1TC3C

Transposase tc3a1-65 from caenorhabditis elegans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*GP*GP*GP*GP*GP*GP*GP*TP*CP*CP*TP*AP*TP*AP*GP*A
publication title Crystal structure of the specific DNA-binding domain of Tc3 transposase of C.elegans in complex with transposon DNA.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein/dna
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11427 HTH_Tnp_Tc3_1 Tc3 transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1tc3C00
4A93J 3JRDA 1JT0A 1WH7A 5FJ8J 2NOGA 5EG0B 4C2MJ 3PO3J 2OF7A 3RZOJ 1HCRA 5EG0A 2DMPA 5EDNA 1GT0C 1RESA 4XICA 2CQQA 5J1YA 1HDDC 5J1RA 5GPAA 1U9NA 1P7JA 3TP3A 3BG5A 2OPTA 3Q0UA 4MFDA 2K9SA 4IHVA 1F43A 2Y31A 3BTJA 2EZIA 2AHQA 5FKLA 2MG4A 1TWCJ 2IAIA 1IGNA 1NTCA 1OFCX 3BT9A 2MSYA 2DMNA 5F08A 3S2DJ 1B8IA 3S2HJ 2ECCA 5E3NA 2YU9J 2LFBA 4JX4A 3G1OA 5IYCJ 2VKVA 1FIPA 4CYCB 3K7AJ 3JRIA 4RDUA 1IUFA 3BR2A 1Z0XA 2DMTA 2XGDA 3JREA 3MKLA 3LNQA 1W0UA 2HOSA 5E3MA 2KDZA 4BBRJ 2LP0A 2XB5A 3G1LA 2ME0A 1GV2A 1GDTA 1ETVA 1IJWC 1OCPA 1MSEC 2R5ZB 2CUEA 1MSFC 4A3JJ 5F0HA 1F36A 2P81A 4I76A 1JJ6C 4BXXJ 1X2NA 3L1PA 1HF0A 2VKEA 1H88C 2D5VA 2JA7J 1HLVA 3GTGJ 4J19A 2O7OA 5K7ZA 2GLOA 3HOYJ 2E1OA 1VI0A 1ETWA 4MFEA 5DTDA 1X2MA 1MH3A 1TWHJ 3BR5A 1Y1VJ 3S1NJ 4EEFG 2LR8A 3FK7A 1JT6A 2N8GA 1R9TJ 1MBKA 3UKGA 3JRHA 4UUTA 2DA5A 4A3FJ 3S15J 3BTLA 3LSGA 4M3DA 2EZLA 5M3FJ 1IG7A 2M0CA 2L7FP 4A3KJ 1BW5A 1UMQA 2R0QC 1MBFA 3C2BA 2ECBA 5FLMJ 5EZGA 3WHBA 4DYCA 2DMQA 2X6OA 2E2JJ 3B6CA 4A3CJ 1JTYA 2PMZN 4BBSJ 2EQRA 2LVSA 4V2FA 1VNDA 3JRGA 3ZQIA 3SDGA 3QPLA 4G12A 1A6IA 1ZK8A 2MW8A 4DZJA 2Y2ZA 3ZQCA 1WCMJ 1WPKA 1ZTRA 2TCTA 1ZGWA 2JA6J 1ZR4A 2NVTJ 2GBYA 3RQIA 4C3IJ 3OSFA 2W48A 2Y9YA 5BNGA 2EBIA 4L5EA 3LSPA 2DMUA 5M5XJ 1Y1WJ 3GBGA 4QIWN 1H8AC 1MNMC 1IDZA 3E7LA 5M3MJ 3BR1A 4BY1J 2WAQN 2VUMJ 3HOUJ 3D1NI 2CRGA 5K7HA 2DA3A 2L0KA 1TWGJ 3RKQA 3G1MA 1W0TA 4QSHA 2DJNA 3GTJJ 3TEDA 2FX0A 4M3BA 2FJ1A 2NVQJ 3VPRA 1PUFB 3HKZN 2ME6A 3BR0A 4C3JJ 3S1MJ 3I4MJ 1PUFA 3O8GA 1FJLA 4JX5A 2NS7A 1BJZA 2DN0A 4LOCA 1GV5A 2NS8A 1TC3C 1JUMA 1BA5A 3BG9A 3HDDA 3GTPJ 3H3VK 2WV1A 4M6VA 2XGEA 5EEAA 3S14J 1B8IB 1JKPC 2JA8J 4JYKA 1ETOA 2LK2A 3HGGA 2B63J 1NK3P 1ETKA 1O4XA 1UHSA 2HXIA 3HOZJ 1I6HJ 1X58A 3Q3SA 3PO2J 3MVPA 2FD5A 3LOCA 1CQTA 5EYRA 1YRNA 3M3YJ 1D5YA 3HBLA 2K9NA 2L7MP 3Q0VA 4IHWA 1TWFJ 1RKWA 1SANA 4XK4A 1LFUP 2EH3A 4D5FA 2I10A 3PM1A 2QCOA 1NK2P 2K40A 3JRAA 1E3OC 1A5JA 4V2GA 5J1UA 4XRMA 3BG3A 1IV6A 1ORKA 1OCTC 5IYBJ 1FEXA 2H8RA 4D7MA 4A3LJ 2JN6A 1S7EA 3K2AA 1OJLA 5JLXA 3HGYA 4A3MJ 3JRCA 1MH4A 2ELKA 2CQXA 3S16J 3IH2A 1T56A 4ABZA 1U9OA 5IOYA 3S1QJ 4I6ZA 4BKXA 3I4NJ 4XIDA 1HOMA 1MBJA 1ZR2A 4A3BJ 2WB1N 4DYRA 5C4XJ 2VI6A 2DA7A 3F0CA 4B1RA 3S17J 1VFCA 2NVYJ 1B72B 1G2HA 1Z77A 3SFIA 1LE8A 2XPWA 2Y30A 1H89C 1ENHA 3BR6A 1B72A 2HXOA 5EZHA 2HOAA 1JJ8C 2IEKA 1DU0A 1T33A 2DA2A 4S0HB 4MIMA 4Y52J 5JLWA 2NVXJ 2Y0SN 2L9RA 2HDDA 2LTPA 5EGOB 3WHCA 5DS9A 2JK3A 2XSDC 1JKOC 2E2IJ 4FCYA 5EGOA 3QPSA 2HYJA 3FISA 2DTZA 3ZQLA 3HB9A 2HI3A 3CQZJ 2RAEA 2COBA 3CMYA 1JGGA 4HNVA 1IC8A 5FKMA 3HOWJ 3BTCA 4QTRA 3TP0A 1JTXA 4AC0A 2ZB9A 1JKRC 3GTQJ 1K61A 3NARA 1AHDP 3GTOJ 1JUPA 4X1EA 1GVDA 2JMWA 5IP6A 5FKNA 3OIOA 1QRYA 4NDLA 1RETA 1FTZA 5IYDJ 3HOVJ 5IP9J 1ZQ3P 3M4OJ 5HODA 2CJJA 1P7IA 5K7FA 3OSGA 2MGQA 2EZKA 4UUSB 2EZHA 4XRSG 2HQ5A 4D7NA 2YS9A 1SFOJ 4XRSA 1IDYA 3LSRA 4UUSA 4IEJA 1QVUA 4DYQA 1WH5A 4RBOA 2L7ZA 5C4JJ 1BW6A 1DU6A 2ID6A 3A02A 3A01B 2X9DA 3DEWA 3HEFA 1AKHB 1YRNB 4A3EJ 3B6AA 2M9HA 5F0CA 1GUUA 3A01A 1JKQC 2XGCA 1AKHA 2KT0A 3ZQGA 3JR9A 2O8KA 2X48A 3O8HA 3BQYA 3ZOBA 1POGA 9ANTA 2CU7A 2ID3A 3IV5A 4M3EA 3TW7A 3JRBA 2XPVA 4JP0A 3ZQHA 4DZPA 1Q1VA 2K9QA 2VPRA 4FE7A 2H1KA 4CYCA 3FK6A 2JWTA 2M34A 1RKTA 2GM4A 2R7ZJ 2E2HJ 3ZQFA 5M5YJ 5FKKA 3HOXJ 5E3LA 4D5CA 5F27A 1VF9A 4GFBA 1ETXA 5F0FA 1XG1A 1IRZA 2XB0X 2LKXA 3TW6A 2XPUA 1RPWA 2HOTA 5E3OA 1U8BA 3NAUA 2LY9A 2R92J 1I50J 2G0EA 1APLC 1QVTA 1LFBA 4FTHA 1AU7A 3IH4A 1RR7A 2R5ZA 1LE8B 5IP7J 2CUFA 4AUXA 5IPAA 2LLKA 2YUSA 2TRTA 1WGXA 4A3IJ 1UG2A 5IOZA 3IH3A 1MBHA 3BTIA 1EF4A 3BQZA 3LSJA 1I3QJ 2QF7A 3DCFA 2IBDA 1ETYA 3MN2A 5FKOA 2Y9ZA 1ITYA 3A03A 1U78A 4Y7NJ 4M3GA 1BL0A 3W6VA 1TWAJ 3GTKJ 3FIWA 3S1RJ 4MLOA 2O9LA 4X6AJ 4IHXA 5FLVA 3CCYA 3BR3A 4JX6A 2DA4A 4MO7A 5F1JA 1ZKGA 1XC5A 4W1UA 1HDPA 2R5YB 3HM5A 3JRFA 3Q0WA 2JA5J 1FIAA 1ETQA 4IHYA 2R5YA 4FISA 2R93J 3GTLJ 1MBEA 3GTMJ 4BY7J 1MBGA 2DA1A 2AO9A 2XRLA 2FQ4A 1QPIA 4B3AA 3QQAA 1XS9A 5C44J 2E19A 2M2EA 5GPCA 3H0GJ 3CDLA 4B4CA 4A69C 2LD5A 3RZDJ 4AYBN 5C3EJ 5F04A 3OOUA 2JJ7A 4DW6A 4W97A 5GP9A 4C3HJ 3SJMA 3FKIJ 2DA6A 4M3FA 1FTTA 5EF6A 4A3DJ 4A3GJ 1JUSA 4FE4A 1WI3A 5J3LA 5M5WJ 2M8GX 1K83J
chains in the Genus database with same CATH superfamily
1TQIA 4U88A 2NOGA 5EG0B 5JR3A 3PO3J 3BPVA 3PQKA 3RZOJ 3MEXA 4F91B 5EG0A 1GT0C 1ZREA 1WJEA 3CUQC 2STWA 1VQLI 2KJCA 2CQQA 4HQMA 1U9NA 1IRGA 2A68F 5BPDA 1FYMA 5HDKA 3BG5A 2VONA 2MD0A 1ZHFA 1R22A 1O3SA 1H9GA 1VQ4I 4IHVA 1N25A 2AXTC 4EVIA 3C1DA 3HSRA 2VOOA 1Z21A 4CSWA 3UR3C 4RGSA 3W6KB 4HV5A 4PDKA 4E70A 2V9KA 3KIOA 4EJOA 3GMEA 4EM0B 4IO9F 2EILH 1OFCX 3HTUA 2KFDA 5HOOA 1J59A 2DMNA 3VYUB 2O5RA 1XMXA 1X1PA 3DEEA 2E5NA 4LIVA 3WG9A 4KMFA 2ECCA 1WKMA 1MGTA 4CYCB 3TGNA 4HX7A 3KYDB 2NVUB 3ERMA 4BJTA 2DMTA 2XGDA 4ZH4F 2AXLA 1HKQA 2BY1A 5E3MA 2UUZA 4ZYEA 1FOYA 1JHHA 3F8BA 1YX3A 2RKHA 4BBRJ 1QU3A 2WY8Q 4EJTA 3V7SA 4O3MA 1GV2A 1S72I 4M9XA 3ZQQA 1OKRA 4KT5C 5ED4A 3IKTA 3KFWX 1I39A 1B59A 2M1BA 3S93A 4A3JJ 4A0XA 3OYJA 3E1SA 2E1MC 1X2NA 5CVVA 4ZDLA 4DNCA 3WTVC 2D5VA 3HTSB 1HLVA 2OCEA 2O7OA 2IS4A 3I5UA 1R36A 3S3OA 2IPQX 1WSUA 3HOYJ 2GA2A 4WF2A 2GOXB 1ETWA 5DTDA 3IHUA 3FZVA 2LY1A 3L2CA 2N8GA 2ZSIB 3CCLI 3UKGA 4FASD 2ACJA 4A3FJ 3LSGA 2BGCA 2LYCA 2P5LC 4RB0A 1J2XA 3T0YA 1OPCA 1QZEA 4B47A 4J01A 1MBFA 2A6TA 5J47A 2XAQA 2ECBA 1MJAA 3K69A 4DBRA 1IXRC 1IV8A 3K4NA 1KYZA 2X6YA 3K4KA 2VJ4A 5EZGA 4ZYAA 3WHBA 2QKMB 2DMQA 1BI1A 1P6RA 3B6CA 1F1ZA 1JTYA 2PMZN 5IT3A 1MMAA 2LVSA 1XDUA 2JRMA 1VNDA 3TO6A 3ZQIA 3DPUA 4LG3A 1R1VA 1A6IA 4CCLA 5J6XA 1W7PB 2HDCA 1MJBA 5L3CA 5LEKA 2G9WA 3T1BA 1ZGWA 3ZRGA 1W7PA 2EV5A 2V1NA 3CCRI 4P96A 3FWEA 2MLGA 4CUGA 2Y9YA 2L7KA 2Y48A 5HLGA 2DMUA 2WAEA 5M5XJ 4EGYA 2LKPA 1H8AC 4MNUA 1IDZA 3E7LA 3HRSA 1IO2A 5M3MJ 2VUMJ 1B6AA 1KU3A 2KISA 2LH9A 1M1EB 2EA2A 2R3SA 1Y8QB 2FNAA 2EFNA 4G8XA 1Y8RB 4XRFA 2NYXA 3GTJJ 3CUQB 2NVQJ 4Y3OA 3VPRA 4A5NA 1RUOA 3HKZN 2R7WA 2ME6A 1FMVA 3MQ0A 1TBXA 3BR0A 4C3JJ 2ISYA 3I4MJ 5FLXZ 1O3RA 2VKDA 3O8GA 3H5NA 3FM5A 4JX5A 1GV5A 2NS8A 1YG2A 2EV0A 2DT5A 2IGNA 3G6EI 1FBQA 3HDDA 3GTPJ 2FEZA 3BJAA 1LKXA 2B0LA 4G94A 1MD0A 1R7JA 3CMAI 1B8IB 1JKPC 3K1NA 4IQ4A 1MMSA 4M9SA 1FBUA 3KP5A 3QAHA 4JYKA 3CCJI 2ICWG 4RB1A 1O4XA 1XPXA 2ZBKA 3J81Z 1X58A 2LRDA 2XDVA 3PO2J 2R7SA 3PIOF 3DV8A 1IN4A 1ZLJA 3WE2A 2J5OA 1YRNA 1L0OC 4MEYF 3K6GA 1RKWA 4HRIA 4XK4A 4D5FA 3K9TA 2ZXWH 3D0SA 2DFFA 4OMYA 2ZNYA 1GHCA 5HVQC 4I7HA 1A5JA 5JHUA 1CGPA 3BG3A 1IW7F 2FNPA 2GQQA 1WI9A 4PJ0C 2M87A 1ORKA 1UHWA 3BZ6A 1OCRH 3RQ4A 2VJ5A 1D8JA 2WY7Q 1AOYA 4D7MA 3BOQA 3QOPA 2MC3A 1J7KA 1FSEA 1WJCA 2CYYA 2R7XA 3DTIA 1S9HA 3KLOA 4A3MJ 2CO5A 3JRCA 4JBAA 2R7VA 2HOEA 1XGOA 1RNLA 2ELKA 5D6FA 3S16J 5DCMA 3BJ6A 3IH2A 4M72A 3EYIA 5CQEA 3SEZA 5EEHA 4CICA 4BKXA 1EH8A 1HQCA 2ZJQF 4F92B 3U1DA 4ZJZA 5DD8A 3D5RC 5C4XJ 2CFOA 3G71I 2DA7A 5ICCA 1XGNA 1VFCA 2NVYJ 4UXNA 4GO1A 3IRQA 2BVLA 1ZYRF 1LE8A 2Y30A 2QQBA 4M9ZA 2CS3A 3IAS2 3WTSC 1O7FA 4XN3A 5LD2C 2BBYA 2HOAA 3ELKA 3HUGA 1JJ8C 1WWXA 2IEKA 3CJRB 4MIMA 2QENA 3JCUC 1VTNC 2LMDA 5E17F 4BE1A 1V3FA 1XSVA 2Y0SN 2L9RA 1S8NA 1HKSA 1J75A 4HV6A 5KCMA 2JK3A 4OINF 4HF2A 1J09A 4KYWA 4G7ZF 2IS2A 2RVCA 1YHQI 4LLGF 3ASNH 2AS5F 3A2KA 5TJJA 3FISA 4FHTA 3HB9A 4HZFA 2XF7A 2CMPA 2D1HA 3CQZJ 2HYGD 2RAEA 3CMYA 2QLZA 1JGGA 2L9NA 4HNVA 3MZYA 4QTRA 1YTYA 3MKZA 3TP0A 1T98A 3MAJA 3HSEA 4AC0A 3GTQJ 4LK1F 1YI2I 4CGZA 1IAWA 4IX7A 4WCGA 3KZIC 3DKWA 4X1EA 2JMWA 1FZPB 5AONA 2WB1A 4NC7A 3TQNA 4AM3A 1P4XA 4NDLA 4RA2A 2OUMA 5IYDJ 4I01A 3HOVJ 4YIIA 1DUXC 3QYBA 3LMMA 1ZQ3P 1BR4A 1D3YA 1BOBA 3ABKH 5HODA 4LB6B 2CJJA 1FYLA 5K7FA 3ZQ7A 1I5ZA 1U6GA 2ELJA 1REPC 2MGQA 3HPHA 3WTTC 4UUSB 4UB6C 2HQ5A 1SFOJ 2Q1ZB 4UUSA 1KQ8A 1XB4A 4RBOA 1C0WA 2ZO4A 1DU6A 2ID6A 1UFMA 4V19K 2VJJA 4LLNA 2CFXA 2VQHA 1T08B 2JZYA 5F0CA 2JUCA 2GIZA 1SFEA 3HJEA 3EETA 4EATA 2DPUA 1LVKA 2A05A 3BQYA 3GZNB 3BC8A 3CZ6A 2CU7A 2ID3A 1FC3A 4L9TA 1VQOI 5FD5A 2GXAA 2O3FA 3JRBA 3NQOA 2NOJB 4I0AA 3HRUA 1G8XA 3BZCA 1IN8A 4P55A 4MHGA 4KNYA 4R1HA 3KPHA 2H1KA 2K9LA 2KDOA 3RPUA 4B09A 2M34A 1W36C 1OR7C 2GM4A 5GAGJ 2R7ZJ 4S05A 3ZQFA 3CJNA 1ZARA 1X4PA 5GTHC 2XB0X 1SD6A 3I71A 3OYLA 4IHSA 2DFHA 4PJLA 2G7UA 2HOTA 5IT9K 4K2EA 4L9VA 2LY9A 3L2VA 2R92J 1APLC 2YX7A 1FNNA 2EK5A 3OYDA 1LFBA 4FTHA 3OL3A 3IH4A 1RR7A 2R5ZA 2OC6A 2QYOA 3FBIB 3K1MA 3NWSA 1IXSB 4I98B 5IP7J 1E3PA 3AG1H 5L3FA 5D8LB 1WGXA 3CP8A 1UG2A 4A3IJ 3W2WA 1HW1A 5H2FC 4IL6C 4NQWB 4XL9A 5HS8A 2WWYA 3G73A 3DLLF 1VQ8I 1I3QJ 1VQ6I 4NQWA 4PFOA 4MTEA 1Z6RA 2XVCA 1KONA 3MN2A 1BBYA 1USSA 5B66C 2Y9ZA 1ITYA 1FYKA 3L9FA 4Y7NJ 2XIGA 4M3GA 1E0EA 1TWAJ 3N4MA 3S1RJ 4MLOA 1IRFA 5LGTA 2FUG2 4CCNA 3BR3A 2DA4A 5B1AH 4LITA 3KP4A 2BXZA 1HDPA 3V8LA 1SEUA 2V6EA 2GOMA 3P7NA 4G6DA 3U1KA 3CCUI 2JA5J 1ETQA 2DDAA 1SFUA 4A5MA 1E2XA 2R93J 3HRTA 2CQNA 2DA1A 2AO9A 4Q5SF 1NG7A 3BJOA 4XLFA 3QQAA 4G7HF 2LD5A 3RZDJ 3CDLA 5HNHA 2VQLA 5C3EJ 3H0DA 5J4YA 1K78B 4ESFA 3FDYA 2DYRH 4XORA 4DGWB 1K78A 3SJMA 3MWMA 2HWVA 3FKIJ 3BCBA 4ZDPA 2BW3B 1Y39A 5B5EC 2R7TA 1Z05A 1WI3A 4QWQA 5J3LA 2BW3A 1T56A 1K83J 2CUJA 1MMNA 4Q4ZF 3CMEI 3CESA 1K6YA 3DXJF 5FJ8J 1WRJA 2OF7A 5DM6F 1U0JA 2MLKA 1HCRA 3IP4B 1RESA 1SD5A 1TW3A 4Y13A 4XICA 3PNYA 2LREA 3V8KA 5GPAA 4BXFA 5HS9A 5F6FA 2VBZA 1Z6TA 3BLYA 3H1CA 5CJ9A 4BJ6C 2K5CA 4MFDA 4II3A 4AVPA 4FETA 2P6TA 2QQAA 2Y31A 3LAJA 2OQGA 5J8FA 2W4SA 1IXCA 4CXFA 2M5WA 3IL2A 2KIFA 3VEPA 1TWCJ 3EUHC 1BR2A 3OV8A 3QP6A 3KETA 2CW0F 3BP8A 2D1VA 1IGNA 4A0YA 2ADUA 3RKWA 4L9JA 2COMA 3V4GA 2MSYA 2CGPA 3H9GA 5E1ZB 3E5QA 1O57A 4AYBA 1NH3A 4L5JA 3TBIA 1A35A 4M73A 1UELB 1YS6A 3D5LA 3E3VA 3ZCOA 3I0TA 3JRIA 2NAZA 1ON2A 4U7BA 2L4MA 3DKXA 1ZRFA 3OS2A 4Y33A 5HDNA 1U3EM 2MABA 3MKLA 2ZXIA 4HG2A 3LNQA 1K7AA 3FXOA 3JTGA 3LA7A 5LGNA 1W7PD 5BQTA 2WAQA 2LP0A 2XB5A 3AAFA 4ZTJA 4BQAA 1S3JA 2K27A 2ME0A 3LQRA 2YSRA 2EFPA 2P8TA 4ETSA 2DAOA 2W84A 1PP7U 1IJWC 2HPMA 1MSEC 4KIFA 1MSFC 1KU9A 2M7AA 3PFYA 1F36A 5F0HA 2BVMA 1J0RA 2DFIA 3L1PA 3OYMA 3Q5FA 1PP8F 5B1BH 1IN7A 1H88C 2JTVA 3JTHA 3RTRA 3HZJA 1YS7A 3CO7C 2W25A 4IRGA 2KIUA 3ISPA 4PCQA 2JVGA 1VI0A 3PUFA 4MQVA 1W1WE 2PJRB 3WGGA 1GXPA 3WTWC 1MH3A 1AWCA 1Y1VJ 4EEFG 4FX4A 4LIUA 2JA2A 2W1OA 3BTLA 2EZLA 2L7FP 2O6GE 4A3KJ 1UMQA 2XGXA 1K4TA 3RYPA 5FLMJ 3HOTA 2V4JC 1D8KA 5FFXA 3QRFF 1PUEE 4DYCA 1HSJA 2X6OA 2HQRA 1X3ZB 4A3CJ 2WV0A 4U87A 4BBSJ 2WAFA 4JOMA 4V2FA 3KLNA 4DQ2A 4ZYHA 3A0HC 2EFOA 3SDGA 3QPLA 2LKSA 4G12A 3I54A 2Y2ZA 3ZQCA 1S7AA 1ZTRA 2QBYB 5D5WB 3GXOA 1BN5A 5B3SH 1ACIA 4B43A 5CQGA 4CA0A 2QBYA 4RGXA 3CCEI 3CC7I 3SDBA 4C3IJ 2W48A 3MZ8A 5BOXA 2HEOA 5BNGA 2K86A 3LSPA 2FU4A 3H3ZA 3ECHA 3KP7A 4A6DA 1QHGA 2H6CA 3RCOA 5FO5A 3BR1A 3P9KA 1W5TA 1IRXA 1KU7A 2YR2A 3E6DA 4MGRA 5K7HA 1TWGJ 3RKQA 2V9VA 2KP6A 3ZMDA 3HRMA 1X3UA 5CPRB 4F55A 1P4AA 2FX0A 2HQNA 2FJ1A 2VIXA 5HNFA 1CF7B 2KRHA 1UB9A 4HBLA 4Z2YA 3GZ6A 3W3CA 4CDGA 3L09A 5FD6A 1CF7A 2WC2A 3VWBA 1V5FA 2A6HF 2L4AA 3KP3A 1BJZA 5LRSA 5GAEJ 1TC3C 3SYTA 5CVRA 1SVOA 2VXZA 4UV9A 5DCFA 1BA5A 3ZMZA 3NRVA 3H3VK 2OZUA 2W57A 2UXXA 2XGEA 4M6VA 4NB5A 4KIGA 3WU0A 1VQ9I 1GLNA 2EWNA 2VB6A 1IZ1A 2IA0A 2XUBA 2J5PA 2ETHA 2FBIA 4BHCA 1ETOA 3HGGA 2PJPA 4Y4RA 2B63J 5KAIC 1RR8C 2RN7A 3GEZA 3IC7A 3GVAA 3HOZJ 4BDZA 3OS0A 3MVPA 4DOZA 3OYAA 3DKYA 1Y0UA 4HDUA 3EPZA 4XOTA 2FRHA 3FM3A 5EYRA 1OCCH 3QWLA 4I09A 3HBLA 2LY2A 4FQGA 4EJVA 1YJNI 2EH3A 4OU0A 2X4HA 1HW5A 1OMIA 2QCOA 3PM1A 4XLNF 1JI8A 1ZLKA 3F6OA 2MH2A 5H6RA 4LB5A 2A5WA 4OIRF 1A04A 4B8XA 3IKVA 1IV6A 1D1CA 5GTIC 4OIQF 3ZMTA 3WODF 3S8PA 2DT7B 1I27A 1FEXA 3FXRA 2H8RA 1SVMA 2G7HA 1HW2A 2KL4A 1V5EA 4OOIA 2VE8A 2HVQA 2OBPA 3HGYA 3P9CA 5D4SA 3QPHA 3ZGKA 1MJ9A 2JVHA 5BPIA 1BI0A 4ENNA 1WJFA 1ZGAA 5EJCA 3WE3A 3V8JA 3S1QJ 4RLFA 5LBQA 4I6ZA 3I4NJ 4EM1A 2DU9A 5DUIA 2P5KA 1RZ4A 2FBKA 1ZR2A 1ZG1A 1ZELA 2WB1N 3C2GA 4H4KC 5E1XA 3F8NA 3F8CA 2O03A 3F0CA 5KHDA 3S17J 1B72B 1X1CA 2VQCA 3GO5A 1FP1D 3I55I 4C2TA 5CLSA 3HSFA 1YO5C 1H89C 1ENHA 3BR6A 1KU2A 3GFJA 1B72A 5AIQA 3N05A 4KICA 1SMTA 2F4IA 4ON0A 1G4DA 1DU0A 2LC2A 4S0HB 5HLHA 3JSOA 1BIAA 2V6CA 4BYYA 1XMKA 4BS9A 5DUKA 5TRDA 2HDDA 1JKOC 5EGOB 5DS9A 3COAC 1MW7A 4FCYA 2DK8A 1FMWA 5EGOA 3ZR8X 4Q48A 1QZYA 4NC6A 3ECOA 1YJWI 4YFNF 4PJMA 2DTZA 4HEA2 2KKOA 2E5ZA 2COBA 4CCMA 3OR2C 3GYHX 4QLCU 3RPUD 5FKMA 3EUKL 3HOWJ 1QBJA 3LSKA 1OISA 1JTXA 4Y15A 1TTYA 1EKEA 3ULQB 2VKHA 4KMUX 3GZ5A 4CH7A 2F5DA 2QM3A 4HX8A 2BEOA 3OYHA 1N77A 4D0PA 4I2OA 2ESNA 3QODA 1GVDA 4X0GA 3HC7A 3OWTA 2HTSA 2L54A 3RSNA 3OIOA 4YEJA 3X2QH 4LD5A 3BG6A 3C3WA 4PUSA 4P1WA 3CO6C 1VQ7I 5IP9J 4NNJA 3M4OJ 2F48A 2ZC2A 4LLLA 1QO0D 3CC4I 3F21A 4EMSA 2F4OB 3FXKA 3PQJA 3OSGA 3T5XA 5CVJA 2EZHA 2P6SA 5ERIA 1R1UA 2YS9A 3JSPA 4XRSA 3LSRA 2V9PA 1OCZH 1FT9A 1R5GA 4E7KA 5IY5H 4DYQA 3M9AA 3CP2A 5JVTA 2Y0MA 1BW6A 2D45A 4YIRX 3A01B 2XKOA 3ONQA 1YRNB 2V1DA 4DJAA 4MEXF 2CV1A 4N9HA 3B6AA 3FHZA 4A3EJ 2XAJA 1J9IA 1GUUA 2PG4A 3TDZC 4AIDA 3A01A 2KT0A 1JKQC 2E1CA 3N97A 3IUOA 4JK1X 3O8HA 2JQ7A 4PZJA 2KZGA 4YIFA 4I0BA 3IV5A 2FE3A 3S2WA 3TW7A 3G2BA 3QU6A 2LG4A 4BU2A 2XPVA 1N78A 4JP0A 2E7WA 3M07A 3ZQHA 1K6OA 2F5VA 2K9QA 2VPRA 1ZG3A 4FE7A 1G6NA 1TT5B 2PQ8A 2JWTA 2K7LA 3K4MA 3FF5A 4IKFA 5LHIA 2FBHA 2UWMA 5DCMB 1EJ9A 4BL0B 4D5CA 4E7SA 1VF9A 1DDNA 5F0FA 1N75A 3IAM2 4HQEA 3MMYB 3FXUA 2XPUA 2QKLB 4KDPA 2G0EA 4NUBA 1R00A 2DJIA 1AU7A 1UZCA 4GYIA 1LE8B 5J40A 2CUFA 3LFKA 5E8GA 2BY3A 3BWGA 1A36A 2TRTA 4XLCA 2VT3A 4GGGA 5LFAA 3IWFA 4AD9A 1TNTA 3RJPA 1KGSA 3DTEA 3ERED 2XKPA 3HUGB 1MBHA 2JUGA 3O3KA 2XRNA 2QF7A 3DCFA 3GWZA 4R79A 2RNGA 3CTAA 3JW4A 3SXYA 3L2UA 2Z2SB 2XSJC 1G3YA 1S5LC 3PSFA 3NEUA 4UB8C 2A3SA 1BL0A 3GTKJ 2BV6A 3CLOA 4CO8A 4BQOA 4X6AJ 1Z7UA 1FWZA 5FLVA 3KZYA 4JX6A 1TLHB 4MO7A 2V79A 1O3TA 1ZKGA 2EB7A 2BY2A 3HXLA 4W1UA 3T8RA 2ISZA 2JT1A 2R5YB 2GIVA 3JRFA 3K4JA 2MC4A 3Q0WA 2K4JA 1X3WB 1FIAA 1VZ0A 2R5YA 4FISA 2UZKA 3LL7A 4F52A 1MZBA 3VFZA 3MKWB 1P4WA 3MZHA 3GTLJ 3GTMJ 3P5JA 4E7ZA 4HAMA 1QPIA 4B3AA 4BQQA 1XS9A 3T8TA 2E19A 2DXIA 2HKXA 3H0GJ 3KZZA 2ZJPF 4AYBN 3A0BC 2H8WA 1LPQA 1BC8C 1Q1HA 2VQGA 4M74A 2EA4A 2DFEA 3Q9VA 3OOUA 4DW6A 1KQ0A 2EFWA 3ABLH 3VYRB 3OS1A 2E71A 1FTTA 4NBQA 1SAXA 1SC7A 4A3DJ 4A3GJ 2DBBA 3TOBA 4XN0A 1FOWA 3R6SA 3PNTA 4EQQA 3K4BA 4MTDA 1MKMA 4ASNA 2KMUA 3JRDA 3AFHA 3MKYB 1JT0A 1WH7A 4WXHA 1B9MA 1KA8A 4C2MJ 5EEGA 4XM3A 2DCEA 5BMZA 2QWWA 2O8XA 2DMPA 4M6YA 4WXCA 4HLYA 1KZHA 3IRRA 5J1YA 2Z5UA 4E6KG 5J1RA 3OYGA 4XKBA 2FMLA 3TP3A 2MBFA 4HW0A 1H9TA 2IGOA 4ENJA 3SHFA 3Q0UA 2IP2A 2K9SA 4G6TB 4BACA 2A69F 1F43A 2RQPA 3SZGA 2HKOA 4Q47A 3K4CA 5FKLA 5LHHA 2MA3A 2IS1A 4FT8A 1D1BA 2IAIA 4C30A 2EINH 1NTCA 4N9IA 3ZMVA 1SD4A 5F08A 3S2DJ 2HZTA 3CCQI 3S2HJ 3OOPA 3DU5A 3W6JB 3TO9A 3ZN0A 2YU9J 2M30A 3G1OA 2VKVA 3LWFA 1FIPA 5IYCJ 3K7AJ 5FRNA 2EV6A 4RDUA 2HYFA 1IUFA 3HYIA 4A0ZA 1LNWA 1Z0XA 3FHNA 4ESJA 5E79C 3JREA 2Z1DA 4OIPF 5K5QA 1YYVA 1YIJI 1W0UA 4AWXB 2GZWA 2Z33A 1RIOH 4B48A 2RQQA 2LNBA 3G1LA 2BXYA 2IXSA 3REOA 4IXAA 1TP4A 4BJ5C 3GX4X 2R5ZB 2CUEA 2DOAA 3F6VA 4IPAA 3OIPA 4G6QA 5ILUA 3CCMI 2IJLA 2PX9A 5FROA 4I76A 1ZN2A 1USTA 3B02A 4BEHA 1D0XA 3ABUA 1AA7A 1WQ2A 1XGMA 2X6XA 2JSPA 4OMZA 5K7ZA 3LA3A 2E1OA 4U0VA 4BGDA 3I9V2 3LFUA 1F9NA 2LDUA 1BM9A 1TWHJ 3BR5A 4ZTFA 4GXOA 2H94A 3S1NJ 1WJ5A 2LR8A 4Z6YA 2R7QA 1R71A 4BDYA 1MBKA 3PJRA 2WTEA 3JRHA 4UUTA 1VQNI 2DA5A 4E7JA 4M3DA 1IG7A 2RDPA 4OIOF 1UCRA 1TNSA 1B4AA 3SZTA 4R8HA 5ICEA 3AL0B 2R0QC 1LUJB 1DPRA 2Q2EA 3VSLA 1T2KA 3BY6A 3CD6I 2D2WA 3K1PA 3VODA 2LF7A 3O6BB 5HLIA 2E1NA 4RM2A 5DD4A 3EQLF 2E2JJ 1V55H 3ML6A 3LAPA 2EQRA 1FY7A 2FQ3A 5FLXK 2VT2A 3K10A 3JRGA 4U0YA 1Y6IA 4OAYA 4J00A 3H9QA 1MNEA 1WCMJ 1R1TA 2TCTA 4ZDOA 2ZJ2A 3VYTB 2V7FA 2QSGX 2JA6J 1QPMA 4WXDA 1UAAA 3TO7A 4ANJA 3E6CC 3OYNA 1ZR4A 2DLLA 2NVTJ 2GBYA 3RQIA 3VSKA 1ZRDA 2XAHA 1FX7A 2EBIA 2OJED 4HF0A 5F1RA 1TT0A 3GBGA 2I8DA 4KT6A 2ZFWA 2LOOA 1XN7A 3K0LA 3J81K 4BY1J 2LSOA 1LDDA 3OYBA 3FMRA 3D1NI 5ICFA 2DA3A 2L0KA 3RKYA 2NRAC 4CZZA 4D1QA 4UY8I 1ZG5A 4B44A 3G1MA 1W0TA 1P2FA 2DJNA 2QVOA 2HFHA 1FOKA 1FLIA 1B1BA 2E35A 3TEDA 2OZ6A 2W24A 5L3DA 4L0ZB 3CCVI 3QP5A 4KA4A 3S1MJ 2IW5A 1YIOA 3QPTA 2UV1A 3QOEA 1FJLA 2DN0A 4IJAA 4L5IA 1DPUA 4ITVA 1V4RA 2A6EF 3BG9A 3WTZA 2RV8A 2WV1A 5H20A 2F5FA 2ZMEA 4A2UA 5EEAA 3K2ZA 3PFIA 2CQ7A 2XF5A 3QYEA 2XAUA 4DIQA 2JA8J 3EUAA 1XD7A 2B7EA 4OAZA 2X6WA 2Y0SA 3WG7H 1ETKA 2DT6A 1UHSA 2DPDA 1I6HJ 3Q3SA 3K70D 3E97A 2PI0A 4NHJA 4ZYGA 2FD5A 1EH6A 3F23A 3LOCA 1E17A 2KLOA 2OTLI 1YW8A 4L9NA 4RGUA 3EYYA 3ZXSA 3TL4X 1RUNA 2L7MP 3Q0VA 4IHWA 3M3YJ 1TWFJ 2KQRA 4PSXA 1SANA 4P9FA 3H5AA 3U9GA 4RAFA 4IF4A 2YX4A 3L2WA 2K40A 1K79A 1E3OC 4KUMA 4V2GA 3L2QA 1SMYF 4EJWA 3V7RA 4A6EA 3TMOA 1OCTC 5IYBJ 4NC8A 2AQFA 2KRCA 2JN6A 1S7EA 3K2AA 4RB2C 1OJLA 3WTUC 5LEJA 1ON1A 1K4SA 1MH4A 1XGSA 4CCOA 2PEXA 2CQXA 5E20A 4CHUA 1I6XA 3DWLE 4BHPA 3HHGA 2GA1A 2X1EA 3M8FA 2VE9A 4M71A 1HOMA 1BR1A 2Q8KA 1Z67A 3DEUA 1R58A 2FMYA 4A3BJ 1G3WA 4HDVA 2VI6A 4O5VA 2R4GA 1OYWA 5FFZA 4B1RA 2XAGA 4XKCA 1G2HA 3SFIA 2DOFA 5ILSA 3DP7A 1YW7A 3OYEA 3K70C 3L2RA 3M8EA 1Z1DA 2UXNA 4IQJA 1XMAA 5EZHA 3SQNA 5K5OA 1U2WA 3E6BA 2CWEA 1XCBA 3CJQB 2DA2A 2W85A 3JAMZ 4G7OF 3FXJA 2K4BA 2BHYA 3I53A 2NVXJ 3ZMUA 2XAFA 3DPTA 3TKYA 2E2IJ 3WHCA 3LSIA 2XSDC 1HC8A 1EH7A 2PN6A 2VBWA 1IUYA 3ROUA 3GUDA 4ZYDA 1STZA 1Z3YA 5JVGF 1ZGJA 5FGMA 2F6CA 2HYJA 1OYYA 3V7CA 2L01A 1I1SA 5LGUA 1DGRM 2HI3A 3MFKA 1X19A 1UHMA 3BCAA 1BI3A 3GFLA 3ZN1A 1IC8A 2HNHA 2WBMA 3V42A 2O0YA 3NARA 1AHDP 3GTOJ 2M3AA 3BG7A 2EPFA 3CMMA 4KN4X 4BHBA 2V1XA 4HF1A 5DYMA 2H27A 1QRYA 2M4GA 4DBQA 1FTZA 1W5CC 5CYVA 2WADA 2ELHA 4XONA 2XHKA 1G3SA 3ZP5A 4KISA 1R5HA 2HDWA 3PL8A 4PGGA 1MIJA 2EZKA 1QNTA 1T0FA 4XRSG 4M6XA 3OYKA 4YRVA 3RDIA 4IEJA 1QVUA 2L7ZA 3H9JA 2MYSA 3GLXA 1DGWY 2P7CB 3K4LA 2X9DA 1AKHB 5J4VA 3I56I 2DYSH 2VC1A 1R4MB 3LSTA 2M9HA 2L9VA 5ICGA 2F2EA 1YW9A 3CLQA 2GXGA 2XGCA 1AKHA 3JR9A 3OYIA 2O8KA 2X48A 4XLAA 3FBNB 1POGA 4HSRA 9ANTA 2Z3YA 4HLXA 2JPBA 4IRIA 3GLLA 4M3EA 2IS6A 3EUHA 1ULYA 4LJZF 2CV2A 1NHAA 4DZPA 2IA2A 2Z9OA 2F5EA 3SZPA 1Q1VA 3H36A 3W2AA 2QA4I 4OWRB 2L9SA 4CYCA 3FK6A 2W7NA 4XNFA 1OQYA 2RREA 3FMQA 4I99C 3G3ZA 2EIKH 3M8JA 2E2HJ 2XV4S 3HOXJ 4YFXF 1LDJA 1LQ1A 4LK0F 5F27A 1ETXA 5K5RA 1OLTA 1XG1A 1IRZA 2LKXA 2TDXA 5JFRA 2VN2A 1RPWA 2JSCA 2I5UA 5E3OA 3NAUA 1XTAA 4RM3A 1I50J 5E8IA 2EJRA 1QHHD 1QVTA 1S6LA 4KN7X 5TGTA 5D4RA 2ZFUA 1WJDA 5FRMA 2FOWA 2LBFB 2IT0A 3VOEA 1S7OA 4QPOA 3F72A 1XSDA 2DW4A 2LBFA 1F4KA 2H6BA 5GAHJ 3CC2I 4C2UA 3BTIA 1EF4A 1Z9CA 4ESBA 3BQZA 3W2VA 2NNNA 2MD5A 1PYVA 3M1EA 1ETYA 5FKOA 3U2RA 4WK8F 2DODA 3A03A 1U78A 4UVCA 2VLAA 4E7HA 3J7AO 4LFUA 2O9LA 3CCYA 1X1DA 3VB2A 3OIQA 4E4HA 1SFKA 3I3LA 3HIFA 5IT9Z 3DBRB 4IHYA 4BXUA 4BY7J 2KJBA 1MBGA 3H5RA 5E1WA 4LG0B 1OYIA 2BHZA 2XRLA 3AG3H 5C44J 4U0WA 3BPXA 4LG0A 5DV5A 3KCCA 3L00A 1LEBA 3CUOA 3TOAA 5LLQA 2JJ7A 3PIPF 1OCOH 5D8KB 2KIQA 1T8IA 1S29A 4C3HJ 1U5TB 1LJ9A 5A2QZ 2E36A 3DBHB 4FE4A 2BZTA 3DQVC 3WTXC 1U5TA 2M4KA 4QPQA 4KIBA 2M8GX 3H3UA 4H0EA 4A93J 2DOEA 3FXQA 3RI4A 4RB3C 2XASA 2CW8A 2OQRA 2K3FA 4TV7A 2ESHA 1FSHA 2EIMH 3F3XA 4WX9A 5EDNA 3EDPA 1VQPI 2PMUA 1HDDC 2KHMA 1BC7C 4GDFA 1Y56A 3LSHA 3L7WA 1P7JA 5D5XB 3CUQA 2QGUA 2MH9A 4O6JA 1R4NB 1BIBA 3G4SI 2OPTA 4PSWA 1RRJA 4IOCF 3PUBA 3OY9A 1HXDA 1HA8A 3BTJA 2EZIA 2AHQA 4ENKA 4RLQA 2MG4A 2FF4A 2VC0A 3HPGA 2A61A 4RS8A 1BOAA 3J80Z 3BT9A 2FA5A 4HOBA 2L02A 1UG0A 3PSIA 1B8IA 1TW2A 4WWCA 5E3NA 2LFBA 2Y69H 4JX4A 4N4OB 4D9JA 4JQFA 2MFZA 1P92A 2ZJRF 1W4MA 3I4PA 2ZXHA 1RI7A 2V1UA 3BR2A 1MMDA 2M8EA 3ESWB 4PFPA 1RC9A 2KIMA 1YFHA 2QZ8A 1T95A 2HOSA 4ZZLA 2NNYA 2KDZA 2EIJH 6PAXA 3E5UA 3KX2A 1W5SA 3VYSB 2VODA 2XC7A 2CG4A 2CH0A 3P9IA 3FXLA 1GDTA 1ETVA 1OCPA 4AU7A 2RC4A 3KEQA 2M45A 1F5TA 3H35A 1D1AA 5F64A 1DQUA 3DF8A 3F22A 2DQRA 3TDUC 2P81A 1JJ6C 4BXXJ 3JAMK 1YITI 1HF0A 3LSMA 1SVLA 2VKEA 2E1MB 5E18F 1PVEA 2JA7J 4F7ZA 2RNJA 3OYCA 3QYFA 5D5UB 4J19A 3GTGJ 2WA0A 4II2A 2DK5A 5ILVA 1JHFA 4AVZA 3GW2A 4P5OA 2GLOA 2OCCH 2CV0A 2OAZA 4N0BA 4MFEA 1X2MA 1G3TA 1LDKB 3FK7A 3RPQA 2A5YB 1JT6A 1YQAA 1R9TJ 2HPIA 3WGIA 2K9MA 2NXNB 3CJTB 3S15J 3C18A 5M3FJ 3AL0C 2M0CA 2M7BA 3KYCB 2X1DA 1IN5A 4I02A 5K1YA 1BW5A 2GWRA 3FKJA 1R6RA 1ZH5A 3C2BA 4XR6A 1I3AA 4AIHA 1L3LA 2K85A 4P9UA 3CDIA 2DTRA 4AIKA 2BY0A 3J7AY 2KPMA 2OTJI 3DBLB 4EJUA 3BDDA 2X0LA 4XQFA 2L3DA 4DZJA 1ZK8A 2MW8A 2ZXJA 3OL4A 3CDHA 2BYVE 5KNLA 4RGRA 1WPKA 4E7IA 2E60A 1PDNC 2VJIA 1QZZA 2IA1A 1QQIA 3OSFA 4BNCA 2X85A 4L5EA 2XROA 2K3PA 1Y1WJ 1MNMC 4QIWN 3GFIA 3FX3A 2WAQN 4GRIA 5J8CA 4UUVA 2PBIA 4RMNA 3HOUJ 2O61A 1J5YA 2Z16A 2QSHX 2CRGA 3S3NA 1R5ID 2X1CA 4L0YB 1PJRA 4QSHA 2CQKA 1W36D 1FBSA 3SEQA 2GAUA 2IGMA 1NG6A 4M3BA 1PUFB 2VOPA 1V5GA 2STTA 2VL8A 3OYFA 5DEQA 1PUFA 4KJZA 4ZC3A 3HL2A 2NS7A 3RKXA 1SAUA 1T6SA 2ZMEC 4LOCA 5L3GA 3AG2H 4BE2A 3AKZA 1D0ZA 1JUMA 5DDGA 3KP2A 3E6MA 4HNUA 2R7RA 4LGWA 2IVMA 1I1GA 3R61A 2FSWA 3BZKA 2IRFG 3S14J 4YFKF 3MD2A 2PMZA 2KZVA 4XOPA 1FPQA 2LK2A 3I59B 1NK3P 3ASOH 2HXIA 1YOVB 4IOAF 3I59A 1JXSA 1CQTA 3UNGC 4E7LA 5L3EA 2IGKA 4CYDA 5LHGA 1D5YA 2K9NA 1MNDA 2KRFA 1O3QA 1LFUP 2I10A 4MQ9F 3S3MA 2HR3A 3DFGA 1NK2P 3FXMA 1XCVA 3JRAA 3WGHA 1SD7A 2FOKA 3M1CA 5J1UA 3GF2A 3HHHA 4XRMA 3WTYC 2B9SA 3WU2C 2NS0A 4Y17A 1ERDA 4XLEA 2DO7A 4IHTA 2F4MB 3KP6A 2RGVA 2LF8A 4BEHB 1D5VA 2HZDA 4A3LJ 5BS6A 3H92A 1LVAA 2CW7A 2VBXA 3HKZA 3F8MA 2ZNZA 4GYGA 5JLXA 4HA8A 1VQ5I 1A6QA 3I58A 3OMYA 1KYWA 3F9KA 3KE2A 4G9YA 1JGSA 4ABZA 2HS5A 1U9OA 5IOYA 3J7ZI 3C7JA 1WHUA 4XIDA 2ZCWA 3F8FA 4BUPA 2PLYA 1WJAA 1MBJA 4CCJA 3RIRA 4DYRA 4UV8A 4B3XA 3M7GA 4F3QA 2V26A 5H6QA 2P5VA 5D5VB 1BI2A 2Q2EB 1Z77A 2DI3A 2XPWA 1WVRA 5GADJ 3O2PE 1ONVA 2R7DA 2Y75A 4BQNA 3QU3A 2HXOA 5A2QK 1GXQA 1WJBA 4EM2A 1GVJA 3U21A 1T33A 4IVNA 1EV7A 4UHTA 1EA3A 1ODDA 1HBXG 4Y52J 2OV7A 4FX0A 4HSTA 5JHFA 5JLWA 3CCSI 1XX5A 3C2HA 5KAFC 1Z91A 2LTPA 1X4OA 2Q0OA 4XSZF 5AIPA 1V54H 3NWTA 1MDMB 3KEYA 3QPSA 2HGCA 1YLFA 4AIJA 1XSXA 1B9NA 1MDMA 3R4KA 1MMGA 1UJ8A 3ZQLA 4BH9A 3SFZA 1YX5A 2CUZA 1FP2A 3BTCA 4CCKA 2K02A 2QUFA 2HQAA 2ZB9A 1JKRC 3R0AA 4S04A 1K61A 3BROA 1JUPA 1XDSA 5IP6A 1D0YA 4ENMA 3J80K 5FKNA 4UVBA 4C9YA 1RETA 3ZPLA 1VQMI 1TL8A 3A1YA 5DM7F 4UNOA 1QGPA 1T0FC 3B73A 2VASA 2YU3A 5HS7A 3D5SC 2ZMEB 1P7IA 3S32A 2QQ9A 1SFXA 4U7DA 2OA4A 3ABMH 3KYLA 4XKVA 4XLHA 3DTKA 2HVSA 4D7NA 2OU2A 3MCZA 2W00A 1DP3A 1TZLA 1IDYA 1DP7P 2AQEA 1WH5A 5C4JJ 1FOXA 4PJNA 3R0JA 2P4WA 2ZKZA 2JPCA 3A02A 3DEWA 3HEFA 3CF2A 4GCVA 2R7FA 2A07F 2X51A 1IN6A 2QQ8A 3FMSA 1YJ9I 3ZQGA 2BOLA 4CZCA 2VBYA 4IRHA 1ZAOA 4KFCA 3ZOBA 2E7XA 2QEXI 1Z3XA 4EV0A 2DDBA 3KEOA 1TQPA 5FB2A 1H0MA 2CSOA 2HTJA 2ZSHB 3VDXA 3PNVA 1LEAA 2HVRA 2XF6A 3GFMA 1LB2A 1IF1A 1YE9A 3LQQA 4HYEA 4RAZA 2FXAA 4N4NB 3J7YJ 2EFQA 1X1AA 4HX4A 4XKWA 4XBFA 3HG9A 3ZMSA 2VPLA 1RKTA 5CKTA 2W82A 4YG2F 3LA2A 5M5YJ 5TISC 5FKKA 3HOSA 5E3LA 4EGZA 4LMYA 1JE8A 1HSTA 4GFBA 1T39A 5HDGA 1OR7A 4HNTA 4PK4A 2PFBA 2OD5A 1X1BA 2H1LA 3TW6A 5KK1A 1A31A 4XLPF 2Z99A 1U8BA 2P0WA 4IZZA 4XSXF 1P9QC 3E0JB 4KITB 1R49A 1QA6A 2QSFX 2VXDA 1LFPA 3AG4H 4PGHA 1TQMA 3R60A 4AUXA 5IPAA 2LLKA 2YUSA 3DU6A 3WU1B 5IOZA 4A12A 3IH3A 2DQLA 1ZRCA 2L5QA 2R7OA 3ABTA 3LSJA 1T38A 3A4CA 2BE5F 3DLAA 2IBDA 5CVUA 2PJRA 1KQ9A 1G59A 3Q9SA 1U8RA 4PJJA 2GXBA 2R7UA 2C6YA 2E34A 1R23A 1E3HA 4F93B 3W6VA 2PMHA 3FIWA 1BJAA 4IHXA 4HPQA 3RYRA 5F1JA 1XC5A 3E5XA 4L18B 3HM5A 3OR1C 2P7VB 1WFXA 4RAGA 5KVRA 2JRTA 2HU9A 1Y0NA 4BE0A 1Z7LA 1MBEA 1O7LA 5CVIA 4ZZDA 5L3BA 2FQ4A 3I64A 2L2OA 2M2EA 3DPLC 2M0MA 5LRRA 4A69C 4XMYA 4B4CA 5GPCA 1WZ2A 5F04A 1VQKI 2YPRA 4BAYA 2F5CA 4W97A 5GP9A 1U5TC 1HKTA 3GCMA 4RAYA 4YELA 4UVAA 2DA6A 4M3FA 5D6EA 5EF6A 5JI6A 1JUSA 2H09A 5M5WJ 3IWZA 3CF5F 5HLTA
chains in the Genus database with same CATH topology
4A93J 3JRDA 1JT0A 1WH7A 5FJ8J 2NOGA 5EG0B 4C2MJ 3PO3J 2OF7A 3RZOJ 1HCRA 5EG0A 2DMPA 5EDNA 1GT0C 1RESA 4XICA 2CQQA 5J1YA 1HDDC 5J1RA 5GPAA 1U9NA 1P7JA 3TP3A 3BG5A 2OPTA 3Q0UA 4MFDA 2K9SA 4IHVA 1F43A 2Y31A 3BTJA 2EZIA 2AHQA 5FKLA 2MG4A 1TWCJ 2IAIA 1IGNA 1NTCA 1OFCX 3BT9A 2MSYA 2DMNA 5F08A 3S2DJ 1B8IA 3S2HJ 2ECCA 5E3NA 2YU9J 2LFBA 4JX4A 3G1OA 5IYCJ 2VKVA 1FIPA 4CYCB 3K7AJ 3JRIA 4RDUA 1IUFA 3BR2A 1Z0XA 2DMTA 2XGDA 3JREA 3MKLA 3LNQA 1W0UA 2HOSA 5E3MA 2KDZA 4BBRJ 2LP0A 2XB5A 3G1LA 2ME0A 1GV2A 1GDTA 1ETVA 1IJWC 1OCPA 1MSEC 2R5ZB 2CUEA 1MSFC 4A3JJ 5F0HA 1F36A 2P81A 4I76A 1JJ6C 4BXXJ 1X2NA 3L1PA 1HF0A 2VKEA 1H88C 2D5VA 2JA7J 1HLVA 3GTGJ 4J19A 2O7OA 5K7ZA 2GLOA 3HOYJ 2E1OA 1VI0A 1ETWA 4MFEA 5DTDA 1X2MA 1MH3A 1TWHJ 3BR5A 1Y1VJ 3S1NJ 4EEFG 2LR8A 3FK7A 1JT6A 2N8GA 1R9TJ 1MBKA 3UKGA 3JRHA 4UUTA 2DA5A 4A3FJ 3S15J 3BTLA 3LSGA 4M3DA 2EZLA 5M3FJ 1IG7A 2M0CA 2L7FP 4A3KJ 1BW5A 1UMQA 2R0QC 1MBFA 3C2BA 2ECBA 5FLMJ 5EZGA 3WHBA 4DYCA 2DMQA 2X6OA 2E2JJ 3B6CA 4A3CJ 1JTYA 2PMZN 4BBSJ 2EQRA 2LVSA 4V2FA 1VNDA 3JRGA 3ZQIA 3SDGA 3QPLA 4G12A 1A6IA 1ZK8A 2MW8A 4DZJA 2Y2ZA 3ZQCA 1WCMJ 1WPKA 1ZTRA 2TCTA 1ZGWA 2JA6J 1ZR4A 2NVTJ 2GBYA 3RQIA 4C3IJ 3OSFA 2W48A 2Y9YA 5BNGA 2EBIA 4L5EA 3LSPA 2DMUA 5M5XJ 1Y1WJ 3GBGA 4QIWN 1H8AC 1MNMC 1IDZA 3E7LA 5M3MJ 3BR1A 4BY1J 2WAQN 2VUMJ 3HOUJ 3D1NI 2CRGA 5K7HA 2DA3A 2L0KA 1TWGJ 3RKQA 3G1MA 1W0TA 4QSHA 2DJNA 3GTJJ 3TEDA 2FX0A 4M3BA 2FJ1A 2NVQJ 3VPRA 1PUFB 3HKZN 2ME6A 3BR0A 4C3JJ 3S1MJ 3I4MJ 1PUFA 3O8GA 1FJLA 4JX5A 2NS7A 1BJZA 2DN0A 4LOCA 1GV5A 2NS8A 1TC3C 1JUMA 1BA5A 3BG9A 3HDDA 3GTPJ 3H3VK 2WV1A 4M6VA 2XGEA 5EEAA 3S14J 1B8IB 1JKPC 2JA8J 4JYKA 1ETOA 2LK2A 3HGGA 2B63J 1NK3P 1ETKA 1O4XA 1UHSA 2HXIA 3HOZJ 1I6HJ 1X58A 3Q3SA 3PO2J 3MVPA 2FD5A 3LOCA 1CQTA 5EYRA 1YRNA 3M3YJ 1D5YA 3HBLA 2K9NA 2L7MP 3Q0VA 4IHWA 1TWFJ 1RKWA 1SANA 4XK4A 1LFUP 2EH3A 4D5FA 2I10A 3PM1A 2QCOA 1NK2P 2K40A 3JRAA 1E3OC 1A5JA 4V2GA 5J1UA 4XRMA 3BG3A 1IV6A 1ORKA 1OCTC 5IYBJ 1FEXA 2H8RA 4D7MA 4A3LJ 2JN6A 1S7EA 3K2AA 1OJLA 5JLXA 3HGYA 4A3MJ 3JRCA 1MH4A 2ELKA 2CQXA 3S16J 3IH2A 1T56A 4ABZA 1U9OA 5IOYA 3S1QJ 4I6ZA 4BKXA 3I4NJ 4XIDA 1HOMA 1MBJA 1ZR2A 4A3BJ 2WB1N 4DYRA 5C4XJ 2VI6A 2DA7A 3F0CA 4B1RA 3S17J 1VFCA 2NVYJ 1B72B 1G2HA 1Z77A 3SFIA 1LE8A 2XPWA 2Y30A 1H89C 1ENHA 3BR6A 1B72A 2HXOA 5EZHA 2HOAA 1JJ8C 2IEKA 1DU0A 1T33A 2DA2A 4S0HB 4MIMA 4Y52J 5JLWA 2NVXJ 2Y0SN 2L9RA 2HDDA 2LTPA 5EGOB 3WHCA 5DS9A 2JK3A 2XSDC 1JKOC 2E2IJ 4FCYA 5EGOA 3QPSA 2HYJA 3FISA 2DTZA 3ZQLA 3HB9A 2HI3A 3CQZJ 2RAEA 2COBA 3CMYA 1JGGA 4HNVA 1IC8A 5FKMA 3HOWJ 3BTCA 4QTRA 3TP0A 1JTXA 4AC0A 2ZB9A 1JKRC 3GTQJ 1K61A 3NARA 1AHDP 3GTOJ 1JUPA 4X1EA 1GVDA 2JMWA 5IP6A 5FKNA 3OIOA 1QRYA 4NDLA 1RETA 1FTZA 5IYDJ 3HOVJ 5IP9J 1ZQ3P 3M4OJ 5HODA 2CJJA 1P7IA 5K7FA 3OSGA 2MGQA 2EZKA 4UUSB 2EZHA 4XRSG 2HQ5A 4D7NA 2YS9A 1SFOJ 4XRSA 1IDYA 3LSRA 4UUSA 4IEJA 1QVUA 4DYQA 1WH5A 4RBOA 2L7ZA 5C4JJ 1BW6A 1DU6A 2ID6A 3A02A 3A01B 2X9DA 3DEWA 3HEFA 1AKHB 1YRNB 4A3EJ 3B6AA 2M9HA 5F0CA 1GUUA 3A01A 1JKQC 2XGCA 1AKHA 2KT0A 3ZQGA 3JR9A 2O8KA 2X48A 3O8HA 3BQYA 3ZOBA 1POGA 9ANTA 2CU7A 2ID3A 3IV5A 4M3EA 3TW7A 3JRBA 2XPVA 4JP0A 3ZQHA 4DZPA 1Q1VA 2K9QA 2VPRA 4FE7A 2H1KA 4CYCA 3FK6A 2JWTA 2M34A 1RKTA 2GM4A 2R7ZJ 2E2HJ 3ZQFA 5M5YJ 5FKKA 3HOXJ 5E3LA 4D5CA 5F27A 1VF9A 4GFBA 1ETXA 5F0FA 1XG1A 1IRZA 2XB0X 2LKXA 3TW6A 2XPUA 1RPWA 2HOTA 5E3OA 1U8BA 3NAUA 2LY9A 2R92J 1I50J 2G0EA 1APLC 1QVTA 1LFBA 4FTHA 1AU7A 3IH4A 1RR7A 2R5ZA 1LE8B 5IP7J 2CUFA 4AUXA 5IPAA 2LLKA 2YUSA 2TRTA 1WGXA 4A3IJ 1UG2A 5IOZA 3IH3A 1MBHA 3BTIA 1EF4A 3BQZA 3LSJA 1I3QJ 2QF7A 3DCFA 2IBDA 1ETYA 3MN2A 5FKOA 2Y9ZA 1ITYA 3A03A 1U78A 4Y7NJ 4M3GA 1BL0A 3W6VA 1TWAJ 3GTKJ 3FIWA 3S1RJ 4MLOA 2O9LA 4X6AJ 4IHXA 5FLVA 3CCYA 3BR3A 4JX6A 2DA4A 4MO7A 5F1JA 1ZKGA 1XC5A 4W1UA 1HDPA 2R5YB 3HM5A 3JRFA 3Q0WA 2JA5J 1FIAA 1ETQA 4IHYA 2R5YA 4FISA 2R93J 3GTLJ 1MBEA 3GTMJ 4BY7J 1MBGA 2DA1A 2AO9A 2XRLA 2FQ4A 1QPIA 4B3AA 3QQAA 1XS9A 5C44J 2E19A 2M2EA 5GPCA 3H0GJ 3CDLA 4B4CA 4A69C 2LD5A 3RZDJ 4AYBN 5C3EJ 5F04A 3OOUA 2JJ7A 4DW6A 4W97A 5GP9A 4C3HJ 3SJMA 3FKIJ 2DA6A 4M3FA 1FTTA 5EF6A 4A3DJ 4A3GJ 1JUSA 4FE4A 1WI3A 5J3LA 5M5WJ 2M8GX 1K83J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A93 J;  3JRD A;  1JT0 A;  1WH7 A;  5FJ8 J;  2NOG A;  5EG0 B;  4C2M J;  3PO3 J;  2OF7 A;  3RZO J;  1HCR A;  5EG0 A;  2DMP A;  5EDN A;  1GT0 C;  1RES A;  4XIC A;  2CQQ A;  5J1Y A;  1HDD C;  5J1R A;  5GPA A;  1U9N A;  1P7J A;  3TP3 A;  3BG5 A;  2OPT A;  3Q0U A;  4MFD A;  2K9S A;  4IHV A;  1F43 A;  2Y31 A;  3BTJ A;  2EZI A;  2AHQ A;  5FKL A;  2MG4 A;  1TWC J;  2IAI A;  1IGN A;  1NTC A;  1OFC X;  3BT9 A;  2MSY A;  2DMN A;  5F08 A;  3S2D J;  1B8I A;  3S2H J;  2ECC A;  5E3N A;  2YU9 J;  2LFB A;  4JX4 A;  3G1O A;  5IYC J;  2VKV A;  1FIP A;  4CYC B;  3K7A J;  3JRI A;  4RDU A;  1IUF A;  3BR2 A;  1Z0X A;  2DMT A;  2XGD A;  3JRE A;  3MKL A;  3LNQ A;  1W0U A;  2HOS A;  5E3M A;  2KDZ A;  4BBR J;  2LP0 A;  2XB5 A;  3G1L A;  2ME0 A;  1GV2 A;  1GDT A;  1ETV A;  1IJW C;  1OCP A;  1MSE C;  2R5Z B;  2CUE A;  1MSF C;  4A3J J;  5F0H A;  1F36 A;  2P81 A;  4I76 A;  1JJ6 C;  4BXX J;  1X2N A;  3L1P A;  1HF0 A;  2VKE A;  1H88 C;  2D5V A;  2JA7 J;  1HLV A;  3GTG J;  4J19 A;  2O7O A;  5K7Z A;  2GLO A;  3HOY J;  2E1O A;  1VI0 A;  1ETW A;  4MFE A;  5DTD A;  1X2M A;  1MH3 A;  1TWH J;  3BR5 A;  1Y1V J;  3S1N J;  4EEF G;  2LR8 A;  3FK7 A;  1JT6 A;  2N8G A;  1R9T J;  1MBK A;  3UKG A;  3JRH A;  4UUT A;  2DA5 A;  4A3F J;  3S15 J;  3BTL A;  3LSG A;  4M3D A;  2EZL A;  5M3F J;  1IG7 A;  2M0C A;  2L7F P;  4A3K J;  1BW5 A;  1UMQ A;  2R0Q C;  1MBF A;  3C2B A;  2ECB A;  5FLM J;  5EZG A;  3WHB A;  4DYC A;  2DMQ A;  2X6O A;  2E2J J;  3B6C A;  4A3C J;  1JTY A;  2PMZ N;  4BBS J;  2EQR A;  2LVS A;  4V2F A;  1VND A;  3JRG A;  3ZQI A;  3SDG A;  3QPL A;  4G12 A;  1A6I A;  1ZK8 A;  2MW8 A;  4DZJ A;  2Y2Z A;  3ZQC A;  1WCM J;  1WPK A;  1ZTR A;  2TCT A;  1ZGW A;  2JA6 J;  1ZR4 A;  2NVT J;  2GBY A;  3RQI A;  4C3I J;  3OSF A;  2W48 A;  2Y9Y A;  5BNG A;  2EBI A;  4L5E A;  3LSP A;  2DMU A;  5M5X J;  1Y1W J;  3GBG A;  4QIW N;  1H8A C;  1MNM C;  1IDZ A;  3E7L A;  5M3M J;  3BR1 A;  4BY1 J;  2WAQ N;  2VUM J;  3HOU J;  3D1N I;  2CRG A;  5K7H A;  2DA3 A;  2L0K A;  1TWG J;  3RKQ A;  3G1M A;  1W0T A;  4QSH A;  2DJN A;  3GTJ J;  3TED A;  2FX0 A;  4M3B A;  2FJ1 A;  2NVQ J;  3VPR A;  1PUF B;  3HKZ N;  2ME6 A;  3BR0 A;  4C3J J;  3S1M J;  3I4M J;  1PUF A;  3O8G A;  1FJL A;  4JX5 A;  2NS7 A;  1BJZ A;  2DN0 A;  4LOC A;  1GV5 A;  2NS8 A;  1TC3 C;  1JUM A;  1BA5 A;  3BG9 A;  3HDD A;  3GTP J;  3H3V K;  2WV1 A;  4M6V A;  2XGE A;  5EEA A;  3S14 J;  1B8I B;  1JKP C;  2JA8 J;  4JYK A;  1ETO A;  2LK2 A;  3HGG A;  2B63 J;  1NK3 P;  1ETK A;  1O4X A;  1UHS A;  2HXI A;  3HOZ J;  1I6H J;  1X58 A;  3Q3S A;  3PO2 J;  3MVP A;  2FD5 A;  3LOC A;  1CQT A;  5EYR A;  1YRN A;  3M3Y J;  1D5Y A;  3HBL A;  2K9N A;  2L7M P;  3Q0V A;  4IHW A;  1TWF J;  1RKW A;  1SAN A;  4XK4 A;  1LFU P;  2EH3 A;  4D5F A;  2I10 A;  3PM1 A;  2QCO A;  1NK2 P;  2K40 A;  3JRA A;  1E3O C;  1A5J A;  4V2G A;  5J1U A;  4XRM A;  3BG3 A;  1IV6 A;  1ORK A;  1OCT C;  5IYB J;  1FEX A;  2H8R A;  4D7M A;  4A3L J;  2JN6 A;  1S7E A;  3K2A A;  1OJL A;  5JLX A;  3HGY A;  4A3M J;  3JRC A;  1MH4 A;  2ELK A;  2CQX A;  3S16 J;  3IH2 A;  1T56 A;  4ABZ A;  1U9O A;  5IOY A;  3S1Q J;  4I6Z A;  4BKX A;  3I4N J;  4XID A;  1HOM A;  1MBJ A;  1ZR2 A;  4A3B J;  2WB1 N;  4DYR A;  5C4X J;  2VI6 A;  2DA7 A;  3F0C A;  4B1R A;  3S17 J;  1VFC A;  2NVY J;  1B72 B;  1G2H A;  1Z77 A;  3SFI A;  1LE8 A;  2XPW A;  2Y30 A;  1H89 C;  1ENH A;  3BR6 A;  1B72 A;  2HXO A;  5EZH A;  2HOA A;  1JJ8 C;  2IEK A;  1DU0 A;  1T33 A;  2DA2 A;  4S0H B;  4MIM A;  4Y52 J;  5JLW A;  2NVX J;  2Y0S N;  2L9R A;  2HDD A;  2LTP A;  5EGO B;  3WHC A;  5DS9 A;  2JK3 A;  2XSD C;  1JKO C;  2E2I J;  4FCY A;  5EGO A;  3QPS A;  2HYJ A;  3FIS A;  2DTZ A;  3ZQL A;  3HB9 A;  2HI3 A;  3CQZ J;  2RAE A;  2COB A;  3CMY A;  1JGG A;  4HNV A;  1IC8 A;  5FKM A;  3HOW J;  3BTC A;  4QTR A;  3TP0 A;  1JTX A;  4AC0 A;  2ZB9 A;  1JKR C;  3GTQ J;  1K61 A;  3NAR A;  1AHD P;  3GTO J;  1JUP A;  4X1E A;  1GVD A;  2JMW A;  5IP6 A;  5FKN A;  3OIO A;  1QRY A;  4NDL A;  1RET A;  1FTZ A;  5IYD J;  3HOV J;  5IP9 J;  1ZQ3 P;  3M4O J;  5HOD A;  2CJJ A;  1P7I A;  5K7F A;  3OSG A;  2MGQ A;  2EZK A;  4UUS B;  2EZH A;  4XRS G;  2HQ5 A;  4D7N A;  2YS9 A;  1SFO J;  4XRS A;  1IDY A;  3LSR A;  4UUS A;  4IEJ A;  1QVU A;  4DYQ A;  1WH5 A;  4RBO A;  2L7Z A;  5C4J J;  1BW6 A;  1DU6 A;  2ID6 A;  3A02 A;  3A01 B;  2X9D A;  3DEW A;  3HEF A;  1AKH B;  1YRN B;  4A3E J;  3B6A A;  2M9H A;  5F0C A;  1GUU A;  3A01 A;  1JKQ C;  2XGC A;  1AKH A;  2KT0 A;  3ZQG A;  3JR9 A;  2O8K A;  2X48 A;  3O8H A;  3BQY A;  3ZOB A;  1POG A;  9ANT A;  2CU7 A;  2ID3 A;  3IV5 A;  4M3E A;  3TW7 A;  3JRB A;  2XPV A;  4JP0 A;  3ZQH A;  4DZP A;  1Q1V A;  2K9Q A;  2VPR A;  4FE7 A;  2H1K A;  4CYC A;  3FK6 A;  2JWT A;  2M34 A;  1RKT A;  2GM4 A;  2R7Z J;  2E2H J;  3ZQF A;  5M5Y J;  5FKK A;  3HOX J;  5E3L A;  4D5C A;  5F27 A;  1VF9 A;  4GFB A;  1ETX A;  5F0F A;  1XG1 A;  1IRZ A;  2XB0 X;  2LKX A;  3TW6 A;  2XPU A;  1RPW A;  2HOT A;  5E3O A;  1U8B A;  3NAU A;  2LY9 A;  2R92 J;  1I50 J;  2G0E A;  1APL C;  1QVT A;  1LFB A;  4FTH A;  1AU7 A;  3IH4 A;  1RR7 A;  2R5Z A;  1LE8 B;  5IP7 J;  2CUF A;  4AUX A;  5IPA A;  2LLK A;  2YUS A;  2TRT A;  1WGX A;  4A3I J;  1UG2 A;  5IOZ A;  3IH3 A;  1MBH A;  3BTI A;  1EF4 A;  3BQZ A;  3LSJ A;  1I3Q J;  2QF7 A;  3DCF A;  2IBD A;  1ETY A;  3MN2 A;  5FKO A;  2Y9Z A;  1ITY A;  3A03 A;  1U78 A;  4Y7N J;  4M3G A;  1BL0 A;  3W6V A;  1TWA J;  3GTK J;  3FIW A;  3S1R J;  4MLO A;  2O9L A;  4X6A J;  4IHX A;  5FLV A;  3CCY A;  3BR3 A;  4JX6 A;  2DA4 A;  4MO7 A;  5F1J A;  1ZKG A;  1XC5 A;  4W1U A;  1HDP A;  2R5Y B;  3HM5 A;  3JRF A;  3Q0W A;  2JA5 J;  1FIA A;  1ETQ A;  4IHY A;  2R5Y A;  4FIS A;  2R93 J;  3GTL J;  1MBE A;  3GTM J;  4BY7 J;  1MBG A;  2DA1 A;  2AO9 A;  2XRL A;  2FQ4 A;  1QPI A;  4B3A A;  3QQA A;  1XS9 A;  5C44 J;  2E19 A;  2M2E A;  5GPC A;  3H0G J;  3CDL A;  4B4C A;  4A69 C;  2LD5 A;  3RZD J;  4AYB N;  5C3E J;  5F04 A;  3OOU A;  2JJ7 A;  4DW6 A;  4W97 A;  5GP9 A;  4C3H J;  3SJM A;  3FKI J;  2DA6 A;  4M3F A;  1FTT A;  5EF6 A;  4A3D J;  4A3G J;  1JUS A;  4FE4 A;  1WI3 A;  5J3L A;  5M5W J;  2M8G X;  1K83 J; 
#chains in the Genus database with same CATH topology
 1TQI A;  4U88 A;  2NOG A;  5EG0 B;  5JR3 A;  3PO3 J;  3BPV A;  3PQK A;  3RZO J;  3MEX A;  4F91 B;  5EG0 A;  1GT0 C;  1ZRE A;  1WJE A;  3CUQ C;  2STW A;  1VQL I;  2KJC A;  2CQQ A;  4HQM A;  1U9N A;  1IRG A;  2A68 F;  5BPD A;  1FYM A;  5HDK A;  3BG5 A;  2VON A;  2MD0 A;  1ZHF A;  1R22 A;  1O3S A;  1H9G A;  1VQ4 I;  4IHV A;  1N25 A;  2AXT C;  4EVI A;  3C1D A;  3HSR A;  2VOO A;  1Z21 A;  4CSW A;  3UR3 C;  4RGS A;  3W6K B;  4HV5 A;  4PDK A;  4E70 A;  2V9K A;  3KIO A;  4EJO A;  3GME A;  4EM0 B;  4IO9 F;  2EIL H;  1OFC X;  3HTU A;  2KFD A;  5HOO A;  1J59 A;  2DMN A;  3VYU B;  2O5R A;  1XMX A;  1X1P A;  3DEE A;  2E5N A;  4LIV A;  3WG9 A;  4KMF A;  2ECC A;  1WKM A;  1MGT A;  4CYC B;  3TGN A;  4HX7 A;  3KYD B;  2NVU B;  3ERM A;  4BJT A;  2DMT A;  2XGD A;  4ZH4 F;  2AXL A;  1HKQ A;  2BY1 A;  5E3M A;  2UUZ A;  4ZYE A;  1FOY A;  1JHH A;  3F8B A;  1YX3 A;  2RKH A;  4BBR J;  1QU3 A;  2WY8 Q;  4EJT A;  3V7S A;  4O3M A;  1GV2 A;  1S72 I;  4M9X A;  3ZQQ A;  1OKR A;  4KT5 C;  5ED4 A;  3IKT A;  3KFW X;  1I39 A;  1B59 A;  2M1B A;  3S93 A;  4A3J J;  4A0X A;  3OYJ A;  3E1S A;  2E1M C;  1X2N A;  5CVV A;  4ZDL A;  4DNC A;  3WTV C;  2D5V A;  3HTS B;  1HLV A;  2OCE A;  2O7O A;  2IS4 A;  3I5U A;  1R36 A;  3S3O A;  2IPQ X;  1WSU A;  3HOY J;  2GA2 A;  4WF2 A;  2GOX B;  1ETW A;  5DTD A;  3IHU A;  3FZV A;  2LY1 A;  3L2C A;  2N8G A;  2ZSI B;  3CCL I;  3UKG A;  4FAS D;  2ACJ A;  4A3F J;  3LSG A;  2BGC A;  2LYC A;  2P5L C;  4RB0 A;  1J2X A;  3T0Y A;  1OPC A;  1QZE A;  4B47 A;  4J01 A;  1MBF A;  2A6T A;  5J47 A;  2XAQ A;  2ECB A;  1MJA A;  3K69 A;  4DBR A;  1IXR C;  1IV8 A;  3K4N A;  1KYZ A;  2X6Y A;  3K4K A;  2VJ4 A;  5EZG A;  4ZYA A;  3WHB A;  2QKM B;  2DMQ A;  1BI1 A;  1P6R A;  3B6C A;  1F1Z A;  1JTY A;  2PMZ N;  5IT3 A;  1MMA A;  2LVS A;  1XDU A;  2JRM A;  1VND A;  3TO6 A;  3ZQI A;  3DPU A;  4LG3 A;  1R1V A;  1A6I A;  4CCL A;  5J6X A;  1W7P B;  2HDC A;  1MJB A;  5L3C A;  5LEK A;  2G9W A;  3T1B A;  1ZGW A;  3ZRG A;  1W7P A;  2EV5 A;  2V1N A;  3CCR I;  4P96 A;  3FWE A;  2MLG A;  4CUG A;  2Y9Y A;  2L7K A;  2Y48 A;  5HLG A;  2DMU A;  2WAE A;  5M5X J;  4EGY A;  2LKP A;  1H8A C;  4MNU A;  1IDZ A;  3E7L A;  3HRS A;  1IO2 A;  5M3M J;  2VUM J;  1B6A A;  1KU3 A;  2KIS A;  2LH9 A;  1M1E B;  2EA2 A;  2R3S A;  1Y8Q B;  2FNA A;  2EFN A;  4G8X A;  1Y8R B;  4XRF A;  2NYX A;  3GTJ J;  3CUQ B;  2NVQ J;  4Y3O A;  3VPR A;  4A5N A;  1RUO A;  3HKZ N;  2R7W A;  2ME6 A;  1FMV A;  3MQ0 A;  1TBX A;  3BR0 A;  4C3J J;  2ISY A;  3I4M J;  5FLX Z;  1O3R A;  2VKD A;  3O8G A;  3H5N A;  3FM5 A;  4JX5 A;  1GV5 A;  2NS8 A;  1YG2 A;  2EV0 A;  2DT5 A;  2IGN A;  3G6E I;  1FBQ A;  3HDD A;  3GTP J;  2FEZ A;  3BJA A;  1LKX A;  2B0L A;  4G94 A;  1MD0 A;  1R7J A;  3CMA I;  1B8I B;  1JKP C;  3K1N A;  4IQ4 A;  1MMS A;  4M9S A;  1FBU A;  3KP5 A;  3QAH A;  4JYK A;  3CCJ I;  2ICW G;  4RB1 A;  1O4X A;  1XPX A;  2ZBK A;  3J81 Z;  1X58 A;  2LRD A;  2XDV A;  3PO2 J;  2R7S A;  3PIO F;  3DV8 A;  1IN4 A;  1ZLJ A;  3WE2 A;  2J5O A;  1YRN A;  1L0O C;  4MEY F;  3K6G A;  1RKW A;  4HRI A;  4XK4 A;  4D5F A;  3K9T A;  2ZXW H;  3D0S A;  2DFF A;  4OMY A;  2ZNY A;  1GHC A;  5HVQ C;  4I7H A;  1A5J A;  5JHU A;  1CGP A;  3BG3 A;  1IW7 F;  2FNP A;  2GQQ A;  1WI9 A;  4PJ0 C;  2M87 A;  1ORK A;  1UHW A;  3BZ6 A;  1OCR H;  3RQ4 A;  2VJ5 A;  1D8J A;  2WY7 Q;  1AOY A;  4D7M A;  3BOQ A;  3QOP A;  2MC3 A;  1J7K A;  1FSE A;  1WJC A;  2CYY A;  2R7X A;  3DTI A;  1S9H A;  3KLO A;  4A3M J;  2CO5 A;  3JRC A;  4JBA A;  2R7V A;  2HOE A;  1XGO A;  1RNL A;  2ELK A;  5D6F A;  3S16 J;  5DCM A;  3BJ6 A;  3IH2 A;  4M72 A;  3EYI A;  5CQE A;  3SEZ A;  5EEH A;  4CIC A;  4BKX A;  1EH8 A;  1HQC A;  2ZJQ F;  4F92 B;  3U1D A;  4ZJZ A;  5DD8 A;  3D5R C;  5C4X J;  2CFO A;  3G71 I;  2DA7 A;  5ICC A;  1XGN A;  1VFC A;  2NVY J;  4UXN A;  4GO1 A;  3IRQ A;  2BVL A;  1ZYR F;  1LE8 A;  2Y30 A;  2QQB A;  4M9Z A;  2CS3 A;  3IAS 2;  3WTS C;  1O7F A;  4XN3 A;  5LD2 C;  2BBY A;  2HOA A;  3ELK A;  3HUG A;  1JJ8 C;  1WWX A;  2IEK A;  3CJR B;  4MIM A;  2QEN A;  3JCU C;  1VTN C;  2LMD A;  5E17 F;  4BE1 A;  1V3F A;  1XSV A;  2Y0S N;  2L9R A;  1S8N A;  1HKS A;  1J75 A;  4HV6 A;  5KCM A;  2JK3 A;  4OIN F;  4HF2 A;  1J09 A;  4KYW A;  4G7Z F;  2IS2 A;  2RVC A;  1YHQ I;  4LLG F;  3ASN H;  2AS5 F;  3A2K A;  5TJJ A;  3FIS A;  4FHT A;  3HB9 A;  4HZF A;  2XF7 A;  2CMP A;  2D1H A;  3CQZ J;  2HYG D;  2RAE A;  3CMY A;  2QLZ A;  1JGG A;  2L9N A;  4HNV A;  3MZY A;  4QTR A;  1YTY A;  3MKZ A;  3TP0 A;  1T98 A;  3MAJ A;  3HSE A;  4AC0 A;  3GTQ J;  4LK1 F;  1YI2 I;  4CGZ A;  1IAW A;  4IX7 A;  4WCG A;  3KZI C;  3DKW A;  4X1E A;  2JMW A;  1FZP B;  5AON A;  2WB1 A;  4NC7 A;  3TQN A;  4AM3 A;  1P4X A;  4NDL A;  4RA2 A;  2OUM A;  5IYD J;  4I01 A;  3HOV J;  4YII A;  1DUX C;  3QYB A;  3LMM A;  1ZQ3 P;  1BR4 A;  1D3Y A;  1BOB A;  3ABK H;  5HOD A;  4LB6 B;  2CJJ A;  1FYL A;  5K7F A;  3ZQ7 A;  1I5Z A;  1U6G A;  2ELJ A;  1REP C;  2MGQ A;  3HPH A;  3WTT C;  4UUS B;  4UB6 C;  2HQ5 A;  1SFO J;  2Q1Z B;  4UUS A;  1KQ8 A;  1XB4 A;  4RBO A;  1C0W A;  2ZO4 A;  1DU6 A;  2ID6 A;  1UFM A;  4V19 K;  2VJJ A;  4LLN A;  2CFX A;  2VQH A;  1T08 B;  2JZY A;  5F0C A;  2JUC A;  2GIZ A;  1SFE A;  3HJE A;  3EET A;  4EAT A;  2DPU A;  1LVK A;  2A05 A;  3BQY A;  3GZN B;  3BC8 A;  3CZ6 A;  2CU7 A;  2ID3 A;  1FC3 A;  4L9T A;  1VQO I;  5FD5 A;  2GXA A;  2O3F A;  3JRB A;  3NQO A;  2NOJ B;  4I0A A;  3HRU A;  1G8X A;  3BZC A;  1IN8 A;  4P55 A;  4MHG A;  4KNY A;  4R1H A;  3KPH A;  2H1K A;  2K9L A;  2KDO A;  3RPU A;  4B09 A;  2M34 A;  1W36 C;  1OR7 C;  2GM4 A;  5GAG J;  2R7Z J;  4S05 A;  3ZQF A;  3CJN A;  1ZAR A;  1X4P A;  5GTH C;  2XB0 X;  1SD6 A;  3I71 A;  3OYL A;  4IHS A;  2DFH A;  4PJL A;  2G7U A;  2HOT A;  5IT9 K;  4K2E A;  4L9V A;  2LY9 A;  3L2V A;  2R92 J;  1APL C;  2YX7 A;  1FNN A;  2EK5 A;  3OYD A;  1LFB A;  4FTH A;  3OL3 A;  3IH4 A;  1RR7 A;  2R5Z A;  2OC6 A;  2QYO A;  3FBI B;  3K1M A;  3NWS A;  1IXS B;  4I98 B;  5IP7 J;  1E3P A;  3AG1 H;  5L3F A;  5D8L B;  1WGX A;  3CP8 A;  1UG2 A;  4A3I J;  3W2W A;  1HW1 A;  5H2F C;  4IL6 C;  4NQW B;  4XL9 A;  5HS8 A;  2WWY A;  3G73 A;  3DLL F;  1VQ8 I;  1I3Q J;  1VQ6 I;  4NQW A;  4PFO A;  4MTE A;  1Z6R A;  2XVC A;  1KON A;  3MN2 A;  1BBY A;  1USS A;  5B66 C;  2Y9Z A;  1ITY A;  1FYK A;  3L9F A;  4Y7N J;  2XIG A;  4M3G A;  1E0E A;  1TWA J;  3N4M A;  3S1R J;  4MLO A;  1IRF A;  5LGT A;  2FUG 2;  4CCN A;  3BR3 A;  2DA4 A;  5B1A H;  4LIT A;  3KP4 A;  2BXZ A;  1HDP A;  3V8L A;  1SEU A;  2V6E A;  2GOM A;  3P7N A;  4G6D A;  3U1K A;  3CCU I;  2JA5 J;  1ETQ A;  2DDA A;  1SFU A;  4A5M A;  1E2X A;  2R93 J;  3HRT A;  2CQN A;  2DA1 A;  2AO9 A;  4Q5S F;  1NG7 A;  3BJO A;  4XLF A;  3QQA A;  4G7H F;  2LD5 A;  3RZD J;  3CDL A;  5HNH A;  2VQL A;  5C3E J;  3H0D A;  5J4Y A;  1K78 B;  4ESF A;  3FDY A;  2DYR H;  4XOR A;  4DGW B;  1K78 A;  3SJM A;  3MWM A;  2HWV A;  3FKI J;  3BCB A;  4ZDP A;  2BW3 B;  1Y39 A;  5B5E C;  2R7T A;  1Z05 A;  1WI3 A;  4QWQ A;  5J3L A;  2BW3 A;  1T56 A;  1K83 J;  2CUJ A;  1MMN A;  4Q4Z F;  3CME I;  3CES A;  1K6Y A;  3DXJ F;  5FJ8 J;  1WRJ A;  2OF7 A;  5DM6 F;  1U0J A;  2MLK A;  1HCR A;  3IP4 B;  1RES A;  1SD5 A;  1TW3 A;  4Y13 A;  4XIC A;  3PNY A;  2LRE A;  3V8K A;  5GPA A;  4BXF A;  5HS9 A;  5F6F A;  2VBZ A;  1Z6T A;  3BLY A;  3H1C A;  5CJ9 A;  4BJ6 C;  2K5C A;  4MFD A;  4II3 A;  4AVP A;  4FET A;  2P6T A;  2QQA A;  2Y31 A;  3LAJ A;  2OQG A;  5J8F A;  2W4S A;  1IXC A;  4CXF A;  2M5W A;  3IL2 A;  2KIF A;  3VEP A;  1TWC J;  3EUH C;  1BR2 A;  3OV8 A;  3QP6 A;  3KET A;  2CW0 F;  3BP8 A;  2D1V A;  1IGN A;  4A0Y A;  2ADU A;  3RKW A;  4L9J A;  2COM A;  3V4G A;  2MSY A;  2CGP A;  3H9G A;  5E1Z B;  3E5Q A;  1O57 A;  4AYB A;  1NH3 A;  4L5J A;  3TBI A;  1A35 A;  4M73 A;  1UEL B;  1YS6 A;  3D5L A;  3E3V A;  3ZCO A;  3I0T A;  3JRI A;  2NAZ A;  1ON2 A;  4U7B A;  2L4M A;  3DKX A;  1ZRF A;  3OS2 A;  4Y33 A;  5HDN A;  1U3E M;  2MAB A;  3MKL A;  2ZXI A;  4HG2 A;  3LNQ A;  1K7A A;  3FXO A;  3JTG A;  3LA7 A;  5LGN A;  1W7P D;  5BQT A;  2WAQ A;  2LP0 A;  2XB5 A;  3AAF A;  4ZTJ A;  4BQA A;  1S3J A;  2K27 A;  2ME0 A;  3LQR A;  2YSR A;  2EFP A;  2P8T A;  4ETS A;  2DAO A;  2W84 A;  1PP7 U;  1IJW C;  2HPM A;  1MSE C;  4KIF A;  1MSF C;  1KU9 A;  2M7A A;  3PFY A;  1F36 A;  5F0H A;  2BVM A;  1J0R A;  2DFI A;  3L1P A;  3OYM A;  3Q5F A;  1PP8 F;  5B1B H;  1IN7 A;  1H88 C;  2JTV A;  3JTH A;  3RTR A;  3HZJ A;  1YS7 A;  3CO7 C;  2W25 A;  4IRG A;  2KIU A;  3ISP A;  4PCQ A;  2JVG A;  1VI0 A;  3PUF A;  4MQV A;  1W1W E;  2PJR B;  3WGG A;  1GXP A;  3WTW C;  1MH3 A;  1AWC A;  1Y1V J;  4EEF G;  4FX4 A;  4LIU A;  2JA2 A;  2W1O A;  3BTL A;  2EZL A;  2L7F P;  2O6G E;  4A3K J;  1UMQ A;  2XGX A;  1K4T A;  3RYP A;  5FLM J;  3HOT A;  2V4J C;  1D8K A;  5FFX A;  3QRF F;  1PUE E;  4DYC A;  1HSJ A;  2X6O A;  2HQR A;  1X3Z B;  4A3C J;  2WV0 A;  4U87 A;  4BBS J;  2WAF A;  4JOM A;  4V2F A;  3KLN A;  4DQ2 A;  4ZYH A;  3A0H C;  2EFO A;  3SDG A;  3QPL A;  2LKS A;  4G12 A;  3I54 A;  2Y2Z A;  3ZQC A;  1S7A A;  1ZTR A;  2QBY B;  5D5W B;  3GXO A;  1BN5 A;  5B3S H;  1ACI A;  4B43 A;  5CQG A;  4CA0 A;  2QBY A;  4RGX A;  3CCE I;  3CC7 I;  3SDB A;  4C3I J;  2W48 A;  3MZ8 A;  5BOX A;  2HEO A;  5BNG A;  2K86 A;  3LSP A;  2FU4 A;  3H3Z A;  3ECH A;  3KP7 A;  4A6D A;  1QHG A;  2H6C A;  3RCO A;  5FO5 A;  3BR1 A;  3P9K A;  1W5T A;  1IRX A;  1KU7 A;  2YR2 A;  3E6D A;  4MGR A;  5K7H A;  1TWG J;  3RKQ A;  2V9V A;  2KP6 A;  3ZMD A;  3HRM A;  1X3U A;  5CPR B;  4F55 A;  1P4A A;  2FX0 A;  2HQN A;  2FJ1 A;  2VIX A;  5HNF A;  1CF7 B;  2KRH A;  1UB9 A;  4HBL A;  4Z2Y A;  3GZ6 A;  3W3C A;  4CDG A;  3L09 A;  5FD6 A;  1CF7 A;  2WC2 A;  3VWB A;  1V5F A;  2A6H F;  2L4A A;  3KP3 A;  1BJZ A;  5LRS A;  5GAE J;  1TC3 C;  3SYT A;  5CVR A;  1SVO A;  2VXZ A;  4UV9 A;  5DCF A;  1BA5 A;  3ZMZ A;  3NRV A;  3H3V K;  2OZU A;  2W57 A;  2UXX A;  2XGE A;  4M6V A;  4NB5 A;  4KIG A;  3WU0 A;  1VQ9 I;  1GLN A;  2EWN A;  2VB6 A;  1IZ1 A;  2IA0 A;  2XUB A;  2J5P A;  2ETH A;  2FBI A;  4BHC A;  1ETO A;  3HGG A;  2PJP A;  4Y4R A;  2B63 J;  5KAI C;  1RR8 C;  2RN7 A;  3GEZ A;  3IC7 A;  3GVA A;  3HOZ J;  4BDZ A;  3OS0 A;  3MVP A;  4DOZ A;  3OYA A;  3DKY A;  1Y0U A;  4HDU A;  3EPZ A;  4XOT A;  2FRH A;  3FM3 A;  5EYR A;  1OCC H;  3QWL A;  4I09 A;  3HBL A;  2LY2 A;  4FQG A;  4EJV A;  1YJN I;  2EH3 A;  4OU0 A;  2X4H A;  1HW5 A;  1OMI A;  2QCO A;  3PM1 A;  4XLN F;  1JI8 A;  1ZLK A;  3F6O A;  2MH2 A;  5H6R A;  4LB5 A;  2A5W A;  4OIR F;  1A04 A;  4B8X A;  3IKV A;  1IV6 A;  1D1C A;  5GTI C;  4OIQ F;  3ZMT A;  3WOD F;  3S8P A;  2DT7 B;  1I27 A;  1FEX A;  3FXR A;  2H8R A;  1SVM A;  2G7H A;  1HW2 A;  2KL4 A;  1V5E A;  4OOI A;  2VE8 A;  2HVQ A;  2OBP A;  3HGY A;  3P9C A;  5D4S A;  3QPH A;  3ZGK A;  1MJ9 A;  2JVH A;  5BPI A;  1BI0 A;  4ENN A;  1WJF A;  1ZGA A;  5EJC A;  3WE3 A;  3V8J A;  3S1Q J;  4RLF A;  5LBQ A;  4I6Z A;  3I4N J;  4EM1 A;  2DU9 A;  5DUI A;  2P5K A;  1RZ4 A;  2FBK A;  1ZR2 A;  1ZG1 A;  1ZEL A;  2WB1 N;  3C2G A;  4H4K C;  5E1X A;  3F8N A;  3F8C A;  2O03 A;  3F0C A;  5KHD A;  3S17 J;  1B72 B;  1X1C A;  2VQC A;  3GO5 A;  1FP1 D;  3I55 I;  4C2T A;  5CLS A;  3HSF A;  1YO5 C;  1H89 C;  1ENH A;  3BR6 A;  1KU2 A;  3GFJ A;  1B72 A;  5AIQ A;  3N05 A;  4KIC A;  1SMT A;  2F4I A;  4ON0 A;  1G4D A;  1DU0 A;  2LC2 A;  4S0H B;  5HLH A;  3JSO A;  1BIA A;  2V6C A;  4BYY A;  1XMK A;  4BS9 A;  5DUK A;  5TRD A;  2HDD A;  1JKO C;  5EGO B;  5DS9 A;  3COA C;  1MW7 A;  4FCY A;  2DK8 A;  1FMW A;  5EGO A;  3ZR8 X;  4Q48 A;  1QZY A;  4NC6 A;  3ECO A;  1YJW I;  4YFN F;  4PJM A;  2DTZ A;  4HEA 2;  2KKO A;  2E5Z A;  2COB A;  4CCM A;  3OR2 C;  3GYH X;  4QLC U;  3RPU D;  5FKM A;  3EUK L;  3HOW J;  1QBJ A;  3LSK A;  1OIS A;  1JTX A;  4Y15 A;  1TTY A;  1EKE A;  3ULQ B;  2VKH A;  4KMU X;  3GZ5 A;  4CH7 A;  2F5D A;  2QM3 A;  4HX8 A;  2BEO A;  3OYH A;  1N77 A;  4D0P A;  4I2O A;  2ESN A;  3QOD A;  1GVD A;  4X0G A;  3HC7 A;  3OWT A;  2HTS A;  2L54 A;  3RSN A;  3OIO A;  4YEJ A;  3X2Q H;  4LD5 A;  3BG6 A;  3C3W A;  4PUS A;  4P1W A;  3CO6 C;  1VQ7 I;  5IP9 J;  4NNJ A;  3M4O J;  2F48 A;  2ZC2 A;  4LLL A;  1QO0 D;  3CC4 I;  3F21 A;  4EMS A;  2F4O B;  3FXK A;  3PQJ A;  3OSG A;  3T5X A;  5CVJ A;  2EZH A;  2P6S A;  5ERI A;  1R1U A;  2YS9 A;  3JSP A;  4XRS A;  3LSR A;  2V9P A;  1OCZ H;  1FT9 A;  1R5G A;  4E7K A;  5IY5 H;  4DYQ A;  3M9A A;  3CP2 A;  5JVT A;  2Y0M A;  1BW6 A;  2D45 A;  4YIR X;  3A01 B;  2XKO A;  3ONQ A;  1YRN B;  2V1D A;  4DJA A;  4MEX F;  2CV1 A;  4N9H A;  3B6A A;  3FHZ A;  4A3E J;  2XAJ A;  1J9I A;  1GUU A;  2PG4 A;  3TDZ C;  4AID A;  3A01 A;  2KT0 A;  1JKQ C;  2E1C A;  3N97 A;  3IUO A;  4JK1 X;  3O8H A;  2JQ7 A;  4PZJ A;  2KZG A;  4YIF A;  4I0B A;  3IV5 A;  2FE3 A;  3S2W A;  3TW7 A;  3G2B A;  3QU6 A;  2LG4 A;  4BU2 A;  2XPV A;  1N78 A;  4JP0 A;  2E7W A;  3M07 A;  3ZQH A;  1K6O A;  2F5V A;  2K9Q A;  2VPR A;  1ZG3 A;  4FE7 A;  1G6N A;  1TT5 B;  2PQ8 A;  2JWT A;  2K7L A;  3K4M A;  3FF5 A;  4IKF A;  5LHI A;  2FBH A;  2UWM A;  5DCM B;  1EJ9 A;  4BL0 B;  4D5C A;  4E7S A;  1VF9 A;  1DDN A;  5F0F A;  1N75 A;  3IAM 2;  4HQE A;  3MMY B;  3FXU A;  2XPU A;  2QKL B;  4KDP A;  2G0E A;  4NUB A;  1R00 A;  2DJI A;  1AU7 A;  1UZC A;  4GYI A;  1LE8 B;  5J40 A;  2CUF A;  3LFK A;  5E8G A;  2BY3 A;  3BWG A;  1A36 A;  2TRT A;  4XLC A;  2VT3 A;  4GGG A;  5LFA A;  3IWF A;  4AD9 A;  1TNT A;  3RJP A;  1KGS A;  3DTE A;  3ERE D;  2XKP A;  3HUG B;  1MBH A;  2JUG A;  3O3K A;  2XRN A;  2QF7 A;  3DCF A;  3GWZ A;  4R79 A;  2RNG A;  3CTA A;  3JW4 A;  3SXY A;  3L2U A;  2Z2S B;  2XSJ C;  1G3Y A;  1S5L C;  3PSF A;  3NEU A;  4UB8 C;  2A3S A;  1BL0 A;  3GTK J;  2BV6 A;  3CLO A;  4CO8 A;  4BQO A;  4X6A J;  1Z7U A;  1FWZ A;  5FLV A;  3KZY A;  4JX6 A;  1TLH B;  4MO7 A;  2V79 A;  1O3T A;  1ZKG A;  2EB7 A;  2BY2 A;  3HXL A;  4W1U A;  3T8R A;  2ISZ A;  2JT1 A;  2R5Y B;  2GIV A;  3JRF A;  3K4J A;  2MC4 A;  3Q0W A;  2K4J A;  1X3W B;  1FIA A;  1VZ0 A;  2R5Y A;  4FIS A;  2UZK A;  3LL7 A;  4F52 A;  1MZB A;  3VFZ A;  3MKW B;  1P4W A;  3MZH A;  3GTL J;  3GTM J;  3P5J A;  4E7Z A;  4HAM A;  1QPI A;  4B3A A;  4BQQ A;  1XS9 A;  3T8T A;  2E19 A;  2DXI A;  2HKX A;  3H0G J;  3KZZ A;  2ZJP F;  4AYB N;  3A0B C;  2H8W A;  1LPQ A;  1BC8 C;  1Q1H A;  2VQG A;  4M74 A;  2EA4 A;  2DFE A;  3Q9V A;  3OOU A;  4DW6 A;  1KQ0 A;  2EFW A;  3ABL H;  3VYR B;  3OS1 A;  2E71 A;  1FTT A;  4NBQ A;  1SAX A;  1SC7 A;  4A3D J;  4A3G J;  2DBB A;  3TOB A;  4XN0 A;  1FOW A;  3R6S A;  3PNT A;  4EQQ A;  3K4B A;  4MTD A;  1MKM A;  4ASN A;  2KMU A;  3JRD A;  3AFH A;  3MKY B;  1JT0 A;  1WH7 A;  4WXH A;  1B9M A;  1KA8 A;  4C2M J;  5EEG A;  4XM3 A;  2DCE A;  5BMZ A;  2QWW A;  2O8X A;  2DMP A;  4M6Y A;  4WXC A;  4HLY A;  1KZH A;  3IRR A;  5J1Y A;  2Z5U A;  4E6K G;  5J1R A;  3OYG A;  4XKB A;  2FML A;  3TP3 A;  2MBF A;  4HW0 A;  1H9T A;  2IGO A;  4ENJ A;  3SHF A;  3Q0U A;  2IP2 A;  2K9S A;  4G6T B;  4BAC A;  2A69 F;  1F43 A;  2RQP A;  3SZG A;  2HKO A;  4Q47 A;  3K4C A;  5FKL A;  5LHH A;  2MA3 A;  2IS1 A;  4FT8 A;  1D1B A;  2IAI A;  4C30 A;  2EIN H;  1NTC A;  4N9I A;  3ZMV A;  1SD4 A;  5F08 A;  3S2D J;  2HZT A;  3CCQ I;  3S2H J;  3OOP A;  3DU5 A;  3W6J B;  3TO9 A;  3ZN0 A;  2YU9 J;  2M30 A;  3G1O A;  2VKV A;  3LWF A;  1FIP A;  5IYC J;  3K7A J;  5FRN A;  2EV6 A;  4RDU A;  2HYF A;  1IUF A;  3HYI A;  4A0Z A;  1LNW A;  1Z0X A;  3FHN A;  4ESJ A;  5E79 C;  3JRE A;  2Z1D A;  4OIP F;  5K5Q A;  1YYV A;  1YIJ I;  1W0U A;  4AWX B;  2GZW A;  2Z33 A;  1RIO H;  4B48 A;  2RQQ A;  2LNB A;  3G1L A;  2BXY A;  2IXS A;  3REO A;  4IXA A;  1TP4 A;  4BJ5 C;  3GX4 X;  2R5Z B;  2CUE A;  2DOA A;  3F6V A;  4IPA A;  3OIP A;  4G6Q A;  5ILU A;  3CCM I;  2IJL A;  2PX9 A;  5FRO A;  4I76 A;  1ZN2 A;  1UST A;  3B02 A;  4BEH A;  1D0X A;  3ABU A;  1AA7 A;  1WQ2 A;  1XGM A;  2X6X A;  2JSP A;  4OMZ A;  5K7Z A;  3LA3 A;  2E1O A;  4U0V A;  4BGD A;  3I9V 2;  3LFU A;  1F9N A;  2LDU A;  1BM9 A;  1TWH J;  3BR5 A;  4ZTF A;  4GXO A;  2H94 A;  3S1N J;  1WJ5 A;  2LR8 A;  4Z6Y A;  2R7Q A;  1R71 A;  4BDY A;  1MBK A;  3PJR A;  2WTE A;  3JRH A;  4UUT A;  1VQN I;  2DA5 A;  4E7J A;  4M3D A;  1IG7 A;  2RDP A;  4OIO F;  1UCR A;  1TNS A;  1B4A A;  3SZT A;  4R8H A;  5ICE A;  3AL0 B;  2R0Q C;  1LUJ B;  1DPR A;  2Q2E A;  3VSL A;  1T2K A;  3BY6 A;  3CD6 I;  2D2W A;  3K1P A;  3VOD A;  2LF7 A;  3O6B B;  5HLI A;  2E1N A;  4RM2 A;  5DD4 A;  3EQL F;  2E2J J;  1V55 H;  3ML6 A;  3LAP A;  2EQR A;  1FY7 A;  2FQ3 A;  5FLX K;  2VT2 A;  3K10 A;  3JRG A;  4U0Y A;  1Y6I A;  4OAY A;  4J00 A;  3H9Q A;  1MNE A;  1WCM J;  1R1T A;  2TCT A;  4ZDO A;  2ZJ2 A;  3VYT B;  2V7F A;  2QSG X;  2JA6 J;  1QPM A;  4WXD A;  1UAA A;  3TO7 A;  4ANJ A;  3E6C C;  3OYN A;  1ZR4 A;  2DLL A;  2NVT J;  2GBY A;  3RQI A;  3VSK A;  1ZRD A;  2XAH A;  1FX7 A;  2EBI A;  2OJE D;  4HF0 A;  5F1R A;  1TT0 A;  3GBG A;  2I8D A;  4KT6 A;  2ZFW A;  2LOO A;  1XN7 A;  3K0L A;  3J81 K;  4BY1 J;  2LSO A;  1LDD A;  3OYB A;  3FMR A;  3D1N I;  5ICF A;  2DA3 A;  2L0K A;  3RKY A;  2NRA C;  4CZZ A;  4D1Q A;  4UY8 I;  1ZG5 A;  4B44 A;  3G1M A;  1W0T A;  1P2F A;  2DJN A;  2QVO A;  2HFH A;  1FOK A;  1FLI A;  1B1B A;  2E35 A;  3TED A;  2OZ6 A;  2W24 A;  5L3D A;  4L0Z B;  3CCV I;  3QP5 A;  4KA4 A;  3S1M J;  2IW5 A;  1YIO A;  3QPT A;  2UV1 A;  3QOE A;  1FJL A;  2DN0 A;  4IJA A;  4L5I A;  1DPU A;  4ITV A;  1V4R A;  2A6E F;  3BG9 A;  3WTZ A;  2RV8 A;  2WV1 A;  5H20 A;  2F5F A;  2ZME A;  4A2U A;  5EEA A;  3K2Z A;  3PFI A;  2CQ7 A;  2XF5 A;  3QYE A;  2XAU A;  4DIQ A;  2JA8 J;  3EUA A;  1XD7 A;  2B7E A;  4OAZ A;  2X6W A;  2Y0S A;  3WG7 H;  1ETK A;  2DT6 A;  1UHS A;  2DPD A;  1I6H J;  3Q3S A;  3K70 D;  3E97 A;  2PI0 A;  4NHJ A;  4ZYG A;  2FD5 A;  1EH6 A;  3F23 A;  3LOC A;  1E17 A;  2KLO A;  2OTL I;  1YW8 A;  4L9N A;  4RGU A;  3EYY A;  3ZXS A;  3TL4 X;  1RUN A;  2L7M P;  3Q0V A;  4IHW A;  3M3Y J;  1TWF J;  2KQR A;  4PSX A;  1SAN A;  4P9F A;  3H5A A;  3U9G A;  4RAF A;  4IF4 A;  2YX4 A;  3L2W A;  2K40 A;  1K79 A;  1E3O C;  4KUM A;  4V2G A;  3L2Q A;  1SMY F;  4EJW A;  3V7R A;  4A6E A;  3TMO A;  1OCT C;  5IYB J;  4NC8 A;  2AQF A;  2KRC A;  2JN6 A;  1S7E A;  3K2A A;  4RB2 C;  1OJL A;  3WTU C;  5LEJ A;  1ON1 A;  1K4S A;  1MH4 A;  1XGS A;  4CCO A;  2PEX A;  2CQX A;  5E20 A;  4CHU A;  1I6X A;  3DWL E;  4BHP A;  3HHG A;  2GA1 A;  2X1E A;  3M8F A;  2VE9 A;  4M71 A;  1HOM A;  1BR1 A;  2Q8K A;  1Z67 A;  3DEU A;  1R58 A;  2FMY A;  4A3B J;  1G3W A;  4HDV A;  2VI6 A;  4O5V A;  2R4G A;  1OYW A;  5FFZ A;  4B1R A;  2XAG A;  4XKC A;  1G2H A;  3SFI A;  2DOF A;  5ILS A;  3DP7 A;  1YW7 A;  3OYE A;  3K70 C;  3L2R A;  3M8E A;  1Z1D A;  2UXN A;  4IQJ A;  1XMA A;  5EZH A;  3SQN A;  5K5O A;  1U2W A;  3E6B A;  2CWE A;  1XCB A;  3CJQ B;  2DA2 A;  2W85 A;  3JAM Z;  4G7O F;  3FXJ A;  2K4B A;  2BHY A;  3I53 A;  2NVX J;  3ZMU A;  2XAF A;  3DPT A;  3TKY A;  2E2I J;  3WHC A;  3LSI A;  2XSD C;  1HC8 A;  1EH7 A;  2PN6 A;  2VBW A;  1IUY A;  3ROU A;  3GUD A;  4ZYD A;  1STZ A;  1Z3Y A;  5JVG F;  1ZGJ A;  5FGM A;  2F6C A;  2HYJ A;  1OYY A;  3V7C A;  2L01 A;  1I1S A;  5LGU A;  1DGR M;  2HI3 A;  3MFK A;  1X19 A;  1UHM A;  3BCA A;  1BI3 A;  3GFL A;  3ZN1 A;  1IC8 A;  2HNH A;  2WBM A;  3V42 A;  2O0Y A;  3NAR A;  1AHD P;  3GTO J;  2M3A A;  3BG7 A;  2EPF A;  3CMM A;  4KN4 X;  4BHB A;  2V1X A;  4HF1 A;  5DYM A;  2H27 A;  1QRY A;  2M4G A;  4DBQ A;  1FTZ A;  1W5C C;  5CYV A;  2WAD A;  2ELH A;  4XON A;  2XHK A;  1G3S A;  3ZP5 A;  4KIS A;  1R5H A;  2HDW A;  3PL8 A;  4PGG A;  1MIJ A;  2EZK A;  1QNT A;  1T0F A;  4XRS G;  4M6X A;  3OYK A;  4YRV A;  3RDI A;  4IEJ A;  1QVU A;  2L7Z A;  3H9J A;  2MYS A;  3GLX A;  1DGW Y;  2P7C B;  3K4L A;  2X9D A;  1AKH B;  5J4V A;  3I56 I;  2DYS H;  2VC1 A;  1R4M B;  3LST A;  2M9H A;  2L9V A;  5ICG A;  2F2E A;  1YW9 A;  3CLQ A;  2GXG A;  2XGC A;  1AKH A;  3JR9 A;  3OYI A;  2O8K A;  2X48 A;  4XLA A;  3FBN B;  1POG A;  4HSR A;  9ANT A;  2Z3Y A;  4HLX A;  2JPB A;  4IRI A;  3GLL A;  4M3E A;  2IS6 A;  3EUH A;  1ULY A;  4LJZ F;  2CV2 A;  1NHA A;  4DZP A;  2IA2 A;  2Z9O A;  2F5E A;  3SZP A;  1Q1V A;  3H36 A;  3W2A A;  2QA4 I;  4OWR B;  2L9S A;  4CYC A;  3FK6 A;  2W7N A;  4XNF A;  1OQY A;  2RRE A;  3FMQ A;  4I99 C;  3G3Z A;  2EIK H;  3M8J A;  2E2H J;  2XV4 S;  3HOX J;  4YFX F;  1LDJ A;  1LQ1 A;  4LK0 F;  5F27 A;  1ETX A;  5K5R A;  1OLT A;  1XG1 A;  1IRZ A;  2LKX A;  2TDX A;  5JFR A;  2VN2 A;  1RPW A;  2JSC A;  2I5U A;  5E3O A;  3NAU A;  1XTA A;  4RM3 A;  1I50 J;  5E8I A;  2EJR A;  1QHH D;  1QVT A;  1S6L A;  4KN7 X;  5TGT A;  5D4R A;  2ZFU A;  1WJD A;  5FRM A;  2FOW A;  2LBF B;  2IT0 A;  3VOE A;  1S7O A;  4QPO A;  3F72 A;  1XSD A;  2DW4 A;  2LBF A;  1F4K A;  2H6B A;  5GAH J;  3CC2 I;  4C2U A;  3BTI A;  1EF4 A;  1Z9C A;  4ESB A;  3BQZ A;  3W2V A;  2NNN A;  2MD5 A;  1PYV A;  3M1E A;  1ETY A;  5FKO A;  3U2R A;  4WK8 F;  2DOD A;  3A03 A;  1U78 A;  4UVC A;  2VLA A;  4E7H A;  3J7A O;  4LFU A;  2O9L A;  3CCY A;  1X1D A;  3VB2 A;  3OIQ A;  4E4H A;  1SFK A;  3I3L A;  3HIF A;  5IT9 Z;  3DBR B;  4IHY A;  4BXU A;  4BY7 J;  2KJB A;  1MBG A;  3H5R A;  5E1W A;  4LG0 B;  1OYI A;  2BHZ A;  2XRL A;  3AG3 H;  5C44 J;  4U0W A;  3BPX A;  4LG0 A;  5DV5 A;  3KCC A;  3L00 A;  1LEB A;  3CUO A;  3TOA A;  5LLQ A;  2JJ7 A;  3PIP F;  1OCO H;  5D8K B;  2KIQ A;  1T8I A;  1S29 A;  4C3H J;  1U5T B;  1LJ9 A;  5A2Q Z;  2E36 A;  3DBH B;  4FE4 A;  2BZT A;  3DQV C;  3WTX C;  1U5T A;  2M4K A;  4QPQ A;  4KIB A;  2M8G X;  3H3U A;  4H0E A;  4A93 J;  2DOE A;  3FXQ A;  3RI4 A;  4RB3 C;  2XAS A;  2CW8 A;  2OQR A;  2K3F A;  4TV7 A;  2ESH A;  1FSH A;  2EIM H;  3F3X A;  4WX9 A;  5EDN A;  3EDP A;  1VQP I;  2PMU A;  1HDD C;  2KHM A;  1BC7 C;  4GDF A;  1Y56 A;  3LSH A;  3L7W A;  1P7J A;  5D5X B;  3CUQ A;  2QGU A;  2MH9 A;  4O6J A;  1R4N B;  1BIB A;  3G4S I;  2OPT A;  4PSW A;  1RRJ A;  4IOC F;  3PUB A;  3OY9 A;  1HXD A;  1HA8 A;  3BTJ A;  2EZI A;  2AHQ A;  4ENK A;  4RLQ A;  2MG4 A;  2FF4 A;  2VC0 A;  3HPG A;  2A61 A;  4RS8 A;  1BOA A;  3J80 Z;  3BT9 A;  2FA5 A;  4HOB A;  2L02 A;  1UG0 A;  3PSI A;  1B8I A;  1TW2 A;  4WWC A;  5E3N A;  2LFB A;  2Y69 H;  4JX4 A;  4N4O B;  4D9J A;  4JQF A;  2MFZ A;  1P92 A;  2ZJR F;  1W4M A;  3I4P A;  2ZXH A;  1RI7 A;  2V1U A;  3BR2 A;  1MMD A;  2M8E A;  3ESW B;  4PFP A;  1RC9 A;  2KIM A;  1YFH A;  2QZ8 A;  1T95 A;  2HOS A;  4ZZL A;  2NNY A;  2KDZ A;  2EIJ H;  6PAX A;  3E5U A;  3KX2 A;  1W5S A;  3VYS B;  2VOD A;  2XC7 A;  2CG4 A;  2CH0 A;  3P9I A;  3FXL A;  1GDT A;  1ETV A;  1OCP A;  4AU7 A;  2RC4 A;  3KEQ A;  2M45 A;  1F5T A;  3H35 A;  1D1A A;  5F64 A;  1DQU A;  3DF8 A;  3F22 A;  2DQR A;  3TDU C;  2P81 A;  1JJ6 C;  4BXX J;  3JAM K;  1YIT I;  1HF0 A;  3LSM A;  1SVL A;  2VKE A;  2E1M B;  5E18 F;  1PVE A;  2JA7 J;  4F7Z A;  2RNJ A;  3OYC A;  3QYF A;  5D5U B;  4J19 A;  3GTG J;  2WA0 A;  4II2 A;  2DK5 A;  5ILV A;  1JHF A;  4AVZ A;  3GW2 A;  4P5O A;  2GLO A;  2OCC H;  2CV0 A;  2OAZ A;  4N0B A;  4MFE A;  1X2M A;  1G3T A;  1LDK B;  3FK7 A;  3RPQ A;  2A5Y B;  1JT6 A;  1YQA A;  1R9T J;  2HPI A;  3WGI A;  2K9M A;  2NXN B;  3CJT B;  3S15 J;  3C18 A;  5M3F J;  3AL0 C;  2M0C A;  2M7B A;  3KYC B;  2X1D A;  1IN5 A;  4I02 A;  5K1Y A;  1BW5 A;  2GWR A;  3FKJ A;  1R6R A;  1ZH5 A;  3C2B A;  4XR6 A;  1I3A A;  4AIH A;  1L3L A;  2K85 A;  4P9U A;  3CDI A;  2DTR A;  4AIK A;  2BY0 A;  3J7A Y;  2KPM A;  2OTJ I;  3DBL B;  4EJU A;  3BDD A;  2X0L A;  4XQF A;  2L3D A;  4DZJ A;  1ZK8 A;  2MW8 A;  2ZXJ A;  3OL4 A;  3CDH A;  2BYV E;  5KNL A;  4RGR A;  1WPK A;  4E7I A;  2E60 A;  1PDN C;  2VJI A;  1QZZ A;  2IA1 A;  1QQI A;  3OSF A;  4BNC A;  2X85 A;  4L5E A;  2XRO A;  2K3P A;  1Y1W J;  1MNM C;  4QIW N;  3GFI A;  3FX3 A;  2WAQ N;  4GRI A;  5J8C A;  4UUV A;  2PBI A;  4RMN A;  3HOU J;  2O61 A;  1J5Y A;  2Z16 A;  2QSH X;  2CRG A;  3S3N A;  1R5I D;  2X1C A;  4L0Y B;  1PJR A;  4QSH A;  2CQK A;  1W36 D;  1FBS A;  3SEQ A;  2GAU A;  2IGM A;  1NG6 A;  4M3B A;  1PUF B;  2VOP A;  1V5G A;  2STT A;  2VL8 A;  3OYF A;  5DEQ A;  1PUF A;  4KJZ A;  4ZC3 A;  3HL2 A;  2NS7 A;  3RKX A;  1SAU A;  1T6S A;  2ZME C;  4LOC A;  5L3G A;  3AG2 H;  4BE2 A;  3AKZ A;  1D0Z A;  1JUM A;  5DDG A;  3KP2 A;  3E6M A;  4HNU A;  2R7R A;  4LGW A;  2IVM A;  1I1G A;  3R61 A;  2FSW A;  3BZK A;  2IRF G;  3S14 J;  4YFK F;  3MD2 A;  2PMZ A;  2KZV A;  4XOP A;  1FPQ A;  2LK2 A;  3I59 B;  1NK3 P;  3ASO H;  2HXI A;  1YOV B;  4IOA F;  3I59 A;  1JXS A;  1CQT A;  3UNG C;  4E7L A;  5L3E A;  2IGK A;  4CYD A;  5LHG A;  1D5Y A;  2K9N A;  1MND A;  2KRF A;  1O3Q A;  1LFU P;  2I10 A;  4MQ9 F;  3S3M A;  2HR3 A;  3DFG A;  1NK2 P;  3FXM A;  1XCV A;  3JRA A;  3WGH A;  1SD7 A;  2FOK A;  3M1C A;  5J1U A;  3GF2 A;  3HHH A;  4XRM A;  3WTY C;  2B9S A;  3WU2 C;  2NS0 A;  4Y17 A;  1ERD A;  4XLE A;  2DO7 A;  4IHT A;  2F4M B;  3KP6 A;  2RGV A;  2LF8 A;  4BEH B;  1D5V A;  2HZD A;  4A3L J;  5BS6 A;  3H92 A;  1LVA A;  2CW7 A;  2VBX A;  3HKZ A;  3F8M A;  2ZNZ A;  4GYG A;  5JLX A;  4HA8 A;  1VQ5 I;  1A6Q A;  3I58 A;  3OMY A;  1KYW A;  3F9K A;  3KE2 A;  4G9Y A;  1JGS A;  4ABZ A;  2HS5 A;  1U9O A;  5IOY A;  3J7Z I;  3C7J A;  1WHU A;  4XID A;  2ZCW A;  3F8F A;  4BUP A;  2PLY A;  1WJA A;  1MBJ A;  4CCJ A;  3RIR A;  4DYR A;  4UV8 A;  4B3X A;  3M7G A;  4F3Q A;  2V26 A;  5H6Q A;  2P5V A;  5D5V B;  1BI2 A;  2Q2E B;  1Z77 A;  2DI3 A;  2XPW A;  1WVR A;  5GAD J;  3O2P E;  1ONV A;  2R7D A;  2Y75 A;  4BQN A;  3QU3 A;  2HXO A;  5A2Q K;  1GXQ A;  1WJB A;  4EM2 A;  1GVJ A;  3U21 A;  1T33 A;  4IVN A;  1EV7 A;  4UHT A;  1EA3 A;  1ODD A;  1HBX G;  4Y52 J;  2OV7 A;  4FX0 A;  4HST A;  5JHF A;  5JLW A;  3CCS I;  1XX5 A;  3C2H A;  5KAF C;  1Z91 A;  2LTP A;  1X4O A;  2Q0O A;  4XSZ F;  5AIP A;  1V54 H;  3NWT A;  1MDM B;  3KEY A;  3QPS A;  2HGC A;  1YLF A;  4AIJ A;  1XSX A;  1B9N A;  1MDM A;  3R4K A;  1MMG A;  1UJ8 A;  3ZQL A;  4BH9 A;  3SFZ A;  1YX5 A;  2CUZ A;  1FP2 A;  3BTC A;  4CCK A;  2K02 A;  2QUF A;  2HQA A;  2ZB9 A;  1JKR C;  3R0A A;  4S04 A;  1K61 A;  3BRO A;  1JUP A;  1XDS A;  5IP6 A;  1D0Y A;  4ENM A;  3J80 K;  5FKN A;  4UVB A;  4C9Y A;  1RET A;  3ZPL A;  1VQM I;  1TL8 A;  3A1Y A;  5DM7 F;  4UNO A;  1QGP A;  1T0F C;  3B73 A;  2VAS A;  2YU3 A;  5HS7 A;  3D5S C;  2ZME B;  1P7I A;  3S32 A;  2QQ9 A;  1SFX A;  4U7D A;  2OA4 A;  3ABM H;  3KYL A;  4XKV A;  4XLH A;  3DTK A;  2HVS A;  4D7N A;  2OU2 A;  3MCZ A;  2W00 A;  1DP3 A;  1TZL A;  1IDY A;  1DP7 P;  2AQE A;  1WH5 A;  5C4J J;  1FOX A;  4PJN A;  3R0J A;  2P4W A;  2ZKZ A;  2JPC A;  3A02 A;  3DEW A;  3HEF A;  3CF2 A;  4GCV A;  2R7F A;  2A07 F;  2X51 A;  1IN6 A;  2QQ8 A;  3FMS A;  1YJ9 I;  3ZQG A;  2BOL A;  4CZC A;  2VBY A;  4IRH A;  1ZAO A;  4KFC A;  3ZOB A;  2E7X A;  2QEX I;  1Z3X A;  4EV0 A;  2DDB A;  3KEO A;  1TQP A;  5FB2 A;  1H0M A;  2CSO A;  2HTJ A;  2ZSH B;  3VDX A;  3PNV A;  1LEA A;  2HVR A;  2XF6 A;  3GFM A;  1LB2 A;  1IF1 A;  1YE9 A;  3LQQ A;  4HYE A;  4RAZ A;  2FXA A;  4N4N B;  3J7Y J;  2EFQ A;  1X1A A;  4HX4 A;  4XKW A;  4XBF A;  3HG9 A;  3ZMS A;  2VPL A;  1RKT A;  5CKT A;  2W82 A;  4YG2 F;  3LA2 A;  5M5Y J;  5TIS C;  5FKK A;  3HOS A;  5E3L A;  4EGZ A;  4LMY A;  1JE8 A;  1HST A;  4GFB A;  1T39 A;  5HDG A;  1OR7 A;  4HNT A;  4PK4 A;  2PFB A;  2OD5 A;  1X1B A;  2H1L A;  3TW6 A;  5KK1 A;  1A31 A;  4XLP F;  2Z99 A;  1U8B A;  2P0W A;  4IZZ A;  4XSX F;  1P9Q C;  3E0J B;  4KIT B;  1R49 A;  1QA6 A;  2QSF X;  2VXD A;  1LFP A;  3AG4 H;  4PGH A;  1TQM A;  3R60 A;  4AUX A;  5IPA A;  2LLK A;  2YUS A;  3DU6 A;  3WU1 B;  5IOZ A;  4A12 A;  3IH3 A;  2DQL A;  1ZRC A;  2L5Q A;  2R7O A;  3ABT A;  3LSJ A;  1T38 A;  3A4C A;  2BE5 F;  3DLA A;  2IBD A;  5CVU A;  2PJR A;  1KQ9 A;  1G59 A;  3Q9S A;  1U8R A;  4PJJ A;  2GXB A;  2R7U A;  2C6Y A;  2E34 A;  1R23 A;  1E3H A;  4F93 B;  3W6V A;  2PMH A;  3FIW A;  1BJA A;  4IHX A;  4HPQ A;  3RYR A;  5F1J A;  1XC5 A;  3E5X A;  4L18 B;  3HM5 A;  3OR1 C;  2P7V B;  1WFX A;  4RAG A;  5KVR A;  2JRT A;  2HU9 A;  1Y0N A;  4BE0 A;  1Z7L A;  1MBE A;  1O7L A;  5CVI A;  4ZZD A;  5L3B A;  2FQ4 A;  3I64 A;  2L2O A;  2M2E A;  3DPL C;  2M0M A;  5LRR A;  4A69 C;  4XMY A;  4B4C A;  5GPC A;  1WZ2 A;  5F04 A;  1VQK I;  2YPR A;  4BAY A;  2F5C A;  4W97 A;  5GP9 A;  1U5T C;  1HKT A;  3GCM A;  4RAY A;  4YEL A;  4UVA A;  2DA6 A;  4M3F A;  5D6E A;  5EF6 A;  5JI6 A;  1JUS A;  2H09 A;  5M5W J;  3IWZ A;  3CF5 F;  5HLT A; 
#chains in the Genus database with same CATH homology
 4A93 J;  3JRD A;  1JT0 A;  1WH7 A;  5FJ8 J;  2NOG A;  5EG0 B;  4C2M J;  3PO3 J;  2OF7 A;  3RZO J;  1HCR A;  5EG0 A;  2DMP A;  5EDN A;  1GT0 C;  1RES A;  4XIC A;  2CQQ A;  5J1Y A;  1HDD C;  5J1R A;  5GPA A;  1U9N A;  1P7J A;  3TP3 A;  3BG5 A;  2OPT A;  3Q0U A;  4MFD A;  2K9S A;  4IHV A;  1F43 A;  2Y31 A;  3BTJ A;  2EZI A;  2AHQ A;  5FKL A;  2MG4 A;  1TWC J;  2IAI A;  1IGN A;  1NTC A;  1OFC X;  3BT9 A;  2MSY A;  2DMN A;  5F08 A;  3S2D J;  1B8I A;  3S2H J;  2ECC A;  5E3N A;  2YU9 J;  2LFB A;  4JX4 A;  3G1O A;  5IYC J;  2VKV A;  1FIP A;  4CYC B;  3K7A J;  3JRI A;  4RDU A;  1IUF A;  3BR2 A;  1Z0X A;  2DMT A;  2XGD A;  3JRE A;  3MKL A;  3LNQ A;  1W0U A;  2HOS A;  5E3M A;  2KDZ A;  4BBR J;  2LP0 A;  2XB5 A;  3G1L A;  2ME0 A;  1GV2 A;  1GDT A;  1ETV A;  1IJW C;  1OCP A;  1MSE C;  2R5Z B;  2CUE A;  1MSF C;  4A3J J;  5F0H A;  1F36 A;  2P81 A;  4I76 A;  1JJ6 C;  4BXX J;  1X2N A;  3L1P A;  1HF0 A;  2VKE A;  1H88 C;  2D5V A;  2JA7 J;  1HLV A;  3GTG J;  4J19 A;  2O7O A;  5K7Z A;  2GLO A;  3HOY J;  2E1O A;  1VI0 A;  1ETW A;  4MFE A;  5DTD A;  1X2M A;  1MH3 A;  1TWH J;  3BR5 A;  1Y1V J;  3S1N J;  4EEF G;  2LR8 A;  3FK7 A;  1JT6 A;  2N8G A;  1R9T J;  1MBK A;  3UKG A;  3JRH A;  4UUT A;  2DA5 A;  4A3F J;  3S15 J;  3BTL A;  3LSG A;  4M3D A;  2EZL A;  5M3F J;  1IG7 A;  2M0C A;  2L7F P;  4A3K J;  1BW5 A;  1UMQ A;  2R0Q C;  1MBF A;  3C2B A;  2ECB A;  5FLM J;  5EZG A;  3WHB A;  4DYC A;  2DMQ A;  2X6O A;  2E2J J;  3B6C A;  4A3C J;  1JTY A;  2PMZ N;  4BBS J;  2EQR A;  2LVS A;  4V2F A;  1VND A;  3JRG A;  3ZQI A;  3SDG A;  3QPL A;  4G12 A;  1A6I A;  1ZK8 A;  2MW8 A;  4DZJ A;  2Y2Z A;  3ZQC A;  1WCM J;  1WPK A;  1ZTR A;  2TCT A;  1ZGW A;  2JA6 J;  1ZR4 A;  2NVT J;  2GBY A;  3RQI A;  4C3I J;  3OSF A;  2W48 A;  2Y9Y A;  5BNG A;  2EBI A;  4L5E A;  3LSP A;  2DMU A;  5M5X J;  1Y1W J;  3GBG A;  4QIW N;  1H8A C;  1MNM C;  1IDZ A;  3E7L A;  5M3M J;  3BR1 A;  4BY1 J;  2WAQ N;  2VUM J;  3HOU J;  3D1N I;  2CRG A;  5K7H A;  2DA3 A;  2L0K A;  1TWG J;  3RKQ A;  3G1M A;  1W0T A;  4QSH A;  2DJN A;  3GTJ J;  3TED A;  2FX0 A;  4M3B A;  2FJ1 A;  2NVQ J;  3VPR A;  1PUF B;  3HKZ N;  2ME6 A;  3BR0 A;  4C3J J;  3S1M J;  3I4M J;  1PUF A;  3O8G A;  1FJL A;  4JX5 A;  2NS7 A;  1BJZ A;  2DN0 A;  4LOC A;  1GV5 A;  2NS8 A;  1TC3 C;  1JUM A;  1BA5 A;  3BG9 A;  3HDD A;  3GTP J;  3H3V K;  2WV1 A;  4M6V A;  2XGE A;  5EEA A;  3S14 J;  1B8I B;  1JKP C;  2JA8 J;  4JYK A;  1ETO A;  2LK2 A;  3HGG A;  2B63 J;  1NK3 P;  1ETK A;  1O4X A;  1UHS A;  2HXI A;  3HOZ J;  1I6H J;  1X58 A;  3Q3S A;  3PO2 J;  3MVP A;  2FD5 A;  3LOC A;  1CQT A;  5EYR A;  1YRN A;  3M3Y J;  1D5Y A;  3HBL A;  2K9N A;  2L7M P;  3Q0V A;  4IHW A;  1TWF J;  1RKW A;  1SAN A;  4XK4 A;  1LFU P;  2EH3 A;  4D5F A;  2I10 A;  3PM1 A;  2QCO A;  1NK2 P;  2K40 A;  3JRA A;  1E3O C;  1A5J A;  4V2G A;  5J1U A;  4XRM A;  3BG3 A;  1IV6 A;  1ORK A;  1OCT C;  5IYB J;  1FEX A;  2H8R A;  4D7M A;  4A3L J;  2JN6 A;  1S7E A;  3K2A A;  1OJL A;  5JLX A;  3HGY A;  4A3M J;  3JRC A;  1MH4 A;  2ELK A;  2CQX A;  3S16 J;  3IH2 A;  1T56 A;  4ABZ A;  1U9O A;  5IOY A;  3S1Q J;  4I6Z A;  4BKX A;  3I4N J;  4XID A;  1HOM A;  1MBJ A;  1ZR2 A;  4A3B J;  2WB1 N;  4DYR A;  5C4X J;  2VI6 A;  2DA7 A;  3F0C A;  4B1R A;  3S17 J;  1VFC A;  2NVY J;  1B72 B;  1G2H A;  1Z77 A;  3SFI A;  1LE8 A;  2XPW A;  2Y30 A;  1H89 C;  1ENH A;  3BR6 A;  1B72 A;  2HXO A;  5EZH A;  2HOA A;  1JJ8 C;  2IEK A;  1DU0 A;  1T33 A;  2DA2 A;  4S0H B;  4MIM A;  4Y52 J;  5JLW A;  2NVX J;  2Y0S N;  2L9R A;  2HDD A;  2LTP A;  5EGO B;  3WHC A;  5DS9 A;  2JK3 A;  2XSD C;  1JKO C;  2E2I J;  4FCY A;  5EGO A;  3QPS A;  2HYJ A;  3FIS A;  2DTZ A;  3ZQL A;  3HB9 A;  2HI3 A;  3CQZ J;  2RAE A;  2COB A;  3CMY A;  1JGG A;  4HNV A;  1IC8 A;  5FKM A;  3HOW J;  3BTC A;  4QTR A;  3TP0 A;  1JTX A;  4AC0 A;  2ZB9 A;  1JKR C;  3GTQ J;  1K61 A;  3NAR A;  1AHD P;  3GTO J;  1JUP A;  4X1E A;  1GVD A;  2JMW A;  5IP6 A;  5FKN A;  3OIO A;  1QRY A;  4NDL A;  1RET A;  1FTZ A;  5IYD J;  3HOV J;  5IP9 J;  1ZQ3 P;  3M4O J;  5HOD A;  2CJJ A;  1P7I A;  5K7F A;  3OSG A;  2MGQ A;  2EZK A;  4UUS B;  2EZH A;  4XRS G;  2HQ5 A;  4D7N A;  2YS9 A;  1SFO J;  4XRS A;  1IDY A;  3LSR A;  4UUS A;  4IEJ A;  1QVU A;  4DYQ A;  1WH5 A;  4RBO A;  2L7Z A;  5C4J J;  1BW6 A;  1DU6 A;  2ID6 A;  3A02 A;  3A01 B;  2X9D A;  3DEW A;  3HEF A;  1AKH B;  1YRN B;  4A3E J;  3B6A A;  2M9H A;  5F0C A;  1GUU A;  3A01 A;  1JKQ C;  2XGC A;  1AKH A;  2KT0 A;  3ZQG A;  3JR9 A;  2O8K A;  2X48 A;  3O8H A;  3BQY A;  3ZOB A;  1POG A;  9ANT A;  2CU7 A;  2ID3 A;  3IV5 A;  4M3E A;  3TW7 A;  3JRB A;  2XPV A;  4JP0 A;  3ZQH A;  4DZP A;  1Q1V A;  2K9Q A;  2VPR A;  4FE7 A;  2H1K A;  4CYC A;  3FK6 A;  2JWT A;  2M34 A;  1RKT A;  2GM4 A;  2R7Z J;  2E2H J;  3ZQF A;  5M5Y J;  5FKK A;  3HOX J;  5E3L A;  4D5C A;  5F27 A;  1VF9 A;  4GFB A;  1ETX A;  5F0F A;  1XG1 A;  1IRZ A;  2XB0 X;  2LKX A;  3TW6 A;  2XPU A;  1RPW A;  2HOT A;  5E3O A;  1U8B A;  3NAU A;  2LY9 A;  2R92 J;  1I50 J;  2G0E A;  1APL C;  1QVT A;  1LFB A;  4FTH A;  1AU7 A;  3IH4 A;  1RR7 A;  2R5Z A;  1LE8 B;  5IP7 J;  2CUF A;  4AUX A;  5IPA A;  2LLK A;  2YUS A;  2TRT A;  1WGX A;  4A3I J;  1UG2 A;  5IOZ A;  3IH3 A;  1MBH A;  3BTI A;  1EF4 A;  3BQZ A;  3LSJ A;  1I3Q J;  2QF7 A;  3DCF A;  2IBD A;  1ETY A;  3MN2 A;  5FKO A;  2Y9Z A;  1ITY A;  3A03 A;  1U78 A;  4Y7N J;  4M3G A;  1BL0 A;  3W6V A;  1TWA J;  3GTK J;  3FIW A;  3S1R J;  4MLO A;  2O9L A;  4X6A J;  4IHX A;  5FLV A;  3CCY A;  3BR3 A;  4JX6 A;  2DA4 A;  4MO7 A;  5F1J A;  1ZKG A;  1XC5 A;  4W1U A;  1HDP A;  2R5Y B;  3HM5 A;  3JRF A;  3Q0W A;  2JA5 J;  1FIA A;  1ETQ A;  4IHY A;  2R5Y A;  4FIS A;  2R93 J;  3GTL J;  1MBE A;  3GTM J;  4BY7 J;  1MBG A;  2DA1 A;  2AO9 A;  2XRL A;  2FQ4 A;  1QPI A;  4B3A A;  3QQA A;  1XS9 A;  5C44 J;  2E19 A;  2M2E A;  5GPC A;  3H0G J;  3CDL A;  4B4C A;  4A69 C;  2LD5 A;  3RZD J;  4AYB N;  5C3E J;  5F04 A;  3OOU A;  2JJ7 A;  4DW6 A;  4W97 A;  5GP9 A;  4C3H J;  3SJM A;  3FKI J;  2DA6 A;  4M3F A;  1FTT A;  5EF6 A;  4A3D J;  4A3G J;  1JUS A;  4FE4 A;  1WI3 A;  5J3L A;  5M5W J;  2M8G X;  1K83 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...