA 4MS1B 1D6JA 1KQ3A 1NE2A 5AJHA 4BU0A 3MYYA 5LOVA 1TW3A 5BSWA 3H5NA 3A1EA 5EZYB 1JDPA 3VAZA 2WVGA 1JXQA 1D0IA 4O3FA 2DQ4A 2XNCA 3DP9A 4UQOA 8ATCA 2Q6TA 5AHRA 5THQA 3LIPA 5I7OA 3THXA 1WB6A 4JI4B 3QLUC 2FMTA 1XEFA 4FFMA 1M8KA 4LXUA 2NX2A 3NJ8A 1N8NA 4H17A 1NRXA 1NXWA 2RHJA 2VYVA 1E2HA 1PK8A 2FZ5A 1O6ZA 3PRJA 5FPTA 1U1CA 2C9MA 4OJYA 2DOKA 3R7DA 5FUXA 4HGNA 1SOAA 2JVKA 3VDQA 4BMCA 5E3HA 3FM9A 4M98A 4BVEA 4HTFA 3FZQA 4CLHA 2PGXA 1QRSA 3L6EA 2V5VA 1NN0A 3SKXA 2NZXA 4BKUA 2A9OA 2ZYIA 4R2XA 2V97A 3SJZA 1DKQA 2W2KB 1HK7A 3W1WA 3ELYA 5FI3A 2I91A 4NYIR 1FXWA 4OGKA 1PJCA 3D1JA 2C2GA 4WKOA 1FS5A 3SC6A 5FI1B 3SX0A 4D9FA 4ZDIA 5LBUA 5CB0A 4MIYA 3W5AA 2JIOA 2YWFA 4IBOA 5JMWA 2WF5A 1QAMA 1M1UA 4QC2A 2QQFA 1G21B 1VMAA 4EW2A 1FJHA 1RYNA 5E38A 1YGPA 5AT1A 2G4LA 1YGYA 1YRYE 1DRVA 3H4MA 4UEQA 4ITUA 1YJQA 1XMPA 4LE0A 4EKDA 1YSCA 2CMGA 2ZJ3A 4HQ6A 3SCZA 3T5GA 5BVHA 4E09A 5BSUA 5IEJA 2JGJA 2GXSA 1QC5A 2R25B 1B8UA 5E9JA 2WIFA 2N47A 3TW0A 1CK4A 2N1BA 4DEXA 5HKAA 3D5EA 4N8SA 2DP4E 1MABA 1HDIA 4KXUA 4TS3A 3BK1A 4HWTA 4YTEA 1H9BA 3AKDA 5B37A 3QZUA 3SIRA 2YJ6A 1XQVA 4FFRA 4GMFA 1IZ7A 2BV3A 1Y4DE 1DWQA 1E79A 2HWWA 1IAQA 4KPUA 2BKXA 2D2VA 3RIYA 4RSMA 4I1VA 4IZOA 3DT9A 2EX1A 1UJ5A 4IVPA 1C1DA 1OYVA 1YKFA 3RQSA 4UDNA 3GP3A 3MMZA 3SYNA 1Z0IA 3AWDA 3K9NA 3FHJA 1NY6A 3OZBA 1USUA 5FXMA 1RAIA 3TR0A 2CZGA 3IE2A 3H2HA 3RS5A 4TZ6A 4I19A 2UZ0A 3WWEA 5CAEA 3GGPA 4Z7QB 2W2TA 1EFRA 3TXXA 4DQ0A 5ARDA 2GAIA 4YPVA 5BVHB 1BVYF 1KK2A 1Z3IX 2VWGA 2BOVA 4N5DA 4ODIA 3V4SA 3EVAA 5EYPA 3PSHA 4IS3A 1H66A 4W9NC 2NYRA 3WA6A 1NN5A 4F7WA 5KI6A 4Q4AA 2PUHA 3DUFA 2CHFA 3LMKA 4PR3A 1E5DA 4R68A 1GYPA 4Y98A 1J97A 1O7JA 3OCWA 3ZWVA 2ZKLA 1UBUS 4GMKA 4KMMA 4LRTB 1KI8A 4ID9A 4LRSB 2BCEA 5GWXA 2H59A 3FPFA 3W7VA 2C9OA 3W4JA 2GO7A 2WWRA 4WNAA 2IHJA 1I4WA 3QU9A 3DONA 1I2CA 2VSXA 3H3JA 1HG0A 3EZFA 3WGZA 2W6OA 2FP3A 4O8ZA 4E1AA 3C1OA 1Z47A 3OE7D 2CN1A 3NKFA 1M6HA 1I0IA 1LK0A 2YW9A 1CQIB 4JL6A 3FTCA 5EPEA 5JNLA 2CKDA 1YVRA 3KT3A 4RFSA 4CM5A 1L7QA 3GP8A 3A3PA 4M0EA 2GD2A 3BFVA 4JLBA 3MBIA 2CLEB 1A95A 3QI2A 4KHPB 1E2MA 3I2GA 5CTJA 2OBNA 3C8ZA 3LDUA 5JQGA 2CXQA 4YMLA 5EZYA 1VE3A 3K5HA 1PR3A 3MINA 1UPTA 1T4GA 3R1IA 4II3A 1FDOA 3KR9A 4Y1EA 2OMEA 1XKXA 3FWKA 1Q6ZA 4M49A 1AF7A 1QXSA 2WYOA 1M6YA 1VZ3A 1N0VC 3BE6A 2ZT5A 3NBXX 1JFSA 1Y7PA 3DO6A 3PQ8A 4QXRA 4Z2YA 1A9SA 4QT0A 4BAGA 5C35A 4YAEA 5K8JB 2JI6A 3FPBA 4X1KA 1T5BA 1KWGA 2B7LA 2KLBA 2QLTA 1QGDA 1EDDA 4IL5A 3FYUA 3T38A 3T7CA 4TT8A 3ZZ0A 1L7DA 1P80A 2HADA 4CMAA 5EIXA 4OI2A 3HDHA 1RMTA 3JQ7B 3KCQA 4J1TA 3AVTA 5EP2A 3FPGA 4HPWA 5DN6D 5EXEA 2WWIA 4GEKA 4J9VA 4B87A 3CNQS 3H3XA 3GJ6A 1B6RA 2JATA 4UVDA 2PSDA 5JAHA 4Q03A 1WXXA 1JFFA 2I67A 1ILEA 3EDQA 4DV0B 1TLLA 3AESA 1VP3A 3TD2A 3RYFA 1PSZA 4MQ5A 5B1DA 4YRFA 4DDMA 4LDQA 4PZZA 2X8LA 1E3TA 3C3EA 4I50F 4PV7A 1SUFA 4JUBA