1TC3C

Transposase tc3a1-65 from caenorhabditis elegans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*GP*GP*GP*GP*GP*TP*CP*CP*TP*AP*TP*AP*GP*A
publication title Crystal structure of the specific DNA-binding domain of Tc3 transposase of C.elegans in complex with transposon DNA.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein/dna
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11427 HTH_Tnp_Tc3_1 Tc3 transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1tc3C00
1RETA 2D5VA 1P7IA 1QVTA 2K40A 2HQ5A 4IHYA 5E3LA 2AO9A 3O8GA 1TWGJ 1K83J 4M3DA 5IYBJ 5BNGA 4D5CA 1FJLA 4EEFG 2DMUA 3BTJA 5J1RA 3JREA 3BR0A 4D5FA 1RPWA 1IDYA 4XICA 4C3IJ 5FLMJ 3BG9A 1MH3A 5FKKA 1A6IA 1GV2A 4J19A 1U9NA 2X9DA 4IHXA 2ECCA 4V2FA 5F27A 2H8RA 1P7JA 5EG0A 2E1OA 2EQRA 1JJ6C 2IBDA 2Y31A 2JA8J 1K61A 2DA4A 3A03A 1O4XA 1LFUP 3G1OA 3BQYA 4A3DJ 1FIAA 1HF0A 2M34A 1FIPA 4D7MA 3H3VK 3CMYA 3ZQGA 2Y9YA 4FE7A 5IP7J 3ZQIA 4FCYA 2VUMJ 1JJ8C 3JRDA 3CDLA 1FTTA 3S1MJ 1LE8A 3IV5A 1FTZA 4BY7J 1TC3C 1R9TJ 2L9RA 4MFEA 5IP9J 3Q3SA 1D5YA 4IHWA 4RDUA 1OCTC 4A3MJ 1TWHJ 1QPIA 3S14J 2Y0SN 2ME6A 1I3QJ 2LKXA 2HDDA 1ORKA 2DMTA 2NVQJ 2FJ1A 4S0HB 5EEAA 1BW6A 3WHBA 2FX0A 1I6HJ 5F0HA 5EGOB 2VI6A 1IG7A 3JRFA 3S2DJ 2NS8A 2VKEA 4QTRA 1PUFB 3O8HA 2DA6A 3S15J 2EZLA 2XRLA 1MSEC 2M8GX 2WB1N 4M3GA 1ETXA 5DS9A 1Y1WJ 5J1YA 1IRZA 5M5XJ 5JLXA 1POGA 2CQXA 2ECBA 5FKOA 1ETVA 3Q0VA 2XGDA 1F43A 2LP0A 1WGXA 2N8GA 5IYCJ 2LD5A 1MH4A 2JA7J 3GTPJ 5GPAA 1IJWC 2DA2A 1VI0A 3QPLA 3TP3A 4B4CA 3M3YJ 4A3FJ 2XGCA 1OFCX 1DU6A 2R0QC 2HXOA 3SDGA 1WH7A 2JK3A 3TW6A 1F36A 2FD5A 1JUSA 3GTGJ 3HOXJ 4FTHA 3K2AA 2DA3A 3SFIA 1TWAJ 3LNQA 5F1JA 2XB0X 4DYCA 2PMZN 3HEFA 3M4OJ 4B3AA 1VFCA 1GT0C 3S2HJ 4XRMA 2DJNA 2JA5J 3DEWA 1XG1A 4I6ZA 4L5EA 2O7OA 3ZQFA 1IC8A 4A3BJ 1ITYA 1WH5A 4AUXA 3B6AA 2VPRA 3G1MA 5K7FA 1RKTA 3JRGA 4JX6A 1HDDC 4JX5A 3MVPA 3LSPA 1U9OA 1GV5A 4FE4A 3BR2A 3LSGA 3BTIA 2LR8A 3GTOJ 3OSGA 3S1RJ 2CRGA 1E3OC 2JN6A 4MFDA 2M0CA 4FISA 4QSHA 3IH2A 2X6OA 1JTXA 1H8AC 1S7EA 2YUSA 3C2BA 2NOGA 1AU7A 4DZJA 2HOSA 1HCRA 1YRNA 1G2HA 1RR7A 5C4JJ 3RQIA 5E3OA 4X1EA 3QPSA 1XC5A 3Q0UA 5EG0B 2IAIA 5FJ8J 3LSJA 1JT6A 4MO7A 3BR6A 2JJ7A 2GLOA 2LLKA 5FLVA 5F0CA 5J3LA 1MBJA 5FKNA 2NVXJ 2EZHA 2QCOA 4DYQA 1UG2A 3HOUJ 2H1KA 2Y2ZA 4ABZA 1X2MA 3S1QJ 3JRCA 3OSFA 5IYDJ 5FKLA 4DZPA 4A69C 1VF9A 2TRTA 3LSRA 1FEXA 1UHSA 2E19A 1B72A 2ME0A 2HOAA 1W0UA 4BXXJ 1JGGA 1MBEA 5C4XJ 1BJZA 1ETYA 1NK2P 4X6AJ 3BR3A 2WAQN 1GUUA 1IV6A 5EF6A 3K7AJ 1ETOA 3FK7A 3FIWA 1ENHA 4V2GA 1ZGWA 2COBA 1GVDA 1A5JA 2XSDC 3HOWJ 3HB9A 2K9QA 3FK6A 1RESA 1ZK8A 2P81A 3PO3J 2ID3A 4A3LJ 3LOCA 3UKGA 5IPAA 3MN2A 2JA6J 5M3MJ 2DA5A 3QQAA 4DYRA 3GTKJ 2LY9A 2MSYA 4I76A 4IHVA 3HOYJ 4A3IJ 1MSFC 4AC0A 1WI3A 1HOMA 2CJJA 4M6VA 1QVUA 2EZIA 5IP6A 1GDTA 1NK3P 1JKPC 1QRYA 1T56A 2DMQA 5EDNA 5E3MA 3H0GJ 4BBRJ 1LFBA 2E2HJ 4AYBN 1OJLA 1JKOC 1JUPA 3JRHA 1IUFA 2R5ZA 4A3CJ 1UMQA 1ZR2A 2MGQA 2IEKA 3S1NJ 4A3KJ 2NS7A 2L0KA 4IEJA 2NVYJ 2R5YA 3VPRA 2DA7A 4C3HJ 1RKWA 2DN0A 4JX4A 3L1PA 1WPKA 2LFBA 4XRSG 4A3GJ 4UUTA 2DMNA 3IH4A 3HKZN 2EH3A 4W97A 4UUSA 3CQZJ 1ETWA 2GM4A 3RKQA 3BG3A 1MNMC 2M2EA 4Y7NJ 3PO2J 3TP0A 4BY1J 1U8BA 1SANA 2YU9J 1HDPA 1X58A 3BT9A 2DTZA 2I10A 1B8IA 2HOTA 3HOZJ 3GBGA 4B1RA 5M5YJ 1ZQ3P 3RZDJ 4MLOA 1AHDP 3BQZA 3HM5A 3SJMA 1AKHA 1TWCJ 4JYKA 4Y52J 1APLC 5M3FJ 3ZQHA 5M5WJ 2LVSA 3FKIJ 1WCMJ 3PM1A 1TWFJ 2G0EA 2Y30A 1JT0A 4CYCA 3W6VA 1X2NA 3ZQCA 2OPTA 5F08A 4BBSJ 3A01A 1YRNB 2R93J 2LTPA 3I4NJ 1H88C 3WHCA 3BR5A 2XPVA 1T33A 3HBLA 3NAUA 4MIMA 2XPWA 9ANTA 2ID6A 5DTDA 4XK4A 4GFBA 1Z77A 4BKXA 2MW8A 3BR1A 2K9NA 5K7ZA 5F0FA 2EZKA 3HDDA 2DMPA 4DW6A 3D1NI 4G12A 3MKLA 1JTYA 2LK2A 1EF4A 3BTCA 1VNDA 1LE8B 1B72B 2HXIA 5HODA 1BL0A 2E2JJ 3HOVJ 2B63J 1MBHA 2L7MP 3GTMJ 3ZOBA 2O8KA 2HYJA 2XB5A 5IOZA 4JP0A 2ELKA 1ZKGA 4QIWN 2M9HA 2CUFA 2JWTA 1JUMA 4NDLA 2O9LA 3JRIA 1MBKA 4C3JJ 2XGEA 5IOYA 4M3BA 2CUEA 4RBOA 4M3EA 1JKRC 4C2MJ 2EBIA 3E7LA 3JR9A 5E3NA 1HLVA 3B6CA 1MBFA 1MBGA 5EZGA 1CQTA 3GTJJ 1DU0A 3IH3A 2XPUA 2GBYA 5EGOA 1OCPA 1Y1VJ 3CCYA 3OIOA 1PUFA 3TEDA 4A93J 3S16J 5F04A 5C44J 4XIDA 1BW5A 2KDZA 5K7HA 1ETKA 1SFOJ 2VKVA 2HI3A 4W1UA 2R5ZB 1ZR4A 5J1UA 3Q0WA 2OF7A 3GTLJ 1Q1VA 2R5YB 1XS9A 3BTLA 2K9SA 2CU7A 2QF7A 2FQ4A 1BA5A 2X48A 2ZB9A 2NVTJ 1JKQC 3OOUA 4A3JJ 2L7FP 4UUSB 2RAEA 3GTQJ 1ZTRA 4D7NA 3ZQLA 5C3EJ 1U78A 3RZOJ 3HGGA 2L7ZA 2TCTA 3JRBA 3BG5A 2R92J 2CQQA 3I4MJ 1B8IB 1NTCA 3HGYA 1IGNA 2Y9ZA 3F0CA 1IDZA 2KT0A 3FISA 2WV1A 2AHQA 3DCFA 5EZHA 1H89C 5GPCA 1Z0XA 2W48A 1AKHB 4XRSA 3JRAA 5EYRA 4M3FA 1ETQA 2YS9A 5JLWA 3NARA 2JMWA 3A02A 3G1LA 4LOCA 4CYCB 4A3EJ 1W0TA 2DA1A 2R7ZJ 5FKMA 5GP9A 3TW7A 4HNVA 2E2IJ 3S17J 3A01B 2MG4A 1I50J
chains in the Genus database with same CATH superfamily
3V8LA 1KU9A 3ZPLA 4IHYA 2F5CA 3FXQA 3KETA 1TWGJ 3LAJA 1K83J 4M3DA 5J4YA 4BACA 3QODA 4D5CA 1FJLA 2VODA 1FPQA 2HPIA 4YEJA 5J1RA 3FXOA 3BR0A 4KN4X 2P7VB 1ZGJA 4B48A 4GYGA 4EV0A 4KFCA 2BGCA 2BOLA 5FKKA 4J19A 2XAFA 1R4NB 5KHDA 1YW8A 1O7FA 1HKQA 2ECCA 2FNAA 1BI2A 1LVKA 3I56I 5EG0A 2FMYA 4HOBA 2JTVA 4UVAA 2OC6A 2IA1A 2Z16A 1LFUP 3G1OA 3BQYA 1HA8A 1GLNA 2DT6A 2DFFA 4I02A 1HF0A 3H3VK 4M74A 1YITI 4IPAA 5AONA 2NNNA 4HSTA 3ML6A 4R1HA 5JHUA 4AIKA 1BR4A 2E1MB 2ESNA 2KIMA 3ASOH 2PMHA 3IV5A 3F8FA 1FTZA 2FA5A 4G8XA 3Q3SA 1FX7A 4YIFA 2DI3A 3I9V2 1HBXG 4AM3A 2WAEA 3WTVC 2DU9A 2XRNA 3WTWC 2DMTA 4HEA2 1XDSA 1UHMA 1CF7B 1FBQA 1BW6A 3ABTA 3ZMVA 3ELKA 3WGIA 1I6HJ 3VFZA 1S72I 1HKSA 1ZG3A 2RV8A 3E6DA 3DEEA 1YQAA 1HSTA 1IG7A 2OCEA 2VKEA 2DOFA 1UFMA 2DA6A 1K4SA 3V8KA 2WB1N 2P5LC 5DS9A 5J1YA 1STZA 2FXAA 2DT7B 1Q1HA 5JLXA 3B73A 4Q48A 1W5TA 3K4BA 5A2QZ 4RA2A 5L3BA 1MMDA 1KU7A 2HNHA 2LP0A 2FNPA 1WGXA 2NAZA 3FDYA 5IYCJ 4UY8I 1VQMI 2JA7J 2Z5UA 3RTRA 1IJWC 3M3YJ 4P96A 2M30A 5D8KB 3G3ZA 4B3XA 2JVGA 2L3DA 3SDGA 1F36A 2HVRA 3J81Z 1R1VA 3GTGJ 4U88A 1ERDA 3SFIA 1TWAJ 1T98A 3CCLI 4GO1A 5J8FA 1D1BA 1YW9A 4KA4A 3HEFA 3M4OJ 1QZZA 2DJNA 1LJ9A 3K4JA 5ICCA 3AG1H 2K4JA 1GXPA 4CUGA 3KFWX 4IOAF 4OMZA 2FSWA 2CV0A 3RKWA 2M7AA 2IS4A 2R7OA 2WWYA 3PUFA 1U9OA 3H3ZA 1ZLKA 1E2XA 3VYUB 2R7RA 2E1CA 5TISC 2LR8A 4AWXB 1FYKA 4AVPA 1E3OC 5IT9Z 2ZXJA 2JN6A 2XHKA 4DIQA 3G6EI 3FM3A 3UR3C 3CMAI 4MFDA 2M0CA 4FISA 4QSHA 2VONA 2QQBA 2OAZA 3IH2A 3SYTA 4ENNA 4GCVA 1WJEA 5KNLA 2R7WA 1U2WA 1JE8A 4JOMA 1MJAA 1S7EA 5E17F 5D4SA 3M9AA 2VN2A 3HYIA 3HOTA 3FM5A 4DZJA 2DDAA 4HDUA 1EH7A 2HFHA 2PQ8A 1NH3A 1BIAA 1KYZA 2CMPA 2HQAA 3RQIA 4LMYA 1ZG5A 1IZ1A 1R6RA 1Y6IA 2LY2A 3QPSA 1XC5A 5EG0B 5FJ8J 2DBBA 5JI6A 2VJ4A 4PGHA 3HZJA 3HRSA 2JJ7A 5DV5A 5L3FA 2VKHA 3PFIA 2HZDA 1SMYF 3ZMDA 5FLVA 3RQ4A 3GW2A 5CVVA 3IHUA 2VLAA 2EZHA 1X1PA 4HF0A 4DYQA 4CGZA 2H1KA 3ZR8X 1X2MA 2EPFA 2M7BA 5FKLA 4KNYA 1FEXA 1FMVA 4LG0A 4KMUX 5E18F 2R7FA 1W0UA 1FYLA 4F92B 2UUZA 1ZH5A 1ETYA 3J7YJ 3RPQA 5LBQA 1W7PA 1B9NA 2E35A 4BE2A 2IRFG 3MKYB 4EM0B 5DYMA 3E6CC 5D5WB 4QWQA 4V2GA 3S93A 2M4KA 3A0HC 5F1RA 2EFQA 4DOZA 2LF7A 3CMMA 2V1NA 2QWWA 2P6TA 2DQLA 2ID3A 5LRRA 5CYVA 2A68F 3HSEA 1TZLA 5IPAA 2JSCA 4UXNA 3MN2A 5A2QK 2CG4A 2JA6J 5D6FA 2JRMA 3GFLA 4KIBA 2QQ9A 2DA5A 5B1BH 4XLEA 2MSYA 3BDDA 3HOYJ 4XLFA 2O8XA 1LB2A 1WI3A 1HOMA 2IS2A 4L9JA 1UG0A 3BZ6A 5ICFA 5IP6A 1I39A 4CZZA 2X6YA 1J0RA 2VXDA 4UB8C 4DGWB 3KLNA 3KP7A 1IUYA 2E1MC 1R4MB 3OYGA 1M1EB 4A0ZA 2QUFA 3OYAA 5GADJ 1MDMA 4BBRJ 1Z05A 4LB6B 2VBZA 4IRHA 1BJAA 3DLLF 3I64A 1LFBA 1G59A 4BHCA 2IA0A 5EEHA 1JUPA 2A07F 2O6GE 4ZC3A 5B3SH 1IUFA 1UMQA 2QYOA 2MGQA 3JTGA 3AFHA 1MKMA 1SD4A 2XC7A 4EJTA 2L0KA 4IEJA 2QKLB 3BZKA 3VPRA 4P5OA 3F8NA 4JX4A 2LFBA 3HTSB 2HZTA 3BCAA 3ECHA 5KAIC 3PUBA 1W5SA 2BXYA 1LQ1A 1QZEA 4EM2A 4L5IA 5D5UB 2ETHA 2LKPA 2BHZA 3CP8A 4G7OF 3IH4A 4IQJA 4XMYA 2GM4A 2VQCA 3CQZJ 4Z2YA 2L54A 2CW7A 2JVHA 3RKQA 3BOQA 3KP3A 2XAJA 4EM1A 2M2EA 3GZNB 5AIQA 4HV6A 1UB9A 1QU3A 1XN7A 3QYEA 3FBIB 3OIQA 3IWZA 2K86A 3O3KA 1B8IA 2Y0SA 2HOTA 3GBGA 4NB5A 4B1RA 3LQQA 5M5YJ 4E7ZA 4MLOA 4XR6A 5CPRB 4A12A 2VBXA 4E7KA 4L0YB 3HM5A 4I0BA 4QPQA 1TWCJ 4JYKA 4WF2A 2ZSIB 4XBFA 4HX7A 1APLC 2W85A 2NS0A 1WI9A 5M5WJ 1WCMJ 2G0EA 1JT0A 4CYCA 4DNCA 2DDBA 3CCMI 4BBSJ 2ZMEA 2KL4A 3KE2A 3QOPA 4OOIA 3KEYA 1J2XA 1PYVA 3TOBA 4M73A 4CH7A 2VL8A 4HAMA 3BR5A 3MZHA 3PIPF 4UHTA 4MEYF 2XPWA 1TTYA 2G7UA 1X3UA 1Z77A 2MW8A 3ERMA 2E5NA 4V19K 3GFJA 4BYYA 1GHCA 1FZPB 1V55H 3OYFA 2B9SA 4N0BA 3JAMZ 1VNDA 3BG6A 2UWMA 1S5LC 1FOYA 2D1HA 4XLPF 4LG0B 4I99C 2IVMA 3GTMJ 1MBHA 3RPUA 4NC7A 1BOBA 1WJ5A 5FRMA 1W7PB 4WWCA 4CCKA 3CC2I 3C2GA 2P8TA 4MNUA 3K1PA 4BJTA 2EK5A 3SXYA 2CUFA 4B47A 1ULYA 4GXOA 2H6CA 1Z7UA 2O9LA 3WTTC 4C3JJ 2Z2SB 2KLOA 4XRFA 4A5NA 2L4AA 3W6KB 2VBWA 3H9JA 4WXDA 4PZJA 3FXJA 3AL0B 1JKRC 3ZXSA 2EBIA 3PNTA 3K70C 3DTIA 1YJ9I 5E3NA 1HLVA 1IN7A 3QU6A 3T0YA 1OYIA 5EZGA 3ASNH 2M3AA 1Z3XA 3MEXA 3GTJJ 4XOTA 3BP8A 2GBYA 5EGOA 1D1AA 1OCPA 3F6VA 3WTSC 1TW3A 2VC1A 2VB6A 2OTLI 3TEDA 1TW2A 1MDMB 2RDPA 1S6LA 3R60A 2EINH 4XL9A 3KZYA 1USSA 1RC9A 1YTYA 2NYXA 2CV1A 1ETKA 2I8DA 3WTUC 1SFOJ 4UNOA 1MJ9A 4W1UA 3KEQA 4OIOF 2UXXA 2M5WA 2W4SA 5J1UA 1ZR4A 1VTNC 3Q0WA 4F52A 1MNEA 3CMEI 5L3GA 1Q1VA 2BE5F 1FSEA 3BTLA 2X6WA 1BI1A 2FQ4A 1BA5A 2X48A 2XF5A 4GYIA 3J7AY 4E7HA 1YG2A 2LY1A 4ASNA 2MA3A 1JKQC 3UNGC 2O3FA 2EV0A 3VOEA 5LFAA 4E70A 1FLIA 1I3AA 1WHUA 2L7ZA 1A04A 2ZJ2A 3CF2A 3F22A 2CQQA 5CQEA 3I4MJ 1B8IB 1P92A 2D2WA 4PDKA 1IDZA 5FLXZ 3ABUA 3M7GA 4XLNF 1QZYA 2P4WA 1H89C 1Z0XA 2W48A 4H4KC 3QYFA 3JRAA 4BNCA 1PDNC 1WJFA 1ETQA 2YS9A 3FKJA 2JMWA 3A02A 3G1LA 4L9TA 3CCRI 5CVIA 1KQ0A 4CYCB 1T8IA 2DA1A 2CGPA 2R7ZJ 2F4OB 5GP9A 4HNVA 3L7WA 1ODDA 2ZMEB 3U9GA 2QVOA 1FSHA 3ZMSA 4KYWA 3LAPA 3CO7C 1O3QA 1P7IA 4MTDA 1EH8A 5E8IA 4E6KG 4MTEA 3O8GA 1SEUA 4NQWA 4PK4A 3QP6A 4CZCA 1JHHA 1YX3A 5E79C 5BNGA 3V4GA 2JRTA 3BTJA 1IXCA 3JAMK 2KIQA 5BPDA 1ZAOA 1KQ9A 4D5FA 2CUJA 2DOAA 4XICA 2CW8A 5FLMJ 1FBUA 2BY2A 3NEUA 4LLNA 5LGUA 1GV2A 1VQ8I 1U9NA 4IHXA 4O6JA 4M72A 5F27A 4BQNA 2ACJA 2OTJI 3T8RA 1WFXA 1JJ6C 2BY3A 2IBDA 2Y31A 3U21A 4HX4A 4F7ZA 1K61A 2RQPA 1HW5A 2GOXB 4A3DJ 4UV8A 1FIAA 1KQ8A 1LPQA 3DKXA 4UVBA 3M1CA 4XSXF 3CMYA 1SC7A 4FE7A 5IP7J 3G71I 3ZQIA 1FT9A 2VQGA 1YI2I 2IP2A 4RM2A 2V6CA 3CDLA 4FT8A 3S1MJ 4BJ6C 3Q9SA 1LE8A 4OIRF 1R9TJ 3LSTA 3WU0A 1D5YA 4RDUA 1OCTC 4BXFA 3S14J 4ESBA 2LKXA 3I58A 2HDDA 2NVQJ 1SD7A 2LH9A 3WHBA 5EGOB 2VJJA 3HPGA 4ENKA 4QTRA 4PFPA 4G6DA 3FHZA 2M8GX 2H09A 2PLYA 1B59A 1YS7A 1Y1WJ 1XGNA 1DGRM 2NXNB 4KMFA 1P4WA 2G7HA 3F8MA 2CQXA 2ECBA 4CCNA 1ETVA 3DTEA 2VOPA 2X1EA 1F43A 3JCUC 2Y48A 4FASD 2N8GA 2VIXA 3GTPJ 1Z9CA 1OQYA 2E71A 2E7WA 3OR2C 3Q5FA 1LVAA 5IY5H 4ZJZA 3AL0C 3G73A 2OJED 2DYRH 1SVMA 3PJRA 3KX2A 5LEJA 3KZIC 1DU6A 2HYGD 5ILSA 1R22A 2E1NA 1IF1A 4Y33A 1JUSA 1LFPA 3K2AA 1YFHA 2GXGA 5F1JA 4IL6C 5D5VB 2K02A 1IW7F 3HRUA 1VFCA 2WBMA 5FFZA 1BBYA 4I6ZA 3J7AO 4OWRB 5K5OA 3HSFA 2L4MA 4YFXF 4HQMA 1ITYA 1ON1A 3OMYA 4XN0A 3PFYA 5K7FA 1RKTA 1W4MA 3JRGA 4JX6A 1HDDC 1R58A 2KKOA 3HG9A 3LQRA 2Q2EA 2AXLA 1W36D 1H0MA 1J5YA 3U2RA 2DPDA 1R23A 1Z6RA 1FY7A 1T39A 2P5KA 1XCBA 3BR2A 2VT2A 3RJPA 4BEHA 3JTHA 2M4GA 3OSGA 4RAGA 1C0WA 3NRVA 4U87A 1VQLI 5HDKA 2CW0F 2W84A 2ZO4A 3TDUC 3DU6A 4OIQF 4IOCF 4E4HA 4N4NB 4NQWB 2MABA 3AG3H 3I55I 3PQJA 3L2CA 1XTAA 2CFXA 2YUSA 3ABLH 3BJAA 3C2BA 2WB1A 2IGMA 2NOGA 4HW0A 2Z33A 2QA4I 2HOSA 1TLHB 4QPOA 2FBHA 1XSVA 4F91B 2HWVA 5C4JJ 5KVRA 2CYYA 2XF6A 2ELHA 2JPCA 2IAIA 4BS9A 3SHFA 3K1NA 1JT6A 3KP6A 4MO7A 2GLOA 1K6YA 5CKTA 1F4KA 2W25A 1Y0UA 3VSLA 2NVXJ 1KYWA 3WTXC 2Q1ZB 2Y2ZA 2ZMEC 3HHHA 4ABZA 3OSFA 3S1QJ 3K4LA 4XORA 2GA1A 1VF9A 2TRTA 4G94A 1OKRA 1SAXA 3LSRA 3LSMA 1UHSA 5J6XA 2AQEA 1S7OA 4XNFA 1BC7C 2ZXHA 3S3OA 2HOAA 3HC7A 2VJ5A 3VYTB 1JGGA 3N97A 2HVQA 4OAYA 5C4XJ 4S05A 2DJIA 3GEZA 1IXRC 1WJBA 2WAQN 4BXUA 1WJAA 2ZKZA 2DFIA 3FK7A 3SZPA 1ENHA 4CCJA 1ZGWA 1P9QC 4P55A 1BI0A 5AIPA 2JZYA 1GVDA 3DF8A 1LDDA 3C18A 2W00A 1Y8RB 2K9QA 3HB9A 1RESA 3QU3A 4WCGA 1OMIA 1ZK8A 2X85A 6PAXA 1ACIA 1FMWA 2KIFA 3DKYA 3OYHA 3DQVC 1FBSA 1Y39A 1XMKA 1UAAA 1XGSA 3MZYA 4DYRA 2LOOA 2DAOA 2XUBA 1J9IA 1MSFC 3HSRA 2E5ZA 4KISA 4HBLA 5K1YA 2V4JC 2EZIA 4KJZA 3OS1A 1B6AA 1TQPA 4A0YA 1FOWA 1RZ4A 3R61A 2EFWA 1T56A 4XKVA 1I27A 3W2AA 2H6BA 5HLHA 3REOA 3GYHX 2DO7A 4RM3A 2OUMA 5E3MA 3TO9A 3LFUA 3M1EA 2XAHA 4AYBN 1W1WE 5LD2C 2XGXA 2MC3A 4C2UA 4KICA 2R7XA 1PVEA 4LJZF 3HHGA 4IQ4A 1OYYA 2IEKA 3I71A 4A3KJ 3MMYB 1U5TA 4IXAA 4PJJA 2R5YA 3KP4A 2DA7A 1V5GA 4KT6A 4C2TA 3L1PA 2GIVA 4XRSG 4YFKF 2LF8A 3KYDB 4A3GJ 2LSOA 4UUTA 4B09A 1IAWA 1XD7A 3EUHA 4W97A 4UUSA 1Z6TA 1UHWA 1ETWA 2EFNA 3EYYA 3HRTA 4KUMA 1QHHD 3L2QA 1XGMA 4MEXF 2IS1A 2R7SA 3BG3A 3CJTB 2VQHA 5J40A 2Q2EB 4BY1J 1SANA 1X58A 5LEKA 4ZYDA 2R3SA 2I10A 3E3VA 3HOZJ 5E8GA 5JVTA 2DTRA 4RAFA 4M9SA 4BEHB 3SDBA 5HLGA 1DQUA 2RGVA 2BZTA 3WE3A 1HW2A 4YIIA 2YX7A 4Y52J 3CCEI 3KEOA 1IN4A 2P6SA 4OAZA 5D4RA 1K6OA 2LVSA 3FKIJ 1LUJB 5B66C 3J80K 3ECOA 3PM1A 4X0GA 1TWFJ 2Y30A 3U1KA 1X2NA 1LEBA 3ZQ7A 1MJBA 1OCOH 4ETSA 4I0AA 1H88C 3CUOA 2XPVA 2HKOA 1E17A 3H36A 3HBLA 3NAUA 1X1DA 2STTA 9ANTA 2A6TA 2ID6A 5DTDA 2DFEA 4GDFA 3BPXA 1N75A 2VPLA 1JI8A 4ZH4F 1VQNI 3WTYC 1SD6A 2ZXWH 5F0FA 5K7ZA 3K4NA 2B0LA 4F93B 5CLSA 2DMPA 4OINF 1REPC 3D1NI 3W2VA 2OU2A 4AVZA 1MMSA 3MKLA 2LK2A 3E5QA 3OYJA 2BVLA 2V7FA 3LSHA 2E2JJ 3K9TA 2L7MP 1VQPI 3OV8A 4PFOA 3OYCA 2HYJA 1XMAA 4U0YA 3DU5A 1T6SA 4ZTFA 2XIGA 1R5ID 5H2FC 5GAEJ 4RGUA 2MD0A 1R71A 1ZKGA 4HNUA 2V26A 3H3UA 4ZDOA 2DW4A 2M0MA 3RIRA 4EGZA 2R7TA 4XLCA 3JRIA 5IOYA 2O61A 2CUZA 3JSPA 3K4CA 3CCVI 4XLAA 1ZRFA 1YW7A 2HS5A 3E7LA 3H5AA 3JR9A 2V9KA 3S3NA 4LLLA 4IHTA 4NNJA 1GVJA 3BJOA 3BJ6A 3TMOA 1N25A 3K69A 4Y3OA 3F23A 5DD8A 4YFNF 4HF2A 2FBKA 4A93J 3SFZA 2R7VA 5F04A 1LNWA 4ZDLA 3W3CA 5DEQA 1BW5A 3ZMUA 3OYBA 1Y0NA 4ZZLA 4XLHA 2DT5A 4IRGA 4AU7A 2PN6A 3HTUA 5FFXA 1HC8A 3GTLJ 1U5TB 3L2WA 4Y17A 2R5YB 2Z99A 1XS9A 5B1AH 2RQQA 1J7KA 1X1AA 1SFUA 3VYRB 2CU7A 2XF7A 3GX4X 2MC4A 1XGOA 2R7DA 1IN6A 2KZGA 4NC6A 5DCFA 4L18B 2KIUA 2DYSH 4A3JJ 4CHUA 3IAS2 4UUSB 3FXRA 3P9IA 2RAEA 2HYFA 2ADUA 4NC8A 3GTQJ 2F6CA 5TJJA 3HGGA 1QNTA 2TCTA 4CICA 2QZ8A 3JRBA 1WRJA 2R92J 1Z91A 2CWEA 3HGYA 1IGNA 1DDNA 2PMUA 2C6YA 2ELJA 3RI4A 3H92A 3DWLE 3FISA 2F48A 3VSKA 2AHQA 2F4MB 5EZHA 3NWTA 3DEUA 3WE2A 4XRSA 3BWGA 2HOEA 4M3FA 3FBNB 5H6RA 1BI3A 5JLWA 4HQEA 1Y8QB 3GF2A 3DPLC 1MMNA 4LOCA 2A5YB 1D8KA 2F5EA 4BQOA 1W0TA 1LKXA 3CUQA 1MZBA 1A36A 5FKMA 3W6JB 1ZYRF 2QSFX 3S17J 2CS3A 3CP2A 3ZQQA 2MG4A 3N4MA 1YS6A 3G4SI 1RETA 5E1ZB 1D0YA 1KU3A 3CJQB 4KIFA 2K40A 2HQ5A 4BDYA 1G3WA 1WSUA 5ICEA 1QHGA 1ON2A 4EEFG 2PJRA 4XQFA 2V1UA 3DTKA 3JREA 2CFOA 1KA8A 5DDGA 2E7XA 1RPWA 1IDYA 2BXZA 1HSJA 3D5RC 3F6OA 4C3IJ 4DBRA 1L3LA 1Z7LA 3BG9A 5D6EA 5LGTA 4G6TB 1MH3A 1A6IA 1U0JA 2X9DA 1SFXA 2H8RA 4PCQA 3X2QH 1P7JA 3V7SA 2E1OA 2JA8J 3OYLA 2GZWA 1Z1DA 4HSRA 3A03A 1A35A 1DP3A 4JK1X 1HKTA 3EYIA 1O4XA 4WXHA 2D1VA 4WXCA 4HZFA 1VQ9I 2E60A 1FIPA 2M34A 2Y9YA 3HKZA 3QPTA 1EKEA 5HS9A 2EFPA 2B7EA 3DXJF 3ZP5A 2VUMJ 2KP6A 1JJ8C 4AD9A 5BMZA 1AWCA 3GMEA 1FTTA 3F3XA 4ZYEA 3OR1C 4XM3A 4Y13A 1VQ4I 1IRGA 3H35A 2CQNA 4BY7J 4BUPA 4XOPA 2L9RA 3FZVA 4DQ2A 3ESWB 3K2ZA 4A3MJ 2KJBA 2Y0SN 2KPMA 2ME6A 1I3QJ 5HLIA 3IL2A 3E97A 2P7CB 1WZ2A 3AAFA 3QRFF 3CF5F 5CVRA 3CC7I 1ORKA 3VDXA 3FHNA 1QA6A 2QBYA 3BC8A 4S0HB 5EEAA 1RNLA 3O2PE 5F0HA 2VI6A 1TT5B 3JRFA 1D1CA 4HPQA 3EQLF 3O8HA 3OOPA 2EZLA 2XRLA 1MSEC 4PJLA 1ETXA 1S8NA 4CO8A 1TL8A 4YELA 1MW7A 5M5XJ 2QENA 4BE0A 3KYCB 1POGA 2PFBA 3RCOA 4AIDA 2M8EA 1XDUA 1V4RA 2XGDA 2P0WA 4Y4RA 3RDIA 2L01A 5FO5A 3ERED 2DA2A 2IJLA 3OY9A 4A3FJ 2LRDA 1BM9A 2A6EF 4EJUA 5K5RA 1OFCX 1O7LA 3DBLB 4K2EA 2HXOA 1WH7A 4I2OA 2IA2A 3KCCA 3TW6A 3OYDA 3I5UA 2H94A 3VYSB 1FNNA 2F5DA 3OL4A 3K4MA 3LMMA 4BJ5C 2EILH 2XB0X 3HOSA 2PMZN 1U6GA 5H6QA 2MFZA 2W57A 1EJ9A 2LNBA 4B3AA 1GT0C 3CD6I 3DEWA 3TKYA 3OWTA 4L5EA 2O7OA 2Q8KA 1G4DA 3ZQFA 4A3BJ 1WH5A 5LHHA 1T0FA 4AUXA 2K27A 3WG9A 3G1MA 3ZMZA 1B9MA 4RAYA 2Q0OA 4JX5A 3MVPA 4FX0A 3C7JA 3GFMA 1U5TC 3QAHA 1PP7U 3F9KA 2ZBKA 1GV5A 3HJEA 3FMRA 3LSGA 2XAUA 3CUQB 3BTIA 3MD2A 1K78A 4OIPF 4NHJA 3S1RJ 2CRGA 4KN7X 3LA3A 2OBPA 5GTIC 1P2FA 3IAM2 3EUHC 3CTAA 3C3WA 1X4OA 4BAYA 2IPQX 4YIRX 2PJRB 2DFHA 1YLFA 5LLQA 1A6QA 3H9GA 4CSWA 3PSFA 4G7ZF 5IT3A 3TDZC 2PEXA 5D8LB 1RR7A 4F55A 4HX8A 3PNVA 3GLLA 5ERIA 4M71A 1DGWY 4GRIA 4KT5C 3BCBA 2DODA 2DK5A 3R0AA 4NUBA 3JSOA 2H1LA 3LSJA 3BR6A 2J5OA 3HUGA 3WTZA 3D5SC 3P9CA 1D0ZA 3GUDA 1MBJA 5FKNA 4A5MA 3HPHA 2BYVE 2QKMB 1UG2A 4II2A 3JRCA 2AXTC 3CJRB 3WU1B 5IYDJ 4DZPA 4OU0A 1TP4A 4BHBA 2KMUA 2CQ7A 1B72A 1UELB 4A0XA 4HYEA 3BZCA 5TRDA 3FWEA 4RB1A 1UZCA 1IV6A 5EF6A 3K7AJ 4I7HA 1ZREA 3FIWA 2COBA 2X4HA 4XKBA 4IKFA 3QPHA 4ZYGA 3KYLA 4BDZA 3EETA 1A5JA 2GA2A 2XSDC 5CJ9A 2QBYB 3HOWJ 2FOWA 3FK6A 3K10A 3PO3J 5LGNA 3MQ0A 2BW3A 2FF4A 4PSXA 3LOCA 3UKGA 2EA2A 3IUOA 4EJOA 4HG2A 3WODF 5M3MJ 2E34A 3QQAA 1SFEA 3GTKJ 1IRXA 4IHVA 4A3IJ 4EMSA 1WWXA 4M6VA 2ZJRF 1GDTA 4PJ0C 2QEXI 1BOAA 3EPZA 1QRYA 2HKXA 3L9FA 5BQTA 2DMQA 3IRRA 5EDNA 2EA4A 3H0GJ 3MZ8A 5E1XA 2EV5A 3W2WA 4AIJA 2X1CA 2HGCA 1JKOC 4RLQA 4UUVA 3JRHA 4LIVA 1YOVB 5KCMA 2R5ZA 4A3CJ 1ZR2A 1WJDA 4LB5A 2NS7A 4P9FA 4B44A 5HOOA 3SEQA 1IV8A 4C3HJ 3CDIA 2K3PA 2JQ7A 2JPBA 4ZYHA 2QSHX 1ZGAA 2OQGA 4RS8A 2VE9A 1D3YA 3VEPA 2LG4A 3EUKL 2ISYA 2KRCA 4XKWA 2W7NA 4ANJA 4HLYA 2EH3A 3EUAA 4DBQA 4IO9F 1VZ0A 1ZN2A 1SFKA 2X1DA 3I59A 4OMYA 1MNMC 2GXBA 4Y7NJ 3PO2J 4N9IA 2HEOA 2YU9J 2WAQA 3BT9A 2DTZA 5FROA 3FXUA 1ZQ3P 3RZDJ 2CH0A 4ITVA 1BIBA 1K78B 4P9UA 2YU3A 2BY0A 3CDHA 3BQZA 3ROUA 2X51A 1F1ZA 1ONVA 2QM3A 3KIOA 4IHSA 3HIFA 5M3FJ 1YX5A 2CSOA 3ZQHA 2VKDA 1B4AA 4AIHA 3CO6C 3C2HA 1K4TA 2HTSA 2BEOA 4A6DA 4ZTJA 3W6VA 2HDWA 3ZGKA 2COMA 5DD4A 5F08A 2K85A 1S3JA 3ZCOA 3M8FA 3B02A 3J80Z 2LTPA 2WA0A 4DJAA 3WHCA 5E1WA 5JR3A 2XV4S 2HR3A 2JUGA 4MIMA 4A2UA 1K7AA 1ZG1A 4XKCA 2HTJA 3SZTA 1U3EM 3BY6A 3U1DA 2GQQA 1O3RA 3HUGB 4XK4A 1GXQA 4GFBA 1X4PA 1N77A 4RB3C 3E0JB 3LFKA 2Y0MA 4Y15A 4AYBA 4E7LA 3CUQC 3BR1A 3L00A 2VBYA 1FYMA 3D0SA 3E5UA 4DW6A 4LITA 3M8JA 1FC3A 3S8PA 3BTCA 1LE8B 1B72B 2HXIA 2MLGA 5HODA 1BL0A 1VQ6I 2B63J 2O8KA 2PI0A 4HLXA 4UVCA 5IOZA 3HRMA 3NQOA 1XCVA 4L9NA 4JP0A 1USTA 2ELKA 4RB0A 2KZVA 2BBYA 3BPVA 2L5QA 2A3SA 2M9HA 5CVJA 1CGPA 1Z21A 4NDLA 4Q47A 1Z67A 2AQFA 2OV7A 5HNHA 2NRAC 2XGEA 4RGRA 5DUIA 4M3BA 2BW3B 3GFIA 2CUEA 4M3EA 3IKVA 2KRHA 4C2MJ 2QSGX 2XAGA 1NHAA 3R4KA 1RRJA 1U8RA 1MBFA 1MBGA 2J5PA 2W82A 4LLGF 3IRQA 5ED4A 1HXDA 2LMDA 1CQTA 1OR7A 5HDNA 1YO5C 3FXKA 3A4CA 3BLYA 2RC4A 3IP4B 3IH3A 2XPUA 5JHFA 3FXMA 2YX4A 1OPCA 3T1BA 2DPUA 1R36A 2RN7A 4RLFA 4U7BA 1EH6A 3CJNA 1OLTA 3DBRB 3T5XA 3FXLA 1KGSA 1PUFA 3V8JA 2WC2A 2XKPA 2EWNA 4G6QA 2P5VA 1JGSA 3LSKA 1QBJA 2NOJB 1FWZA 2KDZA 2L02A 3RKXA 1HQCA 4EGYA 2VKVA 1DPUA 4IF4A 2R5ZB 1QQIA 4U0VA 3K70D 2ZSHB 5LHIA 2FE3A 1L0OC 3O6BB 1T95A 2Y75A 3H5RA 5FD5A 3L09A 2K9SA 2ZC2A 1V54H 1D5VA 2HU9A 2FMLA 3E5XA 5ICGA 2FOKA 1X1CA 2ZB9A 4MQVA 1DP7P 5DCMA 2NVTJ 4JBAA 2A69F 4YG2F 3PSIA 1XSXA 2L7FP 3ABKH 4CYDA 1VQOI 3DLAA 3I59B 3SQNA 3VODA 4D7NA 1YIJI 1F9NA 2UV1A 5CQGA 1KZHA 1QPMA 5C3EJ 3RZOJ 3BG5A 5F6FA 2CV2A 3VWBA 3I4PA 3F0CA 4IZZA 3TO7A 2V1XA 4NBQA 4UB6C 3RYRA 2WV1A 1A31A 4I98B 2W24A 3DCFA 1D0XA 1SVOA 5EYRA 5LHGA 1JHFA 3CESA 4HNTA 5LRSA 2YSRA 2A05A 1YJNI 2YR2A 2F2EA 2EB7A 2QLZA 2UXNA 3HL2A 3TW7A 4LGWA 2E2IJ 4BE1A 1X3WB 1I50J 2M87A 1D8JA 5HS7A 2FRHA 3V42A 2CO5A 2H27A 2D5VA 4D0PA 4PJMA 1QVTA 1ZHFA 1ZLJA 5E3LA 2WADA 5CVUA 1T0FC 2AO9A 4R79A 5IYBJ 2HVSA 1Z3YA 3M07A 1E3HA 2DMUA 3CC4I 2VXZA 3RYPA 2A61A 2AS5F 4ENJA 1G3TA 4PSWA 3ISPA 1RUOA 1MIJA 2KHMA 2RVCA 4Z6YA 3DFGA 5KAFC 3KLOA 4V2FA 4Q4ZF 4S04A 1MGTA 2EQRA 4L5JA 2MD5A 2DA4A 2CQKA 3K4KA 4ZYAA 1G6NA 1H9GA 2XVCA 5B5EC 2OZ6A 2RNGA 3P9KA 4CCLA 4B43A 4D7MA 3CCQI 3ZQGA 1EV7A 3R0JA 4L9VA 1O3SA 1AOYA 4FCYA 2HDCA 2K7LA 3JRDA 5ILUA 3G2BA 2GIZA 3CLOA 3Q9VA 2LC2A 5K5QA 4HV5A 3FX3A 3I53A 1ZRCA 3H9QA 2RREA 2ZJPF 1R49A 1TC3C 4MFEA 3AG2H 3CZ6A 5IP9J 5BPIA 4BGDA 4IHWA 1QPIA 1TWHJ 2JSPA 3QP5A 3FF5A 3FMQA 1P6RA 5TGTA 4N4OB 5FB2A 4P1WA 4BH9A 3KPHA 2H8WA 2FJ1A 2JT1A 2O03A 2QQ8A 4J01A 5E20A 2FX0A 4C30A 2K9MA 3DPUA 3S2DJ 3GXOA 3N05A 2NS8A 1JXSA 2F5FA 5BS6A 1PUFB 1SMTA 3K1MA 1XB4A 3S15J 4D1QA 1HW1A 3OYNA 3ONQA 4M3GA 3SEZA 1IRZA 1B1BA 1IO2A 3PIOF 3ZN1A 1XSDA 5FKOA 3LA2A 3Q0VA 1J59A 2HPMA 3A0BC 2MH9A 2Y69H 4HDVA 1K79A 3MAJA 2LD5A 1MH4A 3OS0A 3MFKA 5GPAA 4TV7A 1VI0A 3QPLA 3TP3A 4B4CA 2OZUA 3J81K 3I3LA 2BY1A 2XGCA 1J09A 3LSIA 2PG4A 2R7QA 4FETA 1W36C 2X6XA 1SAUA 5DCMB 2R0QC 5HS8A 2JK3A 1O57A 3L2VA 2FD5A 2KISA 3D5LA 5FGMA 1KONA 3HOXJ 1W7PD 4EATA 4FTHA 2DA3A 5HDGA 5FD6A 3LNQA 2FU4A 4IVNA 4DYCA 2YPRA 2ZFUA 4YRVA 2KQRA 1OCZH 1IN5A 1W5CC 3S2HJ 4XRMA 3E6BA 2ESHA 4U7DA 3GZ6A 2JA5J 1XG1A 3BROA 3LL7A 1BR2A 4MHGA 3RKYA 1IC8A 1R00A 2G9WA 5L3DA 4ENMA 5DM7F 3TOAA 2E36A 3B6AA 4ON0A 2XAQA 1QO0D 2VPRA 4CDGA 3JW4A 5IT9K 1BR1A 4EJWA 4XONA 1P4XA 3LSPA 2WY7Q 1TBXA 4ESFA 4FE4A 3IWFA 3DV8A 5HNFA 3GTOJ 3J7ZI 1S7AA 2O0YA 4F3QA 1LDKB 2D45A 2LYCA 4BU2A 2NVUB 3WGGA 1PJRA 3F72A 1X19A 2K9LA 4JQFA 3GWZA 1WKMA 3MKZA 1LEAA 2X6OA 1JTXA 2OD5A 2M45A 2IGKA 1H8AC 3PL8A 2STWA 2DCEA 2K4BA 4LIUA 4ZDPA 4HRIA 2IS6A 1AU7A 2ZNYA 2R4GA 1G3YA 1HCRA 1YRNA 1G2HA 1NG6A 1TT0A 2KFDA 3MWMA 3TO6A 5E3OA 3OYEA 1V3FA 3EDPA 2XROA 4X1EA 3Q0UA 2RKHA 2I5UA 3I0TA 4O3MA 2LDUA 2K3FA 2IW5A 5H20A 2LLKA 2ZJQF 4RGSA 5F0CA 5J3LA 1T38A 1QGPA 2A5WA 2QCOA 5L3EA 1R1TA 4J00A 2EJRA 2WTEA 2HQNA 3HOUJ 5KK1A 1YYVA 3KZZA 2Z9OA 1S29A 3CLQA 2K5CA 4A69C 3FMSA 3OL3A 1RI7A 5DUKA 4E7SA 5HLTA 2E19A 4IRIA 2PMZA 3TGNA 2ME0A 4BXXJ 1J75A 1MBEA 1BJZA 5J8CA 1NK2P 4X6AJ 4KIGA 3BR3A 1GUUA 2WV0A 1N78A 5L3CA 1ETOA 2XKOA 1BC8C 5EEGA 2DOEA 1TNTA 3TBIA 4PUSA 4PJNA 1VQKI 2JUCA 3DPTA 3IKTA 4KDPA 1ZRDA 4M9XA 1WQ2A 1DUXC 2P81A 4M6XA 4A3LJ 1TQMA 3K0LA 4HA8A 2EV6A 1OYWA 2V9PA 2LY9A 1TNSA 3L2RA 4I76A 1YHQI 4I09A 1T2KA 1ZARA 4AC0A 2V79A 2CJJA 2FQ3A 1QVUA 1NK3P 5GTHC 4II3A 1JKPC 1R7JA 3I54A 2GWRA 2KRFA 1P4AA 1E3PA 5J47A 4ZZDA 1O3TA 2NNYA 1OCRH 2F5VA 3QOEA 2A6HF 3WG7H 2E2HJ 4FHTA 1E0EA 1OJLA 2PX9A 2XASA 4MQ9F 3S32A 2V9VA 3PNYA 4LK0F 2OCCH 4IJAA 3F8CA 3R6SA 3RPUD 2LREA 3IC7A 2ZCWA 2DLLA 1OR7C 3S1NJ 4H0EA 2FUG2 3BG7A 2NVYJ 2IGOA 3VB2A 2EIMH 4LG3A 1RKWA 2DN0A 2MBFA 1G3SA 3E6MA 1X3ZB 2KDOA 1WPKA 3CCUI 4LFUA 2DXIA 2DMNA 2BHYA 4RB2C 3HKZN 1FOXA 4R8HA 3S2WA 3CCJI 2ZXIA 3E1SA 4O5VA 2OQRA 2ZFWA 3H0DA 3TP0A 3QYBA 2WAFA 3A2KA 1U8BA 2QGUA 1HDPA 1RR8C 2VOOA 1IRFA 1NG7A 1S9HA 4B8XA 4EVIA 1UJ8A 1AHDP 1FP2A 2L9NA 4RGXA 5F64A 1OCCH 1WVRA 3AKZA 3SJMA 4C9YA 1AKHA 3OYMA 5ILVA 4CCOA 2L9SA 4M9ZA 5J4VA 3GLXA 3TQNA 2PBIA 3COAC 3S3MA 2MYSA 4RAZA 1I1GA 1I5ZA 3PQKA 3ZQCA 2OPTA 2LBFA 3P7NA 2WY8Q 1R1UA 3A01A 1YRNB 2VC0A 2R93J 1MMAA 3L2UA 4ESJA 3V7CA 2EIKH 2X0LA 2BVMA 3DBHB 1XPXA 3SZGA 3I4NJ 4EQQA 3WU2C 1T33A 3MKWB 2PJPA 1XMXA 3K6GA 1FOKA 3C1DA 4CA0A 4BL0B 1YE9A 1SVLA 2BV6A 4HF1A 2KJCA 1V5EA 2GXAA 2HQRA 4BKXA 2IGNA 4CXFA 3NWSA 4L0ZB 2JA2A 4LD5A 4MGRA 1I1SA 3DKWA 3OS2A 2K9NA 1X1BA 2EZKA 3KP2A 1XX5A 1FP1D 3HDDA 4G12A 3ZRGA 5FRNA 3OIPA 1JTYA 1EF4A 3F8BA 1MD0A 1F5TA 2Z3YA 3H5NA 3OYIA 2TDXA 3HOVJ 2VE8A 4GGGA 1YJWI 2XSJC 3ZOBA 1SD5A 2XB5A 1OISA 3F21A 5JVGF 4QIWN 1V5FA 4BHPA 2DQRA 4Q5SF 2JWTA 1JUMA 4U0WA 3WGHA 4WK8F 1MBKA 4RMNA 1DPRA 2L9VA 4LK1F 3RSNA 3ZN0A 4BQQA 4CCMA 3AG4H 3ZMTA 2LKSA 2OA4A 1R5HA 5GAGJ 4XN3A 4D9JA 1IXSB 4I01A 4RBOA 2VASA 1VQ7I 1RIOH 2DK8A 2ICWG 4G7HF 4QLCU 5BOXA 3B6CA 2UZKA 5DM6F 1G8XA 4N9HA 4PGGA 1CF7A 3LWFA 1VQ5I 3T8TA 1DU0A 3A1YA 3GVAA 2FBIA 1ZELA 1I6XA 1Y1VJ 2L7KA 3CCYA 3OIOA 4XSZF 1BN5A 2FEZA 5HVQC 3S16J 2RNJA 2EFOA 5C44J 4XIDA 1R5GA 4M6YA 2VQLA 1PUEE 2R7UA 5K7HA 2Z1DA 2VJIA 2EIJH 2ZNZA 2HI3A 3V7RA 3HXLA 2GAUA 3QWLA 4E7IA 2OF7A 4EJVA 5JFRA 3KP5A 5GAHJ 5EJCA 2MH2A 3CCSI 2QF7A 4FQGA 1LDJA 2QQAA 5D5XB 3ABMH 2L2OA 3OOUA 3ULQB 1AA7A 1WJCA 2M1BA 1TQIA 2GOMA 4G9YA 1KU2A 1UCRA 1ZTRA 2VT3A 3LA7A 4A6EA 2IXSA 3ZQLA 1U78A 5FLXK 1YIOA 3DP7A 1RUNA 3GO5A 3GZ5A 1NTCA 3H1CA 2Y9ZA 1PP8F 3GCMA 4KITB 2XDVA 2KT0A 1EA3A 4E7JA 3TL4X 2W1OA 2V1DA 3OYKA 5GPCA 1AKHB 2O5RA 2MLKA 2ISZA 3M8EA 3NARA 4BQAA 4WX9A 3MCZA 1H9TA 2F4IA 4FX4A 1Y56A 4A3EJ 2V6EA 1MNDA 4IX7A 1IN8A 2LBFB 1MMGA 3A01B 3P5JA 4UV9A 1T08B 2IT0A
chains in the Genus database with same CATH topology
1RETA 2D5VA 1P7IA 1QVTA 2K40A 2HQ5A 4IHYA 5E3LA 2AO9A 3O8GA 1TWGJ 1K83J 4M3DA 5IYBJ 5BNGA 4D5CA 1FJLA 4EEFG 2DMUA 3BTJA 5J1RA 3JREA 3BR0A 4D5FA 1RPWA 1IDYA 4XICA 4C3IJ 5FLMJ 3BG9A 1MH3A 5FKKA 1A6IA 1GV2A 4J19A 1U9NA 2X9DA 4IHXA 2ECCA 4V2FA 5F27A 2H8RA 1P7JA 5EG0A 2E1OA 2EQRA 1JJ6C 2IBDA 2Y31A 2JA8J 1K61A 2DA4A 3A03A 1O4XA 1LFUP 3G1OA 3BQYA 4A3DJ 1FIAA 1HF0A 2M34A 1FIPA 4D7MA 3H3VK 3CMYA 3ZQGA 2Y9YA 4FE7A 5IP7J 3ZQIA 4FCYA 2VUMJ 1JJ8C 3JRDA 3CDLA 1FTTA 3S1MJ 1LE8A 3IV5A 1FTZA 4BY7J 1TC3C 1R9TJ 2L9RA 4MFEA 5IP9J 3Q3SA 1D5YA 4IHWA 4RDUA 1OCTC 4A3MJ 1TWHJ 1QPIA 3S14J 2Y0SN 2ME6A 1I3QJ 2LKXA 2HDDA 1ORKA 2DMTA 2NVQJ 2FJ1A 4S0HB 5EEAA 1BW6A 3WHBA 2FX0A 1I6HJ 5F0HA 5EGOB 2VI6A 1IG7A 3JRFA 3S2DJ 2NS8A 2VKEA 4QTRA 1PUFB 3O8HA 2DA6A 3S15J 2EZLA 2XRLA 1MSEC 2M8GX 2WB1N 4M3GA 1ETXA 5DS9A 1Y1WJ 5J1YA 1IRZA 5M5XJ 5JLXA 1POGA 2CQXA 2ECBA 5FKOA 1ETVA 3Q0VA 2XGDA 1F43A 2LP0A 1WGXA 2N8GA 5IYCJ 2LD5A 1MH4A 2JA7J 3GTPJ 5GPAA 1IJWC 2DA2A 1VI0A 3QPLA 3TP3A 4B4CA 3M3YJ 4A3FJ 2XGCA 1OFCX 1DU6A 2R0QC 2HXOA 3SDGA 1WH7A 2JK3A 3TW6A 1F36A 2FD5A 1JUSA 3GTGJ 3HOXJ 4FTHA 3K2AA 2DA3A 3SFIA 1TWAJ 3LNQA 5F1JA 2XB0X 4DYCA 2PMZN 3HEFA 3M4OJ 4B3AA 1VFCA 1GT0C 3S2HJ 4XRMA 2DJNA 2JA5J 3DEWA 1XG1A 4I6ZA 4L5EA 2O7OA 3ZQFA 1IC8A 4A3BJ 1ITYA 1WH5A 4AUXA 3B6AA 2VPRA 3G1MA 5K7FA 1RKTA 3JRGA 4JX6A 1HDDC 4JX5A 3MVPA 3LSPA 1U9OA 1GV5A 4FE4A 3BR2A 3LSGA 3BTIA 2LR8A 3GTOJ 3OSGA 3S1RJ 2CRGA 1E3OC 2JN6A 4MFDA 2M0CA 4FISA 4QSHA 3IH2A 2X6OA 1JTXA 1H8AC 1S7EA 2YUSA 3C2BA 2NOGA 1AU7A 4DZJA 2HOSA 1HCRA 1YRNA 1G2HA 1RR7A 5C4JJ 3RQIA 5E3OA 4X1EA 3QPSA 1XC5A 3Q0UA 5EG0B 2IAIA 5FJ8J 3LSJA 1JT6A 4MO7A 3BR6A 2JJ7A 2GLOA 2LLKA 5FLVA 5F0CA 5J3LA 1MBJA 5FKNA 2NVXJ 2EZHA 2QCOA 4DYQA 1UG2A 3HOUJ 2H1KA 2Y2ZA 4ABZA 1X2MA 3S1QJ 3JRCA 3OSFA 5IYDJ 5FKLA 4DZPA 4A69C 1VF9A 2TRTA 3LSRA 1FEXA 1UHSA 2E19A 1B72A 2ME0A 2HOAA 1W0UA 4BXXJ 1JGGA 1MBEA 5C4XJ 1BJZA 1ETYA 1NK2P 4X6AJ 3BR3A 2WAQN 1GUUA 1IV6A 5EF6A 3K7AJ 1ETOA 3FK7A 3FIWA 1ENHA 4V2GA 1ZGWA 2COBA 1GVDA 1A5JA 2XSDC 3HOWJ 3HB9A 2K9QA 3FK6A 1RESA 1ZK8A 2P81A 3PO3J 2ID3A 4A3LJ 3LOCA 3UKGA 5IPAA 3MN2A 2JA6J 5M3MJ 2DA5A 3QQAA 4DYRA 3GTKJ 2LY9A 2MSYA 4I76A 4IHVA 3HOYJ 4A3IJ 1MSFC 4AC0A 1WI3A 1HOMA 2CJJA 4M6VA 1QVUA 2EZIA 5IP6A 1GDTA 1NK3P 1JKPC 1QRYA 1T56A 2DMQA 5EDNA 5E3MA 3H0GJ 4BBRJ 1LFBA 2E2HJ 4AYBN 1OJLA 1JKOC 1JUPA 3JRHA 1IUFA 2R5ZA 4A3CJ 1UMQA 1ZR2A 2MGQA 2IEKA 3S1NJ 4A3KJ 2NS7A 2L0KA 4IEJA 2NVYJ 2R5YA 3VPRA 2DA7A 4C3HJ 1RKWA 2DN0A 4JX4A 3L1PA 1WPKA 2LFBA 4XRSG 4A3GJ 4UUTA 2DMNA 3IH4A 3HKZN 2EH3A 4W97A 4UUSA 3CQZJ 1ETWA 2GM4A 3RKQA 3BG3A 1MNMC 2M2EA 4Y7NJ 3PO2J 3TP0A 4BY1J 1U8BA 1SANA 2YU9J 1HDPA 1X58A 3BT9A 2DTZA 2I10A 1B8IA 2HOTA 3HOZJ 3GBGA 4B1RA 5M5YJ 1ZQ3P 3RZDJ 4MLOA 1AHDP 3BQZA 3HM5A 3SJMA 1AKHA 1TWCJ 4JYKA 4Y52J 1APLC 5M3FJ 3ZQHA 5M5WJ 2LVSA 3FKIJ 1WCMJ 3PM1A 1TWFJ 2G0EA 2Y30A 1JT0A 4CYCA 3W6VA 1X2NA 3ZQCA 2OPTA 5F08A 4BBSJ 3A01A 1YRNB 2R93J 2LTPA 3I4NJ 1H88C 3WHCA 3BR5A 2XPVA 1T33A 3HBLA 3NAUA 4MIMA 2XPWA 9ANTA 2ID6A 5DTDA 4XK4A 4GFBA 1Z77A 4BKXA 2MW8A 3BR1A 2K9NA 5K7ZA 5F0FA 2EZKA 3HDDA 2DMPA 4DW6A 3D1NI 4G12A 3MKLA 1JTYA 2LK2A 1EF4A 3BTCA 1VNDA 1LE8B 1B72B 2HXIA 5HODA 1BL0A 2E2JJ 3HOVJ 2B63J 1MBHA 2L7MP 3GTMJ 3ZOBA 2O8KA 2HYJA 2XB5A 5IOZA 4JP0A 2ELKA 1ZKGA 4QIWN 2M9HA 2CUFA 2JWTA 1JUMA 4NDLA 2O9LA 3JRIA 1MBKA 4C3JJ 2XGEA 5IOYA 4M3BA 2CUEA 4RBOA 4M3EA 1JKRC 4C2MJ 2EBIA 3E7LA 3JR9A 5E3NA 1HLVA 3B6CA 1MBFA 1MBGA 5EZGA 1CQTA 3GTJJ 1DU0A 3IH3A 2XPUA 2GBYA 5EGOA 1OCPA 1Y1VJ 3CCYA 3OIOA 1PUFA 3TEDA 4A93J 3S16J 5F04A 5C44J 4XIDA 1BW5A 2KDZA 5K7HA 1ETKA 1SFOJ 2VKVA 2HI3A 4W1UA 2R5ZB 1ZR4A 5J1UA 3Q0WA 2OF7A 3GTLJ 1Q1VA 2R5YB 1XS9A 3BTLA 2K9SA 2CU7A 2QF7A 2FQ4A 1BA5A 2X48A 2ZB9A 2NVTJ 1JKQC 3OOUA 4A3JJ 2L7FP 4UUSB 2RAEA 3GTQJ 1ZTRA 4D7NA 3ZQLA 5C3EJ 1U78A 3RZOJ 3HGGA 2L7ZA 2TCTA 3JRBA 3BG5A 2R92J 2CQQA 3I4MJ 1B8IB 1NTCA 3HGYA 1IGNA 2Y9ZA 3F0CA 1IDZA 2KT0A 3FISA 2WV1A 2AHQA 3DCFA 5EZHA 1H89C 5GPCA 1Z0XA 2W48A 1AKHB 4XRSA 3JRAA 5EYRA 4M3FA 1ETQA 2YS9A 5JLWA 3NARA 2JMWA 3A02A 3G1LA 4LOCA 4CYCB 4A3EJ 1W0TA 2DA1A 2R7ZJ 5FKMA 5GP9A 3TW7A 4HNVA 2E2IJ 3S17J 3A01B 2MG4A 1I50J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RET A;  2D5V A;  1P7I A;  1QVT A;  2K40 A;  2HQ5 A;  4IHY A;  5E3L A;  2AO9 A;  3O8G A;  1TWG J;  1K83 J;  4M3D A;  5IYB J;  5BNG A;  4D5C A;  1FJL A;  4EEF G;  2DMU A;  3BTJ A;  5J1R A;  3JRE A;  3BR0 A;  4D5F A;  1RPW A;  1IDY A;  4XIC A;  4C3I J;  5FLM J;  3BG9 A;  1MH3 A;  5FKK A;  1A6I A;  1GV2 A;  4J19 A;  1U9N A;  2X9D A;  4IHX A;  2ECC A;  4V2F A;  5F27 A;  2H8R A;  1P7J A;  5EG0 A;  2E1O A;  2EQR A;  1JJ6 C;  2IBD A;  2Y31 A;  2JA8 J;  1K61 A;  2DA4 A;  3A03 A;  1O4X A;  1LFU P;  3G1O A;  3BQY A;  4A3D J;  1FIA A;  1HF0 A;  2M34 A;  1FIP A;  4D7M A;  3H3V K;  3CMY A;  3ZQG A;  2Y9Y A;  4FE7 A;  5IP7 J;  3ZQI A;  4FCY A;  2VUM J;  1JJ8 C;  3JRD A;  3CDL A;  1FTT A;  3S1M J;  1LE8 A;  3IV5 A;  1FTZ A;  4BY7 J;  1TC3 C;  1R9T J;  2L9R A;  4MFE A;  5IP9 J;  3Q3S A;  1D5Y A;  4IHW A;  4RDU A;  1OCT C;  4A3M J;  1TWH J;  1QPI A;  3S14 J;  2Y0S N;  2ME6 A;  1I3Q J;  2LKX A;  2HDD A;  1ORK A;  2DMT A;  2NVQ J;  2FJ1 A;  4S0H B;  5EEA A;  1BW6 A;  3WHB A;  2FX0 A;  1I6H J;  5F0H A;  5EGO B;  2VI6 A;  1IG7 A;  3JRF A;  3S2D J;  2NS8 A;  2VKE A;  4QTR A;  1PUF B;  3O8H A;  2DA6 A;  3S15 J;  2EZL A;  2XRL A;  1MSE C;  2M8G X;  2WB1 N;  4M3G A;  1ETX A;  5DS9 A;  1Y1W J;  5J1Y A;  1IRZ A;  5M5X J;  5JLX A;  1POG A;  2CQX A;  2ECB A;  5FKO A;  1ETV A;  3Q0V A;  2XGD A;  1F43 A;  2LP0 A;  1WGX A;  2N8G A;  5IYC J;  2LD5 A;  1MH4 A;  2JA7 J;  3GTP J;  5GPA A;  1IJW C;  2DA2 A;  1VI0 A;  3QPL A;  3TP3 A;  4B4C A;  3M3Y J;  4A3F J;  2XGC A;  1OFC X;  1DU6 A;  2R0Q C;  2HXO A;  3SDG A;  1WH7 A;  2JK3 A;  3TW6 A;  1F36 A;  2FD5 A;  1JUS A;  3GTG J;  3HOX J;  4FTH A;  3K2A A;  2DA3 A;  3SFI A;  1TWA J;  3LNQ A;  5F1J A;  2XB0 X;  4DYC A;  2PMZ N;  3HEF A;  3M4O J;  4B3A A;  1VFC A;  1GT0 C;  3S2H J;  4XRM A;  2DJN A;  2JA5 J;  3DEW A;  1XG1 A;  4I6Z A;  4L5E A;  2O7O A;  3ZQF A;  1IC8 A;  4A3B J;  1ITY A;  1WH5 A;  4AUX A;  3B6A A;  2VPR A;  3G1M A;  5K7F A;  1RKT A;  3JRG A;  4JX6 A;  1HDD C;  4JX5 A;  3MVP A;  3LSP A;  1U9O A;  1GV5 A;  4FE4 A;  3BR2 A;  3LSG A;  3BTI A;  2LR8 A;  3GTO J;  3OSG A;  3S1R J;  2CRG A;  1E3O C;  2JN6 A;  4MFD A;  2M0C A;  4FIS A;  4QSH A;  3IH2 A;  2X6O A;  1JTX A;  1H8A C;  1S7E A;  2YUS A;  3C2B A;  2NOG A;  1AU7 A;  4DZJ A;  2HOS A;  1HCR A;  1YRN A;  1G2H A;  1RR7 A;  5C4J J;  3RQI A;  5E3O A;  4X1E A;  3QPS A;  1XC5 A;  3Q0U A;  5EG0 B;  2IAI A;  5FJ8 J;  3LSJ A;  1JT6 A;  4MO7 A;  3BR6 A;  2JJ7 A;  2GLO A;  2LLK A;  5FLV A;  5F0C A;  5J3L A;  1MBJ A;  5FKN A;  2NVX J;  2EZH A;  2QCO A;  4DYQ A;  1UG2 A;  3HOU J;  2H1K A;  2Y2Z A;  4ABZ A;  1X2M A;  3S1Q J;  3JRC A;  3OSF A;  5IYD J;  5FKL A;  4DZP A;  4A69 C;  1VF9 A;  2TRT A;  3LSR A;  1FEX A;  1UHS A;  2E19 A;  1B72 A;  2ME0 A;  2HOA A;  1W0U A;  4BXX J;  1JGG A;  1MBE A;  5C4X J;  1BJZ A;  1ETY A;  1NK2 P;  4X6A J;  3BR3 A;  2WAQ N;  1GUU A;  1IV6 A;  5EF6 A;  3K7A J;  1ETO A;  3FK7 A;  3FIW A;  1ENH A;  4V2G A;  1ZGW A;  2COB A;  1GVD A;  1A5J A;  2XSD C;  3HOW J;  3HB9 A;  2K9Q A;  3FK6 A;  1RES A;  1ZK8 A;  2P81 A;  3PO3 J;  2ID3 A;  4A3L J;  3LOC A;  3UKG A;  5IPA A;  3MN2 A;  2JA6 J;  5M3M J;  2DA5 A;  3QQA A;  4DYR A;  3GTK J;  2LY9 A;  2MSY A;  4I76 A;  4IHV A;  3HOY J;  4A3I J;  1MSF C;  4AC0 A;  1WI3 A;  1HOM A;  2CJJ A;  4M6V A;  1QVU A;  2EZI A;  5IP6 A;  1GDT A;  1NK3 P;  1JKP C;  1QRY A;  1T56 A;  2DMQ A;  5EDN A;  5E3M A;  3H0G J;  4BBR J;  1LFB A;  2E2H J;  4AYB N;  1OJL A;  1JKO C;  1JUP A;  3JRH A;  1IUF A;  2R5Z A;  4A3C J;  1UMQ A;  1ZR2 A;  2MGQ A;  2IEK A;  3S1N J;  4A3K J;  2NS7 A;  2L0K A;  4IEJ A;  2NVY J;  2R5Y A;  3VPR A;  2DA7 A;  4C3H J;  1RKW A;  2DN0 A;  4JX4 A;  3L1P A;  1WPK A;  2LFB A;  4XRS G;  4A3G J;  4UUT A;  2DMN A;  3IH4 A;  3HKZ N;  2EH3 A;  4W97 A;  4UUS A;  3CQZ J;  1ETW A;  2GM4 A;  3RKQ A;  3BG3 A;  1MNM C;  2M2E A;  4Y7N J;  3PO2 J;  3TP0 A;  4BY1 J;  1U8B A;  1SAN A;  2YU9 J;  1HDP A;  1X58 A;  3BT9 A;  2DTZ A;  2I10 A;  1B8I A;  2HOT A;  3HOZ J;  3GBG A;  4B1R A;  5M5Y J;  1ZQ3 P;  3RZD J;  4MLO A;  1AHD P;  3BQZ A;  3HM5 A;  3SJM A;  1AKH A;  1TWC J;  4JYK A;  4Y52 J;  1APL C;  5M3F J;  3ZQH A;  5M5W J;  2LVS A;  3FKI J;  1WCM J;  3PM1 A;  1TWF J;  2G0E A;  2Y30 A;  1JT0 A;  4CYC A;  3W6V A;  1X2N A;  3ZQC A;  2OPT A;  5F08 A;  4BBS J;  3A01 A;  1YRN B;  2R93 J;  2LTP A;  3I4N J;  1H88 C;  3WHC A;  3BR5 A;  2XPV A;  1T33 A;  3HBL A;  3NAU A;  4MIM A;  2XPW A;  9ANT A;  2ID6 A;  5DTD A;  4XK4 A;  4GFB A;  1Z77 A;  4BKX A;  2MW8 A;  3BR1 A;  2K9N A;  5K7Z A;  5F0F A;  2EZK A;  3HDD A;  2DMP A;  4DW6 A;  3D1N I;  4G12 A;  3MKL A;  1JTY A;  2LK2 A;  1EF4 A;  3BTC A;  1VND A;  1LE8 B;  1B72 B;  2HXI A;  5HOD A;  1BL0 A;  2E2J J;  3HOV J;  2B63 J;  1MBH A;  2L7M P;  3GTM J;  3ZOB A;  2O8K A;  2HYJ A;  2XB5 A;  5IOZ A;  4JP0 A;  2ELK A;  1ZKG A;  4QIW N;  2M9H A;  2CUF A;  2JWT A;  1JUM A;  4NDL A;  2O9L A;  3JRI A;  1MBK A;  4C3J J;  2XGE A;  5IOY A;  4M3B A;  2CUE A;  4RBO A;  4M3E A;  1JKR C;  4C2M J;  2EBI A;  3E7L A;  3JR9 A;  5E3N A;  1HLV A;  3B6C A;  1MBF A;  1MBG A;  5EZG A;  1CQT A;  3GTJ J;  1DU0 A;  3IH3 A;  2XPU A;  2GBY A;  5EGO A;  1OCP A;  1Y1V J;  3CCY A;  3OIO A;  1PUF A;  3TED A;  4A93 J;  3S16 J;  5F04 A;  5C44 J;  4XID A;  1BW5 A;  2KDZ A;  5K7H A;  1ETK A;  1SFO J;  2VKV A;  2HI3 A;  4W1U A;  2R5Z B;  1ZR4 A;  5J1U A;  3Q0W A;  2OF7 A;  3GTL J;  1Q1V A;  2R5Y B;  1XS9 A;  3BTL A;  2K9S A;  2CU7 A;  2QF7 A;  2FQ4 A;  1BA5 A;  2X48 A;  2ZB9 A;  2NVT J;  1JKQ C;  3OOU A;  4A3J J;  2L7F P;  4UUS B;  2RAE A;  3GTQ J;  1ZTR A;  4D7N A;  3ZQL A;  5C3E J;  1U78 A;  3RZO J;  3HGG A;  2L7Z A;  2TCT A;  3JRB A;  3BG5 A;  2R92 J;  2CQQ A;  3I4M J;  1B8I B;  1NTC A;  3HGY A;  1IGN A;  2Y9Z A;  3F0C A;  1IDZ A;  2KT0 A;  3FIS A;  2WV1 A;  2AHQ A;  3DCF A;  5EZH A;  1H89 C;  5GPC A;  1Z0X A;  2W48 A;  1AKH B;  4XRS A;  3JRA A;  5EYR A;  4M3F A;  1ETQ A;  2YS9 A;  5JLW A;  3NAR A;  2JMW A;  3A02 A;  3G1L A;  4LOC A;  4CYC B;  4A3E J;  1W0T A;  2DA1 A;  2R7Z J;  5FKM A;  5GP9 A;  3TW7 A;  4HNV A;  2E2I J;  3S17 J;  3A01 B;  2MG4 A;  1I50 J; 
#chains in the Genus database with same CATH topology
 3V8L A;  1KU9 A;  3ZPL A;  4IHY A;  2F5C A;  3FXQ A;  3KET A;  1TWG J;  3LAJ A;  1K83 J;  4M3D A;  5J4Y A;  4BAC A;  3QOD A;  4D5C A;  1FJL A;  2VOD A;  1FPQ A;  2HPI A;  4YEJ A;  5J1R A;  3FXO A;  3BR0 A;  4KN4 X;  2P7V B;  1ZGJ A;  4B48 A;  4GYG A;  4EV0 A;  4KFC A;  2BGC A;  2BOL A;  5FKK A;  4J19 A;  2XAF A;  1R4N B;  5KHD A;  1YW8 A;  1O7F A;  1HKQ A;  2ECC A;  2FNA A;  1BI2 A;  1LVK A;  3I56 I;  5EG0 A;  2FMY A;  4HOB A;  2JTV A;  4UVA A;  2OC6 A;  2IA1 A;  2Z16 A;  1LFU P;  3G1O A;  3BQY A;  1HA8 A;  1GLN A;  2DT6 A;  2DFF A;  4I02 A;  1HF0 A;  3H3V K;  4M74 A;  1YIT I;  4IPA A;  5AON A;  2NNN A;  4HST A;  3ML6 A;  4R1H A;  5JHU A;  4AIK A;  1BR4 A;  2E1M B;  2ESN A;  2KIM A;  3ASO H;  2PMH A;  3IV5 A;  3F8F A;  1FTZ A;  2FA5 A;  4G8X A;  3Q3S A;  1FX7 A;  4YIF A;  2DI3 A;  3I9V 2;  1HBX G;  4AM3 A;  2WAE A;  3WTV C;  2DU9 A;  2XRN A;  3WTW C;  2DMT A;  4HEA 2;  1XDS A;  1UHM A;  1CF7 B;  1FBQ A;  1BW6 A;  3ABT A;  3ZMV A;  3ELK A;  3WGI A;  1I6H J;  3VFZ A;  1S72 I;  1HKS A;  1ZG3 A;  2RV8 A;  3E6D A;  3DEE A;  1YQA A;  1HST A;  1IG7 A;  2OCE A;  2VKE A;  2DOF A;  1UFM A;  2DA6 A;  1K4S A;  3V8K A;  2WB1 N;  2P5L C;  5DS9 A;  5J1Y A;  1STZ A;  2FXA A;  2DT7 B;  1Q1H A;  5JLX A;  3B73 A;  4Q48 A;  1W5T A;  3K4B A;  5A2Q Z;  4RA2 A;  5L3B A;  1MMD A;  1KU7 A;  2HNH A;  2LP0 A;  2FNP A;  1WGX A;  2NAZ A;  3FDY A;  5IYC J;  4UY8 I;  1VQM I;  2JA7 J;  2Z5U A;  3RTR A;  1IJW C;  3M3Y J;  4P96 A;  2M30 A;  5D8K B;  3G3Z A;  4B3X A;  2JVG A;  2L3D A;  3SDG A;  1F36 A;  2HVR A;  3J81 Z;  1R1V A;  3GTG J;  4U88 A;  1ERD A;  3SFI A;  1TWA J;  1T98 A;  3CCL I;  4GO1 A;  5J8F A;  1D1B A;  1YW9 A;  4KA4 A;  3HEF A;  3M4O J;  1QZZ A;  2DJN A;  1LJ9 A;  3K4J A;  5ICC A;  3AG1 H;  2K4J A;  1GXP A;  4CUG A;  3KFW X;  4IOA F;  4OMZ A;  2FSW A;  2CV0 A;  3RKW A;  2M7A A;  2IS4 A;  2R7O A;  2WWY A;  3PUF A;  1U9O A;  3H3Z A;  1ZLK A;  1E2X A;  3VYU B;  2R7R A;  2E1C A;  5TIS C;  2LR8 A;  4AWX B;  1FYK A;  4AVP A;  1E3O C;  5IT9 Z;  2ZXJ A;  2JN6 A;  2XHK A;  4DIQ A;  3G6E I;  3FM3 A;  3UR3 C;  3CMA I;  4MFD A;  2M0C A;  4FIS A;  4QSH A;  2VON A;  2QQB A;  2OAZ A;  3IH2 A;  3SYT A;  4ENN A;  4GCV A;  1WJE A;  5KNL A;  2R7W A;  1U2W A;  1JE8 A;  4JOM A;  1MJA A;  1S7E A;  5E17 F;  5D4S A;  3M9A A;  2VN2 A;  3HYI A;  3HOT A;  3FM5 A;  4DZJ A;  2DDA A;  4HDU A;  1EH7 A;  2HFH A;  2PQ8 A;  1NH3 A;  1BIA A;  1KYZ A;  2CMP A;  2HQA A;  3RQI A;  4LMY A;  1ZG5 A;  1IZ1 A;  1R6R A;  1Y6I A;  2LY2 A;  3QPS A;  1XC5 A;  5EG0 B;  5FJ8 J;  2DBB A;  5JI6 A;  2VJ4 A;  4PGH A;  3HZJ A;  3HRS A;  2JJ7 A;  5DV5 A;  5L3F A;  2VKH A;  3PFI A;  2HZD A;  1SMY F;  3ZMD A;  5FLV A;  3RQ4 A;  3GW2 A;  5CVV A;  3IHU A;  2VLA A;  2EZH A;  1X1P A;  4HF0 A;  4DYQ A;  4CGZ A;  2H1K A;  3ZR8 X;  1X2M A;  2EPF A;  2M7B A;  5FKL A;  4KNY A;  1FEX A;  1FMV A;  4LG0 A;  4KMU X;  5E18 F;  2R7F A;  1W0U A;  1FYL A;  4F92 B;  2UUZ A;  1ZH5 A;  1ETY A;  3J7Y J;  3RPQ A;  5LBQ A;  1W7P A;  1B9N A;  2E35 A;  4BE2 A;  2IRF G;  3MKY B;  4EM0 B;  5DYM A;  3E6C C;  5D5W B;  4QWQ A;  4V2G A;  3S93 A;  2M4K A;  3A0H C;  5F1R A;  2EFQ A;  4DOZ A;  2LF7 A;  3CMM A;  2V1N A;  2QWW A;  2P6T A;  2DQL A;  2ID3 A;  5LRR A;  5CYV A;  2A68 F;  3HSE A;  1TZL A;  5IPA A;  2JSC A;  4UXN A;  3MN2 A;  5A2Q K;  2CG4 A;  2JA6 J;  5D6F A;  2JRM A;  3GFL A;  4KIB A;  2QQ9 A;  2DA5 A;  5B1B H;  4XLE A;  2MSY A;  3BDD A;  3HOY J;  4XLF A;  2O8X A;  1LB2 A;  1WI3 A;  1HOM A;  2IS2 A;  4L9J A;  1UG0 A;  3BZ6 A;  5ICF A;  5IP6 A;  1I39 A;  4CZZ A;  2X6Y A;  1J0R A;  2VXD A;  4UB8 C;  4DGW B;  3KLN A;  3KP7 A;  1IUY A;  2E1M C;  1R4M B;  3OYG A;  1M1E B;  4A0Z A;  2QUF A;  3OYA A;  5GAD J;  1MDM A;  4BBR J;  1Z05 A;  4LB6 B;  2VBZ A;  4IRH A;  1BJA A;  3DLL F;  3I64 A;  1LFB A;  1G59 A;  4BHC A;  2IA0 A;  5EEH A;  1JUP A;  2A07 F;  2O6G E;  4ZC3 A;  5B3S H;  1IUF A;  1UMQ A;  2QYO A;  2MGQ A;  3JTG A;  3AFH A;  1MKM A;  1SD4 A;  2XC7 A;  4EJT A;  2L0K A;  4IEJ A;  2QKL B;  3BZK A;  3VPR A;  4P5O A;  3F8N A;  4JX4 A;  2LFB A;  3HTS B;  2HZT A;  3BCA A;  3ECH A;  5KAI C;  3PUB A;  1W5S A;  2BXY A;  1LQ1 A;  1QZE A;  4EM2 A;  4L5I A;  5D5U B;  2ETH A;  2LKP A;  2BHZ A;  3CP8 A;  4G7O F;  3IH4 A;  4IQJ A;  4XMY A;  2GM4 A;  2VQC A;  3CQZ J;  4Z2Y A;  2L54 A;  2CW7 A;  2JVH A;  3RKQ A;  3BOQ A;  3KP3 A;  2XAJ A;  4EM1 A;  2M2E A;  3GZN B;  5AIQ A;  4HV6 A;  1UB9 A;  1QU3 A;  1XN7 A;  3QYE A;  3FBI B;  3OIQ A;  3IWZ A;  2K86 A;  3O3K A;  1B8I A;  2Y0S A;  2HOT A;  3GBG A;  4NB5 A;  4B1R A;  3LQQ A;  5M5Y J;  4E7Z A;  4MLO A;  4XR6 A;  5CPR B;  4A12 A;  2VBX A;  4E7K A;  4L0Y B;  3HM5 A;  4I0B A;  4QPQ A;  1TWC J;  4JYK A;  4WF2 A;  2ZSI B;  4XBF A;  4HX7 A;  1APL C;  2W85 A;  2NS0 A;  1WI9 A;  5M5W J;  1WCM J;  2G0E A;  1JT0 A;  4CYC A;  4DNC A;  2DDB A;  3CCM I;  4BBS J;  2ZME A;  2KL4 A;  3KE2 A;  3QOP A;  4OOI A;  3KEY A;  1J2X A;  1PYV A;  3TOB A;  4M73 A;  4CH7 A;  2VL8 A;  4HAM A;  3BR5 A;  3MZH A;  3PIP F;  4UHT A;  4MEY F;  2XPW A;  1TTY A;  2G7U A;  1X3U A;  1Z77 A;  2MW8 A;  3ERM A;  2E5N A;  4V19 K;  3GFJ A;  4BYY A;  1GHC A;  1FZP B;  1V55 H;  3OYF A;  2B9S A;  4N0B A;  3JAM Z;  1VND A;  3BG6 A;  2UWM A;  1S5L C;  1FOY A;  2D1H A;  4XLP F;  4LG0 B;  4I99 C;  2IVM A;  3GTM J;  1MBH A;  3RPU A;  4NC7 A;  1BOB A;  1WJ5 A;  5FRM A;  1W7P B;  4WWC A;  4CCK A;  3CC2 I;  3C2G A;  2P8T A;  4MNU A;  3K1P A;  4BJT A;  2EK5 A;  3SXY A;  2CUF A;  4B47 A;  1ULY A;  4GXO A;  2H6C A;  1Z7U A;  2O9L A;  3WTT C;  4C3J J;  2Z2S B;  2KLO A;  4XRF A;  4A5N A;  2L4A A;  3W6K B;  2VBW A;  3H9J A;  4WXD A;  4PZJ A;  3FXJ A;  3AL0 B;  1JKR C;  3ZXS A;  2EBI A;  3PNT A;  3K70 C;  3DTI A;  1YJ9 I;  5E3N A;  1HLV A;  1IN7 A;  3QU6 A;  3T0Y A;  1OYI A;  5EZG A;  3ASN H;  2M3A A;  1Z3X A;  3MEX A;  3GTJ J;  4XOT A;  3BP8 A;  2GBY A;  5EGO A;  1D1A A;  1OCP A;  3F6V A;  3WTS C;  1TW3 A;  2VC1 A;  2VB6 A;  2OTL I;  3TED A;  1TW2 A;  1MDM B;  2RDP A;  1S6L A;  3R60 A;  2EIN H;  4XL9 A;  3KZY A;  1USS A;  1RC9 A;  1YTY A;  2NYX A;  2CV1 A;  1ETK A;  2I8D A;  3WTU C;  1SFO J;  4UNO A;  1MJ9 A;  4W1U A;  3KEQ A;  4OIO F;  2UXX A;  2M5W A;  2W4S A;  5J1U A;  1ZR4 A;  1VTN C;  3Q0W A;  4F52 A;  1MNE A;  3CME I;  5L3G A;  1Q1V A;  2BE5 F;  1FSE A;  3BTL A;  2X6W A;  1BI1 A;  2FQ4 A;  1BA5 A;  2X48 A;  2XF5 A;  4GYI A;  3J7A Y;  4E7H A;  1YG2 A;  2LY1 A;  4ASN A;  2MA3 A;  1JKQ C;  3UNG C;  2O3F A;  2EV0 A;  3VOE A;  5LFA A;  4E70 A;  1FLI A;  1I3A A;  1WHU A;  2L7Z A;  1A04 A;  2ZJ2 A;  3CF2 A;  3F22 A;  2CQQ A;  5CQE A;  3I4M J;  1B8I B;  1P92 A;  2D2W A;  4PDK A;  1IDZ A;  5FLX Z;  3ABU A;  3M7G A;  4XLN F;  1QZY A;  2P4W A;  1H89 C;  1Z0X A;  2W48 A;  4H4K C;  3QYF A;  3JRA A;  4BNC A;  1PDN C;  1WJF A;  1ETQ A;  2YS9 A;  3FKJ A;  2JMW A;  3A02 A;  3G1L A;  4L9T A;  3CCR I;  5CVI A;  1KQ0 A;  4CYC B;  1T8I A;  2DA1 A;  2CGP A;  2R7Z J;  2F4O B;  5GP9 A;  4HNV A;  3L7W A;  1ODD A;  2ZME B;  3U9G A;  2QVO A;  1FSH A;  3ZMS A;  4KYW A;  3LAP A;  3CO7 C;  1O3Q A;  1P7I A;  4MTD A;  1EH8 A;  5E8I A;  4E6K G;  4MTE A;  3O8G A;  1SEU A;  4NQW A;  4PK4 A;  3QP6 A;  4CZC A;  1JHH A;  1YX3 A;  5E79 C;  5BNG A;  3V4G A;  2JRT A;  3BTJ A;  1IXC A;  3JAM K;  2KIQ A;  5BPD A;  1ZAO A;  1KQ9 A;  4D5F A;  2CUJ A;  2DOA A;  4XIC A;  2CW8 A;  5FLM J;  1FBU A;  2BY2 A;  3NEU A;  4LLN A;  5LGU A;  1GV2 A;  1VQ8 I;  1U9N A;  4IHX A;  4O6J A;  4M72 A;  5F27 A;  4BQN A;  2ACJ A;  2OTJ I;  3T8R A;  1WFX A;  1JJ6 C;  2BY3 A;  2IBD A;  2Y31 A;  3U21 A;  4HX4 A;  4F7Z A;  1K61 A;  2RQP A;  1HW5 A;  2GOX B;  4A3D J;  4UV8 A;  1FIA A;  1KQ8 A;  1LPQ A;  3DKX A;  4UVB A;  3M1C A;  4XSX F;  3CMY A;  1SC7 A;  4FE7 A;  5IP7 J;  3G71 I;  3ZQI A;  1FT9 A;  2VQG A;  1YI2 I;  2IP2 A;  4RM2 A;  2V6C A;  3CDL A;  4FT8 A;  3S1M J;  4BJ6 C;  3Q9S A;  1LE8 A;  4OIR F;  1R9T J;  3LST A;  3WU0 A;  1D5Y A;  4RDU A;  1OCT C;  4BXF A;  3S14 J;  4ESB A;  2LKX A;  3I58 A;  2HDD A;  2NVQ J;  1SD7 A;  2LH9 A;  3WHB A;  5EGO B;  2VJJ A;  3HPG A;  4ENK A;  4QTR A;  4PFP A;  4G6D A;  3FHZ A;  2M8G X;  2H09 A;  2PLY A;  1B59 A;  1YS7 A;  1Y1W J;  1XGN A;  1DGR M;  2NXN B;  4KMF A;  1P4W A;  2G7H A;  3F8M A;  2CQX A;  2ECB A;  4CCN A;  1ETV A;  3DTE A;  2VOP A;  2X1E A;  1F43 A;  3JCU C;  2Y48 A;  4FAS D;  2N8G A;  2VIX A;  3GTP J;  1Z9C A;  1OQY A;  2E71 A;  2E7W A;  3OR2 C;  3Q5F A;  1LVA A;  5IY5 H;  4ZJZ A;  3AL0 C;  3G73 A;  2OJE D;  2DYR H;  1SVM A;  3PJR A;  3KX2 A;  5LEJ A;  3KZI C;  1DU6 A;  2HYG D;  5ILS A;  1R22 A;  2E1N A;  1IF1 A;  4Y33 A;  1JUS A;  1LFP A;  3K2A A;  1YFH A;  2GXG A;  5F1J A;  4IL6 C;  5D5V B;  2K02 A;  1IW7 F;  3HRU A;  1VFC A;  2WBM A;  5FFZ A;  1BBY A;  4I6Z A;  3J7A O;  4OWR B;  5K5O A;  3HSF A;  2L4M A;  4YFX F;  4HQM A;  1ITY A;  1ON1 A;  3OMY A;  4XN0 A;  3PFY A;  5K7F A;  1RKT A;  1W4M A;  3JRG A;  4JX6 A;  1HDD C;  1R58 A;  2KKO A;  3HG9 A;  3LQR A;  2Q2E A;  2AXL A;  1W36 D;  1H0M A;  1J5Y A;  3U2R A;  2DPD A;  1R23 A;  1Z6R A;  1FY7 A;  1T39 A;  2P5K A;  1XCB A;  3BR2 A;  2VT2 A;  3RJP A;  4BEH A;  3JTH A;  2M4G A;  3OSG A;  4RAG A;  1C0W A;  3NRV A;  4U87 A;  1VQL I;  5HDK A;  2CW0 F;  2W84 A;  2ZO4 A;  3TDU C;  3DU6 A;  4OIQ F;  4IOC F;  4E4H A;  4N4N B;  4NQW B;  2MAB A;  3AG3 H;  3I55 I;  3PQJ A;  3L2C A;  1XTA A;  2CFX A;  2YUS A;  3ABL H;  3BJA A;  3C2B A;  2WB1 A;  2IGM A;  2NOG A;  4HW0 A;  2Z33 A;  2QA4 I;  2HOS A;  1TLH B;  4QPO A;  2FBH A;  1XSV A;  4F91 B;  2HWV A;  5C4J J;  5KVR A;  2CYY A;  2XF6 A;  2ELH A;  2JPC A;  2IAI A;  4BS9 A;  3SHF A;  3K1N A;  1JT6 A;  3KP6 A;  4MO7 A;  2GLO A;  1K6Y A;  5CKT A;  1F4K A;  2W25 A;  1Y0U A;  3VSL A;  2NVX J;  1KYW A;  3WTX C;  2Q1Z B;  2Y2Z A;  2ZME C;  3HHH A;  4ABZ A;  3OSF A;  3S1Q J;  3K4L A;  4XOR A;  2GA1 A;  1VF9 A;  2TRT A;  4G94 A;  1OKR A;  1SAX A;  3LSR A;  3LSM A;  1UHS A;  5J6X A;  2AQE A;  1S7O A;  4XNF A;  1BC7 C;  2ZXH A;  3S3O A;  2HOA A;  3HC7 A;  2VJ5 A;  3VYT B;  1JGG A;  3N97 A;  2HVQ A;  4OAY A;  5C4X J;  4S05 A;  2DJI A;  3GEZ A;  1IXR C;  1WJB A;  2WAQ N;  4BXU A;  1WJA A;  2ZKZ A;  2DFI A;  3FK7 A;  3SZP A;  1ENH A;  4CCJ A;  1ZGW A;  1P9Q C;  4P55 A;  1BI0 A;  5AIP A;  2JZY A;  1GVD A;  3DF8 A;  1LDD A;  3C18 A;  2W00 A;  1Y8R B;  2K9Q A;  3HB9 A;  1RES A;  3QU3 A;  4WCG A;  1OMI A;  1ZK8 A;  2X85 A;  6PAX A;  1ACI A;  1FMW A;  2KIF A;  3DKY A;  3OYH A;  3DQV C;  1FBS A;  1Y39 A;  1XMK A;  1UAA A;  1XGS A;  3MZY A;  4DYR A;  2LOO A;  2DAO A;  2XUB A;  1J9I A;  1MSF C;  3HSR A;  2E5Z A;  4KIS A;  4HBL A;  5K1Y A;  2V4J C;  2EZI A;  4KJZ A;  3OS1 A;  1B6A A;  1TQP A;  4A0Y A;  1FOW A;  1RZ4 A;  3R61 A;  2EFW A;  1T56 A;  4XKV A;  1I27 A;  3W2A A;  2H6B A;  5HLH A;  3REO A;  3GYH X;  2DO7 A;  4RM3 A;  2OUM A;  5E3M A;  3TO9 A;  3LFU A;  3M1E A;  2XAH A;  4AYB N;  1W1W E;  5LD2 C;  2XGX A;  2MC3 A;  4C2U A;  4KIC A;  2R7X A;  1PVE A;  4LJZ F;  3HHG A;  4IQ4 A;  1OYY A;  2IEK A;  3I71 A;  4A3K J;  3MMY B;  1U5T A;  4IXA A;  4PJJ A;  2R5Y A;  3KP4 A;  2DA7 A;  1V5G A;  4KT6 A;  4C2T A;  3L1P A;  2GIV A;  4XRS G;  4YFK F;  2LF8 A;  3KYD B;  4A3G J;  2LSO A;  4UUT A;  4B09 A;  1IAW A;  1XD7 A;  3EUH A;  4W97 A;  4UUS A;  1Z6T A;  1UHW A;  1ETW A;  2EFN A;  3EYY A;  3HRT A;  4KUM A;  1QHH D;  3L2Q A;  1XGM A;  4MEX F;  2IS1 A;  2R7S A;  3BG3 A;  3CJT B;  2VQH A;  5J40 A;  2Q2E B;  4BY1 J;  1SAN A;  1X58 A;  5LEK A;  4ZYD A;  2R3S A;  2I10 A;  3E3V A;  3HOZ J;  5E8G A;  5JVT A;  2DTR A;  4RAF A;  4M9S A;  4BEH B;  3SDB A;  5HLG A;  1DQU A;  2RGV A;  2BZT A;  3WE3 A;  1HW2 A;  4YII A;  2YX7 A;  4Y52 J;  3CCE I;  3KEO A;  1IN4 A;  2P6S A;  4OAZ A;  5D4R A;  1K6O A;  2LVS A;  3FKI J;  1LUJ B;  5B66 C;  3J80 K;  3ECO A;  3PM1 A;  4X0G A;  1TWF J;  2Y30 A;  3U1K A;  1X2N A;  1LEB A;  3ZQ7 A;  1MJB A;  1OCO H;  4ETS A;  4I0A A;  1H88 C;  3CUO A;  2XPV A;  2HKO A;  1E17 A;  3H36 A;  3HBL A;  3NAU A;  1X1D A;  2STT A;  9ANT A;  2A6T A;  2ID6 A;  5DTD A;  2DFE A;  4GDF A;  3BPX A;  1N75 A;  2VPL A;  1JI8 A;  4ZH4 F;  1VQN I;  3WTY C;  1SD6 A;  2ZXW H;  5F0F A;  5K7Z A;  3K4N A;  2B0L A;  4F93 B;  5CLS A;  2DMP A;  4OIN F;  1REP C;  3D1N I;  3W2V A;  2OU2 A;  4AVZ A;  1MMS A;  3MKL A;  2LK2 A;  3E5Q A;  3OYJ A;  2BVL A;  2V7F A;  3LSH A;  2E2J J;  3K9T A;  2L7M P;  1VQP I;  3OV8 A;  4PFO A;  3OYC A;  2HYJ A;  1XMA A;  4U0Y A;  3DU5 A;  1T6S A;  4ZTF A;  2XIG A;  1R5I D;  5H2F C;  5GAE J;  4RGU A;  2MD0 A;  1R71 A;  1ZKG A;  4HNU A;  2V26 A;  3H3U A;  4ZDO A;  2DW4 A;  2M0M A;  3RIR A;  4EGZ A;  2R7T A;  4XLC A;  3JRI A;  5IOY A;  2O61 A;  2CUZ A;  3JSP A;  3K4C A;  3CCV I;  4XLA A;  1ZRF A;  1YW7 A;  2HS5 A;  3E7L A;  3H5A A;  3JR9 A;  2V9K A;  3S3N A;  4LLL A;  4IHT A;  4NNJ A;  1GVJ A;  3BJO A;  3BJ6 A;  3TMO A;  1N25 A;  3K69 A;  4Y3O A;  3F23 A;  5DD8 A;  4YFN F;  4HF2 A;  2FBK A;  4A93 J;  3SFZ A;  2R7V A;  5F04 A;  1LNW A;  4ZDL A;  3W3C A;  5DEQ A;  1BW5 A;  3ZMU A;  3OYB A;  1Y0N A;  4ZZL A;  4XLH A;  2DT5 A;  4IRG A;  4AU7 A;  2PN6 A;  3HTU A;  5FFX A;  1HC8 A;  3GTL J;  1U5T B;  3L2W A;  4Y17 A;  2R5Y B;  2Z99 A;  1XS9 A;  5B1A H;  2RQQ A;  1J7K A;  1X1A A;  1SFU A;  3VYR B;  2CU7 A;  2XF7 A;  3GX4 X;  2MC4 A;  1XGO A;  2R7D A;  1IN6 A;  2KZG A;  4NC6 A;  5DCF A;  4L18 B;  2KIU A;  2DYS H;  4A3J J;  4CHU A;  3IAS 2;  4UUS B;  3FXR A;  3P9I A;  2RAE A;  2HYF A;  2ADU A;  4NC8 A;  3GTQ J;  2F6C A;  5TJJ A;  3HGG A;  1QNT A;  2TCT A;  4CIC A;  2QZ8 A;  3JRB A;  1WRJ A;  2R92 J;  1Z91 A;  2CWE A;  3HGY A;  1IGN A;  1DDN A;  2PMU A;  2C6Y A;  2ELJ A;  3RI4 A;  3H92 A;  3DWL E;  3FIS A;  2F48 A;  3VSK A;  2AHQ A;  2F4M B;  5EZH A;  3NWT A;  3DEU A;  3WE2 A;  4XRS A;  3BWG A;  2HOE A;  4M3F A;  3FBN B;  5H6R A;  1BI3 A;  5JLW A;  4HQE A;  1Y8Q B;  3GF2 A;  3DPL C;  1MMN A;  4LOC A;  2A5Y B;  1D8K A;  2F5E A;  4BQO A;  1W0T A;  1LKX A;  3CUQ A;  1MZB A;  1A36 A;  5FKM A;  3W6J B;  1ZYR F;  2QSF X;  3S17 J;  2CS3 A;  3CP2 A;  3ZQQ A;  2MG4 A;  3N4M A;  1YS6 A;  3G4S I;  1RET A;  5E1Z B;  1D0Y A;  1KU3 A;  3CJQ B;  4KIF A;  2K40 A;  2HQ5 A;  4BDY A;  1G3W A;  1WSU A;  5ICE A;  1QHG A;  1ON2 A;  4EEF G;  2PJR A;  4XQF A;  2V1U A;  3DTK A;  3JRE A;  2CFO A;  1KA8 A;  5DDG A;  2E7X A;  1RPW A;  1IDY A;  2BXZ A;  1HSJ A;  3D5R C;  3F6O A;  4C3I J;  4DBR A;  1L3L A;  1Z7L A;  3BG9 A;  5D6E A;  5LGT A;  4G6T B;  1MH3 A;  1A6I A;  1U0J A;  2X9D A;  1SFX A;  2H8R A;  4PCQ A;  3X2Q H;  1P7J A;  3V7S A;  2E1O A;  2JA8 J;  3OYL A;  2GZW A;  1Z1D A;  4HSR A;  3A03 A;  1A35 A;  1DP3 A;  4JK1 X;  1HKT A;  3EYI A;  1O4X A;  4WXH A;  2D1V A;  4WXC A;  4HZF A;  1VQ9 I;  2E60 A;  1FIP A;  2M34 A;  2Y9Y A;  3HKZ A;  3QPT A;  1EKE A;  5HS9 A;  2EFP A;  2B7E A;  3DXJ F;  3ZP5 A;  2VUM J;  2KP6 A;  1JJ8 C;  4AD9 A;  5BMZ A;  1AWC A;  3GME A;  1FTT A;  3F3X A;  4ZYE A;  3OR1 C;  4XM3 A;  4Y13 A;  1VQ4 I;  1IRG A;  3H35 A;  2CQN A;  4BY7 J;  4BUP A;  4XOP A;  2L9R A;  3FZV A;  4DQ2 A;  3ESW B;  3K2Z A;  4A3M J;  2KJB A;  2Y0S N;  2KPM A;  2ME6 A;  1I3Q J;  5HLI A;  3IL2 A;  3E97 A;  2P7C B;  1WZ2 A;  3AAF A;  3QRF F;  3CF5 F;  5CVR A;  3CC7 I;  1ORK A;  3VDX A;  3FHN A;  1QA6 A;  2QBY A;  3BC8 A;  4S0H B;  5EEA A;  1RNL A;  3O2P E;  5F0H A;  2VI6 A;  1TT5 B;  3JRF A;  1D1C A;  4HPQ A;  3EQL F;  3O8H A;  3OOP A;  2EZL A;  2XRL A;  1MSE C;  4PJL A;  1ETX A;  1S8N A;  4CO8 A;  1TL8 A;  4YEL A;  1MW7 A;  5M5X J;  2QEN A;  4BE0 A;  3KYC B;  1POG A;  2PFB A;  3RCO A;  4AID A;  2M8E A;  1XDU A;  1V4R A;  2XGD A;  2P0W A;  4Y4R A;  3RDI A;  2L01 A;  5FO5 A;  3ERE D;  2DA2 A;  2IJL A;  3OY9 A;  4A3F J;  2LRD A;  1BM9 A;  2A6E F;  4EJU A;  5K5R A;  1OFC X;  1O7L A;  3DBL B;  4K2E A;  2HXO A;  1WH7 A;  4I2O A;  2IA2 A;  3KCC A;  3TW6 A;  3OYD A;  3I5U A;  2H94 A;  3VYS B;  1FNN A;  2F5D A;  3OL4 A;  3K4M A;  3LMM A;  4BJ5 C;  2EIL H;  2XB0 X;  3HOS A;  2PMZ N;  1U6G A;  5H6Q A;  2MFZ A;  2W57 A;  1EJ9 A;  2LNB A;  4B3A A;  1GT0 C;  3CD6 I;  3DEW A;  3TKY A;  3OWT A;  4L5E A;  2O7O A;  2Q8K A;  1G4D A;  3ZQF A;  4A3B J;  1WH5 A;  5LHH A;  1T0F A;  4AUX A;  2K27 A;  3WG9 A;  3G1M A;  3ZMZ A;  1B9M A;  4RAY A;  2Q0O A;  4JX5 A;  3MVP A;  4FX0 A;  3C7J A;  3GFM A;  1U5T C;  3QAH A;  1PP7 U;  3F9K A;  2ZBK A;  1GV5 A;  3HJE A;  3FMR A;  3LSG A;  2XAU A;  3CUQ B;  3BTI A;  3MD2 A;  1K78 A;  4OIP F;  4NHJ A;  3S1R J;  2CRG A;  4KN7 X;  3LA3 A;  2OBP A;  5GTI C;  1P2F A;  3IAM 2;  3EUH C;  3CTA A;  3C3W A;  1X4O A;  4BAY A;  2IPQ X;  4YIR X;  2PJR B;  2DFH A;  1YLF A;  5LLQ A;  1A6Q A;  3H9G A;  4CSW A;  3PSF A;  4G7Z F;  5IT3 A;  3TDZ C;  2PEX A;  5D8L B;  1RR7 A;  4F55 A;  4HX8 A;  3PNV A;  3GLL A;  5ERI A;  4M71 A;  1DGW Y;  4GRI A;  4KT5 C;  3BCB A;  2DOD A;  2DK5 A;  3R0A A;  4NUB A;  3JSO A;  2H1L A;  3LSJ A;  3BR6 A;  2J5O A;  3HUG A;  3WTZ A;  3D5S C;  3P9C A;  1D0Z A;  3GUD A;  1MBJ A;  5FKN A;  4A5M A;  3HPH A;  2BYV E;  2QKM B;  1UG2 A;  4II2 A;  3JRC A;  2AXT C;  3CJR B;  3WU1 B;  5IYD J;  4DZP A;  4OU0 A;  1TP4 A;  4BHB A;  2KMU A;  2CQ7 A;  1B72 A;  1UEL B;  4A0X A;  4HYE A;  3BZC A;  5TRD A;  3FWE A;  4RB1 A;  1UZC A;  1IV6 A;  5EF6 A;  3K7A J;  4I7H A;  1ZRE A;  3FIW A;  2COB A;  2X4H A;  4XKB A;  4IKF A;  3QPH A;  4ZYG A;  3KYL A;  4BDZ A;  3EET A;  1A5J A;  2GA2 A;  2XSD C;  5CJ9 A;  2QBY B;  3HOW J;  2FOW A;  3FK6 A;  3K10 A;  3PO3 J;  5LGN A;  3MQ0 A;  2BW3 A;  2FF4 A;  4PSX A;  3LOC A;  3UKG A;  2EA2 A;  3IUO A;  4EJO A;  4HG2 A;  3WOD F;  5M3M J;  2E34 A;  3QQA A;  1SFE A;  3GTK J;  1IRX A;  4IHV A;  4A3I J;  4EMS A;  1WWX A;  4M6V A;  2ZJR F;  1GDT A;  4PJ0 C;  2QEX I;  1BOA A;  3EPZ A;  1QRY A;  2HKX A;  3L9F A;  5BQT A;  2DMQ A;  3IRR A;  5EDN A;  2EA4 A;  3H0G J;  3MZ8 A;  5E1X A;  2EV5 A;  3W2W A;  4AIJ A;  2X1C A;  2HGC A;  1JKO C;  4RLQ A;  4UUV A;  3JRH A;  4LIV A;  1YOV B;  5KCM A;  2R5Z A;  4A3C J;  1ZR2 A;  1WJD A;  4LB5 A;  2NS7 A;  4P9F A;  4B44 A;  5HOO A;  3SEQ A;  1IV8 A;  4C3H J;  3CDI A;  2K3P A;  2JQ7 A;  2JPB A;  4ZYH A;  2QSH X;  1ZGA A;  2OQG A;  4RS8 A;  2VE9 A;  1D3Y A;  3VEP A;  2LG4 A;  3EUK L;  2ISY A;  2KRC A;  4XKW A;  2W7N A;  4ANJ A;  4HLY A;  2EH3 A;  3EUA A;  4DBQ A;  4IO9 F;  1VZ0 A;  1ZN2 A;  1SFK A;  2X1D A;  3I59 A;  4OMY A;  1MNM C;  2GXB A;  4Y7N J;  3PO2 J;  4N9I A;  2HEO A;  2YU9 J;  2WAQ A;  3BT9 A;  2DTZ A;  5FRO A;  3FXU A;  1ZQ3 P;  3RZD J;  2CH0 A;  4ITV A;  1BIB A;  1K78 B;  4P9U A;  2YU3 A;  2BY0 A;  3CDH A;  3BQZ A;  3ROU A;  2X51 A;  1F1Z A;  1ONV A;  2QM3 A;  3KIO A;  4IHS A;  3HIF A;  5M3F J;  1YX5 A;  2CSO A;  3ZQH A;  2VKD A;  1B4A A;  4AIH A;  3CO6 C;  3C2H A;  1K4T A;  2HTS A;  2BEO A;  4A6D A;  4ZTJ A;  3W6V A;  2HDW A;  3ZGK A;  2COM A;  5DD4 A;  5F08 A;  2K85 A;  1S3J A;  3ZCO A;  3M8F A;  3B02 A;  3J80 Z;  2LTP A;  2WA0 A;  4DJA A;  3WHC A;  5E1W A;  5JR3 A;  2XV4 S;  2HR3 A;  2JUG A;  4MIM A;  4A2U A;  1K7A A;  1ZG1 A;  4XKC A;  2HTJ A;  3SZT A;  1U3E M;  3BY6 A;  3U1D A;  2GQQ A;  1O3R A;  3HUG B;  4XK4 A;  1GXQ A;  4GFB A;  1X4P A;  1N77 A;  4RB3 C;  3E0J B;  3LFK A;  2Y0M A;  4Y15 A;  4AYB A;  4E7L A;  3CUQ C;  3BR1 A;  3L00 A;  2VBY A;  1FYM A;  3D0S A;  3E5U A;  4DW6 A;  4LIT A;  3M8J A;  1FC3 A;  3S8P A;  3BTC A;  1LE8 B;  1B72 B;  2HXI A;  2MLG A;  5HOD A;  1BL0 A;  1VQ6 I;  2B63 J;  2O8K A;  2PI0 A;  4HLX A;  4UVC A;  5IOZ A;  3HRM A;  3NQO A;  1XCV A;  4L9N A;  4JP0 A;  1UST A;  2ELK A;  4RB0 A;  2KZV A;  2BBY A;  3BPV A;  2L5Q A;  2A3S A;  2M9H A;  5CVJ A;  1CGP A;  1Z21 A;  4NDL A;  4Q47 A;  1Z67 A;  2AQF A;  2OV7 A;  5HNH A;  2NRA C;  2XGE A;  4RGR A;  5DUI A;  4M3B A;  2BW3 B;  3GFI A;  2CUE A;  4M3E A;  3IKV A;  2KRH A;  4C2M J;  2QSG X;  2XAG A;  1NHA A;  3R4K A;  1RRJ A;  1U8R A;  1MBF A;  1MBG A;  2J5P A;  2W82 A;  4LLG F;  3IRQ A;  5ED4 A;  1HXD A;  2LMD A;  1CQT A;  1OR7 A;  5HDN A;  1YO5 C;  3FXK A;  3A4C A;  3BLY A;  2RC4 A;  3IP4 B;  3IH3 A;  2XPU A;  5JHF A;  3FXM A;  2YX4 A;  1OPC A;  3T1B A;  2DPU A;  1R36 A;  2RN7 A;  4RLF A;  4U7B A;  1EH6 A;  3CJN A;  1OLT A;  3DBR B;  3T5X A;  3FXL A;  1KGS A;  1PUF A;  3V8J A;  2WC2 A;  2XKP A;  2EWN A;  4G6Q A;  2P5V A;  1JGS A;  3LSK A;  1QBJ A;  2NOJ B;  1FWZ A;  2KDZ A;  2L02 A;  3RKX A;  1HQC A;  4EGY A;  2VKV A;  1DPU A;  4IF4 A;  2R5Z B;  1QQI A;  4U0V A;  3K70 D;  2ZSH B;  5LHI A;  2FE3 A;  1L0O C;  3O6B B;  1T95 A;  2Y75 A;  3H5R A;  5FD5 A;  3L09 A;  2K9S A;  2ZC2 A;  1V54 H;  1D5V A;  2HU9 A;  2FML A;  3E5X A;  5ICG A;  2FOK A;  1X1C A;  2ZB9 A;  4MQV A;  1DP7 P;  5DCM A;  2NVT J;  4JBA A;  2A69 F;  4YG2 F;  3PSI A;  1XSX A;  2L7F P;  3ABK H;  4CYD A;  1VQO I;  3DLA A;  3I59 B;  3SQN A;  3VOD A;  4D7N A;  1YIJ I;  1F9N A;  2UV1 A;  5CQG A;  1KZH A;  1QPM A;  5C3E J;  3RZO J;  3BG5 A;  5F6F A;  2CV2 A;  3VWB A;  3I4P A;  3F0C A;  4IZZ A;  3TO7 A;  2V1X A;  4NBQ A;  4UB6 C;  3RYR A;  2WV1 A;  1A31 A;  4I98 B;  2W24 A;  3DCF A;  1D0X A;  1SVO A;  5EYR A;  5LHG A;  1JHF A;  3CES A;  4HNT A;  5LRS A;  2YSR A;  2A05 A;  1YJN I;  2YR2 A;  2F2E A;  2EB7 A;  2QLZ A;  2UXN A;  3HL2 A;  3TW7 A;  4LGW A;  2E2I J;  4BE1 A;  1X3W B;  1I50 J;  2M87 A;  1D8J A;  5HS7 A;  2FRH A;  3V42 A;  2CO5 A;  2H27 A;  2D5V A;  4D0P A;  4PJM A;  1QVT A;  1ZHF A;  1ZLJ A;  5E3L A;  2WAD A;  5CVU A;  1T0F C;  2AO9 A;  4R79 A;  5IYB J;  2HVS A;  1Z3Y A;  3M07 A;  1E3H A;  2DMU A;  3CC4 I;  2VXZ A;  3RYP A;  2A61 A;  2AS5 F;  4ENJ A;  1G3T A;  4PSW A;  3ISP A;  1RUO A;  1MIJ A;  2KHM A;  2RVC A;  4Z6Y A;  3DFG A;  5KAF C;  3KLO A;  4V2F A;  4Q4Z F;  4S04 A;  1MGT A;  2EQR A;  4L5J A;  2MD5 A;  2DA4 A;  2CQK A;  3K4K A;  4ZYA A;  1G6N A;  1H9G A;  2XVC A;  5B5E C;  2OZ6 A;  2RNG A;  3P9K A;  4CCL A;  4B43 A;  4D7M A;  3CCQ I;  3ZQG A;  1EV7 A;  3R0J A;  4L9V A;  1O3S A;  1AOY A;  4FCY A;  2HDC A;  2K7L A;  3JRD A;  5ILU A;  3G2B A;  2GIZ A;  3CLO A;  3Q9V A;  2LC2 A;  5K5Q A;  4HV5 A;  3FX3 A;  3I53 A;  1ZRC A;  3H9Q A;  2RRE A;  2ZJP F;  1R49 A;  1TC3 C;  4MFE A;  3AG2 H;  3CZ6 A;  5IP9 J;  5BPI A;  4BGD A;  4IHW A;  1QPI A;  1TWH J;  2JSP A;  3QP5 A;  3FF5 A;  3FMQ A;  1P6R A;  5TGT A;  4N4O B;  5FB2 A;  4P1W A;  4BH9 A;  3KPH A;  2H8W A;  2FJ1 A;  2JT1 A;  2O03 A;  2QQ8 A;  4J01 A;  5E20 A;  2FX0 A;  4C30 A;  2K9M A;  3DPU A;  3S2D J;  3GXO A;  3N05 A;  2NS8 A;  1JXS A;  2F5F A;  5BS6 A;  1PUF B;  1SMT A;  3K1M A;  1XB4 A;  3S15 J;  4D1Q A;  1HW1 A;  3OYN A;  3ONQ A;  4M3G A;  3SEZ A;  1IRZ A;  1B1B A;  1IO2 A;  3PIO F;  3ZN1 A;  1XSD A;  5FKO A;  3LA2 A;  3Q0V A;  1J59 A;  2HPM A;  3A0B C;  2MH9 A;  2Y69 H;  4HDV A;  1K79 A;  3MAJ A;  2LD5 A;  1MH4 A;  3OS0 A;  3MFK A;  5GPA A;  4TV7 A;  1VI0 A;  3QPL A;  3TP3 A;  4B4C A;  2OZU A;  3J81 K;  3I3L A;  2BY1 A;  2XGC A;  1J09 A;  3LSI A;  2PG4 A;  2R7Q A;  4FET A;  1W36 C;  2X6X A;  1SAU A;  5DCM B;  2R0Q C;  5HS8 A;  2JK3 A;  1O57 A;  3L2V A;  2FD5 A;  2KIS A;  3D5L A;  5FGM A;  1KON A;  3HOX J;  1W7P D;  4EAT A;  4FTH A;  2DA3 A;  5HDG A;  5FD6 A;  3LNQ A;  2FU4 A;  4IVN A;  4DYC A;  2YPR A;  2ZFU A;  4YRV A;  2KQR A;  1OCZ H;  1IN5 A;  1W5C C;  3S2H J;  4XRM A;  3E6B A;  2ESH A;  4U7D A;  3GZ6 A;  2JA5 J;  1XG1 A;  3BRO A;  3LL7 A;  1BR2 A;  4MHG A;  3RKY A;  1IC8 A;  1R00 A;  2G9W A;  5L3D A;  4ENM A;  5DM7 F;  3TOA A;  2E36 A;  3B6A A;  4ON0 A;  2XAQ A;  1QO0 D;  2VPR A;  4CDG A;  3JW4 A;  5IT9 K;  1BR1 A;  4EJW A;  4XON A;  1P4X A;  3LSP A;  2WY7 Q;  1TBX A;  4ESF A;  4FE4 A;  3IWF A;  3DV8 A;  5HNF A;  3GTO J;  3J7Z I;  1S7A A;  2O0Y A;  4F3Q A;  1LDK B;  2D45 A;  2LYC A;  4BU2 A;  2NVU B;  3WGG A;  1PJR A;  3F72 A;  1X19 A;  2K9L A;  4JQF A;  3GWZ A;  1WKM A;  3MKZ A;  1LEA A;  2X6O A;  1JTX A;  2OD5 A;  2M45 A;  2IGK A;  1H8A C;  3PL8 A;  2STW A;  2DCE A;  2K4B A;  4LIU A;  4ZDP A;  4HRI A;  2IS6 A;  1AU7 A;  2ZNY A;  2R4G A;  1G3Y A;  1HCR A;  1YRN A;  1G2H A;  1NG6 A;  1TT0 A;  2KFD A;  3MWM A;  3TO6 A;  5E3O A;  3OYE A;  1V3F A;  3EDP A;  2XRO A;  4X1E A;  3Q0U A;  2RKH A;  2I5U A;  3I0T A;  4O3M A;  2LDU A;  2K3F A;  2IW5 A;  5H20 A;  2LLK A;  2ZJQ F;  4RGS A;  5F0C A;  5J3L A;  1T38 A;  1QGP A;  2A5W A;  2QCO A;  5L3E A;  1R1T A;  4J00 A;  2EJR A;  2WTE A;  2HQN A;  3HOU J;  5KK1 A;  1YYV A;  3KZZ A;  2Z9O A;  1S29 A;  3CLQ A;  2K5C A;  4A69 C;  3FMS A;  3OL3 A;  1RI7 A;  5DUK A;  4E7S A;  5HLT A;  2E19 A;  4IRI A;  2PMZ A;  3TGN A;  2ME0 A;  4BXX J;  1J75 A;  1MBE A;  1BJZ A;  5J8C A;  1NK2 P;  4X6A J;  4KIG A;  3BR3 A;  1GUU A;  2WV0 A;  1N78 A;  5L3C A;  1ETO A;  2XKO A;  1BC8 C;  5EEG A;  2DOE A;  1TNT A;  3TBI A;  4PUS A;  4PJN A;  1VQK I;  2JUC A;  3DPT A;  3IKT A;  4KDP A;  1ZRD A;  4M9X A;  1WQ2 A;  1DUX C;  2P81 A;  4M6X A;  4A3L J;  1TQM A;  3K0L A;  4HA8 A;  2EV6 A;  1OYW A;  2V9P A;  2LY9 A;  1TNS A;  3L2R A;  4I76 A;  1YHQ I;  4I09 A;  1T2K A;  1ZAR A;  4AC0 A;  2V79 A;  2CJJ A;  2FQ3 A;  1QVU A;  1NK3 P;  5GTH C;  4II3 A;  1JKP C;  1R7J A;  3I54 A;  2GWR A;  2KRF A;  1P4A A;  1E3P A;  5J47 A;  4ZZD A;  1O3T A;  2NNY A;  1OCR H;  2F5V A;  3QOE A;  2A6H F;  3WG7 H;  2E2H J;  4FHT A;  1E0E A;  1OJL A;  2PX9 A;  2XAS A;  4MQ9 F;  3S32 A;  2V9V A;  3PNY A;  4LK0 F;  2OCC H;  4IJA A;  3F8C A;  3R6S A;  3RPU D;  2LRE A;  3IC7 A;  2ZCW A;  2DLL A;  1OR7 C;  3S1N J;  4H0E A;  2FUG 2;  3BG7 A;  2NVY J;  2IGO A;  3VB2 A;  2EIM H;  4LG3 A;  1RKW A;  2DN0 A;  2MBF A;  1G3S A;  3E6M A;  1X3Z B;  2KDO A;  1WPK A;  3CCU I;  4LFU A;  2DXI A;  2DMN A;  2BHY A;  4RB2 C;  3HKZ N;  1FOX A;  4R8H A;  3S2W A;  3CCJ I;  2ZXI A;  3E1S A;  4O5V A;  2OQR A;  2ZFW A;  3H0D A;  3TP0 A;  3QYB A;  2WAF A;  3A2K A;  1U8B A;  2QGU A;  1HDP A;  1RR8 C;  2VOO A;  1IRF A;  1NG7 A;  1S9H A;  4B8X A;  4EVI A;  1UJ8 A;  1AHD P;  1FP2 A;  2L9N A;  4RGX A;  5F64 A;  1OCC H;  1WVR A;  3AKZ A;  3SJM A;  4C9Y A;  1AKH A;  3OYM A;  5ILV A;  4CCO A;  2L9S A;  4M9Z A;  5J4V A;  3GLX A;  3TQN A;  2PBI A;  3COA C;  3S3M A;  2MYS A;  4RAZ A;  1I1G A;  1I5Z A;  3PQK A;  3ZQC A;  2OPT A;  2LBF A;  3P7N A;  2WY8 Q;  1R1U A;  3A01 A;  1YRN B;  2VC0 A;  2R93 J;  1MMA A;  3L2U A;  4ESJ A;  3V7C A;  2EIK H;  2X0L A;  2BVM A;  3DBH B;  1XPX A;  3SZG A;  3I4N J;  4EQQ A;  3WU2 C;  1T33 A;  3MKW B;  2PJP A;  1XMX A;  3K6G A;  1FOK A;  3C1D A;  4CA0 A;  4BL0 B;  1YE9 A;  1SVL A;  2BV6 A;  4HF1 A;  2KJC A;  1V5E A;  2GXA A;  2HQR A;  4BKX A;  2IGN A;  4CXF A;  3NWS A;  4L0Z B;  2JA2 A;  4LD5 A;  4MGR A;  1I1S A;  3DKW A;  3OS2 A;  2K9N A;  1X1B A;  2EZK A;  3KP2 A;  1XX5 A;  1FP1 D;  3HDD A;  4G12 A;  3ZRG A;  5FRN A;  3OIP A;  1JTY A;  1EF4 A;  3F8B A;  1MD0 A;  1F5T A;  2Z3Y A;  3H5N A;  3OYI A;  2TDX A;  3HOV J;  2VE8 A;  4GGG A;  1YJW I;  2XSJ C;  3ZOB A;  1SD5 A;  2XB5 A;  1OIS A;  3F21 A;  5JVG F;  4QIW N;  1V5F A;  4BHP A;  2DQR A;  4Q5S F;  2JWT A;  1JUM A;  4U0W A;  3WGH A;  4WK8 F;  1MBK A;  4RMN A;  1DPR A;  2L9V A;  4LK1 F;  3RSN A;  3ZN0 A;  4BQQ A;  4CCM A;  3AG4 H;  3ZMT A;  2LKS A;  2OA4 A;  1R5H A;  5GAG J;  4XN3 A;  4D9J A;  1IXS B;  4I01 A;  4RBO A;  2VAS A;  1VQ7 I;  1RIO H;  2DK8 A;  2ICW G;  4G7H F;  4QLC U;  5BOX A;  3B6C A;  2UZK A;  5DM6 F;  1G8X A;  4N9H A;  4PGG A;  1CF7 A;  3LWF A;  1VQ5 I;  3T8T A;  1DU0 A;  3A1Y A;  3GVA A;  2FBI A;  1ZEL A;  1I6X A;  1Y1V J;  2L7K A;  3CCY A;  3OIO A;  4XSZ F;  1BN5 A;  2FEZ A;  5HVQ C;  3S16 J;  2RNJ A;  2EFO A;  5C44 J;  4XID A;  1R5G A;  4M6Y A;  2VQL A;  1PUE E;  2R7U A;  5K7H A;  2Z1D A;  2VJI A;  2EIJ H;  2ZNZ A;  2HI3 A;  3V7R A;  3HXL A;  2GAU A;  3QWL A;  4E7I A;  2OF7 A;  4EJV A;  5JFR A;  3KP5 A;  5GAH J;  5EJC A;  2MH2 A;  3CCS I;  2QF7 A;  4FQG A;  1LDJ A;  2QQA A;  5D5X B;  3ABM H;  2L2O A;  3OOU A;  3ULQ B;  1AA7 A;  1WJC A;  2M1B A;  1TQI A;  2GOM A;  4G9Y A;  1KU2 A;  1UCR A;  1ZTR A;  2VT3 A;  3LA7 A;  4A6E A;  2IXS A;  3ZQL A;  1U78 A;  5FLX K;  1YIO A;  3DP7 A;  1RUN A;  3GO5 A;  3GZ5 A;  1NTC A;  3H1C A;  2Y9Z A;  1PP8 F;  3GCM A;  4KIT B;  2XDV A;  2KT0 A;  1EA3 A;  4E7J A;  3TL4 X;  2W1O A;  2V1D A;  3OYK A;  5GPC A;  1AKH B;  2O5R A;  2MLK A;  2ISZ A;  3M8E A;  3NAR A;  4BQA A;  4WX9 A;  3MCZ A;  1H9T A;  2F4I A;  4FX4 A;  1Y56 A;  4A3E J;  2V6E A;  1MND A;  4IX7 A;  1IN8 A;  2LBF B;  1MMG A;  3A01 B;  3P5J A;  4UV9 A;  1T08 B;  2IT0 A; 
#chains in the Genus database with same CATH homology
 1RET A;  2D5V A;  1P7I A;  1QVT A;  2K40 A;  2HQ5 A;  4IHY A;  5E3L A;  2AO9 A;  3O8G A;  1TWG J;  1K83 J;  4M3D A;  5IYB J;  5BNG A;  4D5C A;  1FJL A;  4EEF G;  2DMU A;  3BTJ A;  5J1R A;  3JRE A;  3BR0 A;  4D5F A;  1RPW A;  1IDY A;  4XIC A;  4C3I J;  5FLM J;  3BG9 A;  1MH3 A;  5FKK A;  1A6I A;  1GV2 A;  4J19 A;  1U9N A;  2X9D A;  4IHX A;  2ECC A;  4V2F A;  5F27 A;  2H8R A;  1P7J A;  5EG0 A;  2E1O A;  2EQR A;  1JJ6 C;  2IBD A;  2Y31 A;  2JA8 J;  1K61 A;  2DA4 A;  3A03 A;  1O4X A;  1LFU P;  3G1O A;  3BQY A;  4A3D J;  1FIA A;  1HF0 A;  2M34 A;  1FIP A;  4D7M A;  3H3V K;  3CMY A;  3ZQG A;  2Y9Y A;  4FE7 A;  5IP7 J;  3ZQI A;  4FCY A;  2VUM J;  1JJ8 C;  3JRD A;  3CDL A;  1FTT A;  3S1M J;  1LE8 A;  3IV5 A;  1FTZ A;  4BY7 J;  1TC3 C;  1R9T J;  2L9R A;  4MFE A;  5IP9 J;  3Q3S A;  1D5Y A;  4IHW A;  4RDU A;  1OCT C;  4A3M J;  1TWH J;  1QPI A;  3S14 J;  2Y0S N;  2ME6 A;  1I3Q J;  2LKX A;  2HDD A;  1ORK A;  2DMT A;  2NVQ J;  2FJ1 A;  4S0H B;  5EEA A;  1BW6 A;  3WHB A;  2FX0 A;  1I6H J;  5F0H A;  5EGO B;  2VI6 A;  1IG7 A;  3JRF A;  3S2D J;  2NS8 A;  2VKE A;  4QTR A;  1PUF B;  3O8H A;  2DA6 A;  3S15 J;  2EZL A;  2XRL A;  1MSE C;  2M8G X;  2WB1 N;  4M3G A;  1ETX A;  5DS9 A;  1Y1W J;  5J1Y A;  1IRZ A;  5M5X J;  5JLX A;  1POG A;  2CQX A;  2ECB A;  5FKO A;  1ETV A;  3Q0V A;  2XGD A;  1F43 A;  2LP0 A;  1WGX A;  2N8G A;  5IYC J;  2LD5 A;  1MH4 A;  2JA7 J;  3GTP J;  5GPA A;  1IJW C;  2DA2 A;  1VI0 A;  3QPL A;  3TP3 A;  4B4C A;  3M3Y J;  4A3F J;  2XGC A;  1OFC X;  1DU6 A;  2R0Q C;  2HXO A;  3SDG A;  1WH7 A;  2JK3 A;  3TW6 A;  1F36 A;  2FD5 A;  1JUS A;  3GTG J;  3HOX J;  4FTH A;  3K2A A;  2DA3 A;  3SFI A;  1TWA J;  3LNQ A;  5F1J A;  2XB0 X;  4DYC A;  2PMZ N;  3HEF A;  3M4O J;  4B3A A;  1VFC A;  1GT0 C;  3S2H J;  4XRM A;  2DJN A;  2JA5 J;  3DEW A;  1XG1 A;  4I6Z A;  4L5E A;  2O7O A;  3ZQF A;  1IC8 A;  4A3B J;  1ITY A;  1WH5 A;  4AUX A;  3B6A A;  2VPR A;  3G1M A;  5K7F A;  1RKT A;  3JRG A;  4JX6 A;  1HDD C;  4JX5 A;  3MVP A;  3LSP A;  1U9O A;  1GV5 A;  4FE4 A;  3BR2 A;  3LSG A;  3BTI A;  2LR8 A;  3GTO J;  3OSG A;  3S1R J;  2CRG A;  1E3O C;  2JN6 A;  4MFD A;  2M0C A;  4FIS A;  4QSH A;  3IH2 A;  2X6O A;  1JTX A;  1H8A C;  1S7E A;  2YUS A;  3C2B A;  2NOG A;  1AU7 A;  4DZJ A;  2HOS A;  1HCR A;  1YRN A;  1G2H A;  1RR7 A;  5C4J J;  3RQI A;  5E3O A;  4X1E A;  3QPS A;  1XC5 A;  3Q0U A;  5EG0 B;  2IAI A;  5FJ8 J;  3LSJ A;  1JT6 A;  4MO7 A;  3BR6 A;  2JJ7 A;  2GLO A;  2LLK A;  5FLV A;  5F0C A;  5J3L A;  1MBJ A;  5FKN A;  2NVX J;  2EZH A;  2QCO A;  4DYQ A;  1UG2 A;  3HOU J;  2H1K A;  2Y2Z A;  4ABZ A;  1X2M A;  3S1Q J;  3JRC A;  3OSF A;  5IYD J;  5FKL A;  4DZP A;  4A69 C;  1VF9 A;  2TRT A;  3LSR A;  1FEX A;  1UHS A;  2E19 A;  1B72 A;  2ME0 A;  2HOA A;  1W0U A;  4BXX J;  1JGG A;  1MBE A;  5C4X J;  1BJZ A;  1ETY A;  1NK2 P;  4X6A J;  3BR3 A;  2WAQ N;  1GUU A;  1IV6 A;  5EF6 A;  3K7A J;  1ETO A;  3FK7 A;  3FIW A;  1ENH A;  4V2G A;  1ZGW A;  2COB A;  1GVD A;  1A5J A;  2XSD C;  3HOW J;  3HB9 A;  2K9Q A;  3FK6 A;  1RES A;  1ZK8 A;  2P81 A;  3PO3 J;  2ID3 A;  4A3L J;  3LOC A;  3UKG A;  5IPA A;  3MN2 A;  2JA6 J;  5M3M J;  2DA5 A;  3QQA A;  4DYR A;  3GTK J;  2LY9 A;  2MSY A;  4I76 A;  4IHV A;  3HOY J;  4A3I J;  1MSF C;  4AC0 A;  1WI3 A;  1HOM A;  2CJJ A;  4M6V A;  1QVU A;  2EZI A;  5IP6 A;  1GDT A;  1NK3 P;  1JKP C;  1QRY A;  1T56 A;  2DMQ A;  5EDN A;  5E3M A;  3H0G J;  4BBR J;  1LFB A;  2E2H J;  4AYB N;  1OJL A;  1JKO C;  1JUP A;  3JRH A;  1IUF A;  2R5Z A;  4A3C J;  1UMQ A;  1ZR2 A;  2MGQ A;  2IEK A;  3S1N J;  4A3K J;  2NS7 A;  2L0K A;  4IEJ A;  2NVY J;  2R5Y A;  3VPR A;  2DA7 A;  4C3H J;  1RKW A;  2DN0 A;  4JX4 A;  3L1P A;  1WPK A;  2LFB A;  4XRS G;  4A3G J;  4UUT A;  2DMN A;  3IH4 A;  3HKZ N;  2EH3 A;  4W97 A;  4UUS A;  3CQZ J;  1ETW A;  2GM4 A;  3RKQ A;  3BG3 A;  1MNM C;  2M2E A;  4Y7N J;  3PO2 J;  3TP0 A;  4BY1 J;  1U8B A;  1SAN A;  2YU9 J;  1HDP A;  1X58 A;  3BT9 A;  2DTZ A;  2I10 A;  1B8I A;  2HOT A;  3HOZ J;  3GBG A;  4B1R A;  5M5Y J;  1ZQ3 P;  3RZD J;  4MLO A;  1AHD P;  3BQZ A;  3HM5 A;  3SJM A;  1AKH A;  1TWC J;  4JYK A;  4Y52 J;  1APL C;  5M3F J;  3ZQH A;  5M5W J;  2LVS A;  3FKI J;  1WCM J;  3PM1 A;  1TWF J;  2G0E A;  2Y30 A;  1JT0 A;  4CYC A;  3W6V A;  1X2N A;  3ZQC A;  2OPT A;  5F08 A;  4BBS J;  3A01 A;  1YRN B;  2R93 J;  2LTP A;  3I4N J;  1H88 C;  3WHC A;  3BR5 A;  2XPV A;  1T33 A;  3HBL A;  3NAU A;  4MIM A;  2XPW A;  9ANT A;  2ID6 A;  5DTD A;  4XK4 A;  4GFB A;  1Z77 A;  4BKX A;  2MW8 A;  3BR1 A;  2K9N A;  5K7Z A;  5F0F A;  2EZK A;  3HDD A;  2DMP A;  4DW6 A;  3D1N I;  4G12 A;  3MKL A;  1JTY A;  2LK2 A;  1EF4 A;  3BTC A;  1VND A;  1LE8 B;  1B72 B;  2HXI A;  5HOD A;  1BL0 A;  2E2J J;  3HOV J;  2B63 J;  1MBH A;  2L7M P;  3GTM J;  3ZOB A;  2O8K A;  2HYJ A;  2XB5 A;  5IOZ A;  4JP0 A;  2ELK A;  1ZKG A;  4QIW N;  2M9H A;  2CUF A;  2JWT A;  1JUM A;  4NDL A;  2O9L A;  3JRI A;  1MBK A;  4C3J J;  2XGE A;  5IOY A;  4M3B A;  2CUE A;  4RBO A;  4M3E A;  1JKR C;  4C2M J;  2EBI A;  3E7L A;  3JR9 A;  5E3N A;  1HLV A;  3B6C A;  1MBF A;  1MBG A;  5EZG A;  1CQT A;  3GTJ J;  1DU0 A;  3IH3 A;  2XPU A;  2GBY A;  5EGO A;  1OCP A;  1Y1V J;  3CCY A;  3OIO A;  1PUF A;  3TED A;  4A93 J;  3S16 J;  5F04 A;  5C44 J;  4XID A;  1BW5 A;  2KDZ A;  5K7H A;  1ETK A;  1SFO J;  2VKV A;  2HI3 A;  4W1U A;  2R5Z B;  1ZR4 A;  5J1U A;  3Q0W A;  2OF7 A;  3GTL J;  1Q1V A;  2R5Y B;  1XS9 A;  3BTL A;  2K9S A;  2CU7 A;  2QF7 A;  2FQ4 A;  1BA5 A;  2X48 A;  2ZB9 A;  2NVT J;  1JKQ C;  3OOU A;  4A3J J;  2L7F P;  4UUS B;  2RAE A;  3GTQ J;  1ZTR A;  4D7N A;  3ZQL A;  5C3E J;  1U78 A;  3RZO J;  3HGG A;  2L7Z A;  2TCT A;  3JRB A;  3BG5 A;  2R92 J;  2CQQ A;  3I4M J;  1B8I B;  1NTC A;  3HGY A;  1IGN A;  2Y9Z A;  3F0C A;  1IDZ A;  2KT0 A;  3FIS A;  2WV1 A;  2AHQ A;  3DCF A;  5EZH A;  1H89 C;  5GPC A;  1Z0X A;  2W48 A;  1AKH B;  4XRS A;  3JRA A;  5EYR A;  4M3F A;  1ETQ A;  2YS9 A;  5JLW A;  3NAR A;  2JMW A;  3A02 A;  3G1L A;  4LOC A;  4CYC B;  4A3E J;  1W0T A;  2DA1 A;  2R7Z J;  5FKM A;  5GP9 A;  3TW7 A;  4HNV A;  2E2I J;  3S17 J;  3A01 B;  2MG4 A;  1I50 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...