1TC1A

A 1.4 angstrom crystal structure for the hypoxanthine phosphoribosyltransferase of trypanosoma cruzi
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
184
structure length
175
Chain Sequence
YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYVRMLLDTRHSIEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 1.4 A crystal structure for the hypoxanthine phosphoribosyltransferase of Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
molecule keywords PROTEIN (HYPOXANTHINE PHOSPHORIBOSYLTRANSFERASE)
total genus 55
structure length 175
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 1998-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tc1A00
1I0IA 2PRYA 4P83A 1P18A 1ECBA 1G9TA 3DMPA 4F8EA 5EUCA 5KAPA 1G2PA 1QB7A 2WNSA 4RHTA 1NULA 4RHXA 3H83A 5IAOA 1CJBA 5BRNA 1DKRA 1ECGA 3LRTA 1P17A 4LZAA 1U9YA 3HVUA 5IPFA 1WD5A 1A98A 1I0LA 1A3CA 4IJQA 4RAQA 1I5EA 5BSKA 1QCCA 2FXVA 4RABA 5ESWA 4RHUA 4X44A 5ESXA 1QK4A 5JV5A 1STOA 3GGCA 1XZNA 1R3UA 1UPFA 1ECCA 3GEPA 1BZYA 1O57A 1ZN7A 4M0KA 4S2UA 2VFAA 1LH0A 2JKZA 1ZN9A 3KB8A 1V9SA 1I13A 2HCRA 1BD4A 1NONA 4X45A 3NAGA 5BQOA 4KN6A 3ACCA 4RHYA 2GEBA 3EFHA 1A4XA 2AEEA 2E55A 1D6NA 1J7JA 1I14A 1G9SA 1VSTA 3OZGA 1ECJA 1L1RA 2H08A 1TC1A 3N2LA 5JSQA 1QB8A 1XZ8A 3DAHA 1A95A 1JLSA 4RACA 4TWBA 1FSGA 5HIAA 4PAWA 4P80A 3OHPA 1Z7GA 2PS1A 1QCDA 1HGXA 5HKLA 1VCHA 1G2QA 4OHCA 1ZN8A 1DQNA 1AO0A 1O5OA 1L1QA 1QK5A 2YZKA 1XTTA 4P84A 4RV4A 1ECFA 4LYYA 3LPNA 1OROA 1P19A 1YFZA 1TC2A 4PFQA 1A96A 1OPRA 2IGBA 3M3HA 2JBHA 3OZFA 3S5JA 2JI4A 4ZFNA 3MBIA 4QRIA 4WMLA 4RADA 3ACBA 1DQPA 2H06A 3GGJA 3MJDA 1GPH1 1U9ZA 2C4KA 5KAMA 1VDMA 2XBUA 4WN3A 1P4AA 1Y0BA 1MZVA 3ACDA 1W30A 4FYMA 5BQPA 4Z1OA 3DEZA 2JKYA 2P1ZA 5E38A 1UFRA 1PZMA 1XTUA 1A97A 3QW4B 3O7MA 2H07A 1QK3A 4JLSA 4LZNA 4JITA 4MB6A 4P3KA 4RAOA 1OREA 2DY0A 1JLRA 1DKUA 4P86A 4M0UA 4P81A 2EHJA 3G6WA 4QYIA 4RQBA 5K51A 1IBSA 4LYGA 4M0PA 1BD3A 1DBRA 1GRVA 4QYIB 4LZOA 2PRZA 1UPUA 4RQAA 1HMPA 1XTVA 4RANA 4P82A
chains in the Genus database with same CATH superfamily
2UVQA 4DBLC 5I7OA 1P18A 2V1UA 2WMYA 4AN0A 1RRVA 2OL4A 4M9UA 1U6IA 4WBXC 1K86A 1YDEA 1Z4KA 4ALJA 1QB7A 1I24A 4L73A 1P81A 2XUQA 1WQ4A 2C92A 1VIAA 4YDHB 5DASA 2ET6A 5CIWA 1C9NA 1TJNA 2H7CA 4MRSA 2CCGA 4PFKA 5JDIC 2HI0A 3UMYA 1L7QA 1F06A 4TUYB 4OHFA 4IYRA 5CT5A 1RTKA 3NWOA 3OG9A 4IJ5A 1RHRA 5ALKA 5TF4A 3A8TA 4F4UA 4QOJA 1ND5A 4KFCA 1VL2A 4I8XA 3RD5A 4O5OA 2O2HA 3ZLJA 1RWXA 2WTEA 4V3BA 2VCYA 2QROA 3DMFA 4QU8A 5FUYA 3WGIA 1CB7A 4LMAA 4A8JC 3EG5A 3V3KA 4URHA 3ZVKA 2OYCA 4XKJA 1KVQA 1UXHA 2G1KA 3HBMA 3ZNNA 1X7YA 2P41A 4I4CA 1TXGA 1QIGA 2IIPA 1OTYA 1FDOA 1PQYA 2IVZA 2NUAA 1G5QA 1XD8A 1RAGA 2Q8QA 2IUYA 3KB8A 1QG2A 3BEOA 5D1HA 3TNLA 2G8NA 1R8JA 3R77A 3ZHQA 2YJ6A 1VE1A 2WR8A 4IGAA 3HUTA 3SS8A 4YJKA 3ZWBA 2REOA 3OKPA 6AT1A 3PQ3A 1WKBA 5A9SB 4Q3EA 3NOOA 1MG0A 1PJCA 3NDBB 5C7IO 1E2MA 2CJXA 4MICA 4U7JA 2R1VA 4Y9RA 5A9SA 5CDTA 3CHYA 3JRNA 3QBDA 2DUJA 1LPOA 5GONB 5DT9A 1IK4A 2EARA 1C3LA 3VDNB 2FN3A 3GBSA 3AKDA 3NEAA 3DHNA 5K8VA 3HA2A 5SV2A 2FHPA 4B3MB 3DC7A 5U4QA 1KDZA 2VAPA 4FWBA 1NRWA 1UJMA 2G07A 4HNSA 4M0MA 4B43A 2SCUA 3F6YA 1PL0A 4ND4A 2BRUC 4QFDA 4E12A 2I1VB 3S8YA 1ULUA 3C97A 1MX1A 4G0OA 4I4IA 3U7IA 3B48A 1DOHA 2OG1A 4JB0A 1WXXA 1RM0A 1SPXA 2VNKA 1CJMA 1IK6A 1GT91 1M1ZA 1NI5A 1K6XA 2W22A 4TYQA 5ALXA 4I55A 1W25A 3S1LA 4K9NA 3FIUA 3D6HA 2TYSB 4M8IA 5I5EA 1F38A 2IH5A 3AJDA 3EWIA 4MS4A 4FYKA 1L4GA 1TO2E 2QRLA 3OOEA 2EP5A 5JMPA 2JBAA 3ZGVA 1QYWA 1IXZA 2BF7A 2W6IA 3L3BA 1A8HA 4GDMA 4IAOA 4JJ4A 1RI4A 4MAAA 5HQ3A 3ZY6A 1O9HA 2Q1TA 3VV3A 1Q1BA 3GRZA 3OJFA 5D5PA 1HYEA 1LVHA 5F5NA 3TL2A 3EWAA 3I30X 3DO8A 4PWZA 1O77A 1NVBA 1UBRS 2XTJA 4JLKA 4LFAB 4FLEA 2PN1A 4MPPA 4P1ZA 3N2YA 2FGJA 1XNHA 5JISA 3T3OA 3AFGA 2E87A 3TMYA 2HSEA 2F7SA 2P2YA 3SSNA 1MW9X 2ORWA 1ZXXA 3F2IA 1WSBA 3QBEA 4B84A 1GA1A 1H8HD 2YJNA 2IZ7A 3CZAA 3ORQA 4J16A 3HXOA 3LHFA 4MYSA 2OZEA 4FFWA 1U8CB 1EXDA 4RMGA 3CCFA 3OTWA 4PPGA 5ALJA 5CG2A 1D2HA 5D7BA 3ZCRA 3VR0A 3R7SA 4CV2A 1D03A 2WSYB 1ZUWA 2IITA 2H1RA 2O6LA 3QVXA 2II6A 5FLXA 2C04A 2XMPA 2NU7B 1Z4MA 2IXEA 3EXFA 1I0IA 2AMVA 3IPRA 2G0NA 5I45A 3UXMA 2ZYIA 2ZTLA 3G5LA 4QGAA 2PZFA 3D7LA 4BPRA 3BCUA 1KMCA 1VBFA 2FP4A 4DG9A 2GOYA 1B2RA 3FPCA 2IK8A 4RZSA 2YMQA 4MEAA 4ENTA 5BRJA 4EB6B 1DKLA 2WLTA 1RI5A 2CEAA 4RS3A 5BOSB 5FUVA 3KFLA 1JLMA 4HGZA 4LXQA 5FAXA 5E7IA 2UVDA 3AZOA 1JVNA 2GTIA 3F71A 3QU9A 4TTAA 2XCRB 3VPGA 1VE5A 3OIWA 4JBNA 1MGPA 4X93A 3PYLA 1Y6ZA 2BTEA 2Q5OA 1H94A 1OFVA 2ZSFA 4H1TA 3H11A 4DS3A 5BSKA 2WB4A 2ZETA 2AXNA 4BOYA 4XUDA 4UZFA 4MI1A 4ZI2A 1QBKC 1SUAA 3WNVA 3EWSA 3FPAA 3QA3E 2NU8A 3ZPXA 3BRWA 4U7FA 2IY9A 2OZKA 4E07A 2IKSA 1REQA 3UFXA 1XQWA 1XHLA 2ZRGA 4KV7A 4C1BA 3WNCA 3KOUA 2R25B 2D5AA 3AF6A 1MV5A 2GJAA 2F3RA 2HCRA 4ZI7A 4EGJA 2H57A 3CWCA 3RAGA 4G8BA 3TL6A 2EYUA 2J32A 3T61A 3FOFC 5CM2Z 1UBEA 2GJKA 2YRFA 5CDGA 5EEGA 3CX8A 4F97A 3B2EA 4OPMA 3DDNA 2XEDA 2OO5A 4YR9A 2NVBA 1J6UA 3BDIA 1XL0A 3PFFA 4FMPA 4LOJA 4OL9A 4IV5A 1TI7A 2B2NA 4DWWA 3HPQA 1PLKA 3RSZA 4E08A 4DUPA 5HG0A 3GBPA 5U4XA 3ZLUA 2V9ZA 2VHTA 3TD9A 4EHIA 2HK9A 1Y9AA 3NKLA 3TAHA 5I4CA 1VCHA 5IANA 1HNZB 1YCFA 3CVWA 2GNAA 2IV3A 2QN8A 2JAXA 2QU7A 3WWCA 1RRPA 3QEMB 1EUCB 3D8RA 2GXUA 4QODA 3D6MA 4QXAA 4JUAA 3W9UA 5HPYB 1XTTA 2PT5A 5LMZA 2HIAA 2JAWA 3NP7A 5E4JA 3UQYS 1PEDA 4JJKA 4NE7A 5BXYA 2VAXA 5I9IA 4D9CA 1ZNWA 2PGOA 4FYWA 1NKTA 2C8LA 4ML3A 1WMAA 1C7EA 2OV1A 3IHKA 2Q5IA 3HCDA 4PE5B 2D5CA 4H7DA 4BKMA 3MCVA 1IN6A 5DX1A 3MJDA 1QVWA 1OLUB 2APJA 1DTWA 2P75A 4ND6A 3ABRB 2HRQA 4PVCA 1KMQA 4JUFA 1BA3A 4L4ZA 3O73A 3C8MA 1MA3A 1JBKA 1WR8A 3GJSA 4Q1VA 2CNDA 2RONA 1XMQB 3IA7A 2ZWOA 4GKKB 4V0LA 3N53A 2QIOA 1LWNA 3I01A 3QV2A 4V1CI 4KIUA 4ZRDA 1P72A 1SEPA 1VP9A 5JH7F 4F96A 1DT3A 2PSEA 1AQUA 3HPRA 5KMGA 2X15A 2YYAA 4WCVA 5K2MA 1H3EA 4B6OA 3MTQA 4LYGA 1UPBA 1MB9A 1ABEA 1MO6A 2O5RA 1M6VB 3EFOB 3RTGA 2DF8A 1NDUA 4UREA 4RPCA 4UULA 2GLUA 4DMMA 3PRHA 1YRLA 3B5JA 3KVOA 1VKOA 2FPXA 4KXFB 4W7IA 5IZ4A 4ZZ2A 3CH4B 1SXJD 3KZCA 1UPTA 1WAMA 5CVCA 5FL7D 1R5JA 3L8HA 2KQUA 3KE8A 3LQ1A 2VWPA 4G4JA 4R16A 4TTJA 1U3DA 1YS9A 2C29D 3KWJA 3PXGA 2B6HA 1SOVA 2AZDA 4AO7A 3M6FA 5ER6A 2OO7A 2Z5FA 2PH5A 1XMSA 2B4AA 1XMXA 2CNWD 2FRVA 1ICEA 4LRUA 3PI6A 4EBBA 3LCVB 2TSYB 3FPEA 3ONVA 1M8FA 2HRDA 3P9NA 1IUKA 1RLOA 3O3NB 4HI0E 4KCGA 3TZBA 2P9TA 4K6OA 3WFIA 4DA6A 1PN3A 2RBEA 1NKVA 1UBGA 1XROA 1KXJA 4GR5A 3BAFA 4BP8A 4YAGA 4FBLA 1AV6A 3K2BA 4XFKA 3A6GA 2P5UA 3TGWA 1E2GA 1WHSB 2NPOA 1PJRA 1KY5A 1X1QA 4QT0A 4WL0A 3BGSA 3LYUA 2Q1SA 3GZ4A 2EW1A 4IHAA 1BD4A 3V4LA 5CB8A 2QRGA 2EIXA 1BWQA 2J87A 3K9HA 5LNK1 3RYFB 2NSHA 1ZUD1 2P5TB 5K3FB 3EMKA 1KKUA 2VT2A 4NR0A 3DBLB 4FFRA 5DTQA 3AB8A 2QNRA 1EVJA 1H2EA 1N6HA 3AETA 3NI2A 4LDZA 4NHEA 4Y2QA 1GQRA 3L8DA 4HQNA 5DCUA 2H08A 3NVDA 1UBOS 1MT0A 9LDTA 4FZVA 1I7SB 4HDMA 4R9RA 4INAA 3NYIA 2ACVA 1ZR4A 1E9FA 3OTQA 4TQAA 3TJZA 2P2LA 1TF5A 3EC2A 3VSCA 1UADA 1YR3A 1OXVA 2NTEA 2VSQA 4YJ2B 2NUTA 4TRNA 1JIUA 5FNVF 4RTMA 3AHIA 2ORED 2VK1A 3QY0A 4GLBA 1VTKA 1WXQA 4U2KA 2NUTB 4XWYA 5F3DA 5GGXA 1XQVA 2VJPA 3RBZA 2PFKA 4CHGA 3JSAA 4MKGA 4NCXA 3OSZA 4E3WA 1XJQA 1W75A 1ZJYA 2KM1A 2EX1A 3BTUA 1QHIA 3UK0A 1AG9A 2O2GA 1M2GA 4QNRA 3UWKA 4AYWA 2IS6A 4OBBA 1WEKA 2CFOA 2CUNA 2ZW9A 3A27A 2ZKLA 3VTAA 1KA9H 1TZCA 3E35A 3O9VA 4M22A 4NMHA 1U0HC 3SEAA 1X74A 4FMDB 4HN2A 3UQZA 1S9HA 2QX9A 4YQZA 3FPFA 1HA3A 2LCQA 5LP1A 2BCJQ 3I83A 3Q1LA 1TK9A 4S0ZA 4H1VA 4LI3X 1CHDA 3S2ZA 1ZK1A 4C6TA 5BOVA 3RVOA 2ZG6A 2XEXA 1U9IA 2G06A 1P4AA 4EUKA 5F12A 1X1DA 5JQGA 4EF5A 3AL3A 3DBHA 3GA5A 2X4GA 3GUUA 4AULA 4Z4IA 2H4YA 3IUBA 4BO4A 2YYYA 2GCEA 2JF0A 3IQDB 1N1MA 3NAQA 1KMIY 5L3VA 1G7CA 1TCUA 4RTJA 4L72A 1EE1A 2MYPA 3LDHA 3ESYA 2L82A 4C4PA 5KYXA 2HCJB 5KSWB 3K9QO 2XI4A 3SF8B 2W70A 1E18A 4X66B 2O9JA 2I4RA 5FH9A 2ZRDA 3ZDRA 4BO0A 5K3BA 3KZKA 5IKEA 4J0IA 3KALA 4BQFA 4EY7A 1BNCA 1TA9A 1N1GA 3HBAA 3W5JA 5F7XA 1BEUB 3QWHA 3CLSD 1ZGCA 3MBKA 4M8LA 1N3LA 1VLLA 4IKEA 3TIIA 2I54A 1L5QA 2G7ZA 2OHJA 3G2QA 4A10A 3OJOA 4BO1A 3VR2D 3HCWA 4GEGA 2UYOA 4ASUD 2IUUA 1DRKA 3TH5A 2OCKA 5AJWA 3CVVA 1P9NA 4MRMB 1UJBA 1R7RA 1DP4A 2OCDA 3HH8A 1NG1A 3WYCA 3HJCA 4GX0A 3G8AA 3PD7A 3CSDA 4LOLA 4ONEA 1MLDA 2AC4A 1Y1KE 2VEOA 2C99A 4OATA 1Y9DA 1ZGZA 2JL1A 5CHYA 4BNLA 1GPKA 2O2CA 2P6MA 3MMNA 1SUFA 1OI4A 4R8SA 5EQJB 1ZITA 5I3CA 3O74A 4PBRA 1BW9A 4L8FA 4C7JA 1VCNA 1TTHA 2CLEB 3AVPA 1JG7A 1J8MF 1H6CA 1S2MA 5JALA 1Z6QA 4P8RA 1N2GA 2OAQ1 1ZRMA 2SICE 2ZJ6A 4H1UA 4OGFA 4BZZA 2JKZA 1X1RA 1I13A 3RFCA 3ENQA 2D4HA 3WIDA 2XYRA 5C8DA 3LUDA 4GPTA 1YL6A 1VPLA 2VP9A 2H51A 2H9YA 5JATA 3AR7A 3VNRA 4P0PB 4BAUA 4A2PA 4EMSA 1I14A 4DMGA 4PR3A 4GVLA 1CIPA 4I6EA 2GO7A 4NAHA 2AIRA 3R7FA 1EVIA 4KV9A 1O5IA 3G0CA 2HPZA 3WDMA 4HDRA 4E5YA 2R60A 1WXEA 3O8CA 4Q4LA 2DPXA 2D7CA 1E1CA 1MO4A 5KNCA 1EXVA 4OX9Y 3ZKAA 4ZO6A 2Y0PA 1A8UA 2D1QA 5EUBA 2RGGA 3NHZA 4XOIA 3ZV4A 2N47A 4BC0A 3WHLA 1H0HA 3AHCA 2LVBA 2YH2A 5CLGA 1FC0A 5LSAA 3OE5A 1S2OA 2I2WA 4AJ4A 1UFKA 4Q3LA 3DO6A 3PQEA 3RNLA 1J0DA 3ZXIA 4XM1A 5JBNA 4U0JA 1VHLA 1Z25A 3PQ6A 4MI3A 4B6GA 3D2BA 2X14A 4K8RB 4L9SA 2YNMC 4N4AA 5ALOA 2WB2A 3VOBA 4TWRA 2A5FA 2QTZA 2QL6A 5DI9A 2IXFA 2JK0A 2NWQA 2YINC 3IIEA 3O4JA 3R5SA 3WKCA 4B2PA 5FV7A 1IZ9A 2ZYGA 3G82C 2RKWA 4P34A 4J29A 3S0JA 2VJNA 3UY4A 1QP0A 3KXDA 1EK2A 2PUBA 2QENA 4DUYB 5ELMA 4V2UA 5FB3A 3ZYCA 3ULKA 4RFVA 4US2R 2ZB8A 3LRXA 4MA4A 5DLYA 5THXA 5CNJA 4DLXA 4YDRA 1FBNA 1YR2A 2RGUA 4Q19A 4YACA 4B3CA 4F4IA 5TGTA 3RHSA 3WNQA 2HGZA 1B73A 1E7YA 3OZAA 4FGKA 4EKIA 3ECCA 2VTKA 4WLNA 1TA4A 3Q3EA 4CT5A 1F6BA 4QYIA 1DBIA 4O0LA 1IBSA 3I2YX 1BWSA 3PIDA 3RWMB 1P9OA 1V4NA 2IYWA 2XVMA 2AOXA 3ND8A 4OA8A 1IG3A 4CF5A 4QM7A 2C7QA 1OVMA 3MUFA 5ISMA 2C83A 2DP4E 2EAUA 3A6JA 1PG2A 2D0OB 3NXKA 2M9MA 4HX9A 3ZE0B 4ZEMA 3QFFA 2QN7A 1UBFA 1XEWX 3D8SA 4EAQA 1KFCB 4Z9FA 2ID9A 3CVOA 2AHRA 1DLJA 5KYGA 5CAEB 2PKQP 1G9TA 1PCXA 4OA5A 4F8YA 5IAGA 5KAPA 4L6AA 4FXOA 1NJGA 2XE4A 2VDNB 3E7XA 4JVMA 2P2GA 1Q0LA 1JIJA 4M87A 1J42A 3HM9A 1L1FA 4Y67A 3R7BA 1P17A 1GUBA 4G41A 3ZHRA 3ZK9A 5CITA 3ZW8A 2ZIWB 3S68A 5FI1B 3ZY5A 3K0FA 4ZI7F 3LF2A 3UNXA 4QJ4A 3M6VA 3MWEA 3OM9A 2C5EA 2Q5HA 1O8CA 3KFXA 1YZNA 3VQTA 3W4IA 3ZQJA 3MWEB 1NBMD 4KYVA 2BE9A 2EZUA 2Q50A 4D9BA 2QRKA 1RXEA 1ZSVA 1FF9A 2B8JA 2M98A 3HEBA 4RJJA 4OI1A 5ADVA 4XDHA 5LP6F 2Z04A 4B7CA 3KUUA 5GONF 5TSDA 3VKFA 1ZVKA 2VWQA 4O2LA 3WL6A 5DCLA 4BLQA 4PPFA 4R7TA 4DILA 4LY9A 4XVCA 2NZVG 2Y1XA 2W9XA 4KWCA 5FBKA 4D6YA 3HJTA 1ZN9A 1FEZA 2BKAA 3AVWA 3GLRA 3MOSA 1E5TA 5HIMA 3PHGA 3CJQA 1G3IA 1PS8A 3NKVA 5SY4A 2O8CA 2P4SA 4DSTA 4OSOA 2JJ1D 3DMNA 4JJ8A 5AXAA 5B57C 1VKZA 3OLYA 4JBHA 2QMUA 1U3VA 3VKHA 3CIOA 3GMIA 1ORRA 3DCYA 2ALJA 4V39A 4A6PA 3HNPA 5HVNA 3U5TA 1S8OA 4J9UE 2IJGX 5EMNA 2G88A 3J7AC 4TYWA 5NULA 4NEQA 3AUSA 1GZ7A 5B6JA 1Z2OX 5KOJA 1FPMA 2V1XA 1J00A 3A14A 2QJTA 2YY6A 3CEMA 3OX4A 4X6UA 4ZAXA 3UWMA 3EHDA 4C0JA 1VKHA 2H5IA 3AX6A 3SI7A 4L9RA 1RVDA 1HDEA 4NK4A 1D2NA 1JG3A 3DHEA 3ER9A 1E0JA 4GMXA 4GX2A 3WKDA 1KJQA 3HCPA 4XPIB 4EUEA 5KWEA 4D82A 2PRJA 4WW0A 2VDOB 5FTJA 2XQGA 2EJVA 3KEQA 4LDQA 2QM0A 1VLQA 4MPTA 2EF1A 2CSUA 4DPKA 1EFPA 1OPXA 3QU5A 4LYYA 4QECA 1XVAA 1IWPB 1JECA 1PUJA 1FE8A 3ETLA 4RELA 2XVYA 2X2EA 3UCFA 2YJGA 3PVZA 4UBOA 1IC6A 2ZI5A 3GEHA 2VXBA 2FVYA 4Q9JA 2MU1A 4EUFA 1NP6A 3C1OA 4HL6A 4WZAA 3TOSA 4EZBA 4RADA 2QX8A 5CLHA 4ZT6A 1N77A 1C7RA 1DQYA 1S2IA 3JYPA 3QFCA 4ZO8A 1SVOA 2C61A 3B5IA 3W5HA 2YYZA 1S01A 1NMXA 1Z08A 1JQDA 1ZISA 1ZSYA 2Q5CA 3EDRA 3Q5EA 1QIIA 1VLHA 1ZIOA 4GBGA 5DTRA 3VHQA 2X1HA 1W34A 4HS9A 3LAWA 3S1SA 1CKEA 4Z7OB 2WTMA 2JGJA 3PC8C 4MYDA 1PK7A 3IQWA 3TINA 1LBSA 2HB6A 3SE7A 1N2SA 4NFYA 4R7GA 2WFAA 4G5YA 1OZFA 4ZYVA 1T6YA 2JIZA 2VS1A 4NV3A 3TOCA 4R0VA 4RGBA 3GFRA 3L43A 1E9BA 5T67A 4Z1MD 1FJHA 121PA 4BLPA 1G7TA 5J23A 3JQAD 4YI3A 3I58A 4GPD1 2O3RA 4HX5A 5FAKA 3FCSB 3HTXA 2XVXA 4RDHA 5C4GB 4DUGA 2GQ0A 3A06A 3RSGA 2ZRFA 1SELA 2IL1A 3NPMA 2GAIA 4REQA 5DLQC 1XRLA 3RS5A 5CA1F 2FDRA 2AX3A 1FFXA 1SCIA 5MDHA 2BJVA 3L8CA 3IPCA 1GL3A 2A9JA 2VWHA 3UCEA 3DL2A 4QBGB 1USKA 1ZGBA 2FAXA 2GS9A 3CKLA 3H83A 1I4WA 2XKJE 4YAWA 4JD5A 4TVKA 4FOSA 3K0EA 4OUDA 5EXXA 4V0RA 5KB3A 1YWGO 1LRJA 1UOPA 4M99A 3FOWA 4JLJA 3WWOA 1W1UA 3ANNA 3M1LA 1DOZA 1ZFNA 3BG5A 1J56A 4PCUA 1ZMBA 4FMCB 4BVJA 1QYDA 3HXMA 3U3ZA 1CD5A 3SE0A 4BKPA 1T0IA 4DXHA 2PA3A 2QVBA 1K27A 1M2EA 1RW4A 3ZR4B 1I7NA 5FWXA 2JD1A 5BMVB 1VI5A 1V8FA 1BTOA 1RZVA 3HJBA 1N3YA 3K73O 1TRHA 3Q12A 4HWTA 1N1DA 3H5OA 5AVJA 3BT7A 4N6NA 4CM9D 3HYRA 1KAQA 3ZN2A 4M0KA 1ODSA 2C5BA 2VFAA 3RTEA 4ZV7A 3OC0A 4UTNA 4OQDA 2R84A 5BQ5A 5I4KA 1MNAA 3JYHA 1U94A 1YULA 5AKJA 4MHOA 1NASA 1M67A 4R31A 1S3GA 1CNMA 3BREA 3OQ1A 1VG9B 2CHGA 5L3ZA 4CEHB 1Z47A 3W9SA 5EHXA 3FG9A 1GAEO 2FPSA 4LEIA 5AIAA 1YQUA 1I3NA 3I2HA 3BGVA 4D3XA 1OYVA 2A0KA 2EL7A 2WJHA 4B3BA 4Z4EA 1K06A 4YMIA 5IVPA 1PJ2A 5E0KB 3ZI0A 1E1MA 2VHZA 5AXDA 3TNDA 2FX5A 2JGLA 3WLFA 1Z7GA 1G2OA 4NJOA 4ZQGA 3B6JA 4O5AA 3CNBA 4YMVA 1YS7A 2Q41A 3HKEB 3K4PA 4UVDA 4W1RA 5DJ5A 1N5OX 1T4BA 2XB9A 3ROGA 1CZUA 1FFCA 1LGYA 3ZWCA 3CURA 1AKTA 5EQTA 5HFJA 3U3RA 5E4YA 2PZBA 5CFOA 3G5AA 1P19A 4FDTA 4JB8A 1SCUB 1Q3KA 2CNKA 3RAPR 3ZD6A 2OQIA 1NVAA 3KIPA 3W79A 1ZUHA 3QUCA 1T3GA 2E4WA 3TVTA 1YC2A 2PUWA 3KPUA 1RAFA 4PGGA 5DGDA 3SZLA 4XTRA 1E2EA 3N6XA 3UB4A 2X9LA 1GPBA 3H5IA 3ZXXA 5C8VA 4LKOA 2PRKA 3KZVA 1H22A 4P4SA 3UANA 3DMRA 2BUBA 4AS2A 2OXCA 3ETHA 5FOQA 4IYJA 4WVFA 1ZUNA 3F9RA 2H0QA 5H9VA 4ETNA 2CMHA 3DHYA 3PSHA 4KX5A 4ZYTA 2E82A 4HAIA 4OLJA 1KRHA 3HV0A 3FNHA 4CKCA 2QQ0A 3AINA 3B12A 3RF7A 4EYOA 2NU7A 1E58A 4E5PA 5AVYA 2IXAA 2J9FA 2ZYHA 3ZDFA 4NVRA 5FWAA 1C9EA 5LKAA 2HXGA 3IP7A 4OV6B 5AHXA 4DV5B 2BIFA 2HRRA 2J9FB 4HJRA 2CVOA 2CLIB 3R3WA 2JEYA 2FWIA 3ZW7A 4DVJA 5KTSA 3AWDA 1KWKA 1XEAA 2XE7A 1MENA 4K8OA 3ROEA 3V1TC 5I9LA 3LFUA 3LECA 5A4IS 2BI8A 4AM8A 4H17A 3ZU6A 4YJ2A 3H2KA 4RBNA 3OFNA 5AQ1A 2HWWA 4G63A 1WBDA 3OZ7A 1L7DA 4IVRA 2BRUA 3G2KA 4JLOA 2JEOA 3T7CA 3VXKA 2N46A 1GZ6A 3I23A 1JHMA 3IOBA 4QBIA 4P5DA 4DLLA 1LRLA 4ZT5A 2POCA 4M83A 1I4LD 2RBKA 4N54A 2V7PA 1XG5A 5JMTA 1O4VA 4UE6A 1X1AA 4TXJA 1D4FA 4R81A 1T2UA 4INOA 3JQ9A 2DPGA 4GI5A 3RGWS 3U7EB 2RI1A 4JAVC 2YIVX 2XA9A 3ANMA 3KYBA 4H0NA 4KSCA 5JD4A 2QMHA 3ZXYA 1FOEB 2ES4A 4NDZA 2JARA 3ODPA 1GO2A 3OCJA 3WISA 1C1DB 2X6RA 5REQB 1QQ7A 2G28A 3A9SA 4B3DA 4TV9A 1XLTC 2AFVA 2Z56A 5LVAA 3KUCA 3W2FA 3W8EA 3OEWA 1XR3A 3L77A 2H9IA 3MS2A 1S3IA 4TV9B 3TZLA 4JYMA 3HCRA 3OOWA 4ROSA 1QHXA 4MGIR 4PRLA 5AJUA 1ZBQA 3CLUC 5K4AA 5ESDA 3NAGA 2CV1A 2GEJA 4HH4A 4CQNA 3O1IC 2VJBA 1EUZA 3K8YA 2WU0A 1YQTA 1QC5A 4G09A 2RFLA 4GGOA 4QPNA 4TMXA 1Z39A 2YWFA 3N0VA 1GPMA 3K1YA 3DVSX 3QVSA 3OD1A 4S12A 4CF4A 2JCBA 3R40A 4DSUA 5KYUB 3L9WA 4AJNA 1AUQA 3C3MA 1NNLA 1VYUA 4N7MA 1MW8X 1JG4A 1NE7A 1U2DA 1XU9A 1I4EB 2Y0CA 2J59A 2IUTA 2ZTMA 3FHTA 3H75A 2G9QA 4P54A 2Q9CA 5CYFA 1UWCA 1MB0A 4OY3A 2Z2ZA 4JMLA 3VYRB 1G0NA 1MABA 2X9NA 1ETUA 3RSLA 2VJOA 1C3VA 3LT0A 3WGUA 2WABA 2NO7A 1LF0A 4DUGD 1CF4A 1W5BA 2V3CC 1XP5A 1JAZA 3IODA 2HF7A 5ETJA 1QG0A 1ZPDA 4IJVA 4A9AA 2YOFA 1DTWB 4BDTA 4JL6A 4TRJA 1V39A 3STHA 4B79A 1D6JA 2XYQA 4M1TA 4MR9B 4JQCA 4PZLA 4DJFC 4UEOA 4C4SA 5EUMA 3ZDYB 2VCHA 1DBWA 1NMZA 4O2BA 1G8KA 1RYYA 2ZPAA 3EUEA 3VDQA 4MDEA 5L3RA 3CO0S 1U7WA 3REGA 3TFQA 1Y7LA 4W9MC 3IAS6 1CZHA 5BN1A 5CFMA 1CE8B 4ZAVA 5HJEA 2CL5A 3H17A 3UJ7A 3AXSA 1NN3A 1S4QA 2QG4A 2GLTA 3B1ZA 4H6XA 1AGXA 1I2ZA 3HXLA 2KSQA 5C8XA 4BIMA 4LY3A 2ZSKA 3GT4A 4I5IA 4CG1A 1WPGA 1DUSA 4JA2A 4PHCA 5DHAA 1LPNA 3MBOA 1RP1A 3CZQA 3KPYA 2Y9MB 2V97A 1T13A 1A8QA 2XYHA 1TLLA 5T4EA 3TBHA 3WL5A 2YY5A 1D07A 1RE1A 1UBSB 2C95A 4JKYA 1KOJA 3PPXA 3DJYA 1P62B 1PGJA 1WM1A 1B93A 1EXWA 1P5JA 5DHRA 3QYFA 3EPHA 2RHRA 2FN7A 2W6PA 3ABOB 1E2KA 2OLEA 2I4NA 2B7BA 3IOCA 4LNUB 4WCFB 4X1YB 3WGOA 3WLEA 4YUXA 4C2UA 1IMJA 3BX1A 4RD3A 5AKKA 3RM3A 1LLUA 4HHEA 1O0CA 2HHHB 4PFSA 3M2TA 1P1FA 2BEWB 2VXOA 2IZZA 4RV5A 4AY3A 1DIHA 1GGJA 3G49A 3D7RA 4JDUA 4YJFA 5J63A 3UC5A 5F73A 3WGHA 4D9FA 1VCMA 1UAGA 3R0XA 2VSNA 1KBQA 1FS6A 1PV2A 2CYCA 2SHKA 2WV7A 4PYRA 3HLKA 4PYMA 4AT1A 4I2VA 4GVPA 5CT8A 3RWOA 2H1FA 2PBRA 3ZY3A 3KAJA 4DG8A 7ADHA 4BE7B 3VPHA 1CUAA 1LBTA 3ZWVA 4AUMA 2XNDD 1GM5A 1OZ0A 4AY2A 1KJJA 1TAHA 1O95D 1FYWA 1Q21A 1BGWA 1EYZA 4RDIA 2FXVA 3IAM6 4UMEA 3ZVMA 3IDQA 3P27A 1CRLA 2D13A 5ER9A 1MIOA 3SZOA 2K7ZA 4GLLA 1AKEA 2IEAA 3G2IA 3NVAA 4MJ7A 5JD5A 2L0XA 4O2BF 4B44A 2AN1A 3ONWA 1HDIA 2BR5A 5JNSA 1XCLA 3CR3C 4IMPA 5JTTA 3U4MA 2PQMA 1NVVQ 1JFFB 2QIPA 3EODA 3IOMA 2Z6AA 1GZ4A 1R6XA 2PAFA 1IN7A 4IDCA 1YS2X 1KQ3A 2B7LA 3KE9A 3Q6NA 4A15A 1RXSA 2ZJ3A 4WNYA 1NBWB 3PNYA 3EF1A 1GUAA 4IFIA 1HF3A 1P2SA 2NO0A 2VQSA 1TQ2A 2DVMA 2X5XA 4I0WB 3REOA 2DWCA 2R5FA 3DHWC 2H1WA 2QP9X 2WK1A 3GIWA 5LZ7A 3NXSA 3SCZA 3ZHOA 4A1OA 5BWOA 4OL0A 3LW8A 4XQ9A 2B8WA 2F55A 1E2DA 1H2WA 5LNK6 2GCPA 1JKJB 2BGIA 4LMBA 3TLGA 2GN4A 2VT6A 1DZIA 2FKAA 3DDUA 4DEXA 2D7JA 1XU7A 4M9XA 2E4UA 2IXGA 3SKYA 2WNHA 5AI0A 4D9GA 4KK3A 4H2DA 4DVGA 3NM5A 4KUGA 5AUOB 1YQXA 2DCUA 4DSNA 2C5FA 1WP9A 5JHGB 4WK2B 3WLPA 3VMMA 3TG2A 2I7DA 5MN4A 2YZKA 3FD8A 3WYAA 4HO1X 4F7DA 2QBYA 2W2KA 1PE0A 4HEA6 4DARA 5HIKA 2OR3A 1RJ9A 1G19A 3LWNA 5LN1A 1FQOA 1NVVR 2QV7A 1RXIA 1YD7A 2BR3A 3BERA 1IPEA 2BWJA 2EXXA 2CD9A 2O8FB 2FDCA 2QXYA 3LCCA 2XUJA 5IKXA 3L79A 2QTVB 2I7XA 1KE2A 4WVLA 4AAYA 1G6OA 4KH0A 1R10A 4EEXA 1QGAA 1OX4B 1IHPA 3I73A 4OSEA 4BEVA 4W1SA 4YMLA 2QJFA 3FOAA 1TYCA 3L1VA 1TF7A 1NW8A 4WNIA 4E32A 2ZYUX 3KKMA 5FI5A 2O8DA 4C4RA 4LWZA 4YQYA 3IURA 4YONB 3PX2A 4KEAA 5JD3A 3TE7A 1G17A 9ATCA 4OXQA 5L4NA 4R2LA 5TXGA 4DDKA 1I8TA 2WG1A 2RHBA 4REOA 3AYXB 1E2LA 3N0XA 1X19A 2H92A 4FONA 4EGAA 5K9ZA 3CNEA 4DL9A 1NXTA 5CM8B 3B3QA 4BRSA 3PKIA 1QHEA 3HY6A 3MIIA 2FW0A 3KVVA 3RRBA 4GZMA 3R0VA 5ES4B 4HFJA 3ILYA 4CMGA 3R3UA 3A10A 1Y4SA 4JC0A 4AY4A 4B3HA 5IJ0B 1WV1A 4JFRA 4NNPA 3ST7A 3A3PA 2FFRA 3UJ6A 1OW3B 3GRAA 4R01A 1V9LA 4P7JA 1SZJG 1DBSA 1KMHB 4ZARA 3UJ3X 1N2ZA 1YOBA 2BGGA 1B8PA 1GN8A 2X58A 3AUKA 4GXQA 4EG3A 3E9RA 2BFFB 5KTTA 3TXAA 4PV7A 2W93A 3F4BA 4HYYA 5CA0F 1F9EA 2I9PA 3NRCA 2J0UA 4NMXB 1AH2A 4Z9BA 3L8ZA 3LX6A 2QLJA 5FJJA 3WFJA 4KR2A 1TJ4A 3B1YA 5EWJB 3D9QX 1FUYB 1N2OA 3CMCO 4Q1CA 3KR1A 1IY2A 3U6KA 3V1NA 1JKFA 1Q0QA 4DV0B 3ZTYA 1VGQA 3ZWAA 1PT6A 1VSUA 3LX8A 3DVQX 5DLPA 3AOGA 4GBMA 1Z74A 3H0CA 4EPWA 3UIEA 3QHPA 3DR5A 4HGRA 3I4CA 3ECSA 3Q8LA 4REMA 1QVRA 2QZSA 3MWYW 3PR1A 5CR9A 4EELA 3GLIA 4B81A 4LNHA 4YP7A 4JP2A 1E1KA 1R88A 4Q37A 1FFHA 3MGBA 5CIQA 5NLLA 2YXNA 4J7AA 1WXWA 2A14A 2PBZA 5DO9A 4DR4B 1ZP6A 2JAPA 2RBGA 4GC5A 5TLSA 2Z3ZA 4R3NA 1YDGA 3I6YA 1SIWA 3RYFA 5KTMA 2FCRA 5IFLA 2BGUA 2O5VA 4EYEA 4HWSA 4I3FA 4DYHA 1ULSA 3P9XA 4ZO4A 1WLYA 3CFYA 3HB5X 4BE4A 2LE0A 3LQFA 3FZNA 3Q7EA 1QWOA 4JVNA 4WOCA 3S2IA 1IL0A 1PV1A 4A3SA 2EKLA 4BGVA 1OI7A 2QD3A 4HAWA 4D9HA 1C3JA 1UBCA 4J76A 4X1KA 3K09C 4Y6LA 2HQSA 5EKTA 1N7GA 4H1WA 1WMFA 4D3DA 3OWHA 2AN4A 4UC0A 1EK1A 2B1QA 5JH7A 2GXQA 4D2IA 5J40A 3D4PA 5HJ2A 2XOXA 1F2DA 1TW3A 2C4NA 2OZLA 2W6ZA 4NRDA 5DCWA 5E6SB 5BO5A 2ZWMA 2XMRA 4JJGA 3UBMA 3DAOA 1M1YB 3RBXA 1AF4A 3VC3A 3N8KA 1NLFA 1GZSA 3ETEA 3NHKA 4N5MA 1XSEA 4ILEA 4EF4A 3I6ZA 4AZWA 5BUSA 3CC8A 4JLPA 2I6FA 4IUBS 1AO3A 1G3MA 1Q1ZA 3L0ZA 5KWVA 2P35A 4MUYA 1A5SB 5HM8A 1NVGA 4JLUA 1JSRA 1SG0A 5EFOA 1Q1EA 4EG7A 1RJEA 3FGOA 4CLOA 3KYCB 2B5VA 4FR5A 2JBHA 2PKWA 1LJ8A 3ABZA 4I4LA 1JQJC 4PO8A 4A0SA 4BB0A 1SCAA 2B6NA 1WZ2A 1OX6A 1RRCA 2XECA 2QK4A 3JAMA 4C6TB 1MZVA 1RJ9B 2FSVA 3QEKA 4JVOA 2RH8A 3NFRA 2VHXA 3TD2A 2ZYDA 3PUIA 1AKUA 5ILGA 3NC1C 1HT0A 3GVIA 5D01A 3O93A 5BYJA 4ENUA 3I09A 2YFQA 2QSZA 2EGGA 2AWNA 3E81A 4OFBA 3L5KA 4CE6A 1Y5RA 2VNJA 2WJPA 1E66A 4CUZA 1YGPA 1GHTA 1GCOA 4JWTA 3Q7RA 3GC6A 4BMSA 3LCJA 5AM2A 2ZCJA 4LDNA 3T95A 3LA8A 5IBQA 2IW1A 1OX4A 3T3HA 5IVKA 1UZAA 5KNDH 3RRJA 2QRUA 4IRUB 3ANYB 3BJMA 2HBRA 3V8EA 5F4ZA 5HF9A 3G5TA 4ERXA 2GPYA 3G2PA 4YB8A 4QARA 2QTNA 1RKUA 4NMWA 4F3YA 3BGOS 4JBWA 4YAUA 3EPJA 5EHNA 1VB5A 1H1LB 2OD2A 3ZCVA 2IYSA 4BKQA 3VYSB 3R8FA 1Z5VA 1Z5NA 2WILA 5KTNA 1E6LA 3A9VA 3JZMA 1CEYA 2JFYA 4BHTA 3U19A 1FCJA 4R1QA 3AWIA 5BSUA 1CUGA 1IBRA 4MRVA 4PCLA 1XDGA 2HRZA 5T3UA 3VR6H 3X1ZA 3CX6A 5BWNA 1RRKA 2NU9B 3OPVA 1JIVA 5TQ2B 1R0SA 3A28A 3AF1A 3E7DA 3VVMA 3PNSA 5HUHA 3OJXA 1P0PA 3D59A 2X42A 2Z2YA 1NR7A 1Q3TA 4RTRA 3BIWA 3Q0EA 4LYDA 5AT1A 4MX8A 4QEDA 3W7VA 3AY7A 4WKPA 1XXHA 4I4TF 1JNXX 2CUTA 2FX2A 1U28A 3RJ5A 1C7IA 3CSSA 3IHWA 9GPBA 1AS2A 3M2PA 4PYJA 1ZRNA 2HJRA 2QR2A 1R9NA 1V9SA 3AM4A 4MEBA 3D4IA 4KVAA 5CEEA 3OZRA 5SY9A 1Z17A 3DTYA 1WJGA 3VOTA 5I6DA 1LRKA 2WTBA 3STVA 4JLAA 1P60A 4F56A 5IJZA 3S55A 5C34B 3WK9A 4DKJA 3R9XB 1CULC 4QUGA 2IUEA 4X8MA 3ZJ5A 2VK2A 3H4IA 1JE0A 1FTGA 3H6GA 1K6MA 1CLUA 1GKYA 1QOQB 3D0QA 4K1XA 4XSVA 5IHPA 5ALZA 3L05A 1Y4DE 3KG2A 1RQGA 4BLTA 3PUXA 3HO1A 1OD6A 3FCYA 1U1DA 4NH4A 4UNIA 1M2WA 2XZDA 2V98A 1G55A 2R7LA 4DCNA 2YWHA 4OXYA 5ULLA 2ETXA 3KAKA 5EAIA 3T1NA 3UB2A 3I6QA 3UEOA 3DO5A 3ZWNA 3QYAA 2W42A 2AC7A 1JYEA 1P7WA 3A6HA 4FBMA 4IIHA 2I1WA 3BSYA 3SD7A 4A2CA 4C4ZA 4E88A 5KU7A 4B4DA 3N8HA 3EXHC 3NTQA 1YMVA 4FFDA 5GM1A 2VQFB 5K3EA 1I2DA 4AJIA 4FHEA 2HSJA 3WO0A 2W6CX 1L4HA 4OD0A 1UXJA 2D0DA 3HR7A 4EW1A 3Q72A 1AT1A 4JLNA 5E6SA 5AI8A 4DIBA 3J80A 4WMLA 3N0RA 1U3WA 1XQ1A 1ZCJA 2C4KA 1ZO8A 4D99A 3E5NA 4WN3A 3T9BA 1G6Q1 3GQVA 3JS5A 1DKQA 1ESNA 5JYBA 1YR6A 1WHSA 3JSXA 3AHJA 2B9EA 3GDOA 1H4VB 3LPAA 5ALUA 5K0GA 2XR1A 2ODTX 4UU8A 3JTMA 3CF4A 2DLCX 2W6NA 2ZSEA 2GK7A 3TN7A 4WKGA 1B0UA 3RUEA 3COWA 2DY0A 2HIGA 5CJJA 4C6HA 1TVMA 1VJRA 3BE4A 1QV7A 4TTRA 3T7RA 3A7EA 4REQB 3VX3A 1ULTA 2Q6VA 3U7RA 1F2VA 4LVCA 1T4CB 2VRNA 3VAZA 2F1JA 2GR9A 3BHNA 1LK0A 2VLIA 3M3DA 1T3LA 4HGNA 4LZOA 1BROA 1Y7IA 3STXA 4XRRA 2G1UA 1WMSA 2X77A 1W1IA 1DIGA 2PL1A 3HWWA 4R1OA 1JX6A 4JUIA 4RWZA 1BRMA 1SRQA 3ILVA 4TXHA 5FT9A 1BMFD 1BQ4A 1Z0DA 3WLMA 4F8EA 1BXKA 3SPXA 4DCMA 4EPRA 4KSYA 2XGMA 3RKSA 1TQ4A 4PYOA 1AURA 1JFSA 4DLSA 1VLJA 1GRCA 5AVZA 5KI6A 2OCPA 3G8BA 2X4DA 1SCQA 2XXBA 3FETA 4NENA 4PXYA 4PX9A 5BMVA 3RKUA 4YO8A 4EYSA 4YIKA 5KO2A 4PHHA 3N0TA 3I34X 4M76B 5KQSA 3ROPA 4I3HA 4WBNA 1KKLA 1QV9A 4UW9A 4NESA 3IEKA 4W9NC 1PWHA 5E3HA 3KHKA 3U56A 1ZIDA 4WBNB 3MEQA 5IHXA 5AVUA 4MRPA 1YMQA 4A6DA 2FMKA 3HFJA 4I1VA 3H4VA 4PRYA 4RZQA 3KLNA 1GCGA 3UT0A 3B8HA 4WNAA 1RYDA 1R27A 2AKYA 3KUDA 1CG6A 4IWYA 2PIDA 5FWDA 4BO3A 2EFJA 1N8SA 3LQ2A 4J3FA 4HDNB 1BEZA 2NU6B 4JR2A 1V35A 1FW8A 1KI6A 1TYAE 4L4YA 3E61A 3LQ4A 4B80A 3CN7A 3ERCA 2C7BA 1A5TA 3STUA 2NU6A 4O2AA 3DFIA 4CKEB 4KXVA 4FEEA 1XEFA 1AXGA 3DUFB 3KTOA 5LA6F 2RH4A 2Z3VA 1J0XO 1EFLA 3IVMA 2BFCA 2OXTA 1CS0A 2O8EA 2BN4A 3QYPA 4D92A 2JFHA 1YDMA 4HR7A 4EY3A 4R5MA 4GRIA 3AP1A 2O8EB 3DTVA 4GLJA 3TLMA 2LXNA 2PMKA 3BSWA 3IDFA 3L7CA 3PQFA 4UM9D 4DJDC 5F21A 4BFUA 4QPJC 5CYGA 5KYWB 4DDWA 2XMDA 4M9SA 4YPOA 2V9PA 2M6KA 3OTHA 3FOEC 4GGMX 1TJPB 5HKLA 1RS0A 3LXUX 4M7RA 1RMYA 4BV2A 2EVWX 1JJVA 1J99A 2BP7A 2Z1DA 3ONFA 1JAYA 4OJTA 5FIUA 1U1EA 1YKGA 5B7QA 4CL8A 5UKDA 1IQRA 1E1RD 4V2IA 3FVRA 1YHYA 2HA5A 7MDHA 3AQ4A 1PYDA 2JK1A 4XJVA 1T5DX 4GICA 1ZGAA 1KF0A 2YBEA 5GJVC 5DZSA 1QGED 3FOCA 2AQKA 2WSIA 4JK3A 1TC2A 2MWMA 4OJNA 4U02A 2CHVA 3CG0A 1VPEA 3I6BA 4RGYA 4PZ9A 4ON9A 3J81A 2C59A 5H02A 3P9CA 2CK3D 3OOSA 2AFHB 3OZCA 1LUAA 4ZJYA 2AE2A 5AW9A 3GGJA 3VC1A 3RSSA 5FR2A 1UDWA 3QP9A 3O3CA 2JAUA 4OGGA 2QLFA 1YAJA 1Q7EA 3UMJA 1CFZA 4WZBE 2PBLA 4GBED 1MFPA 5B53A 1JAIA 2HW8A 2R9VA 4GKBA 3AJEA 4K9DA 4LTNA 2R6DA 5KTRA 1R4NA 4LISA 3W2GA 1X1BA 1TUBA 2I2DA 3UYLA 3O75A 1X80A 2AKAB 3LKDA 1JPVA 3O8OB 4CQMA 1X94A 3WLLA 1GGVA 1CJUC 3SOPA 2JJMA 3VYUB 4J4BA 5FF9A 1KJIA 1CR2A 2CHUA 3FUXA 3MT9A 3OM8A 1R6AA 2AZXA 1ZHFA 2OT3B 3ZE6A 4ZZIA 2V74B 2NZ2A 4X61A 3UICA 4E51A 5CCBA 2GJ4A 1Q1AA 4ESEA 2HDOA 4RK5A 2P9ZA 2FOXA 2GBPA 4BNJA 2D2IA 1PT7A 3C24A 3RLFA 1QIMA 4P3OA 4UTPA 3WL3A 1LBHA 1N7IA 5EJIA 1AVTA 3K0KA 2PUEA 5ICGA 4YPFA 2ATVA 1SN7A 4EKYA 2O5EA 2LIPA 1GSHA 2B78A 1IHXA 5E3IA 2J1LA 2QQ5A 5AKYA 1A98A 1MFZA 1NNSA 4DR1B 1JQBA 3AU8A 2WTUA 4BNTA 4CIVA 4RF4A 4JJFA 4XX0A 4DCGA 2XZOA 5SYAA 3VZQA 2C5AA 3U4QB 1BOOA 1KSFX 3KNZA 1PKXA 1TNDA 6YASA 2J6BA 4LRYA 2C1ZA 4N9WA 2JFVA 3D4BA 4U7DA 3U4QA 2Q2OA 4IQ8A 4HSGA 1G66A 1L5RA 1JIKA 2QTGA 2EKBA 2WTAA 4FU0A 3J7TA 5FL3A 4JELA 1GNSA 4CGYA 4EENA 3E9CA 2PKYX 2WJYA 2P6PA 4LNAA 5CJPA 4U8GA 1IUNA 4I1PA 1I3MA 1P91A 2RGNC 2QMZA 4GAEA 4GNRA 1E4VA 5GZ3A 1GN9A 4O63O 3RG2A 3C7TA 4CKBB 2FKNA 2XGGA 3B1VA 2M2IA 3EIUA 4TT3A 4B85A 2FQXA 4L3VA 3IQFA 3K6SB 2JJ2A 4C21A 1EA7A 2QW8A 4H35A 4ND2A 3M5DA 2KBFA 3T7TA 1IN5A 5KYYA 1UFQA 2P1DA 2ZT7A 4O4LA 1HQYE 4Y98A 1N4AA 3VHLB 3DDWA 1KAMA 3I2KA 4H7JA 3MIZA 1KZGB 1G38A 1KI6B 3L8EA 4GM0A 2WMOB 1WCYA 4ZDKA 3DYVA 1GPWB 1RYFA 1UMCA 5DRYA 3MAGA 3E3OA 4BUJA 4MR9A 3ZHVA 4YUYA 3A9UA 4WNCA 3AIMA 3W8RA 3QFHA 4M1YA 2PVCA 4R6XA 4XIGS 3ZHCA 3PFCA 5M34A 2OK8A 2ID7A 3EIOA 3LCRA 4MVJF 3VR1A 2AE1A 4DQUA 1U99A 2ZSJA 4DT1A 3I8OA 1MVNA 5I8ZA 4YV7A 4LA4A 3COZA 1XPUA 3PGLA 3LPDA 1FVXA 2JH3A 2OV3A 3D64A 3UAOA 2H65A 4B83A 3OOJA 1B2LA 1GTMA 5AKZA 4NMMA 1CXZA 5C35A 4MJXA 3FDZB 1G0OA 3WLAA 1CUJA 1GG9A 3ZGOA 1XQ9A 2JRCA 4RDCA 2V59A 4EL5A 2HDHA 2UYGA 2X8AA 4GMHA 1QJCA 5JWHA 4S1NA 3SZGA 3ROQA 3TMKA 1IN1A 1BG6A 3DEZA 5CIYA 1W49A 5ES3A 4D9IA 3PHBE 4PLPA 2GBIA 2CXNA 2G70A 4S1WA 3UGJA 4HLCA 1SVSA 5FRDA 3SX0A 1U2PA 1VMEA 5A5VA 1ESZA 1SC1A 3TF5A 1UMBB 2HWUA 3KKZA 3T7AA 4YAKA 4MWSA 2Z1NA 1BKDR 1RAIA 1T9GS 3HHPA 4O4IF 4NU6A 2H4FA 2JGNA 4WGFA 4QOFA 5KHAA 4BVGA 3TPZA 2JGEA 2W6QA 3ROXA 3E23A 4EMTA 3WLNA 1H8HA 3RTAA 3QJ5A 1GYRA 1TDJA 2XCLA 1A4IA 4QSHA 1V5FA 3OCVA 2JLVA 3JD0A 4KL8S 4OP3A 4QRHA 3STTA 5LZ4A 3FTCA 3IP9A 3PF8A 4URYR 4ZEWA 2XLBA 2PRYA 1C1XA 2GA9A 3NIWA 1UIRA 1IEVA 1V95A 1EE2A 4YCSA 2A30A 3FLBA 4FFNA 1M0WA 2OHGA 4E14A 3VZCA 1HZZC 3WA7A 1DT5A 3CLRD 3NRJA 3HDHA 4RH3A 2F8LA 4FHCA 3JQ8A 3WQHA 3PWTA 2YQ5A 4FM9A 4C1NA 4RK0A 3S1AA 5E2IA 1PVVA 2HA2A 3QITA 4Q4HB 1A69A 2OA0A 1PAUA 4LJ6A 1PNQA 4KRXA 4Q9KA 1F0KA 4LRWA 4Y6GB 3QJYA 1SA0A 3NDJA 5EXEA 4GQIA 1TEZA 1PLLA 4MIOA 2C4TA 3LTEA 4BVEA 1STOA 1KS9A 2O0LA 2DRIA 1SKUA 2QTTA 3E4DA 3HKDA 3GEPA 1Y8QB 1AUOA 5IAAA 1U2GA 4G97A 1NZJA 1SBNE 3U1VA 4EITA 3HKDB 3ZWOA 1NRJB 3OZBA 2G0AA 3GGPA 4P2BA 4PX5A 3AI7A 1DX9A 2R47A 3PC7A 5H1YA 3ZCTA 1WQ3A 4FSDA 4QUBA 3CRRA 3T9CA 1VYTA 5IS2A 4MUIA 2OD9A 4GPBA 1NGSA 4PTZA 1EJ0A 3F9CA 4Q5IA 1N2XA 3LBAA 3PA8A 4MA5A 1QHSA 4UTVA 3RQSA 2ZJOA 5LDGA 4OOFA 1RXYA 3TTXA 4GLOA 3VKWA 4ZGGA 1TADA 3JQGB 2GJ8A 3QNWA 2C98A 1PGQA 2B4YA 5CHEA 2X5OA 2PMEA 1MVLA 3L4EA 5A9TA 4L27A 2YKGA 1FSGA 2VSFA 1WEHA 5ADWA 1VOTA 2IPXA 4JSRA 3TK1A 4V02A 2Z83A 5ICEA 3G0HA 4QPCA 2FFQA 4PLZA 1AC5A 2HTEA 1NURA 4HPJB 4PSKA 3L84A 4LS3A 4JOCA 4QASA 3UJAA 5CURA 4D6PA 1A9XB 5EI5A 4BNMA 1VSQA 2Q21A 1ZRHA 1GAJA 1WY7A 2CFIA 4RE5A 2W90A 2AJCA 4PYNA 4C3UA 2AW5A 2FLWA 2A8YA 2X9GA 3K9BA 1RAEA 3B7WA 5H7XA 2MSKA 4MGKR 4QBFA 3H16A 3BWYA 3MF4A 5IMBA 3U3DA 3R3SA 4QG3A 3LX5A 1YB1A 3V1LA 3ZV5A 3ZZUA 4BLVA 4EM6A 2BEJA 7AT1A 1UXOA 3ZZMA 4OCZA 3H9QA 5GM2A 3UK2A 1DC4A 1P4RA 1OZAA 3JQAB 5AM3A 2W2OA 3TYXA 2DEUA 4DR3B 1TO1E 3FUWA 1FP1D 3IDAA 4MQBA 3VO9A 3L6EA 4UUQA 1K8XB 1NRIA 4KXMA 4N5IX 1Z6ZA 3ZKWB 5T4BA 1XP8A 4RTKA 4BMCA 4RPLA 1EX9A 4GZ6A 5JXHA 4QG7A 3LUHA 3KC2A 4ENVA 4Y8VA 3CMMA 4CRWB 1UT8A 5BVHA 5J9FA 1FFAA 4A8PA 2FMUA 1KGDA 3RLIA 1Q74A 221PA 3E2PA 2J0EA 2JHAA 2PANA 2XPCA 3PE6A 2P9FA 1V4BA 1IZ0A 2EHJA 4M0UA 5CVUA 1X14A 4FI3F 3HLYA 3ROFA 2XYGA 3GWGA 4H0FA 3KJQA 4HDSA 1EWRA 5G0TA 2BM0A 3HACA 5J4LA 1UQTA 4HDSB 1O94C 1SKYE 1Y48E 3V48A 1KJNA 2RHWA 3GJ0A 3ZLVA 4C20A 4UARA 3A1NA 3AK4A 1Q16A 2WM3A 2P2DA 5DGXA 2AS0A 2OGSA 1B0AA 1Z7EA 3MA0A 4HBZA 1QTIA 2QTBA 4AX4A 4CNBA 3EZ9A 1P2VA 1RBMA 2QRVA 3DL4A 3NHPA 4XTCS 1VMKA 3E70C 3AVYA 5GJBA 1C9JA 4CQLA 5JR3A 4MVJA 3O8LA 5GINE 4IV8A 1WZIA 2H9AA 4G3XA 3QVWA 2AF4C 4FB4A 5AW8A 4BRWA 4LTDA 4EABA 1OWOA 3UUWA 5K0JA 1A9TA 3PP8A 1DLIA 3C5VA 4OEHA 2G9UA 2JJ8A 1FDVA 1MJHA 1N5LA 2VRBA 4U2EA 4C7KA 3N9IA 3IP3A 3FNFA 3L01A 4QOIA 1E5LA 5BQXA 2H16A 1UWKA 4Q18A 4AROA 2AFIA 2ZUEA 3N8NA 3AHHA 4K9LA 2HPHA 1EUDB 3FCXA 4IIBA 3AOEC 4A23A 2AN9A 1Z28A 2P9GA 3ICPA 3K1AA 2OHXA 1MEEA 2OZPA 3AV3A 4A2QA 4F5EA 5CCEA 2Q3DA 3SQWA 3F74A 2QAGB 3JYOA 4BMDA 1GNVA 2MSWA 3UKOA 2VPTA 3X1XA 3AUJB 5BNIA 5EPUA 4LYEA 1X8XA 1XT6A 1QCZA 2CVFA 3JRXA 3ZVNA 3FAKA 4JXKA 4RJIA 1IM8A 3GJQA 1QGZA 3KAQA 3JVDA 4CR7A 4HNRA 2RAVA 5L3QA 4YRFA 3GLSA 2TS1A 1GG8A 1TJ5A 1XV5A 2N42A 2QYHA 1Y8RB 1CIJA 1T34A 1FNBA 2BD0A 1YZKA 2FOIA 1CY2A 2JI6A 1EVLA 1MA0A 1W4BA 4KDCA 4NOLA 4X3CA 4E1AA 1N6OA 1TMKA 5JANA 1HOXA 1CR6A 3LH5A 1IPFA 1M73E 3PFHA 1LDMA 4XPZA 4NXNB 2JDID 4KWEA 2IYAA 2Q7XA 2PXCA 3SP1A 1QR6A 3K0AA 1SBZA 1XK6A 5CLQA 1JUDA 2AWOA 1XXHE 4RFSA 1E2HA 3IV9A 5T41A 2AB0A 1Z0UA 2X40A 3WWEA 2C94A 2WHYA 5E9JA 1H0RA 3JQEA 5JZOA 4P35A 5IZCA 2OSVA 1K66A 1XELA 2HU7A 1N0UA 2W2KB 2WKWA 3I9JA 3PDHA 2GVZC 3HRHA 4LQLA 4S1OA 2OXIA 3LF1A 3QXGA 5DXJA 5CNMA 2ST1A 2W7TA 1RI1A 3V2UA 5EZ6B 1L7XA 1L3BA 1EX7A 1W88A 5DMXA 3RYIA 3O2NA 1MQ8B 2OFXA 4R69A 4TUYA 4CV0A 3ITKA 2I6SA 4M60A 2ZUFA 1W88B 3HCNA 1NP7A 3RYIB 3HB4X 6Q21A 2ATCA 4CL2A 2Q0XA 2PIAA 3T4PA 1P4HA 1I32A 2C0CA 1NJ6A 1XZBA 1EZZA 3OFJA 4HY3A 1O8BA 1UINA 1K4MA 3QE3A 2GD2A 2EZ8A 2WE7A 4WQMA 4BV8A 1YQDA 4PU0A 3CF2A 3NTOA 5EHGA 4Z1MA 1GUZA 3ORRA 3MJCA 2G72A 4YS6A 5HJ5A 5CYOA 4AJJA 4BRUA 1JZSA 2XHEA 2YC4C 1NJ1A 3DT9A 3NDRA 4RYLA 3VR4A 2D1FA 4ENPA 5KX5F 4D26A 4CCYA 5ALNA 2P27A 1HWYA 4C5CA 3VNAA 4UE2A 4FIDA 1R5BA 4Q1FA 2OFPA 3HJGA 3GEEA 4GR4A 3OFND 3ESZA 3OSUA 2VHUA 4F1JA 2JCVA 1MORA 2A9VA 3F5MA 4GWKA 4OHRA 5EZYF 4UFPA 3L0PA 2EDAA 5HDQA 3DDHA 4TMKA 4EZIA 3K70B 2OB2A 2Z5VA 3AVOA 3NETA 4RH0A 2VP6A 4WEQA 3WRXA 1HC7A 3H2YA 4PC3A 2H8KA 3OWOA 4UHEA 2QUJA 3PGKA 3DT6A 3R7AA 3NU1A 3SU8A 2HCFA 1KPGA 3PKZA 3DYBA 1XAHA 4XIYA 2H2GA 3GJ4A 3HDGA 3MC1A 2VZEA 3RS2A 3F3KA 3WBKA 1UDAA 3R9KA 4UTZA 2FF7A 2B20A 3H4TA 1SKYB 4ENWA 2HEIA 4H6PA 4PG8A 2HIHA 1NIJA 1N0IA 2POQX 2PZJA 4RSMA 2BFNA 3S44A 2MYNA 3CH6A 1NYLA 1M34A 1PWYE 3FMOB 2F00A 4B5LA 4L2IA 3OF5A 1HDCA 1RWOA 2PZGA 4POAA 4Z86A 4C7XA 1AS3A 1RQ7A 1IVYA 3K2IA 3I5YA 3K0CA 2YDXA 5ARDA 3RROA 3THWB 2ZQ5A 4FC7A 5COBA 5TMPA 2NV2B 4NU8X 4IJKA 4TMWA 1XA0A 2ZT6A 4NBKA 5CB4B 2XCQA 5F52A 2DXIA 5ALGA 2OTCA 5F35A 3PHCA 3HYNA 5IT0A 1TCAA 4G1BA 2A4MA 4MNTA 2WT8A 4QXPA 4MUJA 2XV1A 4X1YA 1GGNA 3QENA 2QUZA 2YYSA 1K98A 3ETJA 3ZWWA 4F6RA 4UCXA 3TWOA 3ZS9A 3UJCA 4BNYA 3RC7A 4L75A 3KSRA 3CT6A 1BYIA 4J7CA 3CXUA 1WVMA 3QMMA 4K6MA 3W6NA 1HTBA 5DHQA 1AK2A 3EC1A 4AZTA 4CI9A 4ADSG 5JVDB 1FP6A 3OM1A 4PR0A 1O03A 4L78A 4X94A 4AZ0A 4ZYXA 1VC2A 2I03A 4Q3DA 4RV4A 1YZYA 4L22A 5AUQA 4AJLA 3FLMA 5ITVA 3LY9A 1SOUA 3EVDA 3C1TA 2A0WA 4CIBA 3WYGA 5EJEA 1P5RA 1CPYA 3QLVA 4R83A 4QJ3A 1E7RA 1MKYA 1DRUA 3IDOA 4MV6A 1VBMA 3CE9A 4KQHA 4RX1A 3PJEA 1GPH1 5BYBA 4BAZA 1VPDA 5KOHA 1ADFA 4UE3S 1KYTA 4B9EA 1S7GA 2R68A 4PRKA 3OQMA 2YRWA 4WUTA 4J90A 1REQB 3O90A 1K5PA 3K8QA 2X7XA 1P9RA 2FUG6 4Y2YA 2I87A 3E9ZA 4XFDA 2LBPA 1L7EA 5A2GA 1DRVA 1QK3A 2Q9AA 3AETB 1UDBA 2ZBGA 3EBOA 4MYCA 4N0MA 3V9AA 2C4VA 2HX1A 2OQ2A 2X7JA 4Q9NA 1GVHA 2R4UA 3AFHA 3C3BA 3UJPA 4N39A 4BN5A 1BDJA 3F47A 4B3IA 3C70A 4V0KA 1RYBA 3UG6A 1JKJA 4FFBA 1PD1A 1L1EA 2O57A 3L7IA 4YJ3B 2J6IA 1YB5A 1N92A 1Z6GA 3GRYA 3DFMA 3Q3JB 4OQXA 3WL8A 4D8TA 2GX6A 2E85A 4BCDA 1ID1A 2WJWA 2Z6UA 3DMTA 5AK3A 5JHHB 2KJQA 5CXUA 3GRCA 1UT6A 3DMPA 4C2AA 1P74A 3ZDCA 3EEQA 4R8KA 1DIRA 4MR8B 4Q9AA 2LW7A 4D46A 1KIFA 4P4UA 2AR7A 2BSXA 2OFWA 3VI3B 5EE5B 1PO7A 4AP6A 4EHFA 5J4KA 3GH1A 3RC9A 3TZHA 1Z2AA 5KKAA 3K15A 1YU9A 3DM9B 3VI4B 4MLCA 4EI7A 4ZVQA 4KO8A 2IXTA 1JLLA 1XGKA 4F4DA 3U37A 2FQWA 2EYQA 2VP4A 3HN2A 1QCCA 4MR7A 1MRNA 1JHPA 1NFQA 2OBFA 2WU8A 1H2FA 2X5KO 2Z08A 1QAOA 1IM5A 1SUIA 5DM4A 3DTNA 5IVDA 1WTCA 2HAEA 1L5LA 3A4TA 4QM6A 2IYZA 4FGZA 4YRBA 3KB1A 1YBAA 1YIAA 4K40A 1YVRA 2A59A 2ZFUA 4NARA 4UDNA 2QAIA 4ZZ0A 2H5EA 2QMQA 4TL6A 4RO0A 1ZXBA 2CUZA 1IBCA 2O8DB 1FP2A 3TCKA 3FNBA 4DM3A 2BSAA 3L1HA 4OB8A 4B45A 3U0VA 2K6GA 4UBIA 2J9XB 3C3XA 1KPIA 3D2LA 1XCGB 3UT5A 4ICIA 3NBXX 4AS1A 3NBKA 5HQJA 2VQEB 2OHIA 3OWXA 4PZUA 4V3CA 2X2FA 4PHTA 3USES 3FWKA 4TM7A 3UFBA 2YQ4A 3KXIA 3H04A 3JVIA 4OIFA 3V6MA 5KS2A 4PO9A 3I4FA 5KCMA 2OFFA 3NO4A 5G4KB 5K1ZA 3FTPA 2QV0A 1RU3A 3PITA 2PGNA 3GT3A 2R8RA 3WIBA 3TXYA 4KREA 1N2CE 1SBHA 1IB6A 1VIYA 4RY2A 2A78A 2E7ZA 2J41A 1RXWA 3FB1A 2C03A 4P5EA 1AO0A 1O5OA 2YIMA 2BTOA 3FFTA 2IHUA 3W6UA 1YZTA 4AJOA 1LX7A 4NDNE 2UKDA 4GMFA 3UF0A 3B36A 2PWBA 2C7OA 2EBHX 1KIMA 1SQ0A 1B16A 3B1WA 3B5EA 4DIOA 4MHSA 4E03A 3ZH2A 2JJ1A 2HA6A 4G5HA 2VF8A 1ORHA 1GZVA 3IAXA 4BLWA 2BHLA 4WOJA 3TG8A 3IX7A 1M1NB 4DNXA 2FZLA 3NBUA 3HCAA 3X1JA 2RGNA 4AP5A 1MRZA 1YI8A 2NYRA 1DAEA 3EDMA 3JAKB 4V0NA 3RJ9A 3D0KA 4JFAA 1RI2A 4LGMA 1RQNA 3O2SB 4K7JA 3ZWPA 2KLHA 4BNKA 4NZPA 2UUBB 1H5QA 1MOPA 3ELUA 1E3IA 1A0OA 1ZKMA 2VK8A 3Q6MA 3QPAA 2QSJA 2ZIVB 4EG6A 1KYYA 5GIPE 3QFSA 2BGMA 4NFSA 2NVOA 16PKA 3GVHA 1N6RA 1NXWA 5DT2A 5IUKC 5J4HA 1NUUA 5JXWA 5FLKA 4IX9A 1X7XA 1FRZA 2OSBA 5CH8A 4JYCA 4BFWA 3F49S 3ISVA 3MINB 1W2WB 1KYVA 2BELA 2ZJ5A 3KZMA 3PXDA 1VL8A 5SICE 4F06A 2M6RA 1SBYA 4OQQA 4MO9A 2OKGA 4OHKA 1CDZA 4XXHA 5FUBA 3LLUA 2Z09A 5F1PA 4G0YA 4Z4CA 2D0PB 2WA2A 1LPPA 2XMSA 4EJMA 2FSGA 1T1IA 3RABA 1PW5A 3FLEA 2NADA 3H99A 2FSHA 4JJAA 3OU7A 3R20A 5EJ6A 3DGFC 3AUAA 3AVTA 1EVKA 3L46A 3HN7A 2NQTA 3FW1A 4UAJA 3EDYA 1VL6A 1ZWKA 3F1KA 3VR5H 1BDIA 2O8VA 5B4VA 4FOOA 2HUNA 5FJIA 3WL7A 5EQFA 1P0QA 2GWRA 3CUTA 5C0OE 1GEEA 4HZGA 5CT9A 1PJAA 3QEOA 4EO9A 1JN0A 1SU4A 4ZEXA 3CVXA 2JW5A 3PC4A 4GU5A 4B6JA 2J5KA 3BVPA 3CWQA 2IYLD 5A02A 3MAAC 1K9VF 3PSAA 1M34E 1SXIA 1ZMRA 2X8BA 4NK5A 4R98A 4ARVA 3UB3A 1E89A 5AM1A 2VSYA 5TJ9A 3PZBA 2ZBRA 4B8WA 5BVHB 4NATA 3QZUA 3T4XA 2RHTA 2F3SA 3C8HA 1PJQA 5BNWA 2G9VA 5EMMA 3WXMA 4J43A 3OZTA 2JC3A 2QZZA 4G1MB 4QDZA 3TL3A 2B82A 3IV6A 2X4LA 4U6QA 4UBJA 1A2QA 4R0MA 2I4LA 1T2VA 3DE1X 5EKDA 4B3SB 3T4EA 1TO6A 1F8FA 1NBME 3T5AA 3DD5A 2FN8A 3BN3A 4PAWA 4UAVA 2FW6A 1UAYA 4XUGB 2V3VA 1S1MA 1XYVA 2GYVA 2VOJA 5KYWA 2H1LA 2GSDA 3M9LA 2MTBA 3R5KA 5LC1A 1G64A 4Q7KA 1XA3A 5AMXA 3S4YA 3LVFO 4IDEA 5HIJA 3T41A 1YFKA 4FKZA 2P3LA 4O3MA 2BKUA 2BPOA 2G4VA 3C1AA 3X1WA 2B4QA 1Q0TA 1YA6A 1HZJA 4QDKA 2WSLA 2Z2XA 1BRTA 2Q4BA 2IRWA 1H0KA 1M8JA 2Z5GA 3DSRA 4KX3A 4KZKA 4M53A 3LLSA 3ND5A 4RY0A 3ADCA 3R7WB 4FFMA 3ZCUA 4QPDA 5B58T 5BV1A 5LQMA 1ZVVA 4OIMA 4RDXA 4EO4A 1U90A 3C74A 3RS4A 5FBVB 1XZQA 1U9ZA 2FZVA 1BW9B 1Z5ZA 2ZYAA 1UFVA 5WRFA 1JU4A 2QZ9A 3U4IA 2VCEA 3S27A 4C4XA 3MWKA 3LXXA 2XRFA 4DA9A 1E3WA 3IA2A 2NPFA 2IV2X 2GO1A 3BMOA 3I12A 4GWLA 3O4HA 4CYMA 4KMSA 3DBOB 4IDGA 1GRNA 4GYYA 5BR4A 1NJ2A 1NBEA 2QP4A 4Y2SA 1UUFA 2OV4A 1OREA 5FD8A 5HF5A 5JPDA 2EG5A 1QSGA 1WUKS 4ZMRA 1NNI1 5KNDD 1TRKA 1X80B 4X6LA 1QQAA 4ARCA 3TW4A 2WJGA 1QZ3A 4KO3S 3U48A 2EFGA 1RJWA 2YHAA 1FQKA 2P5SA 4UHKA 5K6AC 1J39A 2V55B 3BMNB 3VDRA 4MQ4A 2NP7A 4M49A 1RYMA 2MHCA 1ZNYA 1ENZA 2I91A 3FGZA 3PE3A 4CIAA 1U63A 1E79A 4BB6A 3A11A 5HK9A 3GLHA 3AILA 1QIEA 2D8AA 3JD2A 2H7VA 1ECBA 1NNUA 2Z8ZA 2WWTA 2YWGA 1II8A 1UBMS 3E8MA 3ZNPA 4F3RA 2W58A 5IYZB 3BE6A 2IPLA 2A57A 4Y2JA 4A6EA 1EXMA 5FPTA 4L4XA 3CH7A 2WTNA 2FEAA 3G6KA 5TT1A 3IAEA 3SR3A 1ACMA 2J48A 4B7UA 4K03A 4DNFA 1U0OC 2P1RA 3FYUB 1UZLA 1ZI9A 1AGRA 4D1YA 2OLKA 3IQGX 3OX3A 4F85A 1BE0A 2ZB7A 3WMFA 2R6ZA 5AM0A 3D7SA 4DCJA 2EC5A 3FFXA 3FTQA 1YJ5A 1WB9A 1TCBA 1XTSA 4HDAA 3UMVA 5JCJA 1MMFB 2FGKA 3AGPA 2EEZA 1C9KA 5EZYA 3GLTA 3HRKA 3B1KA 3W3ZB 4EJ2A 1H6AA 5TS3A 1ZN7A 4W5QA 1DC5A 1S96A 2ORIA 4EKDA 5BSGA 3AB7A 1I1HA 3G0OA 4PPNA 2DFLA 2IWHA 4BMZA 4H77A 5IUNC 3F6SA 5EWMA 1RRMA 4JZKA 2C00A 3MTDA 4PLHA 1S6YA 2H0AA 3VM6A 1XZPA 2MDTA 1IJFA 2O0JA 2DQZA 1LLQA 3UV6A 1K89A 3IV7A 4FP9A 3IP1A 3NJ8A 1GLVA 3KR0A 3KZNA 3RFTA 1GV0A 3IVRA 3G2OA 3ZS8A 4B73A 1VSTA 1EDEA 4LZPA 4DMKA 1O97C 4PBSA 4QULA 2FMXA 3DE2X 3OIVA 1F1JA 2XZPA 5AVVA 3LHDA 1RQRA 1P5ZB 3QF4A 1ZUIA 3LCUA 5J59A 4AIIA 4OAQA 4KE9A 3ROTA 3ZHYA 5TDHA 1NVMB 1SUCA 5DGIA 1TECE 4XEUA 5C2JB 3DEFA 5AVRA 5LMUB 1XDWA 3O0DA 1NF8A 3BK2A 1K3TA 1CHNA 2V58A 1PNVA 4MP3A 4ZCQA 1OIXA 2Y1GA 3GPCA 1XRSB 3NW9A 1L5GB 2Y1FA 4WDRA 3SR0A 4F6CA 5EVJA 4HFNA 4YBRA 5P21A 1OZGA 5EZSA 3FCEA 3FYDA 4ZICA 3LQKA 1A8PA 2X1LA 2H1IA 2MSNA 4BFZA 1ZMTA 3S5JA 4CM6A 3RUCA 1RTTA 3FUVA 2HQOA 3M89A 2GZSA 3O7WA 1CS4C 4GZ3A 1E8NA 1ORVA 3ED1A 3F67A 4IL5A 5KOIA 3K9WA 3ZQ6A 1IQ0A 4LCEA 4XM0A 5EHIA 3TSOA 3PDIB 4FYMA 2VNAA 1EDZA 4KAXA 3M4YA 4KFUA 3UHJA 3P0JA 3DYIA 3WRYA 2PU7A 4RE6A 3WLHA 4BQPA 4Z1OA 4EFLA 3R7WA 2GVDC 3JVUA 1FXUA 4YLYA 1U98A 2PSHA 3JQQA 2IIVA 3KYDA 3ZOKA 3S8EA 1TTTA 1PG0A 3FVQA 4TLCA 1LNSA 5HP4A 2LRHA 2W2LA 3QXCA 1B4DA 3F6PA 2Q29A 4O2AB 1JS1X 4PGMA 3NALA 2P6OA 1CNFA 2BBOA 2VPZA 1K75A 3EXIA 3LG2A 4WLOA 2NQ2C 3BRQA 3L4BC 3VUEA 2GZRA 5IM5A 2VH2A 3IBYA 2QRVB 4HGOA 3B9RA 2MCFA 1UP4A 4QZVA 2EATA 4Q3NA 1FNSA 2AJDA 2ODAA 5I9NA 4OQFA 2ZITA 1ATIA 5AM4A 2ZUUA 3N74A 3AB3A 1SY7A 3QXXA 1PDVA 4RVFA 4DAEA 3LSYA 3OPNA 1I33A 1T5SA 1UOEA 2LKDA 2DPYA 2RHDA 5AFSA 3M1AA 1SXJA 4DC9A 2QG6A 2PBFA 2G8LA 2BISA 1U0EA 2ZRQA 3KR2A 4XWAA 4Y1RA 3SSMA 2WQ7A 4RA6B 1L7BA 5ALPA 4KQ6A 3T54A 4F3KA 5JTUA 2R2AA 3VOSA 2XUAA 4C4YA 2AFIB 1FXSA 1HDXA 1NW7A 1CZLA 5DXFA 2RH5A 3NC0C 4AMBA 2CLOB 2R751 3OEEA 4MGYR 4J9VA 2UDPA 4ZDIA 1OX5A 1QTNA 1XWWA 1A76A 5AR1A 2AJTA 1YAHA 2CL0X 2QD4A 2I8CA 3WK4A 3RADC 3S1AB 2AG8A 4KNVA 2OQRA 4MDFA 3I62A 2ZYVX 4FZ5A 4NZZA 4RVSA 4GYJA 3BXOA 4HEJA 4HNAB 5KVSA 3O8QA 3F98A 4IDBA 3MRTA 4X00A 3MCZA 2H2FA 3HL4A 4MIEA 3N07A 1RABA 3W6PA 3SJUA 4KXQA 2VO1A 1NM5A 2ZTUA 3KKQA 2GUWA 3BB3A 3U13A 4JGIA 3W8DA 5H8WA 5KKCA 4QQFA 5C3MA 2FWMX 4N8DA 3W5BA 1E2JA 2OBNA 2OPHA 3VDMA 1CR4A 2Y8EA 2XB8A 4LF7B 4LZWA 2OHVA 4YFYA 1JDTA 4UQPA 3SHTA 4GZ5A 1GPUA 1G5HA 2VQ3A 3OIFA 1W35A 4RK4A 4X54A 3UOGA 4ZZ3A 4JQZA 4WKNA 2FW8A 4UUOA 3UH0A 3TFOA 1G1MA 1BKSB 2QRJA 3EGDB 3A6EA 4ZAWA 5FDFA 2ZXUA 1DEKA 4PF1A 3FKQA 1JWBB 1SCKA 3EGDA 4KXLA 1GRRA 3Q7SA 1PRYA 1G5PA 1QONA 1G8SA 3OJ0A 3HJNA 4QJ5A 3C43A 3OVMA 2GAFA 3EN0A 1UPXA 4IR7A 4TL7A 3GLFB 3F2VA 4C0HA 2DERA 3E3MA 3CLSC 2HCBA 1KRWA 3ZDZB 3K30A 3MTJA 2FMIA 2YC2C 2PMWB 5TPWB 3TEFA 1FJGB 1SNYA 4FKBA 4IQFA 5KVVA 4D0GA 1QE5A 4NPHA 4D0LB 1T8UA 4LBZA 5JS6A 2VJCA 1VHWA 2ADFA 4OU4A 4M1WA 1HMYA 5JZMA 4NJMA 3ZBUA 2YWBA 5F7JA 3P9ZA 2BMEA 3QBVA 4MRAA 4D9NA 4GIBA 1V47A 4E5VA 2NYVA 1SUWA 4PG6A 3E4CA 2Q3LA 1MN6A 1V43A 4YAFA 3SK0A 3ZGYA 3NBMA 1US8B 2X6TA 3RS7A 1HYGA 2H8GA 4YJ3F 4D4MA 2R66A 4LJLA 3U44B 4WGGA 4WKOA 3V2GA 1TQ8A 2YHUA 4YCJA 5D5QA 3BCHA 1QXSA 1VM6A 2BM9A 2HWKA 4IUDS 3ZU3A 3WFZA 4B8ZA 2SECE 3E82A 5H70A 1JXQA 1C1YA 3CX4A 1ATZA 1P0IA 3W5AA 3L0SA 2YZMA 1O9BA 4BMYA 4JENA 4NZ9A 3U81A 2NZWA 4OQZA 6ADHA 4FEGA 3SR4A 3V4PB 2YOHA 2WZDA 2FR1A 3E8XA 3IRUA 5CMLA 3ZE9A 5K51A 4B71A 4L57A 3E9DA 4R1TA 5FPSA 3B85A 2GHRA 3VBEA 4BO8A 5IDVA 2I76A 1ISRA 4IIEA 2VSOA 3Q10A 4KHZA 4PSAA 3K2QA 5K0FA 2ROQA 3RYTC 2VJYA 5JAPA 1HPLA 2PLWA 4KVZA 2RKOA 4ZVUA 3LQQA 1YHZA 4NBTA 4X60A 4QC2A 4F91B 1Y8ZA 2OVFA 3RC2A 1RQ2A 2R0QC 1C3OA 5HGXA 2O1XA 5IF3A 4NQZA 3KL4A 1UAAA 1QRAA 4LVNA 1NVTA 3RHTA 2UVPB 3SHOA 1XMOB 2Q9BA 2DPLA 4KRGA 3FBWA 1N2IA 2JFBA 4UJ5A 1YFJA 4DY6A 2DECA 1YQ9A 5AW7A 2W6JA 4RAQA 4IH4A 4RKFA 1PL6A 4B4OA 1DQRA 1SXJB 4LGVA 4DDUA 2ZWIA 3AIKA 2PPLA 4JP5A 3VH1A 2WF6A 2XCUA 4GX1A 1H2AS 2WU4A 4EHNA 1E9SA 1TCVA 1RMTA 3HFRA 5KWSA 1XK7A 2JD2A 5HS6A 4D8YA 2A3RA 4UNSA 1U1IA 1TD9A 2BM8A 3S2YA 4ETMA 1QH8B 7MHTA 3K70D 3WHIA 5J2UA 5I9MA 1K4YA 4A0GA 2P65A 3LDGA 1L3CA 1CR0A 4JNCA 4TMFA 2A9OA 1NVKA 3TJRA 1IZ8A 5ALDA 1V5WA 2WYWA 4PNZA 1JH8A 3AR6A 4H7IA 1VBNA 3EZ2A 2XRZA 1Z4NA 2RIPA 4CG0A 4EFMA 1X15A 2ORYA 1SUEA 3MUNA 3RFUA 1ZVJA 2VHQA 4DWVA 2JFUA 4Q9IA 2XW6A 2R96A 3KSDO 3A37A 3WIUA 4AZ0B 1GSAA 3R3VA 1EI9A 3BXFA 1NI4A 5D85A 1KP3A 2XWQA 3LKBA 4QGBA 3CX3A 1Z26A 4C05A 1JAXA 3CH5A 1PQUA 2DH5A 1RZRD 3MLBA 4U00A 1HM5A 1Z4QA 3IUQA 2SNIE 3QKIA 4BNIA 4XGRA 4XWOA 2CKMA 3L6BA 3ZHTA 5BOSA 2OAEA 2DHCA 4OK3A 3Q8KA 4RJ2A 3UAWA 4PW0A 2GN1A 2EFHB 3BRSA 2CXTA 2SKCA 3G2HA 1E3QA 3SZUA 3WK7A 1COZA 4F2PA 5CRIA 3G9QA 3WTBA 1UDCA 2QWXA 1EP9A 2DLDA 2GT1A 1KOLA 2W11A 5BPHA 3EVFA 2JFQA 3CONA 3IYLW 4R7ZA 4AG5A 1N8NA 3RC8A 3NATA 5FEUA 4UVIA 4M8KA 2A0FA 1YCHA 1TUIA 4OX9B 3VO8A 4LHYA 4MI6A 2AEMA 4KI0A 2OV2A 3V97A 1CUHA 4AJPA 5HFNA 4Z8XA 3WIOA 2DFVA 2Q5QA 1H66A 2VH5R 1Q0RA 2IHVA 2ISSD 1PJ3A 4NPAA 1U5AA 3L06A 1II9A 4P7GA 3H2IA 4PAQA 2RGDA 1OXSC 1C7FA 2HPVA 4HK4A 4LDRA 2V5VA 3WRVA 3TZKA 2PH7A 4H16A 2NSJA 5BY2A 3LSTA 4OHYA 4PONA 2ZPTX 1XQXA 1PTJA 4B0PA 1VMIA 1M33A 4MWBA 1F8GA 1RLUA 2EP7A 1AGNA 5T6MA 1XUOA 2C4HA 5ELXA 3RU2A 1W5EA 4TLLB 4W5HA 3K5WA 2DOKA 2O4CA 4D42A 4E21A 4DJAA 1U0BB 1O6GA 3GT7A 3HZZA 4MYUA 2AOUA 4P7KA 4YCMA 2CMKA 3F8TA 2QUAA 4UHBA 5JVDF 1KMNA 1M72A 1BAPA 1XLTA 1ADBA 2PZMA 2X6QA 3HY3A 5DBIA 4KP7A 4MLPA 4ECEA 1E63A 4LIPD 3KQUA 1PR9A 2ZR7A 1Q7TA 4AN4A 5D5HA 2PQ6A 1M74A 3P20A 1A9XA 1IZ7A 2E5FA 3D1LA 3GLGA 4ZC1A 5EUQB 4DBZA 1CCWA 3S99A 4B7XA 4KC0A 1PJ4A 3AHFA 3NC4A 3HVUA 5A05A 3WSTA 1AUXA 4ZDJA 3DQPA 1JQAA 2I4IA 2SCUB 5F2EA 3U7GA 1JG1A 3FUTA 3GGDA 1SFRA 5AWFC 3T7EA 3DCNA 5BW8A 3U4HA 5D3KA 1YMUA 3UV3A 4QSMA 2ZU0C 3BKXA 1ZLYA 2QY9A 3G7NA 4M8NE 4N3BA 4HSEA 3SYMA 3PNVA 2NZUG 2RH9B 4LYAA 5E9QA 4PNEA 3VPXA 4I2NA 3RHZA 3MJ4A 3WK8A 2OV8A 2VRCA 1YE8A 4IHJB 4Q7JB 2ON6A 4U3JA 4AMUA 3B2QA 3IESA 1HLDA 1OIWA 4KYUA 4LJAA 1H8ED 2QI9F 5IT5A 3G5MA 2P9HA 2YCBA 3T1QA