1TC3C

Transposase tc3a1-65 from caenorhabditis elegans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
b'PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*GP*GP*GP*GP*GP*TP*CP*CP*TP*AP*TP*AP*GP*A
publication title Crystal structure of the specific DNA-binding domain of Tc3 transposase of C.elegans in complex with transposon DNA.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein/dna
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11427 HTH_Tnp_Tc3_1 Tc3 transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1tc3C00
3GTGJ 1ZTRA 3A02A 2R5ZB 5FLMJ 2H1KA 3CDLA 4M3EA 3NARA 4DW6A 2FQ4A 4S0HB 1X2NA 4L5EA 4EEFG 5IP6A 4M6VA 5FKOA 1IRZA 4CYCA 1Y1WJ 5JLWA 1MH4A 4BBSJ 2L0KA 3IH3A 3SJMA 1GV5A 1UMQA 2E1OA 3DCFA 1VI0A 1F43A 2EZKA 3JRAA 2YUSA 2CUEA 2ECCA 1APLC 3OSGA 2O9LA 1MBEA 1X58A 4XRSA 1SFOJ 5C4XJ 3JRGA 1U9OA 1W0TA 3TW7A 1IDYA 2HQ5A 3BR1A 2DMNA 4A3BJ 2DMPA 2EH3A 3FK6A 2NVQJ 1LFBA 4GFBA 5M5YJ 1YRNB 3HDDA 2XB5A 3GTJJ 1OCPA 4IHWA 3ZOBA 2GBYA 3A01A 1MSFC 2JK3A 2XGCA 9ANTA 4M3BA 1WI3A 4BBRJ 1ETXA 1RETA 2EQRA 1P7IA 3F0CA 1WH7A 3BQYA 1H88C 1YRNA 1U78A 5IP7J 3S14J 2X48A 2WB1N 3D1NI 3TEDA 2DMUA 1WPKA 5EDNA 2IBDA 2JJ7A 2JWTA 1FTTA 1U9NA 1ETVA 1IGNA 1XS9A 2D5VA 3QPLA 3JREA 1RKWA 3S2DJ 3Q0VA 2TCTA 1JKQC 4B1RA 1POGA 3C2BA 2ME6A 5FKLA 5F08A 5HODA 1JJ8C 2DA7A 4MFDA 2JA8J 2M2EA 2M9HA 4A3EJ 3LOCA 3RZOJ 1B8IA 3I4NJ 2QCOA 3BTIA 3WHBA 3PO3J 2LD5A 1BL0A 2CQXA 3HBLA 4MLOA 3LSJA 1BW5A 1DU6A 1FIPA 3HOUJ 3UKGA 4I76A 5F0HA 2P81A 3M3YJ 1I50J 3ZQLA 2L7MP 1MBJA 2K9NA 1DU0A 3HGYA 5DTDA 4Y52J 3JR9A 4A93J 3DEWA 3CCYA 2JA6J 2HXIA 1HF0A 5F1JA 2K40A 1T56A 1TC3C 4FISA 4FCYA 1ETQA 3HM5A 1TWGJ 3VPRA 1GUUA 2K9QA 3HOVJ 2H8RA 1K61A 3BQZA 1TWHJ 2COBA 4DZJA 2DA2A 1FEXA 1HLVA 2OF7A 5K7HA 3BTJA 3W6VA 3SDGA 3SFIA 3G1MA 2DJNA 1F36A 1FTZA 3ZQHA 4Y7NJ 1EF4A 5EF6A 2DN0A 4A3IJ 2EZLA 3GTPJ 3BR6A 3BR5A 1I3QJ 1MBHA 1WH5A 1O4XA 4X1EA 1OCTC 2YS9A 3OSFA 3WHCA 4D7MA 3JRDA 2R5ZA 2NOGA 2L9RA 1ZK8A 3ZQCA 4BXXJ 1HCRA 4IHYA 3BR2A 3TP0A 2LTPA 2CQQA 2LKXA 2XGEA 1RKTA 4I6ZA 1K83J 2RAEA 3FKIJ 3LNQA 3IH2A 2R93J 1TWFJ 5M3MJ 5IOYA 5JLXA 3BG5A 3HOZJ 3S2HJ 4XK4A 1VNDA 2N8GA 3RQIA 1MSEC 3S1RJ 1JUPA 3O8GA 2E2JJ 5EG0B 1HOMA 3LSGA 2IAIA 4MO7A 2LR8A 2X6OA 2Y31A 1HDPA 1G2HA 2KT0A 2CUFA 1JJ6C 2PMZN 3S16J 1I6HJ 3G1LA 2WAQN 1SANA 1ENHA 5E3MA 3LSRA 1JGGA 2AO9A 2XPWA 1AU7A 4C3HJ 3Q0UA 3Q0WA 5IOZA 3TW6A 1Q1VA 3HOWJ 1JKPC 3GTKJ 2G0EA 1U8BA 1XC5A 1E3OC 3RKQA 2DA3A 5GPAA 2GM4A 4A3DJ 2JMWA 4MIMA 1BJZA 4JYKA 2MG4A 2I10A 3BTLA 2MSYA 5BNGA 1H89C 1S7EA 3IH4A 2W48A 5F0CA 2M8GX 5DS9A 2E2HJ 3H3VK 2CRGA 3MKLA 2NS8A 1Z77A 3I4MJ 3GTLJ 1ZR2A 1HDDC 5EGOB 4X6AJ 3ZQGA 1BA5A 5E3NA 5C3EJ 4IHXA 2EZHA 2DA4A 5J1YA 2FJ1A 1RESA 4V2FA 5FJ8J 4BY7J 2VUMJ 3HEFA 1ORKA 3LSPA 1ZQ3P 2EBIA 4BY1J 1TWAJ 1B72B 3FK7A 1WGXA 2XRLA 2ZB9A 1XG1A 1IUFA 2FD5A 4RBOA 3IV5A 2DTZA 4A3FJ 1NK3P 4UUTA 1QVUA 1QPIA 2O7OA 3BT9A 4DZPA 5C44J 3MN2A 5M3FJ 1AKHB 2OPTA 2L7ZA 2VKVA 1PUFB 2XB0X 4IEJA 4C3JJ 3GTOJ 2Y9YA 1WCMJ 1FJLA 3OIOA 2EZIA 4UUSB 5J1RA 3GTQJ 2L7FP 2NVYJ 1ETKA 1B72A 1QRYA 2XPUA 3JRBA 4A3MJ 2E19A 4M3FA 4JX4A 1P7JA 5FKMA 1RPWA 3HOXJ 3G1OA 3BG9A 3JRCA 4J19A 3BG3A 4D7NA 1ZGWA 4M3GA 5FKKA 5E3LA 1JUSA 1IG7A 3S1NJ 1ETOA 4CYCB 5C4JJ 1LE8B 3BR0A 2MGQA 3CQZJ 4UUSA 4A69C 4XRMA 4B4CA 2LP0A 3JRHA 2HDDA 2R7ZJ 2JA5J 3O8HA 3H0GJ 2Y9ZA 4ABZA 1JT0A 3Q3SA 3TP3A 1Z0XA 3FIWA 2LFBA 3NAUA 4W1UA 2JA7J 3JRIA 1MBKA 1Y1VJ 5F27A 5J1UA 3MVPA 4RDUA 4C2MJ 2K9SA 3S15J 3B6CA 4QIWN 4XICA 3BR3A 1CQTA 2LK2A 1LE8A 1JTXA 5M5WJ 1UHSA 4IHVA 5FLVA 2DA5A 1JUMA 2ID6A 1BW6A 2MW8A 4HNVA 2JN6A 2XSDC 3QQAA 5IYDJ 2Y30A 1A6IA 2IEKA 2XGDA 2CJJA 4A3KJ 3A01B 1IDZA 1NK2P 4A3CJ 2HI3A 5GPCA 4NDLA 2FX0A 2R5YB 3S1QJ 5IYCJ 5GP9A 2HOTA 2DMQA 2CU7A 4FE7A 2ME0A 3L1PA 1VFCA 1R9TJ 2M34A 2HXOA 1D5YA 4MFEA 2R92J 5IP9J 5K7FA 1ZKGA 1IC8A 4AYBN 4A3GJ 5IYBJ 5EYRA 1ITYA 2AHQA 2DMTA 1MBGA 3QPSA 3S17J 3CMYA 1GT0C 2R5YA 1IJWC 1NTCA 3A03A 5EG0A 3GTMJ 5F0FA 3B6AA 2HOSA 2DA6A 2ID3A 1JKRC 1OFCX 4A3LJ 3ZQFA 4BKXA 1QVTA 2NVXJ 1GDTA 3RZDJ 4D5CA 3HGGA 3JRFA 1RR7A 1FIAA 1ZR4A 2TRTA 3PM1A 1ETYA 1B8IB 2M0CA 1JT6A 4V2GA 4JP0A 3ZQIA 1AHDP 1ETWA 5F04A 2KDZA 4XRSG 2WV1A 3E7LA 3HOYJ 2Y0SN 5K7ZA 1TWCJ 1MNMC 2XPVA 1VF9A 2VKEA 2QF7A 4QSHA 1LFUP 1IV6A 2VI6A 3HB9A 2YU9J 4A3JJ 2R0QC 2VPRA 2NVTJ 1MBFA 2HYJA 1JKOC 4FTHA 4LOCA 2LLKA 5EZGA 4DYCA 4AUXA 3S1MJ 2DA1A 1X2MA 2LVSA 5EZHA 1JTYA 2NS7A 1UG2A 2ELKA 2HOAA 4DYRA 5EGOA 1GVDA 3FISA 3BTCA 4JX5A 2B63J 2ECBA 4W97A 3HKZN 4FE4A 2GLOA 5J3LA 2LY9A 3PO2J 1W0UA 4B3AA 2E2IJ 1OJLA 4JX6A 2O8KA 2X9DA 1H8AC 3OOUA 2Y2ZA 5FKNA 5M5XJ 3K2AA 5EEAA 4C3IJ 1AKHA 5E3OA 1A5JA 1GV2A 3M4OJ 1PUFA 5IPAA 4XIDA 4QTRA 4G12A 4AC0A 1T33A 4D5FA 1MH3A 3K7AJ 4M3DA 4DYQA 3GBGA
chains in the Genus database with same CATH superfamily
2F4OB 2IJLA 3HPGA 4FHTA 1ZTRA 3A02A 3BJ6A 2R5ZB 3CDLA 3GFJA 4IRGA 4UVAA 4M9ZA 4DW6A 4Q5SF 4Y33A 4F7ZA 4L5EA 4EEFG 3MAJA 2FA5A 4CYCA 1SVMA 2DYSH 2JPCA 1DDNA 5JLWA 3LA7A 1ZELA 1YE9A 5ERIA 1H0MA 1UMQA 1VI0A 1X3WB 4HDUA 3JRAA 4AWXB 3V7RA 2IRFG 2GOMA 5C4XJ 4XRSA 2DT7B 3HRUA 1Y8QB 2BXYA 1U9OA 3C18A 1BOBA 2R4GA 4G6TB 5B66C 1IDYA 2MFZA 5CJ9A 4BH9A 4OIRF 4BXFA 4L9JA 1O7FA 2QQ9A 2BHZA 2EIKH 2ZCWA 3WE3A 4EVIA 2NVQJ 1Y8RB 4GFBA 1R23A 5B1BH 2JVGA 1SAUA 1D1BA 1USTA 2B7EA 5E1WA 3WGIA 1K78B 2QLZA 3J7YJ 2QYOA 1O57A 3FHZA 4KICA 4A0YA 1MSFC 4EJUA 1ZYRF 5FO5A 4BBRJ 5DYMA 2JA2A 2QQ8A 1WH7A 1HC8A 1LUJB 2NVUB 5BPDA 1A6QA 3RKXA 5KK1A 2EFWA 1H88C 2IS1A 3L9FA 1S6LA 2FSWA 1Z1DA 1TNSA 1B4AA 4KUMA 1D3YA 5CPRB 2WTEA 2IBDA 2ZXJA 4XM3A 2JJ7A 4EGZA 3H0DA 3K4KA 2HOEA 3CJQB 1IGNA 3KIOA 2GIZA 3QPLA 3N05A 4UHTA 2F48A 1POGA 3K1NA 3LFUA 1BM9A 1RRJA 4QPOA 2EV6A 2XF7A 4HSRA 1U5TB 5JR3A 5HODA 1YFHA 1U2WA 2L01A 4PK4A 3VSLA 1VQPI 1JJ8C 3ABUA 1Y56A 4IHSA 2M2EA 2M9HA 2YX4A 3K1PA 3AG4H 3HZJA 3WHBA 2O03A 3OV8A 3BG7A 1YW9A 2AXTC 2W1OA 4MLOA 1BW5A 2HVRA 1DU6A 2Z1DA 3UKGA 5F0HA 2P81A 3K70D 1KU3A 4EQQA 1R36A 1Z05A 1JGSA 1Z7UA 5DTDA 1XSDA 2F4IA 4Y52J 2MYSA 3H5AA 3JR9A 4A93J 4DOZA 3H36A 1KQ9A 1T56A 4FISA 3ZCOA 2JPBA 1B9NA 1ETQA 2LBFA 3F21A 4MQVA 3O2PE 3U2RA 1GUUA 3BPXA 2K9MA 4QLCU 4YIFA 2H8RA 3BQZA 1TWHJ 5ILVA 2VQLA 2G9WA 2OU2A 4DZJA 2DA2A 4HX8A 2LRDA 2L9VA 1HLVA 3J81K 2IT0A 3IWZA 3JSOA 4XRFA 1ACIA 1R1UA 3PQJA 4V19K 4M74A 2XAQA 1BI1A 1D8KA 4XONA 1I27A 3QP5A 1FTZA 4Y7NJ 2OCCH 4XSXF 1H9GA 1X1PA 1VQLI 1B6AA 2EJRA 2X6XA 4A3IJ 3GTPJ 3F3XA 3BR6A 2E60A 3BR5A 2E34A 2W24A 4XOTA 1I3QJ 4X1EA 5HLIA 2XASA 1IZ1A 4EMSA 1WJBA 2XC7A 2JUCA 2DT6A 3K0LA 3WU2C 4DGWB 2R5ZA 5TISC 2E1MC 1WI9A 1ZK8A 2QQAA 5HDNA 3ECOA 4BXXJ 5K5QA 1HCRA 4HLYA 3BR2A 2WAQA 2V26A 2CQQA 2FBHA 3CCUI 2XGEA 3W3CA 5L3DA 4FX4A 4YEJA 3E3VA 2Z2SB 3C2GA 2E5NA 2Z9OA 4AM3A 1QNTA 3DPUA 4HSTA 2W7NA 3ML6A 5M3MJ 4O3MA 2JUGA 3CJNA 3MZHA 4XK4A 1GXPA 1R5ID 4UNOA 3RQIA 4RLFA 1J09A 2E2JJ 2Y48A 5BQTA 3LA3A 1M1EB 2W25A 1IXCA 2WAEA 2PBIA 1G2HA 3BOQA 2VJIA 1LVKA 2VL8A 3B02A 2CW0F 3QRFF 3ZRGA 2R7VA 2BOLA 4C9YA 5LEKA 2A07F 4F92B 1Z21A 1DP7P 3S16J 1K78A 3CCQI 1E2XA 4RGUA 5KCMA 1JE8A 1L3LA 1JGGA 4BJ6C 1AU7A 1XSVA 3Q0UA 5IOZA 3A4CA 1YOVB 3DTKA 2GA2A 2VOOA 2G0EA 4RM2A 4XORA 3RKQA 3V8KA 2HEOA 3K2ZA 5DD4A 1BC7C 1BJZA 2XKOA 4JYKA 2EIMH 5J4YA 2I10A 3BTLA 4FETA 2MSYA 4PDKA 2J5PA 3HRSA 3BWGA 3IH4A 1FBUA 2H1LA 3BCBA 4M71A 5DS9A 3ZPLA 3H3VK 1S7OA 2P7CB 2NS8A 1R1VA 2GXGA 1V3FA 3HKZA 3K6GA 5D4SA 1A04A 2IA2A 4RLQA 3I4MJ 4DNCA 1JXSA 1YX3A 2HKOA 2XSJC 1ZR2A 5EGOB 3P9KA 1OMIA 1BA5A 2V9VA 3EDPA 5B3SH 5E3NA 3W2VA 1FMVA 2EZHA 3GZ5A 4IHXA 2DA4A 3S3NA 2FJ1A 4L5IA 2BXZA 4OMZA 3HEFA 5HS8A 1HXDA 2VT3A 2NOJB 3LSPA 4KN4X 4CCNA 1TWAJ 2HZDA 1U5TA 2ZBKA 4CUGA 5B5EC 2FD5A 5CVIA 4CZCA 2MLGA 4UUTA 1QVUA 4CCLA 5DCFA 4DBRA 3BT9A 5KHDA 3KEQA 4I0AA 3OL3A 4H4KC 3RJPA 2D2WA 2XB0X 3H5NA 4C3JJ 1ZRCA 3GTOJ 2Y9YA 1FJLA 5F6FA 3IRQA 3K4MA 5J1RA 4BXUA 1ZHFA 2XUBA 4A5MA 3FF5A 3JRBA 4KT6A 3CCLI 3NEUA 2KIMA 1MJAA 4HNTA 1LEBA 4ANJA 4JX4A 2BVLA 4P9FA 3JAMK 3HOXJ 4J19A 1R1TA 3BG3A 3FDYA 5B1AH 2YPRA 1XTAA 4I09A 4M3GA 1JUSA 2ISYA 4HG2A 4D9JA 1ETOA 4UB8C 2L9NA 1HKTA 1VQ7I 1MGTA 3BR0A 4UUSA 2H8WA 3CQZJ 1DGRM 3CO7C 3TOBA 2E1NA 5J8CA 3M8JA 4XRMA 4B4CA 3MKZA 1HW2A 4LK1F 3CJTB 1TW3A 3FXUA 4OU0A 1JT0A 5FFZA 1RZ4A 1Z0XA 4MNUA 4BS9A 1T38A 4RAYA 3BP8A 4W1UA 5CQGA 5CVRA 2KRCA 2PMHA 3MVPA 2ZMEC 4PCQA 3T5XA 5HLGA 1VQNI 5LRSA 3B6CA 2VQHA 3K9TA 2BVMA 1CQTA 1QQIA 2VKDA 1LE8A 4BYYA 2EFNA 1IN7A 2DA5A 2DOFA 2B9SA 4G7OF 3TO7A 2MW8A 2LREA 3PIOF 1J5YA 4BHPA 5IYDJ 5HLHA 5HVQC 2E7XA 5CVUA 2FRHA 2DPUA 3TDZC 3A01B 4A3CJ 3S1QJ 1G3SA 1S3JA 2HWVA 2FU4A 3KP6A 4L0ZB 4LLNA 2DMQA 2XKPA 3KLNA 4FE7A 3FXQA 1VFCA 2V7FA 2R92J 3TL4X 5K7FA 2VOPA 3Q5FA 4DIQA 4KDPA 2VASA 4A3GJ 5EYRA 2PMUA 1FY7A 3PIPF 3K4CA 1TTYA 3IWFA 3CCJI 3S17J 2IGMA 3HTSB 2VQGA 3RYRA 1EKEA 3WTSC 2R5YA 1IJWC 1OCRH 4OAZA 5F0FA 2RDPA 4E7HA 3I5UA 1VQ9I 2DA6A 1JKRC 3EYYA 2CW8A 4A3LJ 1GLNA 3LSMA 3HC7A 3TKYA 2JT1A 3U9GA 3G2BA 1HQCA 3GVAA 4M73A 5ILUA 1E3HA 3ABKH 1V4RA 3GEZA 3R0AA 4PJMA 1B8IB 1W7PB 4U7BA 4JP0A 4ENNA 1WFXA 1LKXA 2O6GE 2VBZA 1MNMC 2FBIA 2XPVA 2ZSHB 4QSHA 4AIDA 2BYVE 4CH7A 1X1CA 4XQFA 2UUZA 5L3EA 2IXSA 3HB9A 4NC7A 3MKYB 1KQ0A 3OYHA 5FLXZ 3SEQA 2EA4A 2M45A 4A3JJ 2Y69H 2VPRA 3Q9VA 1N77A 1SFXA 1V54H 2Q2EB 3AG3H 4GRIA 3MD2A 4IJAA 3TBIA 5EZHA 4DYRA 5EGOA 3MEXA 3FISA 3PSIA 4E7JA 3GUDA 3M7GA 2RC4A 4NC6A 1N25A 3T1BA 3HKZN 1W1WE 3BCAA 1YO5C 2HVSA 2HQRA 1B1BA 4Y15A 2LG4A 1QZYA 2E2IJ 4GXOA 2R7UA 2CUJA 2STTA 3KEOA 3SZTA 1OCOH 4YFXF 1D1CA 1BI2A 2VQCA 3TGNA 3REOA 5LD2C 4O6JA 5M5XJ 3K2AA 1I1SA 5EJCA 4C3IJ 3HYIA 1WZ2A 5K1YA 2BGCA 4XIDA 3I53A 2XF6A 3KZYA 4YELA 1BC8C 3OYEA 4RMNA 4DYQA 3RDIA 2A6HF 2M8EA 1QPMA 1WJ5A 5F1RA 2ETHA 2K7LA 2UXXA 2CS3A 4PJ0C 3GTGJ 2IA0A 1P4WA 2CO5A 2CWEA 3CTAA 3FZVA 1FT9A 1IRFA 4PJNA 5FLMJ 5DCMB 4PGGA 4BQQA 2OQRA 3ASOH 2VXDA 5DDGA 2RNJA 3K10A 2VBYA 2LKSA 3WTVC 1YLFA 4M6VA 2HU9A 3J80Z 3E6DA 2Y75A 1KZHA 4XBFA 2KZGA 3GLXA 3R4KA 1UELB 2L0KA 1IN5A 3WTTC 1F43A 1S7AA 1JHHA 4FX0A 1LDKB 3ESWB 2X51A 5D4RA 2ECCA 2FXAA 2H09A 3PQKA 3OSGA 2QZ8A 2O9LA 4WF2A 1E0EA 1SFOJ 2FOKA 5D8KB 1B59A 3QWLA 2UXNA 3TW7A 1IRGA 4HLXA 5K5RA 3H9JA 2EH3A 3R6SA 4R79A 3FK6A 3FXOA 1G6NA 2RV8A 1YS7A 2L4AA 2V6EA 3HDDA 4M9SA 1S9HA 4Y13A 5HS9A 4A5NA 2CUZA 3H35A 5DV5A 3GTJJ 2RGVA 3MZ8A 4HF1A 1HW5A 1S8NA 1KGSA 4IKFA 2XAHA 3ZOBA 3CF5F 3DWLE 2GBYA 3A01A 2DFHA 2DOEA 4CZZA 2OUMA 4ENKA 3OY9A 4M3BA 3S3MA 3P5JA 1RETA 2EQRA 3CLQA 1P7IA 3CMAI 4RGXA 3F0CA 3BQYA 4CCJA 1PUEE 4MTEA 1ZARA 2M87A 2G7UA 2HPIA 3IC7A 3KE2A 1YRNA 4F3QA 5IP7J 3S14J 2X48A 2IGKA 3TEDA 3OYLA 3RPUA 4WXCA 3OYJA 3MWMA 1YHQI 2F5CA 1U9NA 4S04A 1IXSB 4NC8A 3G4SI 2M4GA 1XS9A 2X1CA 4PFOA 2VE9A 1RKWA 2VONA 1R4MB 1YIOA 3C2HA 3Q0VA 3QYEA 2TCTA 3DPLC 3C2BA 2ME6A 5FKLA 3D5SC 2PX9A 3C3WA 5F08A 2VJ4A 5J4VA 2DA7A 4MFDA 1SMYF 2R7DA 4A3EJ 3KEYA 2JQ7A 2R7RA 1YYVA 3VFZA 1OPCA 2QCOA 1W7PA 4UB6C 4YFKF 1B8IA 4KJZA 3HIFA 4LJZF 3RSNA 2LD5A 2FOWA 2QWWA 2WC2A 2LBFB 3ROUA 3H3UA 3WTXC 1PDNC 3LSJA 1FIPA 3HOUJ 4DQ2A 2XAUA 1R5HA 1I50J 2QA4I 3J7AO 3K4NA 3HGYA 1Z67A 4E6KG 1CF7B 2LY1A 4BQOA 1XGMA 2JA6J 2D1VA 2IVMA 4LG0B 1O3RA 5F1JA 2Q2EA 3P9CA 2EINH 2QENA 5ICEA 3IKVA 1QGPA 2E36A 5J40A 4ZZLA 2HPMA 5DUIA 1TWGJ 1YS6A 3QPHA 3SYTA 3C1DA 2ZMEB 3VPRA 2K9QA 1BI0A 4E4HA 4BNCA 1BJAA 1BIBA 2ELHA 2WWYA 3HOVJ 2P5KA 3F8CA 1E17A 4ESFA 2CSOA 2OF7A 2OJED 3W6VA 3KYDB 4AVPA 2AS5F 3SFIA 1TNTA 3W2AA 5FD5A 3ZMUA 2WBMA 2Q8KA 5LGTA 2P7VB 1F36A 3H3ZA 4LLGF 1JI8A 2WAFA 3HG9A 5EF6A 3V7SA 4U87A 2M0MA 5L3BA 4E7SA 3LMMA 1ZG1A 1FNNA 3T8TA 3I55I 1SD5A 3ZMVA 3L2WA 2BY1A 2BW3B 1O4XA 5ED4A 3WHCA 1SFKA 4D7MA 3JRDA 4HW0A 2L9RA 1FSEA 3D0SA 5DCMA 5LGUA 4CXFA 2OV7A 3PNTA 4FQGA 4BE2A 1RC9A 3VYUB 4IHYA 1WJCA 2LKXA 1YJ9I 4I6ZA 1K83J 3GCMA 3UNGC 1NH3A 1LDDA 3IH2A 2XV4S 3DEUA 1TWFJ 3M07A 2DODA 2DO7A 1OCZH 1MNDA 3BG5A 3I71A 3F9KA 4RB2C 1J59A 3S2HJ 5J8FA 2W84A 2JZYA 1FOKA 4HPQA 1VNDA 1MMGA 2KLOA 1G4DA 4O5VA 2K85A 2STWA 3CO6C 3BJAA 5EG0B 1XSXA 1FSHA 3HSRA 2DPDA 2MH9A 2IAIA 3LQRA 1T0FC 2KT0A 4Z2YA 3ZMZA 4S05A 1TZLA 3TDUC 2CV2A 2J5OA 3G1LA 1SANA 1XGSA 1ENHA 3QPTA 1TW2A 3L00A 3QU6A 2R7SA 1YG2A 3HUGB 4PJJA 3WODF 2XHKA 4C3HJ 3WTYC 2HKXA 4L5JA 3EQLF 3CC7I 1V5FA 3GFMA 1U8BA 1XC5A 3TMOA 2DTRA 1OYYA 4A3DJ 3FMSA 1B9MA 1Z7LA 2CYYA 2EA2A 2JMWA 2NYXA 4MIMA 4P9UA 1HBXG 2XAJA 4L18B 5BNGA 4K2EA 3ZN1A 4OIOF 2FQ3A 2KFDA 5F0CA 2E2HJ 3K1MA 2CH0A 2CRGA 3ERMA 4ZYEA 1TLHB 2BHYA 3GTLJ 1HDDC 1X4PA 4XLNF 3VWBA 4U0YA 2QGUA 4ZYGA 1R7JA 4IVNA 1A31A 5J1YA 4N0BA 2YR2A 2K86A 4V2FA 4BY7J 5FJ8J 5CVJA 2YU3A 4HQMA 3OYGA 1RI7A 1ZQ3P 1ZGJA 2EBIA 5KAIC 3FK7A 2ZNZA 2BBYA 2ACJA 2ZB9A 1IUFA 4RBOA 3IV5A 2ZXHA 4A3FJ 4JQFA 2F5VA 1FC3A 4C2UA 4II3A 4XLPF 3BZKA 3MN2A 5C44J 3OS0A 5M3FJ 2CV1A 2VKVA 1PUFB 4GYGA 3F6OA 2MD5A 5ILSA 2LKPA 2EZIA 4UUSB 3GTQJ 2L7FP 1CF7A 4OMYA 2RNGA 1QRYA 2XPUA 4P55A 1P4AA 4LG0A 4EATA 3EUHC 4ZH4F 2VT2A 1TT0A 4M3FA 1KQ8A 1P7JA 3ERED 2W4SA 2LY2A 1FP2A 3G1OA 2EWNA 4Q47A 3BG9A 1Z9CA 3F8MA 5TGTA 5JFRA 1IG7A 1O7LA 2ZMEA 3R60A 5AONA 3E5UA 2HFHA 5C4JJ 3PFIA 1LE8B 3HRMA 4A69C 2L2OA 1K4TA 2L4MA 2PG4A 4BJ5C 2LP0A 2MC4A 4D1QA 1J9IA 2VE8A 1P9QC 1R22A 3BDDA 3FIWA 5DM6F 3NAUA 4UV9A 1C0WA 3GFLA 3RQ4A 2JA7J 5E8GA 4I01A 1MBKA 1Y1VJ 4RDUA 2K9SA 1XGNA 3S15J 1XCVA 3M9AA 1X1AA 5E1ZB 1J75A 4XICA 2PFBA 2A05A 1JTXA 2VC0A 2K4BA 5M5WJ 4HV6A 1XX5A 5HNFA 1YQAA 1MJBA 1T98A 2AQEA 3S32A 5DUKA 3VOEA 1FYKA 2BW3A 2Y30A 1A6IA 4MEYF 3HHGA 2FE3A 1YI2I 1NHAA 1RR8C 3U21A 4IPAA 2R5YB 2XRNA 4G6DA 4UY8I 3IRRA 4ENJA 1W36D 2HOTA 4BHBA 2XVCA 4LB5A 2DAOA 4GDFA 2M3AA 3M8FA 5EEHA 2ME0A 3L1PA 1YJNI 1KA8A 2DW4A 2F5DA 4N9HA 1ZKGA 1XN7A 2EV5A 1IC8A 3ZP5A 1R4NB 2FMYA 1ITYA 5ICCA 3FMRA 1IF1A 1KYWA 2F4MB 1X3UA 1GT0C 1NTCA 3A03A 1X1BA 2HYFA 5D5VB 5EG0A 3GTMJ 3BY6A 2H6CA 3JCUC 3S8PA 1WWXA 3LAJA 2ID3A 2OBPA 4XOPA 2Z5UA 1DPUA 3EUKL 1QVTA 1X3ZB 2HS5A 3LAPA 2ADUA 2BZTA 2KMUA 3AFHA 1GDTA 3HGGA 1ZLKA 1F4KA 2GIVA 3GWZA 1FIAA 4XKCA 2R7TA 3FMQA 1FOXA 1ETYA 3SDBA 2X6YA 2M0CA 1EH8A 5K5OA 3HUGA 1FOYA 1SC7A 4V2GA 5FD6A 1HSJA 3DBHB 4XRSG 3E7LA 3R61A 3HOYJ 5K7ZA 5ICFA 2ZJQF 2VKEA 2QF7A 4IOCF 1ON2A 1LFUP 1IV6A 2G7HA 1FBSA 3F22A 1YW8A 5KVRA 2VI6A 2KJCA 2WY7Q 1Q1HA 4KMUX 3DTIA 3OS1A 5FLXK 1MBFA 2HYJA 1JKOC 2DQLA 4C30A 2KDOA 2CG4A 2V1DA 1YIJI 3LSKA 4AUXA 3RPUD 3CMEI 4KT5C 3FXMA 1IN8A 2EK5A 4RS8A 2NS7A 1UG2A 2JSCA 3M1EA 2W82A 3LSIA 2RKHA 1F1ZA 3FWEA 1LFPA 2ESNA 2B63J 4XLEA 2X1EA 4I0BA 5F64A 2A69F 2ZJPF 2BY2A 4HZFA 2LF8A 4QWQA 3GZNB 4KIFA 4BQAA 4B3AA 2A5WA 3QP6A 2O8KA 4JX6A 5FRMA 1J2XA 1JHFA 3ASNH 4NNJA 4WX9A 2LSOA 4ESBA 1P2FA 2VJ5A 1QA6A 1OKRA 1W7PD 1HSTA 4B3XA 3L2RA 4CCOA 1K79A 5EEAA 4B09A 5E3OA 3WU0A 3M4OJ 1PUFA 4QTRA 4G12A 1SAXA 1FLIA 3IUOA 4KITB 2BY0A 3LL7A 4M3DA 1HW1A 3PNVA 1D8JA 1YTYA 4RGRA 1LB2A 1AOYA 3BLYA 3Q9SA 5BOXA 4IRIA 3ZQ7A 1TQIA 4AD9A 1V5EA 3DEEA 4OINF 4WXHA 2V4JC 3O3KA 4S0HB 1GXQA 1X2NA 1VQ5I 1XD7A 5IP6A 1QZZA 5FKOA 4FT8A 3WGGA 4UV8A 3J80K 1EV7A 3FXKA 4BBSJ 3IH3A 4R8HA 2EZKA 1XMKA 1U8RA 2VJJA 2CUEA 2DQRA 4PGHA 1APLC 2K4JA 2Y0MA 3JRGA 1NG7A 2M30A 4OWRB 2B0LA 4A12A 5JHUA 1T08B 2HQ5A 2PMZA 3OIQA 2DMNA 4KYWA 1BR2A 2QSHX 1CGPA 3DF8A 1LFBA 3FX3A 3AG2H 2P6SA 5JI6A 4HV5A 5M5YJ 1YRNB 3M1CA 2XB5A 2A68F 4LK0F 4KIGA 4NBQA 5D5WB 4ZC3A 4IHWA 3FKJA 2O5RA 4UVBA 1WJEA 3ISPA 5HDGA 2JRTA 2JK3A 2XGCA 1ETXA 3CCSI 2MC3A 5JVTA 4BQNA 1U6GA 4KNYA 4ZJZA 3PNYA 1G59A 4Q48A 1U78A 4L9VA 5J47A 2WB1N 5KNLA 3D1NI 1UHMA 1ZAOA 3GX4X 5EDNA 3EUAA 5TRDA 1P6RA 1ETVA 3HHHA 4G7HF 2UWMA 3JREA 4PUSA 2UZKA 1JKQC 3MQ0A 1ODDA 2HGCA 2DFIA 3I4PA 4B1RA 1SFUA 1VQ6I 1V5GA 1W5CC 4BJTA 1MJ9A 1WVRA 5E8IA 3LOCA 3RZOJ 3I4NJ 3FXLA 2LH9A 1BL0A 2CQXA 4XNFA 4Z6YA 4LFUA 3HJEA 3OYDA 3CLOA 1OYWA 3CCVI 3FM5A 1SD7A 2H6BA 3VYRB 4G94A 4I76A 4EJWA 3AG1H 2KRHA 2L7MP 2VBWA 3HXLA 1RNLA 3SEZA 4BL0B 3CUOA 3DEWA 3CCYA 4I98B 3CJRB 1HF0A 1MIJA 3DLAA 5GAHJ 2K40A 3J7AY 3WGHA 3MMYB 4F55A 5CQEA 2F5EA 5HS7A 2M1BA 1GHCA 5A2QK 2E35A 2E1MB 2L5QA 3SQNA 4Q4ZF 3V8LA 1FWZA 4Y4RA 4C2TA 2MA3A 3CD6I 4RB0A 2NS0A 4EM1A 1K61A 2OD5A 4LLLA 3GO5A 2O8XA 3BJOA 2VODA 3QYBA 5K7HA 3BTJA 2YSRA 3V8JA 5GTHC 2DK8A 5L3FA 1OR7C 2R3SA 3G1MA 3LSTA 5HLTA 3KYLA 3F72A 1VTNC 2DJNA 2EIJH 4IX7A 4XLAA 3ZQQA 1LDJA 4CYDA 3ZQHA 3DBRB 1I5ZA 5E1XA 4CICA 2MLKA 2XIGA 3RIRA 1EF4A 3F8FA 4UXNA 3CF2A 4ZDOA 4F93B 3KP4A 2DN0A 3HSFA 4HEA2 2W85A 3JW4A 1SVLA 4LG3A 5JVGF 1MBHA 1WH5A 1PVEA 4H0EA 5D5XB 2BY3A 5ICGA 2YS9A 3OSFA 1Y39A 1OCTC 4CCKA 4L0YB 5FRNA 1MW7A 4BAYA 2DFFA 3WG7H 3PUFA 5HNHA 2M4KA 3ZQCA 3TQNA 3ZN0A 3DPTA 4LB6B 4YFNF 4U88A 2V79A 3TP0A 1PJRA 1W5SA 2LMDA 5BPIA 2V1NA 4EJTA 2MD0A 2HR3A 2GZWA 1SVOA 3SFZA 3GZ6A 3KP2A 2W00A 2RAEA 2EV0A 3E6MA 5TJJA 5GTIC 3DFGA 3LA2A 1T0FA 4XSZF 2VC1A 3HOZJ 2L02A 3KZIC 3FHNA 1F9NA 2N8GA 2Q1ZB 1MSEC 4Y17A 3FXJA 3X2QH 3S1RJ 1SEUA 1JUPA 3O8GA 2DI3A 4D0PA 1XCBA 2P8TA 1HOMA 3LSGA 3WG9A 3S93A 2Y31A 4LITA 4IZZA 3JSPA 3DKYA 2QM3A 1IW7F 4IQ4A 1KU2A 3PJRA 2PMZN 2ZJRF 2Y0SA 1O3TA 1X19A 1EH6A 2KIUA 3LSRA 1VQ4I 3KYCB 2AO9A 1VZ0A 3OIPA 1IN6A 2GWRA 3WTZA 2A5YB 3I0TA 5J6XA 1K6OA 2HDWA 5LHGA 1Q1VA 3HOWJ 2MBFA 5D5UB 4YIRX 4KN7X 3ELKA 3ABTA 2DA3A 2WV0A 2GM4A 4J01A 4XLHA 2OZ6A 1TQMA 2P5LC 2MG4A 2JTVA 2DCEA 5FB2A 1SD6A 3HOTA 2DJIA 1H89C 2OZUA 1PP8F 3DP7A 2XAFA 1Z91A 3MKLA 3CUQC 2V1UA 1Z77A 3VSKA 4EM0B 3K70C 3W2WA 1LEAA 3CC4I 3NWTA 5H20A 4OIPF 1KU9A 4TV7A 2OCEA 5IT3A 3CCEI 4N4OB 1T6SA 4U0WA 4BY1J 2OC6A 3AAFA 3QODA 3RTRA 2LNBA 1WGXA 2XRLA 3A0HC 1XG1A 4XN0A 2K02A 2DTZA 3BG6A 4HRIA 4BDZA 1WHUA 3OOPA 3EUHA 3E1SA 2O7OA 3OYCA 3OWTA 1QZEA 4CDGA 5DEQA 4RAGA 3KP5A 1AKHB 3MZYA 1FPQA 4LIUA 4BEHB 4E7ZA 2O3FA 2M7AA 4KMFA 3OIOA 4IRHA 2K5CA 3K69A 3WU1B 2MABA 2NVYJ 1ETKA 2RQQA 1B72A 3GYHX 4A3MJ 3HPHA 1STZA 4KA4A 5DM7F 2E19A 5FKMA 1A35A 1RPWA 1WJAA 2KP6A 3B73A 4EJVA 1BR4A 1PYVA 3JRCA 1S72I 1WJDA 4D7NA 1AWCA 5E3LA 5FKKA 2VN2A 3UR3C 2KZVA 3V42A 4A2UA 5LHHA 4G8XA 1E3PA 1T95A 3IAM2 3JRHA 3CZ6A 2HDDA 3H0GJ 2Y9ZA 4ABZA 2I8DA 3Q3SA 2ZJ2A 2K27A 1N75A 3RPQA 3TP3A 4B47A 3CC2I 2LFBA 4MGRA 1LPQA 4XN3A 5LLQA 1BBYA 4PZJA 5F27A 5J1UA 3JRIA 3L2QA 2IGOA 1BOAA 2GOXB 1P4XA 2CQ7A 5E17F 2LK2A 1MKMA 1TP4A 2EB7A 4LGWA 4B48A 3OS2A 4G7ZF 2OTLI 3OR2C 4RAZA 1W5TA 3ZXSA 1JUMA 3ZMTA 2ID6A 1BW6A 3VODA 3COAC 4I7HA 3QQAA 5DD8A 3W6JB 2IEKA 3DU6A 1A36A 2CQNA 3I64A 4B43A 2CJJA 4E70A 4A3KJ 1W36C 4G9YA 2A61A 2HTJA 1NK2P 2HI3A 3KX2A 2P6TA 2FX0A 4M9XA 2IP2A 2FBKA 1FMWA 3VB2A 1O3QA 1LNWA 2VB6A 5LEJA 3P7NA 2CU7A 3RKYA 5HDKA 4CO8A 1R49A 1X4OA 1XDUA 1IUYA 1USSA 5IP9J 2E1CA 4P1WA 6PAXA 1ON1A 4IQJA 3C7JA 4M6XA 5IYBJ 2DU9A 2DFEA 3A2KA 4BE0A 4WXDA 5CKTA 2X85A 2ZXWH 3CMYA 4BHCA 1XMAA 1FYMA 3B6AA 3E5QA 3TO6A 2CQKA 3RYPA 4L9NA 2HOSA 2NAZA 1WKMA 4PJLA 2VLAA 1UAAA 2L54A 2ZSIB 3GFIA 5FFXA 4DJAA 5LBQA 1FYLA 1RR7A 1EH7A 3U1DA 3LWFA 1ZR4A 2WA0A 4WCGA 2TRTA 4RAFA 3PM1A 2F5FA 3OYIA 3AL0C 3HOSA 3DKXA 1JT6A 3G71I 4ENMA 4HNUA 2HZTA 3H92A 1VQMI 3ZQIA 4HDVA 2DDAA 1PP7U 2XF5A 2E5ZA 2Y0SN 4RGSA 2PJRB 3FBIB 5EEGA 1S29A 1TWCJ 2HVQA 1VF9A 1QBJA 2K9LA 4YRVA 2ESHA 4HBLA 4KFCA 1ZH5A 1UZCA 1FZPB 2R0QC 1IXRC 4FTHA 4ESJA 2R7XA 4IF4A 5EZGA 4DYCA 2EPFA 3L2CA 3H9GA 3S1MJ 2LVSA 4BGDA 3PL8A 2V9KA 1JTYA 2HOAA 1MD0A 1GVDA 2RN7A 1N78A 1WJFA 2YX7A 4NB5A 2V6CA 2JSPA 1BI3A 2R7OA 3EYIA 1ZN2A 2ECBA 3HSEA 4RM3A 4W97A 4DBQA 3IL2A 4ZYAA 2D45A 4ZTFA 2VXZA 2COMA 1G8XA 3ZR8X 3PFYA 3OYMA 5J3LA 1Z6TA 2GLOA 1Y0UA 1ZLJA 2Z33A 3CDIA 1K7AA 1Y6IA 1IN4A 2GAUA 4HX4A 3OOUA 5IT9Z 1XDSA 1ZG3A 3L09A 2A6TA 5CYVA 5FGMA 3J7ZI 5FKNA 1WQ2A 2OQGA 5H6QA 1Z3YA 1T2KA 3F23A 2XDVA 1U3EM 1AKHA 2Z99A 1GV2A 2IGNA 5IPAA 4BEHA 4AC0A 1T33A 3MFKA 1LJ9A 4D5FA 1MH3A 3K7AJ 4LD5A 4ZDLA 5FROA 3VEPA 3VYTB 3V4GA 3WTUC 1IRXA 2HQAA 2NNYA 2EILH 2ISZA 2P0WA 2QBYB 1XB4A 1D1AA 2KIFA 2ZXIA 2H1KA 3ZGKA 5E18F 4IO9F 1SFEA 3DQVC 3NARA 4M3EA 4A0ZA 2FQ4A 2ZC2A 3E6CC 3LQQA 2O61A 1EA3A 1IRZA 5D6EA 2TDXA 3L2VA 1Y1WJ 1ZGAA 2KQRA 2L9SA 2QVOA 1MH4A 1UG0A 2C6YA 3SJMA 1GV5A 2E1OA 2Z3YA 3DCFA 3L2UA 1G3TA 2OTJI 2YUSA 3SXYA 3D5RC 3OYNA 1MBEA 1X58A 4JK1X 3H9QA 4OAYA 1W0TA 3JTHA 3JTGA 4IL6C 2WB1A 3BR1A 2X6WA 4A3BJ 5E20A 2DMPA 2HTSA 4EGYA 1J0RA 3ONQA 3EETA 4P5OA 1Z3XA 1VQ8I 2E71A 3BZCA 2H27A 1FP1D 3HRTA 3WE2A 1OCPA 1O3SA 1K4SA 3F6VA 4AU7A 4ON0A 3OYAA 3KP7A 3U1KA 4I99C 1IO2A 2BE5F 5BS6A 3DTEA 2GA1A 3CUQB 2OA4A 9ANTA 3DBLB 4EM2A 1WI3A 1MMSA 3CP2A 3DLLF 4CA0A 3A0BC 4AIHA 4IXAA 4BE1A 1OCCH 1TQPA 4I02A 3ZMDA 4PSWA 2DMUA 1WPKA 3DXJF 4ZDPA 4R1HA 2VIXA 2JWTA 3H1CA 2RQPA 4E7IA 1FTTA 2CGPA 3ABMH 2FNPA 1VQOI 2D5VA 2IS6A 3M8EA 1BIAA 1QHGA 2LDUA 3S2DJ 3FBNB 1KONA 5E79C 1U0JA 1D5VA 1UHWA 1HKSA 2QUFA 1YITI 4XR6A 4HA8A 3CCMI 2JA8J 4YIIA 2PQ8A 4PFPA 2DXIA 2A6EF 3CESA 3BTIA 3PO3J 4L9TA 2QSGX 1BR1A 3HBLA 2VKHA 1MZBA 4HF0A 2IPQX 3SZGA 4E7KA 2PJRA 4CHUA 2DDBA 4YG2F 5LRRA 3KFWX 2JVHA 1D0YA 3M3YJ 3ZQLA 2LYCA 1MBJA 2K9NA 4ZYHA 1IV8A 1DU0A 4JBAA 1MMAA 2CW7A 1GVJA 4HF2A 4ASNA 1DPRA 2HXIA 1RUOA 3K4JA 3LFKA 2FUG2 1TC3C 4FCYA 1FBQA 1UB9A 3QYFA 3KPHA 1XPXA 2MH2A 1OR7A 3HM5A 1ZRDA 3T0YA 1UJ8A 3D5LA 2IS2A 1P92A 1K6YA 2COBA 1OLTA 2CV0A 3J81Z 4UUVA 1FEXA 3ECHA 3IKTA 1Y0NA 4LMYA 2KHMA 3SDGA 2O0YA 2Z16A 3BC8A 1ZREA 1D0XA 3I9V2 4E7LA 3QU3A 2NXNB 1ONVA 2ZNYA 3BROA 4WK8F 2IA1A 1BN5A 2EFOA 2EZLA 4XKWA 1G3WA 1DP3A 1T39A 5IY5H 2PJPA 3OYKA 2V1XA 1I6XA 4HX7A 3S2WA 3DV8A 2LOOA 1R5GA 2ICWG 2QBYA 4KIBA 2NOGA 5D6FA 1SMTA 2XROA 4PSXA 1SD4A 5L3CA 4CGZA 3GXOA 3CCRI 2EFPA 2LTPA 1EJ9A 3BPVA 3OL4A 3FXRA 4AYBA 1RKTA 3SZPA 2Q0OA 3FKIJ 3LNQA 2HQNA 2R93J 5IOYA 5LHIA 3IAS2 4UVCA 2M7BA 3N4MA 5JLXA 3I59B 4M6YA 3I58A 3GMEA 3G3ZA 3I56I 4BDYA 2QEXI 4N4NB 5H2FC 1OISA 3AL0B 2FF4A 2DK5A 1ZG5A 2GQQA 1ULYA 4A6DA 2HNHA 4MO7A 2LR8A 2X6OA 3CP8A 2R7WA 1HDPA 2HDCA 2FMLA 2NRAC 1MDMB 2KKOA 4MEXF 1MNEA 2CUFA 3HTUA 1JJ6C 1I6HJ 2WAQN 1X1DA 5E3MA 3PSFA 1J7KA 2XPWA 3Q0WA 3RCOA 4KISA 3K4BA 2XGXA 3CUQA 3TW6A 4NQWB 1JKPC 3GTKJ 3GF2A 1E3OC 3A1YA 4NHJA 5GPAA 3VDXA 4BU2A 2A3SA 4B8XA 3O6BB 2M5WA 2EFQA 1DGWY 3I54A 4QPQA 1T8IA 5AIQA 4GGGA 2QSFX 1S7EA 2W48A 2DBBA 4G6QA 4HQEA 2M8GX 1LQ1A 1KYZA 4RA2A 5GAEJ 4EJOA 2FEZA 1XMXA 4OOIA 3WTWC 3KZZA 4X6AJ 3ZQGA 3ULQB 2DYRH 5C3EJ 2CFOA 1REPC 2KL4A 1RESA 2RVCA 1UFMA 1AA7A 2VUMJ 5GADJ 1ORKA 4CCMA 1R71A 3F8BA 4CSWA 3F8NA 4WWCA 4II2A 2LF7A 4Y3OA 3MCZA 1B72B 4AIJA 1XGOA 4A0XA 5LFAA 3S3OA 2VBXA 5D8LB 4BACA 4JOMA 2L3DA 3W6KB 1NK3P 2JRMA 2L7KA 2F2EA 4FASD 1TT5B 1QPIA 4DZPA 2P5VA 3DU5A 2OPTA 2L7ZA 1FX7A 4IEJA 2GXAA 1R6RA 2KJBA 1L0OC 1WCMJ 2PLYA 3IHUA 5CLSA 5CVVA 1U5TC 2KISA 2GXBA 2I5UA 2BV6A 3GW2A 3OMYA 4IHTA 3JAMZ 1S5LC 3E97A 3KCCA 2X1DA 2ZFUA 2X4HA 4B44A 1ZGWA 5KAFC 4MQ9F 4XLFA 3S1NJ 4CYCB 4MHGA 2QKLB 1HKQA 2IS4A 2MGQA 1QU3A 4AVZA 5GAGJ 4RB3C 1WSUA 5JHFA 1LVAA 3OR1C 2R7ZJ 4GO1A 2JA5J 3O8HA 1RIOH 4GYIA 1YX5A 3MKWB 1D0ZA 2P4WA 4IOAF 2DT5A 4C2MJ 1W4MA 1VQKI 3G73A 4QIWN 2IW5A 3SHFA 1R58A 3BR3A 3CDHA 2X0LA 1TBXA 1KU7A 2QKMB 3NQOA 1UHSA 2CMPA 2E7WA 4IHVA 4BUPA 5FLVA 2VPLA 1ERDA 1FOWA 2PEXA 4EV0A 4F52A 2JN6A 3IP4B 4HNVA 2XSDC 4LIVA 1QO0D 4F91B 4HAMA 2XGDA 1TL8A 3FM3A 5HOOA 2XAGA 3ZMSA 3I3LA 1Z6RA 1F5TA 3RKWA 1IDZA 5GPCA 4ZZDA 2K3PA 4NDLA 1IAWA 3L7WA 3RI4A 5IYCJ 4HYEA 5GP9A 3T8RA 3KETA 2DLLA 2F6CA 3QOPA 1NG6A 4P96A 2UV1A 1R9TJ 2KPMA 2M34A 2W57A 2HXOA 1D5YA 4MFEA 4N9IA 1DQUA 2LC2A 3I59A 4AYBN 2AHQA 2DMTA 3V7CA 5BMZA 1MBGA 3QPSA 4A6EA 2WADA 5L3GA 1DUXC 4ITVA 4ZTJA 3NWSA 3H5RA 3TO9A 3K4LA 1OFCX 2AXLA 3GLLA 2HYGD 3ZQFA 4BKXA 2NVXJ 1R00A 3RZDJ 1UCRA 1MDMA 4D5CA 2PN6A 3QOEA 3ABLH 3JRFA 4XKBA 4XLCA 1YJWI 4GCVA 2AQFA 2FNAA 4U0VA 4OIQF 3E5XA 4XL9A 1H9TA 1OQYA 3KP3A 1AHDP 1ETWA 1WRJA 2RREA 5F04A 2KDZA 3VYSB 4NQWA 2WV1A 2ELJA 1MMNA 1YW7A 3EPZA 4HOBA 3OYFA 2R7QA 1RUNA 4J00A 2YU9J 2CFXA 2K3FA 2NVTJ 2DOAA 1I1GA 3BZ6A 4M72A 4LOCA 3HL2A 1QHHD 5AIPA 2LLKA 2DA1A 1X2MA 3AKZA 2NNNA 2KIQA 1V55H 4MTDA 1G3YA 3OYBA 2ELKA 2ZO4A 3R0JA 4X0GA 3BTCA 4JX5A 5LGNA 3N97A 4XMYA 4RB1A 2PI0A 2KRFA 2H94A 4FE4A 1HA8A 2QQBA 3DKWA 3KLOA 3QAHA 3LSHA 3G6EI 2LY9A 2WY8Q 3PO2J 4XKVA 1W0UA 4I2OA 1I3AA 1OYIA 1OJLA 2X9DA 2V9PA 3E0JB 1H8AC 3P9IA 2R7FA 4ZYDA 4ETSA 5A2QZ 2Y2ZA 5IT9K 2ZKZA 1ZRFA 4NUBA 1MMDA 1I39A 1A5JA 2BEOA 2ZFWA 4AIKA 4U7DA 2D1HA 3E6BA 3NRVA 3PUBA 3TOAA 3CMMA 3GBGA 5H6RA 2OAZA
chains in the Genus database with same CATH topology
3GTGJ 1ZTRA 3A02A 2R5ZB 5FLMJ 2H1KA 3CDLA 4M3EA 3NARA 4DW6A 2FQ4A 4S0HB 1X2NA 4L5EA 4EEFG 5IP6A 4M6VA 5FKOA 1IRZA 4CYCA 1Y1WJ 5JLWA 1MH4A 4BBSJ 2L0KA 3IH3A 3SJMA 1GV5A 1UMQA 2E1OA 3DCFA 1VI0A 1F43A 2EZKA 3JRAA 2YUSA 2CUEA 2ECCA 1APLC 3OSGA 2O9LA 1MBEA 1X58A 4XRSA 1SFOJ 5C4XJ 3JRGA 1U9OA 1W0TA 3TW7A 1IDYA 2HQ5A 3BR1A 2DMNA 4A3BJ 2DMPA 2EH3A 3FK6A 2NVQJ 1LFBA 4GFBA 5M5YJ 1YRNB 3HDDA 2XB5A 3GTJJ 1OCPA 4IHWA 3ZOBA 2GBYA 3A01A 1MSFC 2JK3A 2XGCA 9ANTA 4M3BA 1WI3A 4BBRJ 1ETXA 1RETA 2EQRA 1P7IA 3F0CA 1WH7A 3BQYA 1H88C 1YRNA 1U78A 5IP7J 3S14J 2X48A 2WB1N 3D1NI 3TEDA 2DMUA 1WPKA 5EDNA 2IBDA 2JJ7A 2JWTA 1FTTA 1U9NA 1ETVA 1IGNA 1XS9A 2D5VA 3QPLA 3JREA 1RKWA 3S2DJ 3Q0VA 2TCTA 1JKQC 4B1RA 1POGA 3C2BA 2ME6A 5FKLA 5F08A 5HODA 1JJ8C 2DA7A 4MFDA 2JA8J 2M2EA 2M9HA 4A3EJ 3LOCA 3RZOJ 1B8IA 3I4NJ 2QCOA 3BTIA 3WHBA 3PO3J 2LD5A 1BL0A 2CQXA 3HBLA 4MLOA 3LSJA 1BW5A 1DU6A 1FIPA 3HOUJ 3UKGA 4I76A 5F0HA 2P81A 3M3YJ 1I50J 3ZQLA 2L7MP 1MBJA 2K9NA 1DU0A 3HGYA 5DTDA 4Y52J 3JR9A 4A93J 3DEWA 3CCYA 2JA6J 2HXIA 1HF0A 5F1JA 2K40A 1T56A 1TC3C 4FISA 4FCYA 1ETQA 3HM5A 1TWGJ 3VPRA 1GUUA 2K9QA 3HOVJ 2H8RA 1K61A 3BQZA 1TWHJ 2COBA 4DZJA 2DA2A 1FEXA 1HLVA 2OF7A 5K7HA 3BTJA 3W6VA 3SDGA 3SFIA 3G1MA 2DJNA 1F36A 1FTZA 3ZQHA 4Y7NJ 1EF4A 5EF6A 2DN0A 4A3IJ 2EZLA 3GTPJ 3BR6A 3BR5A 1I3QJ 1MBHA 1WH5A 1O4XA 4X1EA 1OCTC 2YS9A 3OSFA 3WHCA 4D7MA 3JRDA 2R5ZA 2NOGA 2L9RA 1ZK8A 3ZQCA 4BXXJ 1HCRA 4IHYA 3BR2A 3TP0A 2LTPA 2CQQA 2LKXA 2XGEA 1RKTA 4I6ZA 1K83J 2RAEA 3FKIJ 3LNQA 3IH2A 2R93J 1TWFJ 5M3MJ 5IOYA 5JLXA 3BG5A 3HOZJ 3S2HJ 4XK4A 1VNDA 2N8GA 3RQIA 1MSEC 3S1RJ 1JUPA 3O8GA 2E2JJ 5EG0B 1HOMA 3LSGA 2IAIA 4MO7A 2LR8A 2X6OA 2Y31A 1HDPA 1G2HA 2KT0A 2CUFA 1JJ6C 2PMZN 3S16J 1I6HJ 3G1LA 2WAQN 1SANA 1ENHA 5E3MA 3LSRA 1JGGA 2AO9A 2XPWA 1AU7A 4C3HJ 3Q0UA 3Q0WA 5IOZA 3TW6A 1Q1VA 3HOWJ 1JKPC 3GTKJ 2G0EA 1U8BA 1XC5A 1E3OC 3RKQA 2DA3A 5GPAA 2GM4A 4A3DJ 2JMWA 4MIMA 1BJZA 4JYKA 2MG4A 2I10A 3BTLA 2MSYA 5BNGA 1H89C 1S7EA 3IH4A 2W48A 5F0CA 2M8GX 5DS9A 2E2HJ 3H3VK 2CRGA 3MKLA 2NS8A 1Z77A 3I4MJ 3GTLJ 1ZR2A 1HDDC 5EGOB 4X6AJ 3ZQGA 1BA5A 5E3NA 5C3EJ 4IHXA 2EZHA 2DA4A 5J1YA 2FJ1A 1RESA 4V2FA 5FJ8J 4BY7J 2VUMJ 3HEFA 1ORKA 3LSPA 1ZQ3P 2EBIA 4BY1J 1TWAJ 1B72B 3FK7A 1WGXA 2XRLA 2ZB9A 1XG1A 1IUFA 2FD5A 4RBOA 3IV5A 2DTZA 4A3FJ 1NK3P 4UUTA 1QVUA 1QPIA 2O7OA 3BT9A 4DZPA 5C44J 3MN2A 5M3FJ 1AKHB 2OPTA 2L7ZA 2VKVA 1PUFB 2XB0X 4IEJA 4C3JJ 3GTOJ 2Y9YA 1WCMJ 1FJLA 3OIOA 2EZIA 4UUSB 5J1RA 3GTQJ 2L7FP 2NVYJ 1ETKA 1B72A 1QRYA 2XPUA 3JRBA 4A3MJ 2E19A 4M3FA 4JX4A 1P7JA 5FKMA 1RPWA 3HOXJ 3G1OA 3BG9A 3JRCA 4J19A 3BG3A 4D7NA 1ZGWA 4M3GA 5FKKA 5E3LA 1JUSA 1IG7A 3S1NJ 1ETOA 4CYCB 5C4JJ 1LE8B 3BR0A 2MGQA 3CQZJ 4UUSA 4A69C 4XRMA 4B4CA 2LP0A 3JRHA 2HDDA 2R7ZJ 2JA5J 3O8HA 3H0GJ 2Y9ZA 4ABZA 1JT0A 3Q3SA 3TP3A 1Z0XA 3FIWA 2LFBA 3NAUA 4W1UA 2JA7J 3JRIA 1MBKA 1Y1VJ 5F27A 5J1UA 3MVPA 4RDUA 4C2MJ 2K9SA 3S15J 3B6CA 4QIWN 4XICA 3BR3A 1CQTA 2LK2A 1LE8A 1JTXA 5M5WJ 1UHSA 4IHVA 5FLVA 2DA5A 1JUMA 2ID6A 1BW6A 2MW8A 4HNVA 2JN6A 2XSDC 3QQAA 5IYDJ 2Y30A 1A6IA 2IEKA 2XGDA 2CJJA 4A3KJ 3A01B 1IDZA 1NK2P 4A3CJ 2HI3A 5GPCA 4NDLA 2FX0A 2R5YB 3S1QJ 5IYCJ 5GP9A 2HOTA 2DMQA 2CU7A 4FE7A 2ME0A 3L1PA 1VFCA 1R9TJ 2M34A 2HXOA 1D5YA 4MFEA 2R92J 5IP9J 5K7FA 1ZKGA 1IC8A 4AYBN 4A3GJ 5IYBJ 5EYRA 1ITYA 2AHQA 2DMTA 1MBGA 3QPSA 3S17J 3CMYA 1GT0C 2R5YA 1IJWC 1NTCA 3A03A 5EG0A 3GTMJ 5F0FA 3B6AA 2HOSA 2DA6A 2ID3A 1JKRC 1OFCX 4A3LJ 3ZQFA 4BKXA 1QVTA 2NVXJ 1GDTA 3RZDJ 4D5CA 3HGGA 3JRFA 1RR7A 1FIAA 1ZR4A 2TRTA 3PM1A 1ETYA 1B8IB 2M0CA 1JT6A 4V2GA 4JP0A 3ZQIA 1AHDP 1ETWA 5F04A 2KDZA 4XRSG 2WV1A 3E7LA 3HOYJ 2Y0SN 5K7ZA 1TWCJ 1MNMC 2XPVA 1VF9A 2VKEA 2QF7A 4QSHA 1LFUP 1IV6A 2VI6A 3HB9A 2YU9J 4A3JJ 2R0QC 2VPRA 2NVTJ 1MBFA 2HYJA 1JKOC 4FTHA 4LOCA 2LLKA 5EZGA 4DYCA 4AUXA 3S1MJ 2DA1A 1X2MA 2LVSA 5EZHA 1JTYA 2NS7A 1UG2A 2ELKA 2HOAA 4DYRA 5EGOA 1GVDA 3FISA 3BTCA 4JX5A 2B63J 2ECBA 4W97A 3HKZN 4FE4A 2GLOA 5J3LA 2LY9A 3PO2J 1W0UA 4B3AA 2E2IJ 1OJLA 4JX6A 2O8KA 2X9DA 1H8AC 3OOUA 2Y2ZA 5FKNA 5M5XJ 3K2AA 5EEAA 4C3IJ 1AKHA 5E3OA 1A5JA 1GV2A 3M4OJ 1PUFA 5IPAA 4XIDA 4QTRA 4G12A 4AC0A 1T33A 4D5FA 1MH3A 3K7AJ 4M3DA 4DYQA 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG J;  1ZTR A;  3A02 A;  2R5Z B;  5FLM J;  2H1K A;  3CDL A;  4M3E A;  3NAR A;  4DW6 A;  2FQ4 A;  4S0H B;  1X2N A;  4L5E A;  4EEF G;  5IP6 A;  4M6V A;  5FKO A;  1IRZ A;  4CYC A;  1Y1W J;  5JLW A;  1MH4 A;  4BBS J;  2L0K A;  3IH3 A;  3SJM A;  1GV5 A;  1UMQ A;  2E1O A;  3DCF A;  1VI0 A;  1F43 A;  2EZK A;  3JRA A;  2YUS A;  2CUE A;  2ECC A;  1APL C;  3OSG A;  2O9L A;  1MBE A;  1X58 A;  4XRS A;  1SFO J;  5C4X J;  3JRG A;  1U9O A;  1W0T A;  3TW7 A;  1IDY A;  2HQ5 A;  3BR1 A;  2DMN A;  4A3B J;  2DMP A;  2EH3 A;  3FK6 A;  2NVQ J;  1LFB A;  4GFB A;  5M5Y J;  1YRN B;  3HDD A;  2XB5 A;  3GTJ J;  1OCP A;  4IHW A;  3ZOB A;  2GBY A;  3A01 A;  1MSF C;  2JK3 A;  2XGC A;  9ANT A;  4M3B A;  1WI3 A;  4BBR J;  1ETX A;  1RET A;  2EQR A;  1P7I A;  3F0C A;  1WH7 A;  3BQY A;  1H88 C;  1YRN A;  1U78 A;  5IP7 J;  3S14 J;  2X48 A;  2WB1 N;  3D1N I;  3TED A;  2DMU A;  1WPK A;  5EDN A;  2IBD A;  2JJ7 A;  2JWT A;  1FTT A;  1U9N A;  1ETV A;  1IGN A;  1XS9 A;  2D5V A;  3QPL A;  3JRE A;  1RKW A;  3S2D J;  3Q0V A;  2TCT A;  1JKQ C;  4B1R A;  1POG A;  3C2B A;  2ME6 A;  5FKL A;  5F08 A;  5HOD A;  1JJ8 C;  2DA7 A;  4MFD A;  2JA8 J;  2M2E A;  2M9H A;  4A3E J;  3LOC A;  3RZO J;  1B8I A;  3I4N J;  2QCO A;  3BTI A;  3WHB A;  3PO3 J;  2LD5 A;  1BL0 A;  2CQX A;  3HBL A;  4MLO A;  3LSJ A;  1BW5 A;  1DU6 A;  1FIP A;  3HOU J;  3UKG A;  4I76 A;  5F0H A;  2P81 A;  3M3Y J;  1I50 J;  3ZQL A;  2L7M P;  1MBJ A;  2K9N A;  1DU0 A;  3HGY A;  5DTD A;  4Y52 J;  3JR9 A;  4A93 J;  3DEW A;  3CCY A;  2JA6 J;  2HXI A;  1HF0 A;  5F1J A;  2K40 A;  1T56 A;  1TC3 C;  4FIS A;  4FCY A;  1ETQ A;  3HM5 A;  1TWG J;  3VPR A;  1GUU A;  2K9Q A;  3HOV J;  2H8R A;  1K61 A;  3BQZ A;  1TWH J;  2COB A;  4DZJ A;  2DA2 A;  1FEX A;  1HLV A;  2OF7 A;  5K7H A;  3BTJ A;  3W6V A;  3SDG A;  3SFI A;  3G1M A;  2DJN A;  1F36 A;  1FTZ A;  3ZQH A;  4Y7N J;  1EF4 A;  5EF6 A;  2DN0 A;  4A3I J;  2EZL A;  3GTP J;  3BR6 A;  3BR5 A;  1I3Q J;  1MBH A;  1WH5 A;  1O4X A;  4X1E A;  1OCT C;  2YS9 A;  3OSF A;  3WHC A;  4D7M A;  3JRD A;  2R5Z A;  2NOG A;  2L9R A;  1ZK8 A;  3ZQC A;  4BXX J;  1HCR A;  4IHY A;  3BR2 A;  3TP0 A;  2LTP A;  2CQQ A;  2LKX A;  2XGE A;  1RKT A;  4I6Z A;  1K83 J;  2RAE A;  3FKI J;  3LNQ A;  3IH2 A;  2R93 J;  1TWF J;  5M3M J;  5IOY A;  5JLX A;  3BG5 A;  3HOZ J;  3S2H J;  4XK4 A;  1VND A;  2N8G A;  3RQI A;  1MSE C;  3S1R J;  1JUP A;  3O8G A;  2E2J J;  5EG0 B;  1HOM A;  3LSG A;  2IAI A;  4MO7 A;  2LR8 A;  2X6O A;  2Y31 A;  1HDP A;  1G2H A;  2KT0 A;  2CUF A;  1JJ6 C;  2PMZ N;  3S16 J;  1I6H J;  3G1L A;  2WAQ N;  1SAN A;  1ENH A;  5E3M A;  3LSR A;  1JGG A;  2AO9 A;  2XPW A;  1AU7 A;  4C3H J;  3Q0U A;  3Q0W A;  5IOZ A;  3TW6 A;  1Q1V A;  3HOW J;  1JKP C;  3GTK J;  2G0E A;  1U8B A;  1XC5 A;  1E3O C;  3RKQ A;  2DA3 A;  5GPA A;  2GM4 A;  4A3D J;  2JMW A;  4MIM A;  1BJZ A;  4JYK A;  2MG4 A;  2I10 A;  3BTL A;  2MSY A;  5BNG A;  1H89 C;  1S7E A;  3IH4 A;  2W48 A;  5F0C A;  2M8G X;  5DS9 A;  2E2H J;  3H3V K;  2CRG A;  3MKL A;  2NS8 A;  1Z77 A;  3I4M J;  3GTL J;  1ZR2 A;  1HDD C;  5EGO B;  4X6A J;  3ZQG A;  1BA5 A;  5E3N A;  5C3E J;  4IHX A;  2EZH A;  2DA4 A;  5J1Y A;  2FJ1 A;  1RES A;  4V2F A;  5FJ8 J;  4BY7 J;  2VUM J;  3HEF A;  1ORK A;  3LSP A;  1ZQ3 P;  2EBI A;  4BY1 J;  1TWA J;  1B72 B;  3FK7 A;  1WGX A;  2XRL A;  2ZB9 A;  1XG1 A;  1IUF A;  2FD5 A;  4RBO A;  3IV5 A;  2DTZ A;  4A3F J;  1NK3 P;  4UUT A;  1QVU A;  1QPI A;  2O7O A;  3BT9 A;  4DZP A;  5C44 J;  3MN2 A;  5M3F J;  1AKH B;  2OPT A;  2L7Z A;  2VKV A;  1PUF B;  2XB0 X;  4IEJ A;  4C3J J;  3GTO J;  2Y9Y A;  1WCM J;  1FJL A;  3OIO A;  2EZI A;  4UUS B;  5J1R A;  3GTQ J;  2L7F P;  2NVY J;  1ETK A;  1B72 A;  1QRY A;  2XPU A;  3JRB A;  4A3M J;  2E19 A;  4M3F A;  4JX4 A;  1P7J A;  5FKM A;  1RPW A;  3HOX J;  3G1O A;  3BG9 A;  3JRC A;  4J19 A;  3BG3 A;  4D7N A;  1ZGW A;  4M3G A;  5FKK A;  5E3L A;  1JUS A;  1IG7 A;  3S1N J;  1ETO A;  4CYC B;  5C4J J;  1LE8 B;  3BR0 A;  2MGQ A;  3CQZ J;  4UUS A;  4A69 C;  4XRM A;  4B4C A;  2LP0 A;  3JRH A;  2HDD A;  2R7Z J;  2JA5 J;  3O8H A;  3H0G J;  2Y9Z A;  4ABZ A;  1JT0 A;  3Q3S A;  3TP3 A;  1Z0X A;  3FIW A;  2LFB A;  3NAU A;  4W1U A;  2JA7 J;  3JRI A;  1MBK A;  1Y1V J;  5F27 A;  5J1U A;  3MVP A;  4RDU A;  4C2M J;  2K9S A;  3S15 J;  3B6C A;  4QIW N;  4XIC A;  3BR3 A;  1CQT A;  2LK2 A;  1LE8 A;  1JTX A;  5M5W J;  1UHS A;  4IHV A;  5FLV A;  2DA5 A;  1JUM A;  2ID6 A;  1BW6 A;  2MW8 A;  4HNV A;  2JN6 A;  2XSD C;  3QQA A;  5IYD J;  2Y30 A;  1A6I A;  2IEK A;  2XGD A;  2CJJ A;  4A3K J;  3A01 B;  1IDZ A;  1NK2 P;  4A3C J;  2HI3 A;  5GPC A;  4NDL A;  2FX0 A;  2R5Y B;  3S1Q J;  5IYC J;  5GP9 A;  2HOT A;  2DMQ A;  2CU7 A;  4FE7 A;  2ME0 A;  3L1P A;  1VFC A;  1R9T J;  2M34 A;  2HXO A;  1D5Y A;  4MFE A;  2R92 J;  5IP9 J;  5K7F A;  1ZKG A;  1IC8 A;  4AYB N;  4A3G J;  5IYB J;  5EYR A;  1ITY A;  2AHQ A;  2DMT A;  1MBG A;  3QPS A;  3S17 J;  3CMY A;  1GT0 C;  2R5Y A;  1IJW C;  1NTC A;  3A03 A;  5EG0 A;  3GTM J;  5F0F A;  3B6A A;  2HOS A;  2DA6 A;  2ID3 A;  1JKR C;  1OFC X;  4A3L J;  3ZQF A;  4BKX A;  1QVT A;  2NVX J;  1GDT A;  3RZD J;  4D5C A;  3HGG A;  3JRF A;  1RR7 A;  1FIA A;  1ZR4 A;  2TRT A;  3PM1 A;  1ETY A;  1B8I B;  2M0C A;  1JT6 A;  4V2G A;  4JP0 A;  3ZQI A;  1AHD P;  1ETW A;  5F04 A;  2KDZ A;  4XRS G;  2WV1 A;  3E7L A;  3HOY J;  2Y0S N;  5K7Z A;  1TWC J;  1MNM C;  2XPV A;  1VF9 A;  2VKE A;  2QF7 A;  4QSH A;  1LFU P;  1IV6 A;  2VI6 A;  3HB9 A;  2YU9 J;  4A3J J;  2R0Q C;  2VPR A;  2NVT J;  1MBF A;  2HYJ A;  1JKO C;  4FTH A;  4LOC A;  2LLK A;  5EZG A;  4DYC A;  4AUX A;  3S1M J;  2DA1 A;  1X2M A;  2LVS A;  5EZH A;  1JTY A;  2NS7 A;  1UG2 A;  2ELK A;  2HOA A;  4DYR A;  5EGO A;  1GVD A;  3FIS A;  3BTC A;  4JX5 A;  2B63 J;  2ECB A;  4W97 A;  3HKZ N;  4FE4 A;  2GLO A;  5J3L A;  2LY9 A;  3PO2 J;  1W0U A;  4B3A A;  2E2I J;  1OJL A;  4JX6 A;  2O8K A;  2X9D A;  1H8A C;  3OOU A;  2Y2Z A;  5FKN A;  5M5X J;  3K2A A;  5EEA A;  4C3I J;  1AKH A;  5E3O A;  1A5J A;  1GV2 A;  3M4O J;  1PUF A;  5IPA A;  4XID A;  4QTR A;  4G12 A;  4AC0 A;  1T33 A;  4D5F A;  1MH3 A;  3K7A J;  4M3D A;  4DYQ A;  3GBG A; 
#chains in the Genus database with same CATH topology
 2F4O B;  2IJL A;  3HPG A;  4FHT A;  1ZTR A;  3A02 A;  3BJ6 A;  2R5Z B;  3CDL A;  3GFJ A;  4IRG A;  4UVA A;  4M9Z A;  4DW6 A;  4Q5S F;  4Y33 A;  4F7Z A;  4L5E A;  4EEF G;  3MAJ A;  2FA5 A;  4CYC A;  1SVM A;  2DYS H;  2JPC A;  1DDN A;  5JLW A;  3LA7 A;  1ZEL A;  1YE9 A;  5ERI A;  1H0M A;  1UMQ A;  1VI0 A;  1X3W B;  4HDU A;  3JRA A;  4AWX B;  3V7R A;  2IRF G;  2GOM A;  5C4X J;  4XRS A;  2DT7 B;  3HRU A;  1Y8Q B;  2BXY A;  1U9O A;  3C18 A;  1BOB A;  2R4G A;  4G6T B;  5B66 C;  1IDY A;  2MFZ A;  5CJ9 A;  4BH9 A;  4OIR F;  4BXF A;  4L9J A;  1O7F A;  2QQ9 A;  2BHZ A;  2EIK H;  2ZCW A;  3WE3 A;  4EVI A;  2NVQ J;  1Y8R B;  4GFB A;  1R23 A;  5B1B H;  2JVG A;  1SAU A;  1D1B A;  1UST A;  2B7E A;  5E1W A;  3WGI A;  1K78 B;  2QLZ A;  3J7Y J;  2QYO A;  1O57 A;  3FHZ A;  4KIC A;  4A0Y A;  1MSF C;  4EJU A;  1ZYR F;  5FO5 A;  4BBR J;  5DYM A;  2JA2 A;  2QQ8 A;  1WH7 A;  1HC8 A;  1LUJ B;  2NVU B;  5BPD A;  1A6Q A;  3RKX A;  5KK1 A;  2EFW A;  1H88 C;  2IS1 A;  3L9F A;  1S6L A;  2FSW A;  1Z1D A;  1TNS A;  1B4A A;  4KUM A;  1D3Y A;  5CPR B;  2WTE A;  2IBD A;  2ZXJ A;  4XM3 A;  2JJ7 A;  4EGZ A;  3H0D A;  3K4K A;  2HOE A;  3CJQ B;  1IGN A;  3KIO A;  2GIZ A;  3QPL A;  3N05 A;  4UHT A;  2F48 A;  1POG A;  3K1N A;  3LFU A;  1BM9 A;  1RRJ A;  4QPO A;  2EV6 A;  2XF7 A;  4HSR A;  1U5T B;  5JR3 A;  5HOD A;  1YFH A;  1U2W A;  2L01 A;  4PK4 A;  3VSL A;  1VQP I;  1JJ8 C;  3ABU A;  1Y56 A;  4IHS A;  2M2E A;  2M9H A;  2YX4 A;  3K1P A;  3AG4 H;  3HZJ A;  3WHB A;  2O03 A;  3OV8 A;  3BG7 A;  1YW9 A;  2AXT C;  2W1O A;  4MLO A;  1BW5 A;  2HVR A;  1DU6 A;  2Z1D A;  3UKG A;  5F0H A;  2P81 A;  3K70 D;  1KU3 A;  4EQQ A;  1R36 A;  1Z05 A;  1JGS A;  1Z7U A;  5DTD A;  1XSD A;  2F4I A;  4Y52 J;  2MYS A;  3H5A A;  3JR9 A;  4A93 J;  4DOZ A;  3H36 A;  1KQ9 A;  1T56 A;  4FIS A;  3ZCO A;  2JPB A;  1B9N A;  1ETQ A;  2LBF A;  3F21 A;  4MQV A;  3O2P E;  3U2R A;  1GUU A;  3BPX A;  2K9M A;  4QLC U;  4YIF A;  2H8R A;  3BQZ A;  1TWH J;  5ILV A;  2VQL A;  2G9W A;  2OU2 A;  4DZJ A;  2DA2 A;  4HX8 A;  2LRD A;  2L9V A;  1HLV A;  3J81 K;  2IT0 A;  3IWZ A;  3JSO A;  4XRF A;  1ACI A;  1R1U A;  3PQJ A;  4V19 K;  4M74 A;  2XAQ A;  1BI1 A;  1D8K A;  4XON A;  1I27 A;  3QP5 A;  1FTZ A;  4Y7N J;  2OCC H;  4XSX F;  1H9G A;  1X1P A;  1VQL I;  1B6A A;  2EJR A;  2X6X A;  4A3I J;  3GTP J;  3F3X A;  3BR6 A;  2E60 A;  3BR5 A;  2E34 A;  2W24 A;  4XOT A;  1I3Q J;  4X1E A;  5HLI A;  2XAS A;  1IZ1 A;  4EMS A;  1WJB A;  2XC7 A;  2JUC A;  2DT6 A;  3K0L A;  3WU2 C;  4DGW B;  2R5Z A;  5TIS C;  2E1M C;  1WI9 A;  1ZK8 A;  2QQA A;  5HDN A;  3ECO A;  4BXX J;  5K5Q A;  1HCR A;  4HLY A;  3BR2 A;  2WAQ A;  2V26 A;  2CQQ A;  2FBH A;  3CCU I;  2XGE A;  3W3C A;  5L3D A;  4FX4 A;  4YEJ A;  3E3V A;  2Z2S B;  3C2G A;  2E5N A;  2Z9O A;  4AM3 A;  1QNT A;  3DPU A;  4HST A;  2W7N A;  3ML6 A;  5M3M J;  4O3M A;  2JUG A;  3CJN A;  3MZH A;  4XK4 A;  1GXP A;  1R5I D;  4UNO A;  3RQI A;  4RLF A;  1J09 A;  2E2J J;  2Y48 A;  5BQT A;  3LA3 A;  1M1E B;  2W25 A;  1IXC A;  2WAE A;  2PBI A;  1G2H A;  3BOQ A;  2VJI A;  1LVK A;  2VL8 A;  3B02 A;  2CW0 F;  3QRF F;  3ZRG A;  2R7V A;  2BOL A;  4C9Y A;  5LEK A;  2A07 F;  4F92 B;  1Z21 A;  1DP7 P;  3S16 J;  1K78 A;  3CCQ I;  1E2X A;  4RGU A;  5KCM A;  1JE8 A;  1L3L A;  1JGG A;  4BJ6 C;  1AU7 A;  1XSV A;  3Q0U A;  5IOZ A;  3A4C A;  1YOV B;  3DTK A;  2GA2 A;  2VOO A;  2G0E A;  4RM2 A;  4XOR A;  3RKQ A;  3V8K A;  2HEO A;  3K2Z A;  5DD4 A;  1BC7 C;  1BJZ A;  2XKO A;  4JYK A;  2EIM H;  5J4Y A;  2I10 A;  3BTL A;  4FET A;  2MSY A;  4PDK A;  2J5P A;  3HRS A;  3BWG A;  3IH4 A;  1FBU A;  2H1L A;  3BCB A;  4M71 A;  5DS9 A;  3ZPL A;  3H3V K;  1S7O A;  2P7C B;  2NS8 A;  1R1V A;  2GXG A;  1V3F A;  3HKZ A;  3K6G A;  5D4S A;  1A04 A;  2IA2 A;  4RLQ A;  3I4M J;  4DNC A;  1JXS A;  1YX3 A;  2HKO A;  2XSJ C;  1ZR2 A;  5EGO B;  3P9K A;  1OMI A;  1BA5 A;  2V9V A;  3EDP A;  5B3S H;  5E3N A;  3W2V A;  1FMV A;  2EZH A;  3GZ5 A;  4IHX A;  2DA4 A;  3S3N A;  2FJ1 A;  4L5I A;  2BXZ A;  4OMZ A;  3HEF A;  5HS8 A;  1HXD A;  2VT3 A;  2NOJ B;  3LSP A;  4KN4 X;  4CCN A;  1TWA J;  2HZD A;  1U5T A;  2ZBK A;  4CUG A;  5B5E C;  2FD5 A;  5CVI A;  4CZC A;  2MLG A;  4UUT A;  1QVU A;  4CCL A;  5DCF A;  4DBR A;  3BT9 A;  5KHD A;  3KEQ A;  4I0A A;  3OL3 A;  4H4K C;  3RJP A;  2D2W A;  2XB0 X;  3H5N A;  4C3J J;  1ZRC A;  3GTO J;  2Y9Y A;  1FJL A;  5F6F A;  3IRQ A;  3K4M A;  5J1R A;  4BXU A;  1ZHF A;  2XUB A;  4A5M A;  3FF5 A;  3JRB A;  4KT6 A;  3CCL I;  3NEU A;  2KIM A;  1MJA A;  4HNT A;  1LEB A;  4ANJ A;  4JX4 A;  2BVL A;  4P9F A;  3JAM K;  3HOX J;  4J19 A;  1R1T A;  3BG3 A;  3FDY A;  5B1A H;  2YPR A;  1XTA A;  4I09 A;  4M3G A;  1JUS A;  2ISY A;  4HG2 A;  4D9J A;  1ETO A;  4UB8 C;  2L9N A;  1HKT A;  1VQ7 I;  1MGT A;  3BR0 A;  4UUS A;  2H8W A;  3CQZ J;  1DGR M;  3CO7 C;  3TOB A;  2E1N A;  5J8C A;  3M8J A;  4XRM A;  4B4C A;  3MKZ A;  1HW2 A;  4LK1 F;  3CJT B;  1TW3 A;  3FXU A;  4OU0 A;  1JT0 A;  5FFZ A;  1RZ4 A;  1Z0X A;  4MNU A;  4BS9 A;  1T38 A;  4RAY A;  3BP8 A;  4W1U A;  5CQG A;  5CVR A;  2KRC A;  2PMH A;  3MVP A;  2ZME C;  4PCQ A;  3T5X A;  5HLG A;  1VQN I;  5LRS A;  3B6C A;  2VQH A;  3K9T A;  2BVM A;  1CQT A;  1QQI A;  2VKD A;  1LE8 A;  4BYY A;  2EFN A;  1IN7 A;  2DA5 A;  2DOF A;  2B9S A;  4G7O F;  3TO7 A;  2MW8 A;  2LRE A;  3PIO F;  1J5Y A;  4BHP A;  5IYD J;  5HLH A;  5HVQ C;  2E7X A;  5CVU A;  2FRH A;  2DPU A;  3TDZ C;  3A01 B;  4A3C J;  3S1Q J;  1G3S A;  1S3J A;  2HWV A;  2FU4 A;  3KP6 A;  4L0Z B;  4LLN A;  2DMQ A;  2XKP A;  3KLN A;  4FE7 A;  3FXQ A;  1VFC A;  2V7F A;  2R92 J;  3TL4 X;  5K7F A;  2VOP A;  3Q5F A;  4DIQ A;  4KDP A;  2VAS A;  4A3G J;  5EYR A;  2PMU A;  1FY7 A;  3PIP F;  3K4C A;  1TTY A;  3IWF A;  3CCJ I;  3S17 J;  2IGM A;  3HTS B;  2VQG A;  3RYR A;  1EKE A;  3WTS C;  2R5Y A;  1IJW C;  1OCR H;  4OAZ A;  5F0F A;  2RDP A;  4E7H A;  3I5U A;  1VQ9 I;  2DA6 A;  1JKR C;  3EYY A;  2CW8 A;  4A3L J;  1GLN A;  3LSM A;  3HC7 A;  3TKY A;  2JT1 A;  3U9G A;  3G2B A;  1HQC A;  3GVA A;  4M73 A;  5ILU A;  1E3H A;  3ABK H;  1V4R A;  3GEZ A;  3R0A A;  4PJM A;  1B8I B;  1W7P B;  4U7B A;  4JP0 A;  4ENN A;  1WFX A;  1LKX A;  2O6G E;  2VBZ A;  1MNM C;  2FBI A;  2XPV A;  2ZSH B;  4QSH A;  4AID A;  2BYV E;  4CH7 A;  1X1C A;  4XQF A;  2UUZ A;  5L3E A;  2IXS A;  3HB9 A;  4NC7 A;  3MKY B;  1KQ0 A;  3OYH A;  5FLX Z;  3SEQ A;  2EA4 A;  2M45 A;  4A3J J;  2Y69 H;  2VPR A;  3Q9V A;  1N77 A;  1SFX A;  1V54 H;  2Q2E B;  3AG3 H;  4GRI A;  3MD2 A;  4IJA A;  3TBI A;  5EZH A;  4DYR A;  5EGO A;  3MEX A;  3FIS A;  3PSI A;  4E7J A;  3GUD A;  3M7G A;  2RC4 A;  4NC6 A;  1N25 A;  3T1B A;  3HKZ N;  1W1W E;  3BCA A;  1YO5 C;  2HVS A;  2HQR A;  1B1B A;  4Y15 A;  2LG4 A;  1QZY A;  2E2I J;  4GXO A;  2R7U A;  2CUJ A;  2STT A;  3KEO A;  3SZT A;  1OCO H;  4YFX F;  1D1C A;  1BI2 A;  2VQC A;  3TGN A;  3REO A;  5LD2 C;  4O6J A;  5M5X J;  3K2A A;  1I1S A;  5EJC A;  4C3I J;  3HYI A;  1WZ2 A;  5K1Y A;  2BGC A;  4XID A;  3I53 A;  2XF6 A;  3KZY A;  4YEL A;  1BC8 C;  3OYE A;  4RMN A;  4DYQ A;  3RDI A;  2A6H F;  2M8E A;  1QPM A;  1WJ5 A;  5F1R A;  2ETH A;  2K7L A;  2UXX A;  2CS3 A;  4PJ0 C;  3GTG J;  2IA0 A;  1P4W A;  2CO5 A;  2CWE A;  3CTA A;  3FZV A;  1FT9 A;  1IRF A;  4PJN A;  5FLM J;  5DCM B;  4PGG A;  4BQQ A;  2OQR A;  3ASO H;  2VXD A;  5DDG A;  2RNJ A;  3K10 A;  2VBY A;  2LKS A;  3WTV C;  1YLF A;  4M6V A;  2HU9 A;  3J80 Z;  3E6D A;  2Y75 A;  1KZH A;  4XBF A;  2KZG A;  3GLX A;  3R4K A;  1UEL B;  2L0K A;  1IN5 A;  3WTT C;  1F43 A;  1S7A A;  1JHH A;  4FX0 A;  1LDK B;  3ESW B;  2X51 A;  5D4R A;  2ECC A;  2FXA A;  2H09 A;  3PQK A;  3OSG A;  2QZ8 A;  2O9L A;  4WF2 A;  1E0E A;  1SFO J;  2FOK A;  5D8K B;  1B59 A;  3QWL A;  2UXN A;  3TW7 A;  1IRG A;  4HLX A;  5K5R A;  3H9J A;  2EH3 A;  3R6S A;  4R79 A;  3FK6 A;  3FXO A;  1G6N A;  2RV8 A;  1YS7 A;  2L4A A;  2V6E A;  3HDD A;  4M9S A;  1S9H A;  4Y13 A;  5HS9 A;  4A5N A;  2CUZ A;  3H35 A;  5DV5 A;  3GTJ J;  2RGV A;  3MZ8 A;  4HF1 A;  1HW5 A;  1S8N A;  1KGS A;  4IKF A;  2XAH A;  3ZOB A;  3CF5 F;  3DWL E;  2GBY A;  3A01 A;  2DFH A;  2DOE A;  4CZZ A;  2OUM A;  4ENK A;  3OY9 A;  4M3B A;  3S3M A;  3P5J A;  1RET A;  2EQR A;  3CLQ A;  1P7I A;  3CMA I;  4RGX A;  3F0C A;  3BQY A;  4CCJ A;  1PUE E;  4MTE A;  1ZAR A;  2M87 A;  2G7U A;  2HPI A;  3IC7 A;  3KE2 A;  1YRN A;  4F3Q A;  5IP7 J;  3S14 J;  2X48 A;  2IGK A;  3TED A;  3OYL A;  3RPU A;  4WXC A;  3OYJ A;  3MWM A;  1YHQ I;  2F5C A;  1U9N A;  4S04 A;  1IXS B;  4NC8 A;  3G4S I;  2M4G A;  1XS9 A;  2X1C A;  4PFO A;  2VE9 A;  1RKW A;  2VON A;  1R4M B;  1YIO A;  3C2H A;  3Q0V A;  3QYE A;  2TCT A;  3DPL C;  3C2B A;  2ME6 A;  5FKL A;  3D5S C;  2PX9 A;  3C3W A;  5F08 A;  2VJ4 A;  5J4V A;  2DA7 A;  4MFD A;  1SMY F;  2R7D A;  4A3E J;  3KEY A;  2JQ7 A;  2R7R A;  1YYV A;  3VFZ A;  1OPC A;  2QCO A;  1W7P A;  4UB6 C;  4YFK F;  1B8I A;  4KJZ A;  3HIF A;  4LJZ F;  3RSN A;  2LD5 A;  2FOW A;  2QWW A;  2WC2 A;  2LBF B;  3ROU A;  3H3U A;  3WTX C;  1PDN C;  3LSJ A;  1FIP A;  3HOU J;  4DQ2 A;  2XAU A;  1R5H A;  1I50 J;  2QA4 I;  3J7A O;  3K4N A;  3HGY A;  1Z67 A;  4E6K G;  1CF7 B;  2LY1 A;  4BQO A;  1XGM A;  2JA6 J;  2D1V A;  2IVM A;  4LG0 B;  1O3R A;  5F1J A;  2Q2E A;  3P9C A;  2EIN H;  2QEN A;  5ICE A;  3IKV A;  1QGP A;  2E36 A;  5J40 A;  4ZZL A;  2HPM A;  5DUI A;  1TWG J;  1YS6 A;  3QPH A;  3SYT A;  3C1D A;  2ZME B;  3VPR A;  2K9Q A;  1BI0 A;  4E4H A;  4BNC A;  1BJA A;  1BIB A;  2ELH A;  2WWY A;  3HOV J;  2P5K A;  3F8C A;  1E17 A;  4ESF A;  2CSO A;  2OF7 A;  2OJE D;  3W6V A;  3KYD B;  4AVP A;  2AS5 F;  3SFI A;  1TNT A;  3W2A A;  5FD5 A;  3ZMU A;  2WBM A;  2Q8K A;  5LGT A;  2P7V B;  1F36 A;  3H3Z A;  4LLG F;  1JI8 A;  2WAF A;  3HG9 A;  5EF6 A;  3V7S A;  4U87 A;  2M0M A;  5L3B A;  4E7S A;  3LMM A;  1ZG1 A;  1FNN A;  3T8T A;  3I55 I;  1SD5 A;  3ZMV A;  3L2W A;  2BY1 A;  2BW3 B;  1O4X A;  5ED4 A;  3WHC A;  1SFK A;  4D7M A;  3JRD A;  4HW0 A;  2L9R A;  1FSE A;  3D0S A;  5DCM A;  5LGU A;  4CXF A;  2OV7 A;  3PNT A;  4FQG A;  4BE2 A;  1RC9 A;  3VYU B;  4IHY A;  1WJC A;  2LKX A;  1YJ9 I;  4I6Z A;  1K83 J;  3GCM A;  3UNG C;  1NH3 A;  1LDD A;  3IH2 A;  2XV4 S;  3DEU A;  1TWF J;  3M07 A;  2DOD A;  2DO7 A;  1OCZ H;  1MND A;  3BG5 A;  3I71 A;  3F9K A;  4RB2 C;  1J59 A;  3S2H J;  5J8F A;  2W84 A;  2JZY A;  1FOK A;  4HPQ A;  1VND A;  1MMG A;  2KLO A;  1G4D A;  4O5V A;  2K85 A;  2STW A;  3CO6 C;  3BJA A;  5EG0 B;  1XSX A;  1FSH A;  3HSR A;  2DPD A;  2MH9 A;  2IAI A;  3LQR A;  1T0F C;  2KT0 A;  4Z2Y A;  3ZMZ A;  4S05 A;  1TZL A;  3TDU C;  2CV2 A;  2J5O A;  3G1L A;  1SAN A;  1XGS A;  1ENH A;  3QPT A;  1TW2 A;  3L00 A;  3QU6 A;  2R7S A;  1YG2 A;  3HUG B;  4PJJ A;  3WOD F;  2XHK A;  4C3H J;  3WTY C;  2HKX A;  4L5J A;  3EQL F;  3CC7 I;  1V5F A;  3GFM A;  1U8B A;  1XC5 A;  3TMO A;  2DTR A;  1OYY A;  4A3D J;  3FMS A;  1B9M A;  1Z7L A;  2CYY A;  2EA2 A;  2JMW A;  2NYX A;  4MIM A;  4P9U A;  1HBX G;  2XAJ A;  4L18 B;  5BNG A;  4K2E A;  3ZN1 A;  4OIO F;  2FQ3 A;  2KFD A;  5F0C A;  2E2H J;  3K1M A;  2CH0 A;  2CRG A;  3ERM A;  4ZYE A;  1TLH B;  2BHY A;  3GTL J;  1HDD C;  1X4P A;  4XLN F;  3VWB A;  4U0Y A;  2QGU A;  4ZYG A;  1R7J A;  4IVN A;  1A31 A;  5J1Y A;  4N0B A;  2YR2 A;  2K86 A;  4V2F A;  4BY7 J;  5FJ8 J;  5CVJ A;  2YU3 A;  4HQM A;  3OYG A;  1RI7 A;  1ZQ3 P;  1ZGJ A;  2EBI A;  5KAI C;  3FK7 A;  2ZNZ A;  2BBY A;  2ACJ A;  2ZB9 A;  1IUF A;  4RBO A;  3IV5 A;  2ZXH A;  4A3F J;  4JQF A;  2F5V A;  1FC3 A;  4C2U A;  4II3 A;  4XLP F;  3BZK A;  3MN2 A;  5C44 J;  3OS0 A;  5M3F J;  2CV1 A;  2VKV A;  1PUF B;  4GYG A;  3F6O A;  2MD5 A;  5ILS A;  2LKP A;  2EZI A;  4UUS B;  3GTQ J;  2L7F P;  1CF7 A;  4OMY A;  2RNG A;  1QRY A;  2XPU A;  4P55 A;  1P4A A;  4LG0 A;  4EAT A;  3EUH C;  4ZH4 F;  2VT2 A;  1TT0 A;  4M3F A;  1KQ8 A;  1P7J A;  3ERE D;  2W4S A;  2LY2 A;  1FP2 A;  3G1O A;  2EWN A;  4Q47 A;  3BG9 A;  1Z9C A;  3F8M A;  5TGT A;  5JFR A;  1IG7 A;  1O7L A;  2ZME A;  3R60 A;  5AON A;  3E5U A;  2HFH A;  5C4J J;  3PFI A;  1LE8 B;  3HRM A;  4A69 C;  2L2O A;  1K4T A;  2L4M A;  2PG4 A;  4BJ5 C;  2LP0 A;  2MC4 A;  4D1Q A;  1J9I A;  2VE8 A;  1P9Q C;  1R22 A;  3BDD A;  3FIW A;  5DM6 F;  3NAU A;  4UV9 A;  1C0W A;  3GFL A;  3RQ4 A;  2JA7 J;  5E8G A;  4I01 A;  1MBK A;  1Y1V J;  4RDU A;  2K9S A;  1XGN A;  3S15 J;  1XCV A;  3M9A A;  1X1A A;  5E1Z B;  1J75 A;  4XIC A;  2PFB A;  2A05 A;  1JTX A;  2VC0 A;  2K4B A;  5M5W J;  4HV6 A;  1XX5 A;  5HNF A;  1YQA A;  1MJB A;  1T98 A;  2AQE A;  3S32 A;  5DUK A;  3VOE A;  1FYK A;  2BW3 A;  2Y30 A;  1A6I A;  4MEY F;  3HHG A;  2FE3 A;  1YI2 I;  1NHA A;  1RR8 C;  3U21 A;  4IPA A;  2R5Y B;  2XRN A;  4G6D A;  4UY8 I;  3IRR A;  4ENJ A;  1W36 D;  2HOT A;  4BHB A;  2XVC A;  4LB5 A;  2DAO A;  4GDF A;  2M3A A;  3M8F A;  5EEH A;  2ME0 A;  3L1P A;  1YJN I;  1KA8 A;  2DW4 A;  2F5D A;  4N9H A;  1ZKG A;  1XN7 A;  2EV5 A;  1IC8 A;  3ZP5 A;  1R4N B;  2FMY A;  1ITY A;  5ICC A;  3FMR A;  1IF1 A;  1KYW A;  2F4M B;  1X3U A;  1GT0 C;  1NTC A;  3A03 A;  1X1B A;  2HYF A;  5D5V B;  5EG0 A;  3GTM J;  3BY6 A;  2H6C A;  3JCU C;  3S8P A;  1WWX A;  3LAJ A;  2ID3 A;  2OBP A;  4XOP A;  2Z5U A;  1DPU A;  3EUK L;  1QVT A;  1X3Z B;  2HS5 A;  3LAP A;  2ADU A;  2BZT A;  2KMU A;  3AFH A;  1GDT A;  3HGG A;  1ZLK A;  1F4K A;  2GIV A;  3GWZ A;  1FIA A;  4XKC A;  2R7T A;  3FMQ A;  1FOX A;  1ETY A;  3SDB A;  2X6Y A;  2M0C A;  1EH8 A;  5K5O A;  3HUG A;  1FOY A;  1SC7 A;  4V2G A;  5FD6 A;  1HSJ A;  3DBH B;  4XRS G;  3E7L A;  3R61 A;  3HOY J;  5K7Z A;  5ICF A;  2ZJQ F;  2VKE A;  2QF7 A;  4IOC F;  1ON2 A;  1LFU P;  1IV6 A;  2G7H A;  1FBS A;  3F22 A;  1YW8 A;  5KVR A;  2VI6 A;  2KJC A;  2WY7 Q;  1Q1H A;  4KMU X;  3DTI A;  3OS1 A;  5FLX K;  1MBF A;  2HYJ A;  1JKO C;  2DQL A;  4C30 A;  2KDO A;  2CG4 A;  2V1D A;  1YIJ I;  3LSK A;  4AUX A;  3RPU D;  3CME I;  4KT5 C;  3FXM A;  1IN8 A;  2EK5 A;  4RS8 A;  2NS7 A;  1UG2 A;  2JSC A;  3M1E A;  2W82 A;  3LSI A;  2RKH A;  1F1Z A;  3FWE A;  1LFP A;  2ESN A;  2B63 J;  4XLE A;  2X1E A;  4I0B A;  5F64 A;  2A69 F;  2ZJP F;  2BY2 A;  4HZF A;  2LF8 A;  4QWQ A;  3GZN B;  4KIF A;  4BQA A;  4B3A A;  2A5W A;  3QP6 A;  2O8K A;  4JX6 A;  5FRM A;  1J2X A;  1JHF A;  3ASN H;  4NNJ A;  4WX9 A;  2LSO A;  4ESB A;  1P2F A;  2VJ5 A;  1QA6 A;  1OKR A;  1W7P D;  1HST A;  4B3X A;  3L2R A;  4CCO A;  1K79 A;  5EEA A;  4B09 A;  5E3O A;  3WU0 A;  3M4O J;  1PUF A;  4QTR A;  4G12 A;  1SAX A;  1FLI A;  3IUO A;  4KIT B;  2BY0 A;  3LL7 A;  4M3D A;  1HW1 A;  3PNV A;  1D8J A;  1YTY A;  4RGR A;  1LB2 A;  1AOY A;  3BLY A;  3Q9S A;  5BOX A;  4IRI A;  3ZQ7 A;  1TQI A;  4AD9 A;  1V5E A;  3DEE A;  4OIN F;  4WXH A;  2V4J C;  3O3K A;  4S0H B;  1GXQ A;  1X2N A;  1VQ5 I;  1XD7 A;  5IP6 A;  1QZZ A;  5FKO A;  4FT8 A;  3WGG A;  4UV8 A;  3J80 K;  1EV7 A;  3FXK A;  4BBS J;  3IH3 A;  4R8H A;  2EZK A;  1XMK A;  1U8R A;  2VJJ A;  2CUE A;  2DQR A;  4PGH A;  1APL C;  2K4J A;  2Y0M A;  3JRG A;  1NG7 A;  2M30 A;  4OWR B;  2B0L A;  4A12 A;  5JHU A;  1T08 B;  2HQ5 A;  2PMZ A;  3OIQ A;  2DMN A;  4KYW A;  1BR2 A;  2QSH X;  1CGP A;  3DF8 A;  1LFB A;  3FX3 A;  3AG2 H;  2P6S A;  5JI6 A;  4HV5 A;  5M5Y J;  1YRN B;  3M1C A;  2XB5 A;  2A68 F;  4LK0 F;  4KIG A;  4NBQ A;  5D5W B;  4ZC3 A;  4IHW A;  3FKJ A;  2O5R A;  4UVB A;  1WJE A;  3ISP A;  5HDG A;  2JRT A;  2JK3 A;  2XGC A;  1ETX A;  3CCS I;  2MC3 A;  5JVT A;  4BQN A;  1U6G A;  4KNY A;  4ZJZ A;  3PNY A;  1G59 A;  4Q48 A;  1U78 A;  4L9V A;  5J47 A;  2WB1 N;  5KNL A;  3D1N I;  1UHM A;  1ZAO A;  3GX4 X;  5EDN A;  3EUA A;  5TRD A;  1P6R A;  1ETV A;  3HHH A;  4G7H F;  2UWM A;  3JRE A;  4PUS A;  2UZK A;  1JKQ C;  3MQ0 A;  1ODD A;  2HGC A;  2DFI A;  3I4P A;  4B1R A;  1SFU A;  1VQ6 I;  1V5G A;  1W5C C;  4BJT A;  1MJ9 A;  1WVR A;  5E8I A;  3LOC A;  3RZO J;  3I4N J;  3FXL A;  2LH9 A;  1BL0 A;  2CQX A;  4XNF A;  4Z6Y A;  4LFU A;  3HJE A;  3OYD A;  3CLO A;  1OYW A;  3CCV I;  3FM5 A;  1SD7 A;  2H6B A;  3VYR B;  4G94 A;  4I76 A;  4EJW A;  3AG1 H;  2KRH A;  2L7M P;  2VBW A;  3HXL A;  1RNL A;  3SEZ A;  4BL0 B;  3CUO A;  3DEW A;  3CCY A;  4I98 B;  3CJR B;  1HF0 A;  1MIJ A;  3DLA A;  5GAH J;  2K40 A;  3J7A Y;  3WGH A;  3MMY B;  4F55 A;  5CQE A;  2F5E A;  5HS7 A;  2M1B A;  1GHC A;  5A2Q K;  2E35 A;  2E1M B;  2L5Q A;  3SQN A;  4Q4Z F;  3V8L A;  1FWZ A;  4Y4R A;  4C2T A;  2MA3 A;  3CD6 I;  4RB0 A;  2NS0 A;  4EM1 A;  1K61 A;  2OD5 A;  4LLL A;  3GO5 A;  2O8X A;  3BJO A;  2VOD A;  3QYB A;  5K7H A;  3BTJ A;  2YSR A;  3V8J A;  5GTH C;  2DK8 A;  5L3F A;  1OR7 C;  2R3S A;  3G1M A;  3LST A;  5HLT A;  3KYL A;  3F72 A;  1VTN C;  2DJN A;  2EIJ H;  4IX7 A;  4XLA A;  3ZQQ A;  1LDJ A;  4CYD A;  3ZQH A;  3DBR B;  1I5Z A;  5E1X A;  4CIC A;  2MLK A;  2XIG A;  3RIR A;  1EF4 A;  3F8F A;  4UXN A;  3CF2 A;  4ZDO A;  4F93 B;  3KP4 A;  2DN0 A;  3HSF A;  4HEA 2;  2W85 A;  3JW4 A;  1SVL A;  4LG3 A;  5JVG F;  1MBH A;  1WH5 A;  1PVE A;  4H0E A;  5D5X B;  2BY3 A;  5ICG A;  2YS9 A;  3OSF A;  1Y39 A;  1OCT C;  4CCK A;  4L0Y B;  5FRN A;  1MW7 A;  4BAY A;  2DFF A;  3WG7 H;  3PUF A;  5HNH A;  2M4K A;  3ZQC A;  3TQN A;  3ZN0 A;  3DPT A;  4LB6 B;  4YFN F;  4U88 A;  2V79 A;  3TP0 A;  1PJR A;  1W5S A;  2LMD A;  5BPI A;  2V1N A;  4EJT A;  2MD0 A;  2HR3 A;  2GZW A;  1SVO A;  3SFZ A;  3GZ6 A;  3KP2 A;  2W00 A;  2RAE A;  2EV0 A;  3E6M A;  5TJJ A;  5GTI C;  3DFG A;  3LA2 A;  1T0F A;  4XSZ F;  2VC1 A;  3HOZ J;  2L02 A;  3KZI C;  3FHN A;  1F9N A;  2N8G A;  2Q1Z B;  1MSE C;  4Y17 A;  3FXJ A;  3X2Q H;  3S1R J;  1SEU A;  1JUP A;  3O8G A;  2DI3 A;  4D0P A;  1XCB A;  2P8T A;  1HOM A;  3LSG A;  3WG9 A;  3S93 A;  2Y31 A;  4LIT A;  4IZZ A;  3JSP A;  3DKY A;  2QM3 A;  1IW7 F;  4IQ4 A;  1KU2 A;  3PJR A;  2PMZ N;  2ZJR F;  2Y0S A;  1O3T A;  1X19 A;  1EH6 A;  2KIU A;  3LSR A;  1VQ4 I;  3KYC B;  2AO9 A;  1VZ0 A;  3OIP A;  1IN6 A;  2GWR A;  3WTZ A;  2A5Y B;  3I0T A;  5J6X A;  1K6O A;  2HDW A;  5LHG A;  1Q1V A;  3HOW J;  2MBF A;  5D5U B;  4YIR X;  4KN7 X;  3ELK A;  3ABT A;  2DA3 A;  2WV0 A;  2GM4 A;  4J01 A;  4XLH A;  2OZ6 A;  1TQM A;  2P5L C;  2MG4 A;  2JTV A;  2DCE A;  5FB2 A;  1SD6 A;  3HOT A;  2DJI A;  1H89 C;  2OZU A;  1PP8 F;  3DP7 A;  2XAF A;  1Z91 A;  3MKL A;  3CUQ C;  2V1U A;  1Z77 A;  3VSK A;  4EM0 B;  3K70 C;  3W2W A;  1LEA A;  3CC4 I;  3NWT A;  5H20 A;  4OIP F;  1KU9 A;  4TV7 A;  2OCE A;  5IT3 A;  3CCE I;  4N4O B;  1T6S A;  4U0W A;  4BY1 J;  2OC6 A;  3AAF A;  3QOD A;  3RTR A;  2LNB A;  1WGX A;  2XRL A;  3A0H C;  1XG1 A;  4XN0 A;  2K02 A;  2DTZ A;  3BG6 A;  4HRI A;  4BDZ A;  1WHU A;  3OOP A;  3EUH A;  3E1S A;  2O7O A;  3OYC A;  3OWT A;  1QZE A;  4CDG A;  5DEQ A;  4RAG A;  3KP5 A;  1AKH B;  3MZY A;  1FPQ A;  4LIU A;  4BEH B;  4E7Z A;  2O3F A;  2M7A A;  4KMF A;  3OIO A;  4IRH A;  2K5C A;  3K69 A;  3WU1 B;  2MAB A;  2NVY J;  1ETK A;  2RQQ A;  1B72 A;  3GYH X;  4A3M J;  3HPH A;  1STZ A;  4KA4 A;  5DM7 F;  2E19 A;  5FKM A;  1A35 A;  1RPW A;  1WJA A;  2KP6 A;  3B73 A;  4EJV A;  1BR4 A;  1PYV A;  3JRC A;  1S72 I;  1WJD A;  4D7N A;  1AWC A;  5E3L A;  5FKK A;  2VN2 A;  3UR3 C;  2KZV A;  3V42 A;  4A2U A;  5LHH A;  4G8X A;  1E3P A;  1T95 A;  3IAM 2;  3JRH A;  3CZ6 A;  2HDD A;  3H0G J;  2Y9Z A;  4ABZ A;  2I8D A;  3Q3S A;  2ZJ2 A;  2K27 A;  1N75 A;  3RPQ A;  3TP3 A;  4B47 A;  3CC2 I;  2LFB A;  4MGR A;  1LPQ A;  4XN3 A;  5LLQ A;  1BBY A;  4PZJ A;  5F27 A;  5J1U A;  3JRI A;  3L2Q A;  2IGO A;  1BOA A;  2GOX B;  1P4X A;  2CQ7 A;  5E17 F;  2LK2 A;  1MKM A;  1TP4 A;  2EB7 A;  4LGW A;  4B48 A;  3OS2 A;  4G7Z F;  2OTL I;  3OR2 C;  4RAZ A;  1W5T A;  3ZXS A;  1JUM A;  3ZMT A;  2ID6 A;  1BW6 A;  3VOD A;  3COA C;  4I7H A;  3QQA A;  5DD8 A;  3W6J B;  2IEK A;  3DU6 A;  1A36 A;  2CQN A;  3I64 A;  4B43 A;  2CJJ A;  4E70 A;  4A3K J;  1W36 C;  4G9Y A;  2A61 A;  2HTJ A;  1NK2 P;  2HI3 A;  3KX2 A;  2P6T A;  2FX0 A;  4M9X A;  2IP2 A;  2FBK A;  1FMW A;  3VB2 A;  1O3Q A;  1LNW A;  2VB6 A;  5LEJ A;  3P7N A;  2CU7 A;  3RKY A;  5HDK A;  4CO8 A;  1R49 A;  1X4O A;  1XDU A;  1IUY A;  1USS A;  5IP9 J;  2E1C A;  4P1W A;  6PAX A;  1ON1 A;  4IQJ A;  3C7J A;  4M6X A;  5IYB J;  2DU9 A;  2DFE A;  3A2K A;  4BE0 A;  4WXD A;  5CKT A;  2X85 A;  2ZXW H;  3CMY A;  4BHC A;  1XMA A;  1FYM A;  3B6A A;  3E5Q A;  3TO6 A;  2CQK A;  3RYP A;  4L9N A;  2HOS A;  2NAZ A;  1WKM A;  4PJL A;  2VLA A;  1UAA A;  2L54 A;  2ZSI B;  3GFI A;  5FFX A;  4DJA A;  5LBQ A;  1FYL A;  1RR7 A;  1EH7 A;  3U1D A;  3LWF A;  1ZR4 A;  2WA0 A;  4WCG A;  2TRT A;  4RAF A;  3PM1 A;  2F5F A;  3OYI A;  3AL0 C;  3HOS A;  3DKX A;  1JT6 A;  3G71 I;  4ENM A;  4HNU A;  2HZT A;  3H92 A;  1VQM I;  3ZQI A;  4HDV A;  2DDA A;  1PP7 U;  2XF5 A;  2E5Z A;  2Y0S N;  4RGS A;  2PJR B;  3FBI B;  5EEG A;  1S29 A;  1TWC J;  2HVQ A;  1VF9 A;  1QBJ A;  2K9L A;  4YRV A;  2ESH A;  4HBL A;  4KFC A;  1ZH5 A;  1UZC A;  1FZP B;  2R0Q C;  1IXR C;  4FTH A;  4ESJ A;  2R7X A;  4IF4 A;  5EZG A;  4DYC A;  2EPF A;  3L2C A;  3H9G A;  3S1M J;  2LVS A;  4BGD A;  3PL8 A;  2V9K A;  1JTY A;  2HOA A;  1MD0 A;  1GVD A;  2RN7 A;  1N78 A;  1WJF A;  2YX7 A;  4NB5 A;  2V6C A;  2JSP A;  1BI3 A;  2R7O A;  3EYI A;  1ZN2 A;  2ECB A;  3HSE A;  4RM3 A;  4W97 A;  4DBQ A;  3IL2 A;  4ZYA A;  2D45 A;  4ZTF A;  2VXZ A;  2COM A;  1G8X A;  3ZR8 X;  3PFY A;  3OYM A;  5J3L A;  1Z6T A;  2GLO A;  1Y0U A;  1ZLJ A;  2Z33 A;  3CDI A;  1K7A A;  1Y6I A;  1IN4 A;  2GAU A;  4HX4 A;  3OOU A;  5IT9 Z;  1XDS A;  1ZG3 A;  3L09 A;  2A6T A;  5CYV A;  5FGM A;  3J7Z I;  5FKN A;  1WQ2 A;  2OQG A;  5H6Q A;  1Z3Y A;  1T2K A;  3F23 A;  2XDV A;  1U3E M;  1AKH A;  2Z99 A;  1GV2 A;  2IGN A;  5IPA A;  4BEH A;  4AC0 A;  1T33 A;  3MFK A;  1LJ9 A;  4D5F A;  1MH3 A;  3K7A J;  4LD5 A;  4ZDL A;  5FRO A;  3VEP A;  3VYT B;  3V4G A;  3WTU C;  1IRX A;  2HQA A;  2NNY A;  2EIL H;  2ISZ A;  2P0W A;  2QBY B;  1XB4 A;  1D1A A;  2KIF A;  2ZXI A;  2H1K A;  3ZGK A;  5E18 F;  4IO9 F;  1SFE A;  3DQV C;  3NAR A;  4M3E A;  4A0Z A;  2FQ4 A;  2ZC2 A;  3E6C C;  3LQQ A;  2O61 A;  1EA3 A;  1IRZ A;  5D6E A;  2TDX A;  3L2V A;  1Y1W J;  1ZGA A;  2KQR A;  2L9S A;  2QVO A;  1MH4 A;  1UG0 A;  2C6Y A;  3SJM A;  1GV5 A;  2E1O A;  2Z3Y A;  3DCF A;  3L2U A;  1G3T A;  2OTJ I;  2YUS A;  3SXY A;  3D5R C;  3OYN A;  1MBE A;  1X58 A;  4JK1 X;  3H9Q A;  4OAY A;  1W0T A;  3JTH A;  3JTG A;  4IL6 C;  2WB1 A;  3BR1 A;  2X6W A;  4A3B J;  5E20 A;  2DMP A;  2HTS A;  4EGY A;  1J0R A;  3ONQ A;  3EET A;  4P5O A;  1Z3X A;  1VQ8 I;  2E71 A;  3BZC A;  2H27 A;  1FP1 D;  3HRT A;  3WE2 A;  1OCP A;  1O3S A;  1K4S A;  3F6V A;  4AU7 A;  4ON0 A;  3OYA A;  3KP7 A;  3U1K A;  4I99 C;  1IO2 A;  2BE5 F;  5BS6 A;  3DTE A;  2GA1 A;  3CUQ B;  2OA4 A;  9ANT A;  3DBL B;  4EM2 A;  1WI3 A;  1MMS A;  3CP2 A;  3DLL F;  4CA0 A;  3A0B C;  4AIH A;  4IXA A;  4BE1 A;  1OCC H;  1TQP A;  4I02 A;  3ZMD A;  4PSW A;  2DMU A;  1WPK A;  3DXJ F;  4ZDP A;  4R1H A;  2VIX A;  2JWT A;  3H1C A;  2RQP A;  4E7I A;  1FTT A;  2CGP A;  3ABM H;  2FNP A;  1VQO I;  2D5V A;  2IS6 A;  3M8E A;  1BIA A;  1QHG A;  2LDU A;  3S2D J;  3FBN B;  1KON A;  5E79 C;  1U0J A;  1D5V A;  1UHW A;  1HKS A;  2QUF A;  1YIT I;  4XR6 A;  4HA8 A;  3CCM I;  2JA8 J;  4YII A;  2PQ8 A;  4PFP A;  2DXI A;  2A6E F;  3CES A;  3BTI A;  3PO3 J;  4L9T A;  2QSG X;  1BR1 A;  3HBL A;  2VKH A;  1MZB A;  4HF0 A;  2IPQ X;  3SZG A;  4E7K A;  2PJR A;  4CHU A;  2DDB A;  4YG2 F;  5LRR A;  3KFW X;  2JVH A;  1D0Y A;  3M3Y J;  3ZQL A;  2LYC A;  1MBJ A;  2K9N A;  4ZYH A;  1IV8 A;  1DU0 A;  4JBA A;  1MMA A;  2CW7 A;  1GVJ A;  4HF2 A;  4ASN A;  1DPR A;  2HXI A;  1RUO A;  3K4J A;  3LFK A;  2FUG 2;  1TC3 C;  4FCY A;  1FBQ A;  1UB9 A;  3QYF A;  3KPH A;  1XPX A;  2MH2 A;  1OR7 A;  3HM5 A;  1ZRD A;  3T0Y A;  1UJ8 A;  3D5L A;  2IS2 A;  1P92 A;  1K6Y A;  2COB A;  1OLT A;  2CV0 A;  3J81 Z;  4UUV A;  1FEX A;  3ECH A;  3IKT A;  1Y0N A;  4LMY A;  2KHM A;  3SDG A;  2O0Y A;  2Z16 A;  3BC8 A;  1ZRE A;  1D0X A;  3I9V 2;  4E7L A;  3QU3 A;  2NXN B;  1ONV A;  2ZNY A;  3BRO A;  4WK8 F;  2IA1 A;  1BN5 A;  2EFO A;  2EZL A;  4XKW A;  1G3W A;  1DP3 A;  1T39 A;  5IY5 H;  2PJP A;  3OYK A;  2V1X A;  1I6X A;  4HX7 A;  3S2W A;  3DV8 A;  2LOO A;  1R5G A;  2ICW G;  2QBY A;  4KIB A;  2NOG A;  5D6F A;  1SMT A;  2XRO A;  4PSX A;  1SD4 A;  5L3C A;  4CGZ A;  3GXO A;  3CCR I;  2EFP A;  2LTP A;  1EJ9 A;  3BPV A;  3OL4 A;  3FXR A;  4AYB A;  1RKT A;  3SZP A;  2Q0O A;  3FKI J;  3LNQ A;  2HQN A;  2R93 J;  5IOY A;  5LHI A;  3IAS 2;  4UVC A;  2M7B A;  3N4M A;  5JLX A;  3I59 B;  4M6Y A;  3I58 A;  3GME A;  3G3Z A;  3I56 I;  4BDY A;  2QEX I;  4N4N B;  5H2F C;  1OIS A;  3AL0 B;  2FF4 A;  2DK5 A;  1ZG5 A;  2GQQ A;  1ULY A;  4A6D A;  2HNH A;  4MO7 A;  2LR8 A;  2X6O A;  3CP8 A;  2R7W A;  1HDP A;  2HDC A;  2FML A;  2NRA C;  1MDM B;  2KKO A;  4MEX F;  1MNE A;  2CUF A;  3HTU A;  1JJ6 C;  1I6H J;  2WAQ N;  1X1D A;  5E3M A;  3PSF A;  1J7K A;  2XPW A;  3Q0W A;  3RCO A;  4KIS A;  3K4B A;  2XGX A;  3CUQ A;  3TW6 A;  4NQW B;  1JKP C;  3GTK J;  3GF2 A;  1E3O C;  3A1Y A;  4NHJ A;  5GPA A;  3VDX A;  4BU2 A;  2A3S A;  4B8X A;  3O6B B;  2M5W A;  2EFQ A;  1DGW Y;  3I54 A;  4QPQ A;  1T8I A;  5AIQ A;  4GGG A;  2QSF X;  1S7E A;  2W48 A;  2DBB A;  4G6Q A;  4HQE A;  2M8G X;  1LQ1 A;  1KYZ A;  4RA2 A;  5GAE J;  4EJO A;  2FEZ A;  1XMX A;  4OOI A;  3WTW C;  3KZZ A;  4X6A J;  3ZQG A;  3ULQ B;  2DYR H;  5C3E J;  2CFO A;  1REP C;  2KL4 A;  1RES A;  2RVC A;  1UFM A;  1AA7 A;  2VUM J;  5GAD J;  1ORK A;  4CCM A;  1R71 A;  3F8B A;  4CSW A;  3F8N A;  4WWC A;  4II2 A;  2LF7 A;  4Y3O A;  3MCZ A;  1B72 B;  4AIJ A;  1XGO A;  4A0X A;  5LFA A;  3S3O A;  2VBX A;  5D8L B;  4BAC A;  4JOM A;  2L3D A;  3W6K B;  1NK3 P;  2JRM A;  2L7K A;  2F2E A;  4FAS D;  1TT5 B;  1QPI A;  4DZP A;  2P5V A;  3DU5 A;  2OPT A;  2L7Z A;  1FX7 A;  4IEJ A;  2GXA A;  1R6R A;  2KJB A;  1L0O C;  1WCM J;  2PLY A;  3IHU A;  5CLS A;  5CVV A;  1U5T C;  2KIS A;  2GXB A;  2I5U A;  2BV6 A;  3GW2 A;  3OMY A;  4IHT A;  3JAM Z;  1S5L C;  3E97 A;  3KCC A;  2X1D A;  2ZFU A;  2X4H A;  4B44 A;  1ZGW A;  5KAF C;  4MQ9 F;  4XLF A;  3S1N J;  4CYC B;  4MHG A;  2QKL B;  1HKQ A;  2IS4 A;  2MGQ A;  1QU3 A;  4AVZ A;  5GAG J;  4RB3 C;  1WSU A;  5JHF A;  1LVA A;  3OR1 C;  2R7Z J;  4GO1 A;  2JA5 J;  3O8H A;  1RIO H;  4GYI A;  1YX5 A;  3MKW B;  1D0Z A;  2P4W A;  4IOA F;  2DT5 A;  4C2M J;  1W4M A;  1VQK I;  3G73 A;  4QIW N;  2IW5 A;  3SHF A;  1R58 A;  3BR3 A;  3CDH A;  2X0L A;  1TBX A;  1KU7 A;  2QKM B;  3NQO A;  1UHS A;  2CMP A;  2E7W A;  4IHV A;  4BUP A;  5FLV A;  2VPL A;  1ERD A;  1FOW A;  2PEX A;  4EV0 A;  4F52 A;  2JN6 A;  3IP4 B;  4HNV A;  2XSD C;  4LIV A;  1QO0 D;  4F91 B;  4HAM A;  2XGD A;  1TL8 A;  3FM3 A;  5HOO A;  2XAG A;  3ZMS A;  3I3L A;  1Z6R A;  1F5T A;  3RKW A;  1IDZ A;  5GPC A;  4ZZD A;  2K3P A;  4NDL A;  1IAW A;  3L7W A;  3RI4 A;  5IYC J;  4HYE A;  5GP9 A;  3T8R A;  3KET A;  2DLL A;  2F6C A;  3QOP A;  1NG6 A;  4P96 A;  2UV1 A;  1R9T J;  2KPM A;  2M34 A;  2W57 A;  2HXO A;  1D5Y A;  4MFE A;  4N9I A;  1DQU A;  2LC2 A;  3I59 A;  4AYB N;  2AHQ A;  2DMT A;  3V7C A;  5BMZ A;  1MBG A;  3QPS A;  4A6E A;  2WAD A;  5L3G A;  1DUX C;  4ITV A;  4ZTJ A;  3NWS A;  3H5R A;  3TO9 A;  3K4L A;  1OFC X;  2AXL A;  3GLL A;  2HYG D;  3ZQF A;  4BKX A;  2NVX J;  1R00 A;  3RZD J;  1UCR A;  1MDM A;  4D5C A;  2PN6 A;  3QOE A;  3ABL H;  3JRF A;  4XKB A;  4XLC A;  1YJW I;  4GCV A;  2AQF A;  2FNA A;  4U0V A;  4OIQ F;  3E5X A;  4XL9 A;  1H9T A;  1OQY A;  3KP3 A;  1AHD P;  1ETW A;  1WRJ A;  2RRE A;  5F04 A;  2KDZ A;  3VYS B;  4NQW A;  2WV1 A;  2ELJ A;  1MMN A;  1YW7 A;  3EPZ A;  4HOB A;  3OYF A;  2R7Q A;  1RUN A;  4J00 A;  2YU9 J;  2CFX A;  2K3F A;  2NVT J;  2DOA A;  1I1G A;  3BZ6 A;  4M72 A;  4LOC A;  3HL2 A;  1QHH D;  5AIP A;  2LLK A;  2DA1 A;  1X2M A;  3AKZ A;  2NNN A;  2KIQ A;  1V55 H;  4MTD A;  1G3Y A;  3OYB A;  2ELK A;  2ZO4 A;  3R0J A;  4X0G A;  3BTC A;  4JX5 A;  5LGN A;  3N97 A;  4XMY A;  4RB1 A;  2PI0 A;  2KRF A;  2H94 A;  4FE4 A;  1HA8 A;  2QQB A;  3DKW A;  3KLO A;  3QAH A;  3LSH A;  3G6E I;  2LY9 A;  2WY8 Q;  3PO2 J;  4XKV A;  1W0U A;  4I2O A;  1I3A A;  1OYI A;  1OJL A;  2X9D A;  2V9P A;  3E0J B;  1H8A C;  3P9I A;  2R7F A;  4ZYD A;  4ETS A;  5A2Q Z;  2Y2Z A;  5IT9 K;  2ZKZ A;  1ZRF A;  4NUB A;  1MMD A;  1I39 A;  1A5J A;  2BEO A;  2ZFW A;  4AIK A;  4U7D A;  2D1H A;  3E6B A;  3NRV A;  3PUB A;  3TOA A;  3CMM A;  3GBG A;  5H6R A;  2OAZ A; 
#chains in the Genus database with same CATH homology
 3GTG J;  1ZTR A;  3A02 A;  2R5Z B;  5FLM J;  2H1K A;  3CDL A;  4M3E A;  3NAR A;  4DW6 A;  2FQ4 A;  4S0H B;  1X2N A;  4L5E A;  4EEF G;  5IP6 A;  4M6V A;  5FKO A;  1IRZ A;  4CYC A;  1Y1W J;  5JLW A;  1MH4 A;  4BBS J;  2L0K A;  3IH3 A;  3SJM A;  1GV5 A;  1UMQ A;  2E1O A;  3DCF A;  1VI0 A;  1F43 A;  2EZK A;  3JRA A;  2YUS A;  2CUE A;  2ECC A;  1APL C;  3OSG A;  2O9L A;  1MBE A;  1X58 A;  4XRS A;  1SFO J;  5C4X J;  3JRG A;  1U9O A;  1W0T A;  3TW7 A;  1IDY A;  2HQ5 A;  3BR1 A;  2DMN A;  4A3B J;  2DMP A;  2EH3 A;  3FK6 A;  2NVQ J;  1LFB A;  4GFB A;  5M5Y J;  1YRN B;  3HDD A;  2XB5 A;  3GTJ J;  1OCP A;  4IHW A;  3ZOB A;  2GBY A;  3A01 A;  1MSF C;  2JK3 A;  2XGC A;  9ANT A;  4M3B A;  1WI3 A;  4BBR J;  1ETX A;  1RET A;  2EQR A;  1P7I A;  3F0C A;  1WH7 A;  3BQY A;  1H88 C;  1YRN A;  1U78 A;  5IP7 J;  3S14 J;  2X48 A;  2WB1 N;  3D1N I;  3TED A;  2DMU A;  1WPK A;  5EDN A;  2IBD A;  2JJ7 A;  2JWT A;  1FTT A;  1U9N A;  1ETV A;  1IGN A;  1XS9 A;  2D5V A;  3QPL A;  3JRE A;  1RKW A;  3S2D J;  3Q0V A;  2TCT A;  1JKQ C;  4B1R A;  1POG A;  3C2B A;  2ME6 A;  5FKL A;  5F08 A;  5HOD A;  1JJ8 C;  2DA7 A;  4MFD A;  2JA8 J;  2M2E A;  2M9H A;  4A3E J;  3LOC A;  3RZO J;  1B8I A;  3I4N J;  2QCO A;  3BTI A;  3WHB A;  3PO3 J;  2LD5 A;  1BL0 A;  2CQX A;  3HBL A;  4MLO A;  3LSJ A;  1BW5 A;  1DU6 A;  1FIP A;  3HOU J;  3UKG A;  4I76 A;  5F0H A;  2P81 A;  3M3Y J;  1I50 J;  3ZQL A;  2L7M P;  1MBJ A;  2K9N A;  1DU0 A;  3HGY A;  5DTD A;  4Y52 J;  3JR9 A;  4A93 J;  3DEW A;  3CCY A;  2JA6 J;  2HXI A;  1HF0 A;  5F1J A;  2K40 A;  1T56 A;  1TC3 C;  4FIS A;  4FCY A;  1ETQ A;  3HM5 A;  1TWG J;  3VPR A;  1GUU A;  2K9Q A;  3HOV J;  2H8R A;  1K61 A;  3BQZ A;  1TWH J;  2COB A;  4DZJ A;  2DA2 A;  1FEX A;  1HLV A;  2OF7 A;  5K7H A;  3BTJ A;  3W6V A;  3SDG A;  3SFI A;  3G1M A;  2DJN A;  1F36 A;  1FTZ A;  3ZQH A;  4Y7N J;  1EF4 A;  5EF6 A;  2DN0 A;  4A3I J;  2EZL A;  3GTP J;  3BR6 A;  3BR5 A;  1I3Q J;  1MBH A;  1WH5 A;  1O4X A;  4X1E A;  1OCT C;  2YS9 A;  3OSF A;  3WHC A;  4D7M A;  3JRD A;  2R5Z A;  2NOG A;  2L9R A;  1ZK8 A;  3ZQC A;  4BXX J;  1HCR A;  4IHY A;  3BR2 A;  3TP0 A;  2LTP A;  2CQQ A;  2LKX A;  2XGE A;  1RKT A;  4I6Z A;  1K83 J;  2RAE A;  3FKI J;  3LNQ A;  3IH2 A;  2R93 J;  1TWF J;  5M3M J;  5IOY A;  5JLX A;  3BG5 A;  3HOZ J;  3S2H J;  4XK4 A;  1VND A;  2N8G A;  3RQI A;  1MSE C;  3S1R J;  1JUP A;  3O8G A;  2E2J J;  5EG0 B;  1HOM A;  3LSG A;  2IAI A;  4MO7 A;  2LR8 A;  2X6O A;  2Y31 A;  1HDP A;  1G2H A;  2KT0 A;  2CUF A;  1JJ6 C;  2PMZ N;  3S16 J;  1I6H J;  3G1L A;  2WAQ N;  1SAN A;  1ENH A;  5E3M A;  3LSR A;  1JGG A;  2AO9 A;  2XPW A;  1AU7 A;  4C3H J;  3Q0U A;  3Q0W A;  5IOZ A;  3TW6 A;  1Q1V A;  3HOW J;  1JKP C;  3GTK J;  2G0E A;  1U8B A;  1XC5 A;  1E3O C;  3RKQ A;  2DA3 A;  5GPA A;  2GM4 A;  4A3D J;  2JMW A;  4MIM A;  1BJZ A;  4JYK A;  2MG4 A;  2I10 A;  3BTL A;  2MSY A;  5BNG A;  1H89 C;  1S7E A;  3IH4 A;  2W48 A;  5F0C A;  2M8G X;  5DS9 A;  2E2H J;  3H3V K;  2CRG A;  3MKL A;  2NS8 A;  1Z77 A;  3I4M J;  3GTL J;  1ZR2 A;  1HDD C;  5EGO B;  4X6A J;  3ZQG A;  1BA5 A;  5E3N A;  5C3E J;  4IHX A;  2EZH A;  2DA4 A;  5J1Y A;  2FJ1 A;  1RES A;  4V2F A;  5FJ8 J;  4BY7 J;  2VUM J;  3HEF A;  1ORK A;  3LSP A;  1ZQ3 P;  2EBI A;  4BY1 J;  1TWA J;  1B72 B;  3FK7 A;  1WGX A;  2XRL A;  2ZB9 A;  1XG1 A;  1IUF A;  2FD5 A;  4RBO A;  3IV5 A;  2DTZ A;  4A3F J;  1NK3 P;  4UUT A;  1QVU A;  1QPI A;  2O7O A;  3BT9 A;  4DZP A;  5C44 J;  3MN2 A;  5M3F J;  1AKH B;  2OPT A;  2L7Z A;  2VKV A;  1PUF B;  2XB0 X;  4IEJ A;  4C3J J;  3GTO J;  2Y9Y A;  1WCM J;  1FJL A;  3OIO A;  2EZI A;  4UUS B;  5J1R A;  3GTQ J;  2L7F P;  2NVY J;  1ETK A;  1B72 A;  1QRY A;  2XPU A;  3JRB A;  4A3M J;  2E19 A;  4M3F A;  4JX4 A;  1P7J A;  5FKM A;  1RPW A;  3HOX J;  3G1O A;  3BG9 A;  3JRC A;  4J19 A;  3BG3 A;  4D7N A;  1ZGW A;  4M3G A;  5FKK A;  5E3L A;  1JUS A;  1IG7 A;  3S1N J;  1ETO A;  4CYC B;  5C4J J;  1LE8 B;  3BR0 A;  2MGQ A;  3CQZ J;  4UUS A;  4A69 C;  4XRM A;  4B4C A;  2LP0 A;  3JRH A;  2HDD A;  2R7Z J;  2JA5 J;  3O8H A;  3H0G J;  2Y9Z A;  4ABZ A;  1JT0 A;  3Q3S A;  3TP3 A;  1Z0X A;  3FIW A;  2LFB A;  3NAU A;  4W1U A;  2JA7 J;  3JRI A;  1MBK A;  1Y1V J;  5F27 A;  5J1U A;  3MVP A;  4RDU A;  4C2M J;  2K9S A;  3S15 J;  3B6C A;  4QIW N;  4XIC A;  3BR3 A;  1CQT A;  2LK2 A;  1LE8 A;  1JTX A;  5M5W J;  1UHS A;  4IHV A;  5FLV A;  2DA5 A;  1JUM A;  2ID6 A;  1BW6 A;  2MW8 A;  4HNV A;  2JN6 A;  2XSD C;  3QQA A;  5IYD J;  2Y30 A;  1A6I A;  2IEK A;  2XGD A;  2CJJ A;  4A3K J;  3A01 B;  1IDZ A;  1NK2 P;  4A3C J;  2HI3 A;  5GPC A;  4NDL A;  2FX0 A;  2R5Y B;  3S1Q J;  5IYC J;  5GP9 A;  2HOT A;  2DMQ A;  2CU7 A;  4FE7 A;  2ME0 A;  3L1P A;  1VFC A;  1R9T J;  2M34 A;  2HXO A;  1D5Y A;  4MFE A;  2R92 J;  5IP9 J;  5K7F A;  1ZKG A;  1IC8 A;  4AYB N;  4A3G J;  5IYB J;  5EYR A;  1ITY A;  2AHQ A;  2DMT A;  1MBG A;  3QPS A;  3S17 J;  3CMY A;  1GT0 C;  2R5Y A;  1IJW C;  1NTC A;  3A03 A;  5EG0 A;  3GTM J;  5F0F A;  3B6A A;  2HOS A;  2DA6 A;  2ID3 A;  1JKR C;  1OFC X;  4A3L J;  3ZQF A;  4BKX A;  1QVT A;  2NVX J;  1GDT A;  3RZD J;  4D5C A;  3HGG A;  3JRF A;  1RR7 A;  1FIA A;  1ZR4 A;  2TRT A;  3PM1 A;  1ETY A;  1B8I B;  2M0C A;  1JT6 A;  4V2G A;  4JP0 A;  3ZQI A;  1AHD P;  1ETW A;  5F04 A;  2KDZ A;  4XRS G;  2WV1 A;  3E7L A;  3HOY J;  2Y0S N;  5K7Z A;  1TWC J;  1MNM C;  2XPV A;  1VF9 A;  2VKE A;  2QF7 A;  4QSH A;  1LFU P;  1IV6 A;  2VI6 A;  3HB9 A;  2YU9 J;  4A3J J;  2R0Q C;  2VPR A;  2NVT J;  1MBF A;  2HYJ A;  1JKO C;  4FTH A;  4LOC A;  2LLK A;  5EZG A;  4DYC A;  4AUX A;  3S1M J;  2DA1 A;  1X2M A;  2LVS A;  5EZH A;  1JTY A;  2NS7 A;  1UG2 A;  2ELK A;  2HOA A;  4DYR A;  5EGO A;  1GVD A;  3FIS A;  3BTC A;  4JX5 A;  2B63 J;  2ECB A;  4W97 A;  3HKZ N;  4FE4 A;  2GLO A;  5J3L A;  2LY9 A;  3PO2 J;  1W0U A;  4B3A A;  2E2I J;  1OJL A;  4JX6 A;  2O8K A;  2X9D A;  1H8A C;  3OOU A;  2Y2Z A;  5FKN A;  5M5X J;  3K2A A;  5EEA A;  4C3I J;  1AKH A;  5E3O A;  1A5J A;  1GV2 A;  3M4O J;  1PUF A;  5IPA A;  4XID A;  4QTR A;  4G12 A;  4AC0 A;  1T33 A;  4D5F A;  1MH3 A;  3K7A J;  4M3D A;  4DYQ A;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...