1TC3C

Transposase tc3a1-65 from caenorhabditis elegans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the specific DNA-binding domain of Tc3 transposase of C.elegans in complex with transposon DNA.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*AP*GP*GP*GP*GP*GP*GP*GP*TP*CP*CP*TP*AP*TP*AP*GP*A
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11427 HTH_Tnp_Tc3_1 Tc3 transposase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1tc3C00
2VPRA 1BW5A 5GPAA 3GTLJ 2VKVA 5F0CA 1LE8B 2I10A 4A3MJ 5HODA 3IH3A 3JRAA 1PUFA 2LY9A 2GM4A 1WH7A 1TWAJ 1FIAA 2HXIA 1AKHA 3S1NJ 5EZHA 3GTQJ 1U78A 4XIDA 1JT6A 5IP7J 4BBRJ 1MBFA 1K61A 1P7JA 2DTZA 2K9QA 4V2GA 1OCTC 2NOGA 1JJ6C 3OSFA 3H3VK 1AU7A 2K9SA 4J19A 1R9TJ 2Y31A 4JX5A 4A3KJ 1G2HA 4RBOA 1LFUP 4RDUA 1JUPA 2R5YA 4FCYA 3HDDA 1B8IB 3S1QJ 1HDPA 4X6AJ 1AKHB 1I3QJ 2IEKA 3CQZJ 2LTPA 2XB5A 1JJ8C 2NVTJ 1HOMA 4B3AA 1ETYA 4M3BA 5JLWA 2R0QC 4M3DA 5F04A 4IEJA 4L5EA 3M4OJ 1VF9A 5FLVA 2JA8J 5F1JA 1VNDA 3W6VA 2JJ7A 2NS8A 1FEXA 5C4JJ 3LSRA 1B72B 4A3EJ 3HOWJ 4BXXJ 1MNMC 3TW7A 2ECBA 2R5ZA 1DU6A 2WAQN 4JYKA 1JTYA 5IP6A 2O8KA 4ABZA 1SANA 2X9DA 3MN2A 5FJ8J 1HF0A 1LFBA 2DN0A 2EZIA 4NDLA 1S7EA 3WHCA 4FTHA 2ID6A 4B1RA 4A3IJ 5GPCA 3TEDA 2OF7A 2HXOA 4LOCA 3QQAA 4MFDA 2JMWA 3M3YJ 3NAUA 4QIWN 2R5YB 3CMYA 1FTZA 1TWCJ 1JTXA 3HM5A 3CDLA 2X48A 5FKNA 3RKQA 3BT9A 3HKZN 1DU0A 4A69C 3D1NI 4Y52J 5F0FA 5IYCJ 4XRSA 5EDNA 4S0HB 1ZR4A 3GTMJ 3RZOJ 5IP9J 2ELKA 4M3GA 4DYRA 1VI0A 2RAEA 4QTRA 5EGOA 5BNGA 2L7ZA 4DZJA 5M3MJ 1ZGWA 1GT0C 1SFOJ 1GDTA 3BR6A 5DS9A 1MBGA 3K2AA 5E3NA 3OIOA 1Y1VJ 3TP3A 2ECCA 4DW6A 2CU7A 3Q0UA 2XPWA 4DYQA 2DA1A 2LK2A 2D5VA 3BR3A 1JKRC 4A3CJ 1OCPA 5K7ZA 2LR8A 3HOVJ 3BG3A 1MSEC 3S17J 1OFCX 1WPKA 2AO9A 3SFIA 4V2FA 1JKPC 1VFCA 1RPWA 3JRHA 2H1KA 2HOSA 1YRNA 3BG9A 5FKLA 5FLMJ 2TRTA 2N8GA 5IYDJ 1QRYA 1XC5A 1IJWC 1QVTA 3G1MA 1I50J 2YS9A 5EGOB 1ETXA 1H89C 1WCMJ 1XS9A 3FK6A 9ANTA 1NK2P 4MO7A 4D5FA 5IPAA 2YUSA 1B72A 2GLOA 3K7AJ 1F43A 3JRIA 3S14J 4AYBN 1HDDC 3MKLA 3GTJJ 2XPUA 2LKXA 2YU9J 1ZKGA 2OPTA 1F36A 1IDYA 2EH3A 3BR1A 1XG1A 3BQYA 3B6AA 3LSJA 1RKTA 4C3HJ 2NVYJ 3JRFA 2VI6A 2X6OA 4JX6A 2HYJA 2WB1N 4HNVA 2QCOA 2E2IJ 2FD5A 4BY7J 2JWTA 4UUSA 1ZQ3P 4D5CA 4C3IJ 2KT0A 3BTIA 4FISA 3C2BA 3TW6A 3FIWA 5FKOA 1ZR2A 4AUXA 1Z77A 5FKKA 3HOZJ 3HOUJ 3FISA 2LD5A 5M5YJ 2XSDC 2MW8A 5J1YA 3WHBA 3PO3J 4D7NA 2L7FP 3HOXJ 2H8RA 1MH3A 4CYCB 3HGYA 4FE7A 3S15J 1TC3C 4UUTA 1ZTRA 2FX0A 3S16J 3OOUA 3FK7A 4B4CA 2K9NA 1IG7A 2CUFA 2ME6A 2NVXJ 2CJJA 3JRBA 3LNQA 1NTCA 2MGQA 1TWGJ 2LFBA 3HB9A 2MSYA 1GUUA 3Q3SA 3UKGA 2XGEA 2ZB9A 2FQ4A 1FJLA 4DYCA 1D5YA 2VKEA 5IOYA 1RETA 4CYCA 1ORKA 2IBDA 1JT0A 2DA3A 3TP0A 1BW6A 3BR5A 1B8IA 4UUSB 3Q0WA 1YRNB 3IV5A 4I6ZA 2DA4A 2Y30A 2ME0A 2E2HJ 3BR0A 3G1OA 1ETKA 2HDDA 2JA5J 5C44J 4A3BJ 2CQXA 4IHYA 3VPRA 3S1MJ 1T33A 1GVDA 5F0HA 2L9RA 2TCTA 2DA5A 3LSGA 1T56A 3A03A 2WV1A 2CQQA 4GFBA 2Y0SN 5F27A 3IH4A 4JP0A 1EF4A 1K83J 3HOYJ 3BTCA 1JUSA 2M2EA 2Y9ZA 1A5JA 1ENHA 3LOCA 3SJMA 3RZDJ 1IDZA 4QSHA 2DMTA 2XPVA 2IAIA 1TWHJ 1ZK8A 1E3OC 1BA5A 3HGGA 2KDZA 5JLXA 3JRCA 3RQIA 5E3LA 3QPLA 2GBYA 2R92J 1IV6A 3ZQLA 1MSFC 4DZPA 5EG0B 3F0CA 1ETQA 3A01A 1IGNA 2NS7A 1U9NA 3ZOBA 3JRDA 5GP9A 2MG4A 2XRLA 5E3MA 1FTTA 2M0CA 2R93J 2LP0A 1ETOA 2FJ1A 3GTPJ 5M5WJ 3DCFA 2W48A 4M3FA 4A3FJ 1JUMA 2COBA 2DJNA 2LVSA 4EEFG 4XRSG 4XICA 1H8AC 2M9HA 2EZKA 2L7MP 1JKOC 5M5XJ 3BTJA 2B63J 3S2HJ 4A3DJ 3ZQCA 1GV2A 4M6VA 1Q1VA 4C2MJ 4IHXA 3LSPA 5IYBJ 1TWFJ 1RESA 3I4NJ 3GBGA 1JKQC 3CCYA 5M3FJ 1UMQA 4Y7NJ 3H0GJ 1CQTA 5FKMA 5C3EJ 3GTOJ 4IHWA 1X2NA 1IC8A 2K40A 5J1UA 2PMZN 5K7HA 2QF7A 5E3OA 1WI3A 3S2DJ 2ID3A 3JREA 2HOTA 4A3JJ 5IOZA 1HLVA 1ETWA 2E2JJ 3I4MJ 3E7LA 2HI3A 2EZLA 1AHDP 3HEFA 2E19A 1IUFA 1QPIA 3QPSA 2HQ5A 3BQZA 2Y9YA 3B6CA 5EZGA 4M3EA 3BG5A 1RR7A 1MBJA 4X1EA 2M34A 3GTGJ 1W0UA 1NK3P 2E1OA 3BTLA 3JRGA 2EQRA 1O4XA 4A3GJ 3PM1A 2M8GX 1HCRA 1X2MA 2NVQJ 1FIPA 3GTKJ 2JN6A 3Q0VA 2JA6J 1PUFB 3ZQFA 3SDGA 1LE8A 5K7FA 1MH4A 5EG0A 1MBHA 1UHSA 5J1RA 3A01B 2AHQA 4C3JJ 2L0KA 5EF6A 4I76A 3IH2A 1WH5A 2CUEA 3PO2J 1Y1WJ 1UG2A 2DA6A 4MFEA 1JGGA 4BKXA 3BR2A 2G0EA 3ZQGA 4AC0A 2O9LA 2CRGA 3OSGA 4MIMA 4MLOA 3S1RJ 3NARA 1A6IA 1MBEA 1BJZA 4G12A 3G1LA 1OJLA 3A02A 4XK4A 1U8BA 5C4XJ 3O8HA 1IRZA 4W97A 4IHVA 4XRMA 1BL0A 1POGA 1W0TA 2EZHA 1H88C 3JR9A 1MBKA 1Z0XA 2R7ZJ 1QVUA 2JK3A 2XB0X 1P7IA 2DMNA 4A93J 2DMUA 3ZQHA 2JA7J 3HBLA 1WGXA 2VUMJ 2Y2ZA 1APLC 5EYRA 2R5ZB 3L1PA 4BY1J 1X58A 2XGCA 1GV5A 4A3LJ 1ETVA 2DMQA 2P81A 2LLKA 3FKIJ 1I6HJ 4D7MA 2DA7A 1RKWA 1ITYA 5DTDA 1U9OA 2EBIA 2O7OA 5EEAA 4BBSJ 2XGDA 2DMPA 3MVPA 3DEWA 5J3LA 3ZQIA 2DA2A 4FE4A 3O8GA 5F08A 4JX4A 2HOAA 4W1UA
chains in the Genus database with same CATH superfamily
3C3WA 5HOOA 1BW5A 2VJIA 5BS6A 3MAJA 5F0CA 2K27A 4NHJA 3DBRB 4RA2A 3OR2C 5L3EA 2G7HA 5CVJA 5DDGA 4HNTA 5EZHA 4BJ6C 3TDZC 4CZCA 4XIDA 4YEJA 2QGUA 4BBRJ 3IC7A 4BGDA 2F5CA 2R7QA 1K61A 3RPQA 1P7JA 1J0RA 2DTZA 2K9QA 1T0FC 1R22A 2CS3A 2NOGA 3WU1B 1JJ6C 3OSFA 3H3VK 2EFPA 3PFYA 2HQAA 2JSPA 2Y31A 3PL8A 4Q47A 1R9TJ 4IX7A 4RBOA 1HKTA 4YIIA 2VOPA 1FT9A 1TP4A 1SFKA 2W82A 1PYVA 4X6AJ 3EYYA 1I3QJ 3M7GA 2V6CA 3K4JA 1JJ8C 2NVTJ 1HOMA 1YE9A 4B3AA 1ETYA 3H1CA 3CO7C 4FT8A 2KL4A 1GXPA 2UWMA 4U0WA 1J5YA 2OTLI 5FLVA 1W5SA 2A68F 2IJLA 4L5IA 1A35A 2JQ7A 3K1MA 1U5TA 4PSXA 2BY0A 4ON0A 1QNTA 3DF8A 3LSRA 3QU3A 3TW7A 2R5ZA 2WAQN 2V1XA 5IP6A 2ADUA 4G7HF 2O8KA 1PUEE 3DTIA 4OIRF 4DGWB 2FRHA 3AG2H 3I4PA 3PJRA 3GZ5A 2EZIA 1PP8F 4NDLA 1G3TA 3WHCA 2R7OA 2FF4A 2VODA 1VQLI 3N4MA 2H27A 3L2VA 1SFXA 3V7CA 2QZ8A 5F6FA 4Y3OA 2DK8A 4BEHA 4QIWN 4BEHB 2YSRA 1WJFA 3HM5A 1V5GA 2V9KA 1B9NA 1HSJA 2DDBA 1XCBA 2FE3A 2NS0A 5FKNA 3RKQA 4BQQA 3HKZN 3FMRA 5IY5H 4XRSA 4A12A 1B59A 3DKXA 2R7RA 3F8FA 3FHZA 3GTMJ 3KZYA 3CTAA 4EM0B 4CXFA 4ENKA 5IT9K 4NQWB 3E6CC 4LJZF 1VI0A 2VBWA 3O2PE 2RAEA 3A4CA 3RKXA 5EGOA 3CC7I 3TO7A 1RZ4A 1TT0A 4CCJA 4XNFA 1LEBA 5LEKA 5KAIC 2MA3A 3DKYA 1X1BA 4F92B 2HR3A 3OYEA 1SFOJ 1GT0C 2X0LA 4RLQA 2ZC2A 1QO0D 2ZXJA 5F1RA 1JXSA 1K6OA 3CC2I 1Z6TA 2A61A 3PSIA 4DW6A 5JHUA 4HX4A 2XPWA 1E2XA 4Q4ZF 2LK2A 3BR3A 4HRIA 2KZVA 1FSEA 4LLGF 3U2RA 2E1NA 4BQNA 4A3CJ 4U7DA 1ZH5A 3H5NA 4HEA2 3HRSA 3RIRA 4PSWA 2V4JC 1ZAOA 4BHPA 1X19A 3ZMUA 3QP5A 5GAEJ 1WPKA 3SFIA 4EGYA 1TTYA 4A0YA 1RPWA 3F8CA 4BE0A 2VLAA 1X4PA 2EFQA 4KITB 2ISZA 1R23A 3BG9A 3ZMTA 1ZLKA 2KRCA 5IYDJ 1QRYA 3E5UA 1UHWA 1EV7A 3G1MA 1K79A 2XAUA 4Y15A 2FBKA 4AIHA 5EGOB 3OY9A 3DBLB 1R71A 3K0LA 1H89C 4I7HA 5CJ9A 3PNTA 4CCNA 3I56I 3NRVA 4D5FA 1BI2A 3F23A 1G6NA 1B72A 4XONA 5FD6A 3GYHX 2Z33A 2XPUA 3K70C 3PIPF 4A6DA 1ZKGA 3OYAA 2YU9J 3QWLA 5CVVA 2EH3A 2E35A 3BR1A 1CF7A 5CQGA 2OU2A 3O6BB 4B3XA 1D8KA 2QCOA 3TGNA 2BY2A 3HTUA 2FNAA 4BE2A 2E1CA 2PJRB 3ESWB 2AXTC 4ENNA 4RB3C 4C3IJ 3C2BA 4FISA 3DTEA 3CF5F 4F3QA 4IL6C 1NG7A 2CYYA 3MKWB 4H4KC 4PDKA 5CKTA 2Q2EB 3LWFA 2XSDC 1LJ9A 5J1YA 3JTHA 2HKOA 4HYEA 5K5QA 3OYCA 3VWBA 4BJ5C 3S15J 3TO6A 4UUTA 5LGUA 5EEHA 2FX0A 1T6SA 3OOUA 1V4RA 3JSOA 2ME6A 2CJJA 3JRBA 4XSXF 2M4KA 5HLIA 2FEZA 1TWGJ 1A04A 1QZYA 2XGEA 5GAGJ 4UVCA 1E17A 2E34A 2ZB9A 2KKOA 1FWZA 2MLKA 4EATA 5IOYA 1C0WA 3W2VA 3CCLI 3WTZA 1LVAA 2DLLA 1ACIA 5DEQA 2L9VA 2LC2A 3LL7A 2IS6A 4LLLA 2BZTA 3IKVA 4MEXF 2MLGA 1YX5A 4WXDA 5HS9A 4MTEA 1O3SA 2RREA 2E2HJ 2ME0A 3HYIA 3G1OA 4LG0A 5LRSA 4F93B 4IOCF 2Q2EA 1SD7A 5F0HA 2V1DA 2L9RA 3MD2A 2TCTA 4PJLA 3E0JB 2CFXA 5H6RA 1MJBA 1OCOH 4HX7A 4S05A 1T56A 3A03A 4I98B 3RPUA 3CCQI 5LHGA 2Y0SN 5F27A 1IAWA 3KP7A 1K83J 3K4NA 3BTCA 1MD0A 3R0AA 4CZZA 1A5JA 3LOCA 4G6TB 3F8BA 3T8RA 3SJMA 3C1DA 3H9QA 1IDZA 2KRHA 1W1WE 2L9NA 2XPVA 2ZJ2A 5TISC 3DQVC 2FOWA 4I0BA 3X2QH 1MSFC 1LVKA 5EG0B 1OPCA 3F0CA 2VXZA 1YIJI 2UV1A 2NS7A 1P6RA 4LIUA 2IA1A 3S8PA 3QODA 2XVCA 4WCGA 1TNTA 2DO7A 3ERED 1FTTA 4HSTA 3ZN0A 4QLCU 1BR1A 3C2HA 4P1WA 1ETOA 4KISA 2K86A 2ZSIB 3DCFA 5CLSA 4OMYA 4M3FA 1MMGA 3GLLA 2NNNA 3HSEA 4ENMA 4NNJA 4HLYA 1R1UA 2GWRA 2W1OA 3BTJA 1BM9A 4M9SA 5FGMA 2EWNA 2PMHA 4O5VA 1OKRA 1S7AA 1Q1VA 2HQRA 2RQQA 2CO5A 2MD0A 2HEOA 1I3AA 2LMDA 2ZNYA 3RJPA 5IYBJ 3LSPA 5ILSA 4IHXA 4UV8A 4LIVA 3GBGA 1OQYA 3BZCA 1AOYA 5C3EJ 3FXUA 1X2NA 1R1VA 1K6YA 3KEYA 3QPHA 2QEXI 4ZDOA 2VPLA 3GUDA 4I2OA 1SEUA 1G59A 1F5TA 3LFKA 2E2JJ 2K3PA 1W5TA 4G7ZF 2MD5A 4B44A 1SFEA 1Z7LA 3CUOA 4BS9A 1WJDA 4IRIA 2K9MA 1QPIA 3PNVA 2OJED 1ZGJA 1HQCA 1HKQA 4M3EA 2F2EA 3K9TA 2EV5A 2M87A 3EYIA 1LNWA 2EINH 4HDUA 3PQJA 2VE8A 2FU4A 1VQ4I 4AWXB 2KIFA 2DOAA 2EIKH 4RMNA 1Y8RB 4AM3A 2QQ9A 4XLEA 6PAXA 1FIPA 5JI6A 2F6CA 2JN6A 1P4AA 1U8RA 3J81Z 3CUQC 1EJ9A 2JA6J 4ZJZA 2PX9A 1RNLA 4XN0A 1XGSA 2CW7A 1LE8A 3ECHA 3ABTA 3FM5A 1MH4A 1R5GA 4CCKA 3N05A 5E1ZB 4HF2A 1WVRA 1QU3A 2AHQA 2HU9A 1SMTA 2XC7A 2X1EA 2W84A 2R3SA 4K2EA 3BPVA 4AVZA 2CH0A 2P7VB 3ERMA 1LPQA 4AC0A 2V1NA 3QYBA 2A3SA 4I0AA 2LREA 4YFXF 1GVJA 2ZJPF 3NARA 3WU0A 3EUKL 1QZZA 1RUNA 1GLNA 3LQRA 3FM3A 3OOPA 1ZREA 2F5DA 1S9HA 4KMUX 3A02A 4ZTFA 4W97A 4IHVA 2EJRA 1K4SA 1KYWA 1WQ2A 1BL0A 2R7UA 3QU6A 1POGA 3U1KA 1W0TA 1VQPI 1MBKA 2R7ZJ 4ANJA 1R00A 1QVUA 2JK3A 2F5VA 3NEUA 1P7IA 1MNEA 2DMNA 3SEZA 1KU7A 2QBYB 4A93J 2QKLB 1P9QC 2EA4A 2K9LA 2VUMJ 1BI3A 2HVRA 2PQ8A 2ZFUA 5EYRA 2IGMA 4BY1J 3OL3A 3S3MA 1TZLA 4M72A 4XKVA 4A3LJ 1UELB 1MDMA 2HTJA 4GRIA 1IN4A 4UB6C 2FOKA 3BZ6A 2DFIA 3RQ4A 3FKIJ 1I6HJ 1W36D 3U9GA 4D7MA 2DA7A 3C7JA 3ZR8X 2K4JA 3IRRA 5EEAA 3AL0B 3C2GA 2KISA 3FMSA 3MVPA 4EGZA 4P9UA 1V3FA 2R4GA 2O0YA 3BWGA 3O8GA 1XMAA 5LRRA 4R1HA 2A6TA 2E71A 4JX4A 4MEYF 1IN5A 5DS9A 3VYTB 3K1NA 2VPRA 3GTLJ 2DW4A 5B3SH 2V26A 5BOXA 1R7JA 3BDDA 5JHFA 2I10A 4A3MJ 2XASA 4L9NA 1PUFA 2GOXB 2XF5A 3PUBA 4EVIA 4XLFA 4EJWA 2HXIA 1AKHA 4ZTJA 3I71A 1REPC 2H09A 1MBFA 3VB2A 3ZN1A 1WJBA 3M8FA 3IAS2 2CV0A 4CO8A 5D5UB 2VE9A 4IQJA 2PMZA 3QOEA 4V19K 3DU6A 2VONA 3K4LA 1RIOH 1FP1D 4JX5A 4RS8A 3IUOA 4RDUA 5LBQA 2VIXA 4RAZA 4FCYA 3O3KA 3HDDA 1YYVA 5ERIA 1ZYRF 2P5KA 1B8IB 1O57A 2JPBA 5HS7A 2LTPA 1KYZA 4E7SA 2XB5A 1VQ6I 3G2BA 3DWLE 3GZNB 3I0TA 2G9WA 1XX5A 2OZUA 1LEAA 1J7KA 5TJJA 1SD4A 1T8IA 4M6XA 4M3DA 1OCCH 2ZXHA 2WADA 4L5EA 1VQ9I 3M4OJ 2X1DA 1VNDA 3W6VA 2DYRH 4BXFA 2JJ7A 2NS8A 2W4SA 5C4JJ 1B72B 4BXXJ 4A3EJ 2ECBA 2EFOA 1OYIA 4YFKF 2LBFB 2WC2A 5CVUA 3FF5A 4FQGA 3HUGB 1BOBA 4ABZA 4B09A 3D5LA 1TBXA 4NC7A 3MN2A 4KFCA 1HF0A 5DD4A 1LFBA 3CUQA 4QPOA 2A6HF 2P7CB 2DN0A 1P2FA 2DYSH 1S6LA 2ID6A 4B1RA 4A3IJ 3KFWX 2R7SA 2PMUA 2OF7A 2HXOA 1HKSA 4LOCA 3CCSI 1PP7U 4GO1A 4PZJA 2VT2A 2E7XA 2KLOA 5H20A 4IXAA 1Z21A 4NUBA 2VKDA 4MQVA 1HW5A 4WX9A 2Z1DA 2M7AA 2E5NA 2JA2A 3HRMA 3Q5FA 5K5OA 1Z91A 1U0JA 2WB1A 3D1NI 1S7OA 3I5UA 5F0FA 4BYYA 5EDNA 3MZYA 2D45A 2HDWA 3GZ6A 4R8HA 2CMPA 1V5EA 5D6FA 3BY6A 3D5RC 2VN2A 5GADJ 2RV8A 5IP9J 4M3GA 3JAMK 2CV1A 3L2CA 5J4VA 4E7KA 1JE8A 2LF7A 3IAM2 3CP8A 5FD5A 2F4OB 2H94A 3ZMZA 3L9FA 5BNGA 4BH9A 1K7AA 3HJEA 1N75A 3MQ0A 1E0EA 2IXSA 3K2AA 5E3NA 3L00A 4EMSA 3OIOA 2EIJH 4L9VA 4RB0A 2FXAA 4OU0A 5FROA 3MZ8A 5A2QZ 4DOZA 3IRQA 3L09A 2BW3B 3W2AA 1OR7C 2LNBA 1NG6A 5ICGA 1DPUA 5FO5A 1OR7A 4IVNA 5ICEA 1IN8A 1OCPA 2XF7A 2STWA 1UG0A 2LR8A 2V9PA 1K4TA 3HOVJ 4H0EA 3TOAA 5E1WA 3ONQA 3OYJA 1ERDA 5DD8A 2AO9A 4OOIA 5K1YA 3AL0C 4EQQA 2AQFA 1JKPC 1MMAA 1XGMA 3T1BA 1VFCA 2DPDA 3CMEI 1YRNA 4O3MA 1KU9A 2TRTA 2N8GA 2ISYA 3DEUA 3BOQA 4U88A 1XC5A 1QVTA 2YS9A 5E18F 1ETXA 4XRFA 2FQ3A 1XS9A 4DBRA 3OR1C 1NK2P 1YLFA 4MO7A 4ESJA 3K7AJ 3DLLF 1FY7A 5KAFC 4ITVA 1QGPA 2XSJC 3JRIA 3COAC 3GTJJ 5J47A 4U7BA 1XMKA 2VBZA 3GF2A 2OPTA 3DPUA 3OS0A 1DQUA 1IDYA 3LSJA 1XG1A 2CSOA 1V5FA 1YIOA 2VI6A 2CGPA 4ZYEA 2E2IJ 3WTTC 3WTSC 4UUSA 4D5CA 3F6VA 3TW6A 3FIWA 5FKOA 1ZR2A 4BJTA 4AUXA 3PNYA 5FKKA 3MMYB 2CWEA 3FISA 5M5YJ 2MW8A 2QENA 5J6XA 4P5OA 3KE2A 1ZLJA 3P7NA 3PO3J 4D7NA 3S32A 2H8RA 1MH3A 5FFXA 1I27A 1ZTRA 2I8DA 4HBLA 4B4CA 1E3HA 2K9NA 2CUFA 3TBIA 3G73A 4PFPA 3CCVI 3HC7A 2MGQA 3QPTA 3HB9A 2OA4A 3RTRA 4E7ZA 1BJAA 3UKGA 2Z16A 1FMWA 4CGZA 1USSA 2FQ4A 5ILUA 3HSRA 4DYCA 1D5YA 4B43A 2IRFG 2LG4A 1RETA 1R5ID 1WRJA 4KT5C 3Q9SA 3TO9A 4S04A 2Q8KA 3TP0A 2DOEA 3BR5A 1XB4A 2HFHA 2VKHA 4UUSB 4A0XA 2PN6A 3Q0WA 4HQEA 1S8NA 2K4BA 4DNCA 3CLOA 3IV5A 2Y30A 1Y6IA 4HA8A 2E60A 5BMZA 4RAGA 2NNYA 4A3BJ 2CQXA 1YJWI 4LMYA 3VPRA 3ZP5A 1T33A 2HQNA 1GVDA 5BPDA 2ZMEC 1UAAA 2DA5A 4F55A 1IRFA 1TLHB 3A1YA 4UY8I 4GFBA 1IW7F 4XLAA 4YFNF 2XAHA 2KZGA 4JP0A 1YQAA 1MZBA 2GAUA 3LAJA 3BJ6A 3ABLH 1FBQA 2PBIA 4YIRX 4QSHA 4HV6A 5D5WB 2GA2A 1BA5A 2BY1A 3KP4A 4NB5A 3RYRA 3A2KA 5JLXA 2X6WA 3WTUC 5E79C 3CDIA 3I54A 4IHTA 3M8EA 4HQMA 1OCZH 2J5PA 2VC0A 2LY1A 3ZQLA 4DZPA 3VFZA 5KNLA 1IGNA 2I5UA 3H5AA 3ZOBA 2XRLA 3K4MA 1QQIA 1WJAA 1WI9A 5B1BH 2DCEA 2R7FA 3CJNA 5A2QK 2ZJRF 2LP0A 2DJIA 1W7PA 1JHHA 2OQGA 3HKZA 2FJ1A 2K02A 5ILVA 5J40A 4JBAA 1XGNA 1SVMA 4A3FJ 5AONA 3VSKA 3CMMA 1P92A 2COBA 2DJNA 2Y48A 4EEFG 2OCCH 1YS7A 4XRSG 2KRFA 2KIMA 4DBQA 1O3TA 2L7KA 2M9HA 2QBYA 2L7MP 1JKOC 2B63J 3MCZA 3CJTB 2BYVE 1S29A 5IT9Z 4YG2F 2IT0A 1XTAA 3AKZA 2R7WA 4N0BA 3JSPA 2EPFA 3I4NJ 3CJRB 5E8GA 1TT5B 3H9JA 1UCRA 2ELJA 2K7LA 4Y7NJ 1S5LC 1SVOA 4GYGA 4CDGA 1W5CC 3BLYA 2VT3A 4LD5A 4UVAA 2BBYA 2HTSA 2Y75A 1VQNI 2M30A 2QF7A 2VOOA 1WI3A 1I1SA 3A0HC 1H9GA 3ZMSA 3S2DJ 3RCOA 1CGPA 2ID3A 2RQPA 3JREA 2HOTA 4A3JJ 1BOAA 5IOZA 2M4GA 3I4MJ 2MC3A 1Y56A 3E7LA 3FWEA 4FX0A 3M9AA 2EZLA 3ABMH 1AHDP 4JOMA 1A6QA 5FFZA 2CV2A 2LH9A 2E19A 1IUFA 3K6GA 3LA7A 5J4YA 3BQZA 5EZGA 2BVMA 1D3YA 4IHSA 1RC9A 2X85A 4RGXA 3L2RA 2D1VA 4WXHA 2EFWA 3GTGJ 1Q1HA 4XLCA 1T2KA 3H5RA 3H92A 3JRGA 1A31A 2NXNB 2EQRA 2P6TA 2KFDA 3AAFA 1HCRA 2M8GX 3CUQB 4DQ2A 2DK5A 1W7PB 2NVQJ 3GMEA 4E6KG 2A07F 1ZELA 3Q0VA 4KT6A 3OYIA 2HVSA 5KVRA 1LB2A 1T38A 2PJRA 2AQEA 1PUFB 2GXAA 2M7BA 5DM7F 2DODA 4IRGA 4PCQA 5K7FA 2JUCA 3OIQA 3GCMA 4E7LA 1UHSA 2DTRA 4JQFA 3L7WA 3NWSA 2X4HA 2NRAC 1DUXC 3B02A 2DAOA 3M1EA 1VQOI 3GLXA 2QQAA 1U5TC 3PO2J 1FOXA 4BKXA 3BR2A 3SFZA 2G0EA 4L9TA 3ZQGA 5FRMA 3HIFA 2L3DA 2DFHA 4OINF 2O9LA 3ASNH 4MIMA 4MLOA 5JR3A 5ICFA 4XM3A 3H9GA 1P4WA 2Q1ZB 1OJLA 4XK4A 1U8BA 3SEQA 2AXLA 1I6XA 3OV8A 1A36A 1H0MA 3K70D 2ELHA 3CCJI 2EZHA 2M1BA 2KJBA 4IJAA 3ULQB 1ODDA 5FLXZ 1IZ1A 1HA8A 2ZKZA 2IVMA 5D5XB 3GX4X 4CYDA 2H8WA 1ON1A 4BACA 3LQQA 2X6YA 1WGXA 1FSHA 2BW3A 2Y2ZA 3WTYC 1RUOA 2R5ZB 1LKXA 2WV0A 4PGGA 1X58A 2YX4A 1TW2A 2XGCA 1GV5A 2X51A 2QYOA 5FRNA 1ETVA 1V54H 1R1TA 2L4AA 1MNDA 2LLKA 2WY8Q 4G9YA 3WE3A 3P9KA 3R0JA 1RKWA 2VQCA 3V4GA 3BJAA 1ITYA 1U9OA 4X0GA 2EBIA 2O7OA 1ZRDA 1J59A 3I53A 4BU2A 2P4WA 1SFUA 3PUFA 3DEWA 2EB7A 3ZQIA 4FE4A 4RGRA 3F21A 3TQNA 3F9KA 5F08A 3QOPA 4KYWA 1ZARA 3H3UA 2HOAA 3FXLA 2XV4S 1UHMA 3DPLC 2O6GE 2OCEA 3TL4X 4RGSA 3RSNA 3T0YA 5HODA 3JRAA 2GM4A 1WH7A 3FHNA 1F4KA 4XL9A 2W7NA 3GTQJ 4CHUA 2WY7Q 1HW1A 2IGNA 2VJ5A 5DM6F 3E5QA 1TQPA 2QQBA 1J09A 3AG3H 1QZEA 1AU7A 1R36A 1KQ0A 2K9SA 2PEXA 1TW3A 1ZG1A 1HC8A 1G2HA 2XAFA 5DUKA 1JUPA 3OYLA 4KIGA 3LMMA 3J7AY 3K4KA 4OMZA 3JAMZ 1HDPA 1AKHB 3QYFA 1IO2A 1G3WA 2Y0MA 1CF7B 1Z9CA 1VQ7I 1IV8A 2VC1A 5JLWA 3HRTA 2R0QC 4FETA 3FBNB 3GO5A 4L5JA 3OYHA 1VF9A 4JK1X 5B66C 2XUBA 1VTNC 4BAYA 2JA8J 5F1JA 1YOVB 2ZXWH 3OS1A 4DJAA 5DUIA 3BG6A 2LYCA 3GXOA 4ZZLA 1DU6A 1MKMA 1HW2A 1JTYA 3BZKA 4G6QA 3EETA 2YPRA 2VQHA 2VBYA 4EM1A 2X9DA 4F52A 3FXQA 5DCMB 4LLNA 3V8JA 4LB5A 3TEDA 2DDAA 2JVHA 4PK4A 3JTGA 1USTA 3DFGA 2L01A 3EUAA 4HZFA 3NAUA 3CMYA 3R6SA 2P5VA 4KJZA 4Q48A 4ZZDA 2X6XA 4XR6A 3HOTA 2JRMA 4KUMA 4M73A 2X48A 5LHHA 4UXNA 3BT9A 3ZRGA 1DU0A 2HS5A 3M07A 2EV0A 4N9IA 5CVIA 2RN7A 4IQ4A 3WG9A 2HYFA 5IYCJ 3OWTA 1EH8A 2IA0A 2VJ4A 3J7YJ 1ZHFA 3DXJF 3RZOJ 2CUZA 1YO5C 2JUGA 3PFIA 1IRXA 4Y33A 4OIQF 4AU7A 2KMUA 2B9SA 1J2XA 4QTRA 4M71A 5H2FC 4UV9A 3F3XA 2L7ZA 4DZJA 5M3MJ 2CQ7A 3OYFA 1ZGWA 2XKPA 3BR6A 1MBGA 3VYRB 1N25A 4ZDPA 1D1AA 3BG7A 3TP3A 4PJJA 3OIPA 3P5JA 1Y0UA 2DT5A 3Q0UA 4F91B 2WA0A 4E4HA 1HSTA 2DA1A 1QHHD 4OAYA 2D5VA 5EJCA 2ZXIA 1JKRC 2H1LA 2OAZA 2R7TA 2RNJA 5JVGF 3RKWA 1LUJB 2FBHA 3BG3A 3KPHA 3FXRA 1D1CA 3SZGA 3S17J 2ICWG 4LB6B 1DDNA 4XOTA 4V2FA 4ZH4F 4KICA 2H1KA 3JRHA 2HOSA 2L54A 2E7WA 4B48A 3VSLA 5FKLA 5FLMJ 5HLHA 4BNCA 3LSHA 1U3EM 3FMQA 1YHQI 3E1SA 1IJWC 3FBIB 4WF2A 2RKHA 4CUGA 2FSWA 1WHUA 2XAGA 2OD5A 3DTKA 2MABA 3VDXA 2XRNA 2YUSA 4WXCA 2Z99A 1F43A 4AYBN 1LFPA 4RM3A 3MKLA 1HDDC 5BPIA 4KIBA 4RGUA 2V6EA 4CH7A 4BUPA 3T5XA 2V1UA 4C3HJ 2NVYJ 2EFNA 4G94A 2BOLA 1SD6A 4JX6A 2HYJA 4I02A 2GXBA 2P6SA 3KYCB 1W4MA 2FD5A 3NWTA 4BY7J 4HLXA 2JWTA 2PLYA 3GFIA 1IUYA 2KT0A 2GOMA 2IGOA 3BTIA 4C9YA 4DIQA 1WZ2A 4D1QA 1Z77A 3R4KA 1G3SA 3U1DA 3F22A 3HOUJ 5HLGA 3OYMA 3W2WA 1FOWA 1WJCA 3R61A 1XCVA 1JI8A 3SHFA 2L7FP 4XORA 4CA0A 3HOXJ 1X1AA 4CYCB 3HGYA 4ESBA 3RYPA 4C2UA 4XN3A 5FB2A 1TC3C 4PFOA 3G6EI 4O6JA 5DV5A 3S16J 1VQ5I 1D1BA 3SXYA 2ESNA 4GCVA 1P4XA 2CQKA 3LNQA 1BI1A 1KQ9A 4RLFA 1W36C 4KNYA 3PSFA 2LFBA 1FP2A 1LDJA 1FBUA 4QWQA 1ZG5A 3Q3SA 4XBFA 4C30A 3WGGA 4XOPA 3RPUD 2AS5F 2HNHA 4IPAA 1FJLA 1ZN2A 2VKEA 3TDUC 2H6BA 4A5NA 2HYGD 3HZJA 4IO9F 2E1MC 1XSDA 1JT0A 2DA3A 4RB2C 1BW6A 3FXKA 5D4RA 3QP6A 3WGIA 2BHZA 2JRTA 2E1MB 2BXYA 1X3WB 5L3GA 2MYSA 1T0FA 4FASD 1KGSA 1U2WA 1ETKA 3KETA 1BN5A 2ZMEB 3V8KA 2ZFWA 1QBJA 2WWYA 5J8CA 3IL2A 1N77A 1O7FA 1VQ8I 1YI2I 5KK1A 3LSMA 4ETSA 2WV1A 2W00A 2BEOA 3IKTA 2M5WA 3IH4A 5ICCA 1SD5A 1EF4A 3FXOA 3F8MA 3H35A 1JUSA 2Y9ZA 4ZYDA 1DGRM 5HVQC 3KYDB 2DOFA 3MWMA 3RZDJ 1X1CA 5LFAA 2QSGX 4AD9A 2DMTA 1E3OC 3HGGA 2VASA 2KDZA 3JRCA 2FUG2 1IN7A 3RQIA 5CPRB 5E3LA 2CUJA 4E7IA 1XD7A 3EUHA 1I5ZA 4YRVA 2Z5UA 2DU9A 4P55A 2LY2A 2CG4A 2HWVA 2M3AA 2OV7A 2OTJI 1ETQA 1NHAA 1OYWA 4XKWA 3BPXA 3VOEA 1GHCA 5E3MA 1N78A 2M0MA 2ZBKA 3OYBA 3R60A 1S72I 3GTPJ 4M74A 2DXIA 3EPZA 4PGHA 3IP4B 1K78B 2W48A 1IXRC 2WAFA 3K1PA 4A2UA 2LVSA 2Z2SB 1E3PA 3OYKA 3OYDA 4G7OF 3TMOA 4GGGA 3ZQCA 4G8XA 3HUGA 3DEEA 4C2MJ 3MZHA 2F5EA 1RESA 4E70A 2VBXA 1R6RA 2LKPA 4ASNA 2D1HA 2Z3YA 4PJ0C 3ABKH 3GTOJ 2RC4A 3KYLA 2MH2A 4ZDLA 1IC8A 4GYIA 2VJJA 2HPMA 2HOEA 5CVRA 5E3OA 1R4NB 1QPMA 2CQNA 2Q0OA 1HLVA 2E36A 3ELKA 5BQTA 3I3LA 5AIPA 1EH7A 2XAQA 2LKSA 3HXLA 2HI3A 3L2WA 3LSKA 2JSCA 4EM2A 2WAEA 3QPSA 4I09A 2HQ5A 4YELA 2Y9YA 4EJVA 1G8XA 1BC8C 3CD6I 4WWCA 3BG5A 2IS4A 3WTXC 2NYXA 5D8KB 3J80K 1G4DA 1Z3XA 2GQQA 2M34A 1KU2A 2V7FA 1V55H 2FMYA 3HHHA 1W0UA 1NK3P 4P96A 1Z67A 3BTLA 2LSOA 4MTDA 3S3OA 1O4XA 4A3GJ 3PM1A 2OZ6A 3ISPA 4KA4A 4PUSA 3I64A 3KP2A 2F48A 3P9CA 3FXMA 1RR8C 4HW0A 5ED4A 2XF6A 2Y0SA 2YU3A 3SDGA 3LA3A 1M1EB 2V79A 4OWRB 2BV6A 3J7ZI 3A01B 1R58A 1Y8QB 4C3JJ 2L0KA 5EF6A 2W25A 2HZDA 2VQLA 1TL8A 3RKYA 3OL4A 4M6YA 1BI0A 2CUEA 3DKWA 1Y1WJ 1UJ8A 2DA6A 1JGGA 2R7VA 3VYSB 4BQOA 2EA2A 2UXXA 3K10A 2CRGA 3OSGA 2DPUA 2VB6A 4ENJA 3S1RJ 2QVOA 1WSUA 1XDSA 3QAHA 4G12A 1AA7A 3MEXA 3K4CA 5C4XJ 2P5LC 1WJEA 1OMIA 5D8LB 3O8HA 1IRZA 1XGOA 5D4SA 3FXJA 3OYGA 3P9IA 4II2A 4A0ZA 3JR9A 4NBQA 3G4SI 4R79A 2XB0X 3F72A 1MJAA 2J5OA 4CCOA 2HPIA 4F7ZA 2DMUA 3H3ZA 3ZQHA 4BHCA 4BE1A 5JFRA 1APLC 4EJTA 3M1CA 4OIPF 1STZA 3BCAA 2V9VA 1YTYA 3ABUA 3DP7A 2DMQA 2KHMA 1BBYA 1IXCA 1Y0NA 2P81A 2DFFA 4RAFA 3JCUC 2DBBA 4KN4X 3FDYA 4HDVA 4BBSJ 4C2TA 2L4MA 4L9JA 3E3VA 4XSZF 1T98A 2DMPA 2XKOA 1DP7P 5KCMA 3SQNA 2JTVA 1SAXA 3CESA 4BDZA 3DV8A 1EH6A 2O61A 2K85A 1UZCA 2XAJA 2FNPA 2HGCA 3FZVA 2B0LA 4W1UA 2X1CA 2G7UA 3HPGA 2WBMA 1TQIA 5HLTA 1VQMI 4BHBA 5GPAA 5HNHA 1FYMA 2LRDA 2NOJB 4KMFA 2R7DA 2VKVA 4WK8F 2QA4I 2QLZA 1LE8B 4M9XA 2EIMH 5LEJA 3IH3A 2LY9A 4LK0F 4AYBA 1T39A 2GZWA 1TWAJ 1FIAA 2ZCWA 3S1NJ 1WWXA 1IXSB 1U78A 2UUZA 3VEPA 1JT6A 2XIGA 2L2OA 5IP7J 2W24A 2BGCA 2HKXA 2ETHA 3ZCOA 1XSXA 4V2GA 1OCTC 3SZPA 5GTIC 3WU2C 1KZHA 3IWZA 4KIFA 4CCLA 4J19A 4A3KJ 2PFBA 5DCMA 4I99C 1X1DA 1LFUP 3F6OA 5CQEA 2R5YA 2TDXA 4XMYA 2GA1A 3DBHB 4AIKA 3IWFA 2O8XA 3S1QJ 3KCCA 1OYYA 2IEKA 2XHKA 3CQZJ 2EK5A 1QHGA 3GFMA 2A6EF 4M3BA 3PIOF 1ONVA 3G3ZA 5LGTA 2L02A 4XQFA 2O5RA 4LG3A 5F04A 2XROA 4IEJA 2W57A 1LDKB 3C18A 3H0DA 2OUMA 3J81K 4UHTA 1KONA 4PJNA 1FEXA 4Z6YA 4U0VA 3HL2A 1Z7UA 3HOWJ 3EDPA 1KA8A 1MNMC 4BQAA 3AFHA 4FHTA 5LHIA 4JYKA 2RNGA 2COMA 1I39A 1SANA 1IF1A 2JVGA 2STTA 2VQGA 5FJ8J 4U0YA 3ZMVA 4TV7A 4NC8A 2QSHX 1S7EA 4CSWA 4FTHA 5HS8A 4OIOF 5GPCA 2ZJQF 3J7AO 1MIJA 2DQLA 3QQAA 3W6KB 2VXDA 2JMWA 4MFDA 3M3YJ 1PDNC 5LGNA 2LF8A 1D0YA 2ZMEA 4E7HA 1BIBA 1SVLA 4BL0B 3OYNA 2R5YB 3S3NA 1D8JA 4J01A 3DPTA 3CJQB 2PJPA 5LLQA 4J00A 3PQKA 1FTZA 1TWCJ 1JTXA 2F4MB 1ZG3A 2PI0A 4II3A 5JVTA 3CDLA 2BE5F 3D5SC 1TNSA 1JGSA 1U5TB 2ACJA 4A69C 2IPQX 3OMYA 4Y52J 4CICA 3VYUB 2FBIA 2D2WA 4L0YB 4S0HB 1ZR4A 5LD2C 4G6DA 3CLQA 3LSIA 2ELKA 2KPMA 1DPRA 4HPQA 4QPQA 1XMXA 2IP2A 3W3CA 4DYRA 3ASOH 4MGRA 3E6MA 2EV6A 4Z2YA 3T8TA 3MKYB 4ZYAA 1X3UA 1GDTA 2JZYA 1YG2A 1Y1VJ 3CO6C 1IRGA 2IS2A 1XN7A 2ECCA 2ZO4A 5IT3A 4KN7X 1Z3YA 5E17F 1X4OA 2A05A 2CU7A 2ESHA 4DYQA 2FA5A 2YR2A 4N4OB 1BIAA 4HF1A 4IRHA 3ZQ7A 3L2QA 1MMSA 2XDVA 2O3FA 2CW8A 5D6EA 5K7ZA 5H6QA 1MSEC 2Y69H 4XLPF 1NH3A 2A5WA 1OFCX 4KDPA 2EILH 2P0WA 2OC6A 5HDNA 1PJRA 4NQWA 2A5YB 3KP3A 2RDPA 5J8FA 4HOBA 2KIUA 4ZYGA 3L2UA 3EUHC 3KLNA 1J75A 1I50J 2GXGA 3I58A 1R49A 3GFJA 2E5ZA 1WCMJ 1YFHA 2M8EA 3FK6A 9ANTA 3V8LA 3OS2A 5IPAA 4XKCA 1B1BA 1Y39A 2GLOA 3WGHA 3S14J 2KDOA 3CCUI 1U6GA 1XSVA 4LGWA 3CCMI 2LKXA 1ZRFA 3K69A 5HNFA 1F36A 2O03A 1LQ1A 3BQYA 3B6AA 3REOA 1XDUA 1RKTA 5FLXK 2BHYA 1RRJA 3JRFA 2X6OA 3SYTA 2DT7B 2WB1N 3FKJA 3LFUA 2CW0F 4HNVA 2GIVA 4E7JA 3BCBA 3CZ6A 3BP8A 1MGTA 4B47A 1ZQ3P 3BROA 4HSRA 1O7LA 1YW7A 4UUVA 2W85A 1EA3A 4XKBA 4YIFA 1FNNA 3KEOA 5L3FA 2LD5A 2WTEA 1XPXA 3HOZJ 2ZNZA 3KEQA 2RVCA 3WHBA 2YX7A 4XLNF 3CCRI 2RGVA 3F8NA 4AVPA 4BDYA 1K78A 4FE7A 2IA2A 4M9ZA 3IHUA 5L3BA 2OBPA 3RDIA 1B4AA 2QSFX 3FK7A 1DGWY 5DCFA 1FZPB 2H6CA 4HX8A 1IG7A 1L0OC 2HZTA 1YX3A 2K3FA 2NVXJ 5KHDA 1NTCA 1RI7A 2P8TA 4Q5SF 2IS1A 3H36A 1T08B 2MSYA 1GUUA 3V7SA 3GEZA 4LFUA 2WAQA 2R7XA 3FX3A 4UVBA 5TGTA 1HXDA 3KZIC 3TOBA 1X3ZB 5CYVA 1TQMA 3N97A 1FOYA 4CYCA 3AG1H 4Y13A 4Y4RA 5D5VB 1ORKA 1YW9A 2IBDA 3KLOA 3CP2A 4D0PA 2UXNA 3ZQQA 3B73A 3JW4A 1H9TA 1B8IA 2PG4A 1YRNB 4I01A 2CFOA 1EKEA 4I6ZA 2DA4A 4IZZA 3J80Z 1YITI 3BR0A 2HDDA 2JA5J 5C44J 3CCEI 4IHYA 1WJ5A 3HOSA 3S1MJ 3AG4H 1D0ZA 1D5VA 3ROUA 3K4BA 1OISA 3LSGA 1OCRH 3U21A 1R4MB 4Y17A 2CQQA 1PVEA 3A0BC 5HDGA 4RM2A 3HOYJ 3ZPLA 2M2EA 2LBFA 1ENHA 4EJOA 3ZGKA 2K5CA 3HPHA 1FYLA 2IAIA 3WTVC 1TWHJ 1ZK8A 3DLAA 5L3CA 1W7PD 2JT1A 4CCMA 3QPLA 2GBYA 2R92J 2LDUA 2BXZA 4MQ9F 1O3QA 1IV6A 3HRUA 3I55I 2QUFA 2KQRA 1F9NA 2A69F 4RB1A 2QKMB 3A01A 1Z1DA 1U9NA 3I59B 3KP5A 3JRDA 1F1ZA 2F4IA 2JPCA 5GP9A 3I59A 2MG4A 1ON2A 2BVLA 1VQKI 3KP6A 1BC7C 4MHGA 4HF0A 2M0CA 2R93J 1FYKA 4HV5A 3WODF 4GDFA 5DYMA 3GFLA 5M5WJ 2C6YA 1FOKA 5E8IA 2HDCA 1L3LA 2NAZA 4ZC3A 3ECOA 1JUMA 1S3JA 3SZTA 1YS6A 3UR3C 4XICA 1B6AA 1H8AC 4L0ZB 2EZKA 1KQ8A 1X1PA 5M5XJ 4A3DJ 2DI3A 3S2HJ 1VZ0A 1GV2A 5AIQA 4M6VA 1WFXA 4LITA 1TWFJ 5E20A 1JKQC 5B5EC 3K2ZA 3CCYA 4HNUA 5M3FJ 1UMQA 4UB8C 3GVAA 1JHFA 3H0GJ 2MH9A 1CQTA 2LOOA 5FKMA 1QA6A 4IOAF 4IHWA 1I1GA 2K40A 5J1UA 2OQRA 2PMZN 3MKZA 5K7HA 4EJUA 2IGKA 3DU5A 4P9FA 1ETWA 1KU3A 5E1XA 1ZGAA 2B7EA 3S93A 4EV0A 1YW8A 2NVUB 3HEFA 3RI4A 4HG2A 4AIDA 4GXOA 3KX2A 1UB9A 3B6CA 3E97A 1FPQA 1RR7A 1MBJA 2QM3A 1G3YA 2BY3A 3GW2A 3HG9A 1LDDA 3LSTA 4NC6A 4X1EA 3E6DA 3V42A 2E1OA 1O3RA 3Q9VA 3TKYA 3G71I 3E6BA 1D0XA 1X2MA 3GTKJ 3CDHA 4XLHA 4B8XA 1B9MA 2KJCA 2GIZA 3EQLF 4ESFA 3W6JB 1R5HA 1T95A 3ZQFA 2F5FA 1BR4A 4IF4A 2L9SA 4FX4A 5K5RA 5EG0A 1MBHA 5J1RA 1BR2A 4OAZA 2KIQA 2MFZA 3M8JA 2MC4A 4HAMA 3I9V2 2IW5A 4I76A 3S2WA 5TRDA 2DT6A 3IH2A 1WH5A 3LAPA 1UG2A 4ZYHA 4MFEA 2QWWA 5EEGA 2KP6A 3UNGC 1MJ9A 3ZXSA 1DP3A 1SMYF 5F64A 5GTHC 1FMVA 2DQRA 2ZSHB 3QYEA 4N9HA 3SDBA 3KZZA 4L18B 3ML6A 3GWZA 2MBFA 1ZRCA 2UZKA 1A6IA 2HVQA 1MBEA 1BJZA 2M45A 4RAYA 3G1LA 3NQOA 3WE2A 1OLTA 1GXQA 1MDMB 3CC4I 4XRMA 4LG0B 5L3DA 3QRFF 4AIJA 4LK1F 3HTSB 2DFEA 1H88C 1FX7A 1Z0XA 2XGXA 1Z05A 1Z6RA 2FMLA 3BJOA 3HSFA 2QQ8A 3WG7H 3WTWC 1MW7A 4IKFA 2JA7J 3HBLA 3KIOA 5B1AH 3LA2A 1FBSA 4U87A 2VL8A 3CMAI 4UNOA 4N4NB 3MFKA 3L1PA 2Z9OA 4PJMA 3E5XA 1YJ9I 1UFMA 3ZMDA 5HDKA 1SC7A 1FLIA 4A5MA 1J9IA 3BC8A 1ULYA 2L5QA 3D0SA 5GAHJ 4D9JA 4A6EA 1YJNI 3VODA 5DTDA 1SAUA 2XGDA 4BXUA 1HBXG 1MMNA 3V7RA 1AWCA 1IN6A 1MMDA 5J3LA 1WKMA 2DA2A 1FC3A 4MNUA 3CF2A 3HHGA
chains in the Genus database with same CATH topology
2VPRA 1BW5A 5GPAA 3GTLJ 2VKVA 5F0CA 1LE8B 2I10A 4A3MJ 5HODA 3IH3A 3JRAA 1PUFA 2LY9A 2GM4A 1WH7A 1TWAJ 1FIAA 2HXIA 1AKHA 3S1NJ 5EZHA 3GTQJ 1U78A 4XIDA 1JT6A 5IP7J 4BBRJ 1MBFA 1K61A 1P7JA 2DTZA 2K9QA 4V2GA 1OCTC 2NOGA 1JJ6C 3OSFA 3H3VK 1AU7A 2K9SA 4J19A 1R9TJ 2Y31A 4JX5A 4A3KJ 1G2HA 4RBOA 1LFUP 4RDUA 1JUPA 2R5YA 4FCYA 3HDDA 1B8IB 3S1QJ 1HDPA 4X6AJ 1AKHB 1I3QJ 2IEKA 3CQZJ 2LTPA 2XB5A 1JJ8C 2NVTJ 1HOMA 4B3AA 1ETYA 4M3BA 5JLWA 2R0QC 4M3DA 5F04A 4IEJA 4L5EA 3M4OJ 1VF9A 5FLVA 2JA8J 5F1JA 1VNDA 3W6VA 2JJ7A 2NS8A 1FEXA 5C4JJ 3LSRA 1B72B 4A3EJ 3HOWJ 4BXXJ 1MNMC 3TW7A 2ECBA 2R5ZA 1DU6A 2WAQN 4JYKA 1JTYA 5IP6A 2O8KA 4ABZA 1SANA 2X9DA 3MN2A 5FJ8J 1HF0A 1LFBA 2DN0A 2EZIA 4NDLA 1S7EA 3WHCA 4FTHA 2ID6A 4B1RA 4A3IJ 5GPCA 3TEDA 2OF7A 2HXOA 4LOCA 3QQAA 4MFDA 2JMWA 3M3YJ 3NAUA 4QIWN 2R5YB 3CMYA 1FTZA 1TWCJ 1JTXA 3HM5A 3CDLA 2X48A 5FKNA 3RKQA 3BT9A 3HKZN 1DU0A 4A69C 3D1NI 4Y52J 5F0FA 5IYCJ 4XRSA 5EDNA 4S0HB 1ZR4A 3GTMJ 3RZOJ 5IP9J 2ELKA 4M3GA 4DYRA 1VI0A 2RAEA 4QTRA 5EGOA 5BNGA 2L7ZA 4DZJA 5M3MJ 1ZGWA 1GT0C 1SFOJ 1GDTA 3BR6A 5DS9A 1MBGA 3K2AA 5E3NA 3OIOA 1Y1VJ 3TP3A 2ECCA 4DW6A 2CU7A 3Q0UA 2XPWA 4DYQA 2DA1A 2LK2A 2D5VA 3BR3A 1JKRC 4A3CJ 1OCPA 5K7ZA 2LR8A 3HOVJ 3BG3A 1MSEC 3S17J 1OFCX 1WPKA 2AO9A 3SFIA 4V2FA 1JKPC 1VFCA 1RPWA 3JRHA 2H1KA 2HOSA 1YRNA 3BG9A 5FKLA 5FLMJ 2TRTA 2N8GA 5IYDJ 1QRYA 1XC5A 1IJWC 1QVTA 3G1MA 1I50J 2YS9A 5EGOB 1ETXA 1H89C 1WCMJ 1XS9A 3FK6A 9ANTA 1NK2P 4MO7A 4D5FA 5IPAA 2YUSA 1B72A 2GLOA 3K7AJ 1F43A 3JRIA 3S14J 4AYBN 1HDDC 3MKLA 3GTJJ 2XPUA 2LKXA 2YU9J 1ZKGA 2OPTA 1F36A 1IDYA 2EH3A 3BR1A 1XG1A 3BQYA 3B6AA 3LSJA 1RKTA 4C3HJ 2NVYJ 3JRFA 2VI6A 2X6OA 4JX6A 2HYJA 2WB1N 4HNVA 2QCOA 2E2IJ 2FD5A 4BY7J 2JWTA 4UUSA 1ZQ3P 4D5CA 4C3IJ 2KT0A 3BTIA 4FISA 3C2BA 3TW6A 3FIWA 5FKOA 1ZR2A 4AUXA 1Z77A 5FKKA 3HOZJ 3HOUJ 3FISA 2LD5A 5M5YJ 2XSDC 2MW8A 5J1YA 3WHBA 3PO3J 4D7NA 2L7FP 3HOXJ 2H8RA 1MH3A 4CYCB 3HGYA 4FE7A 3S15J 1TC3C 4UUTA 1ZTRA 2FX0A 3S16J 3OOUA 3FK7A 4B4CA 2K9NA 1IG7A 2CUFA 2ME6A 2NVXJ 2CJJA 3JRBA 3LNQA 1NTCA 2MGQA 1TWGJ 2LFBA 3HB9A 2MSYA 1GUUA 3Q3SA 3UKGA 2XGEA 2ZB9A 2FQ4A 1FJLA 4DYCA 1D5YA 2VKEA 5IOYA 1RETA 4CYCA 1ORKA 2IBDA 1JT0A 2DA3A 3TP0A 1BW6A 3BR5A 1B8IA 4UUSB 3Q0WA 1YRNB 3IV5A 4I6ZA 2DA4A 2Y30A 2ME0A 2E2HJ 3BR0A 3G1OA 1ETKA 2HDDA 2JA5J 5C44J 4A3BJ 2CQXA 4IHYA 3VPRA 3S1MJ 1T33A 1GVDA 5F0HA 2L9RA 2TCTA 2DA5A 3LSGA 1T56A 3A03A 2WV1A 2CQQA 4GFBA 2Y0SN 5F27A 3IH4A 4JP0A 1EF4A 1K83J 3HOYJ 3BTCA 1JUSA 2M2EA 2Y9ZA 1A5JA 1ENHA 3LOCA 3SJMA 3RZDJ 1IDZA 4QSHA 2DMTA 2XPVA 2IAIA 1TWHJ 1ZK8A 1E3OC 1BA5A 3HGGA 2KDZA 5JLXA 3JRCA 3RQIA 5E3LA 3QPLA 2GBYA 2R92J 1IV6A 3ZQLA 1MSFC 4DZPA 5EG0B 3F0CA 1ETQA 3A01A 1IGNA 2NS7A 1U9NA 3ZOBA 3JRDA 5GP9A 2MG4A 2XRLA 5E3MA 1FTTA 2M0CA 2R93J 2LP0A 1ETOA 2FJ1A 3GTPJ 5M5WJ 3DCFA 2W48A 4M3FA 4A3FJ 1JUMA 2COBA 2DJNA 2LVSA 4EEFG 4XRSG 4XICA 1H8AC 2M9HA 2EZKA 2L7MP 1JKOC 5M5XJ 3BTJA 2B63J 3S2HJ 4A3DJ 3ZQCA 1GV2A 4M6VA 1Q1VA 4C2MJ 4IHXA 3LSPA 5IYBJ 1TWFJ 1RESA 3I4NJ 3GBGA 1JKQC 3CCYA 5M3FJ 1UMQA 4Y7NJ 3H0GJ 1CQTA 5FKMA 5C3EJ 3GTOJ 4IHWA 1X2NA 1IC8A 2K40A 5J1UA 2PMZN 5K7HA 2QF7A 5E3OA 1WI3A 3S2DJ 2ID3A 3JREA 2HOTA 4A3JJ 5IOZA 1HLVA 1ETWA 2E2JJ 3I4MJ 3E7LA 2HI3A 2EZLA 1AHDP 3HEFA 2E19A 1IUFA 1QPIA 3QPSA 2HQ5A 3BQZA 2Y9YA 3B6CA 5EZGA 4M3EA 3BG5A 1RR7A 1MBJA 4X1EA 2M34A 3GTGJ 1W0UA 1NK3P 2E1OA 3BTLA 3JRGA 2EQRA 1O4XA 4A3GJ 3PM1A 2M8GX 1HCRA 1X2MA 2NVQJ 1FIPA 3GTKJ 2JN6A 3Q0VA 2JA6J 1PUFB 3ZQFA 3SDGA 1LE8A 5K7FA 1MH4A 5EG0A 1MBHA 1UHSA 5J1RA 3A01B 2AHQA 4C3JJ 2L0KA 5EF6A 4I76A 3IH2A 1WH5A 2CUEA 3PO2J 1Y1WJ 1UG2A 2DA6A 4MFEA 1JGGA 4BKXA 3BR2A 2G0EA 3ZQGA 4AC0A 2O9LA 2CRGA 3OSGA 4MIMA 4MLOA 3S1RJ 3NARA 1A6IA 1MBEA 1BJZA 4G12A 3G1LA 1OJLA 3A02A 4XK4A 1U8BA 5C4XJ 3O8HA 1IRZA 4W97A 4IHVA 4XRMA 1BL0A 1POGA 1W0TA 2EZHA 1H88C 3JR9A 1MBKA 1Z0XA 2R7ZJ 1QVUA 2JK3A 2XB0X 1P7IA 2DMNA 4A93J 2DMUA 3ZQHA 2JA7J 3HBLA 1WGXA 2VUMJ 2Y2ZA 1APLC 5EYRA 2R5ZB 3L1PA 4BY1J 1X58A 2XGCA 1GV5A 4A3LJ 1ETVA 2DMQA 2P81A 2LLKA 3FKIJ 1I6HJ 4D7MA 2DA7A 1RKWA 1ITYA 5DTDA 1U9OA 2EBIA 2O7OA 5EEAA 4BBSJ 2XGDA 2DMPA 3MVPA 3DEWA 5J3LA 3ZQIA 2DA2A 4FE4A 3O8GA 5F08A 4JX4A 2HOAA 4W1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPR A;  1BW5 A;  5GPA A;  3GTL J;  2VKV A;  5F0C A;  1LE8 B;  2I10 A;  4A3M J;  5HOD A;  3IH3 A;  3JRA A;  1PUF A;  2LY9 A;  2GM4 A;  1WH7 A;  1TWA J;  1FIA A;  2HXI A;  1AKH A;  3S1N J;  5EZH A;  3GTQ J;  1U78 A;  4XID A;  1JT6 A;  5IP7 J;  4BBR J;  1MBF A;  1K61 A;  1P7J A;  2DTZ A;  2K9Q A;  4V2G A;  1OCT C;  2NOG A;  1JJ6 C;  3OSF A;  3H3V K;  1AU7 A;  2K9S A;  4J19 A;  1R9T J;  2Y31 A;  4JX5 A;  4A3K J;  1G2H A;  4RBO A;  1LFU P;  4RDU A;  1JUP A;  2R5Y A;  4FCY A;  3HDD A;  1B8I B;  3S1Q J;  1HDP A;  4X6A J;  1AKH B;  1I3Q J;  2IEK A;  3CQZ J;  2LTP A;  2XB5 A;  1JJ8 C;  2NVT J;  1HOM A;  4B3A A;  1ETY A;  4M3B A;  5JLW A;  2R0Q C;  4M3D A;  5F04 A;  4IEJ A;  4L5E A;  3M4O J;  1VF9 A;  5FLV A;  2JA8 J;  5F1J A;  1VND A;  3W6V A;  2JJ7 A;  2NS8 A;  1FEX A;  5C4J J;  3LSR A;  1B72 B;  4A3E J;  3HOW J;  4BXX J;  1MNM C;  3TW7 A;  2ECB A;  2R5Z A;  1DU6 A;  2WAQ N;  4JYK A;  1JTY A;  5IP6 A;  2O8K A;  4ABZ A;  1SAN A;  2X9D A;  3MN2 A;  5FJ8 J;  1HF0 A;  1LFB A;  2DN0 A;  2EZI A;  4NDL A;  1S7E A;  3WHC A;  4FTH A;  2ID6 A;  4B1R A;  4A3I J;  5GPC A;  3TED A;  2OF7 A;  2HXO A;  4LOC A;  3QQA A;  4MFD A;  2JMW A;  3M3Y J;  3NAU A;  4QIW N;  2R5Y B;  3CMY A;  1FTZ A;  1TWC J;  1JTX A;  3HM5 A;  3CDL A;  2X48 A;  5FKN A;  3RKQ A;  3BT9 A;  3HKZ N;  1DU0 A;  4A69 C;  3D1N I;  4Y52 J;  5F0F A;  5IYC J;  4XRS A;  5EDN A;  4S0H B;  1ZR4 A;  3GTM J;  3RZO J;  5IP9 J;  2ELK A;  4M3G A;  4DYR A;  1VI0 A;  2RAE A;  4QTR A;  5EGO A;  5BNG A;  2L7Z A;  4DZJ A;  5M3M J;  1ZGW A;  1GT0 C;  1SFO J;  1GDT A;  3BR6 A;  5DS9 A;  1MBG A;  3K2A A;  5E3N A;  3OIO A;  1Y1V J;  3TP3 A;  2ECC A;  4DW6 A;  2CU7 A;  3Q0U A;  2XPW A;  4DYQ A;  2DA1 A;  2LK2 A;  2D5V A;  3BR3 A;  1JKR C;  4A3C J;  1OCP A;  5K7Z A;  2LR8 A;  3HOV J;  3BG3 A;  1MSE C;  3S17 J;  1OFC X;  1WPK A;  2AO9 A;  3SFI A;  4V2F A;  1JKP C;  1VFC A;  1RPW A;  3JRH A;  2H1K A;  2HOS A;  1YRN A;  3BG9 A;  5FKL A;  5FLM J;  2TRT A;  2N8G A;  5IYD J;  1QRY A;  1XC5 A;  1IJW C;  1QVT A;  3G1M A;  1I50 J;  2YS9 A;  5EGO B;  1ETX A;  1H89 C;  1WCM J;  1XS9 A;  3FK6 A;  9ANT A;  1NK2 P;  4MO7 A;  4D5F A;  5IPA A;  2YUS A;  1B72 A;  2GLO A;  3K7A J;  1F43 A;  3JRI A;  3S14 J;  4AYB N;  1HDD C;  3MKL A;  3GTJ J;  2XPU A;  2LKX A;  2YU9 J;  1ZKG A;  2OPT A;  1F36 A;  1IDY A;  2EH3 A;  3BR1 A;  1XG1 A;  3BQY A;  3B6A A;  3LSJ A;  1RKT A;  4C3H J;  2NVY J;  3JRF A;  2VI6 A;  2X6O A;  4JX6 A;  2HYJ A;  2WB1 N;  4HNV A;  2QCO A;  2E2I J;  2FD5 A;  4BY7 J;  2JWT A;  4UUS A;  1ZQ3 P;  4D5C A;  4C3I J;  2KT0 A;  3BTI A;  4FIS A;  3C2B A;  3TW6 A;  3FIW A;  5FKO A;  1ZR2 A;  4AUX A;  1Z77 A;  5FKK A;  3HOZ J;  3HOU J;  3FIS A;  2LD5 A;  5M5Y J;  2XSD C;  2MW8 A;  5J1Y A;  3WHB A;  3PO3 J;  4D7N A;  2L7F P;  3HOX J;  2H8R A;  1MH3 A;  4CYC B;  3HGY A;  4FE7 A;  3S15 J;  1TC3 C;  4UUT A;  1ZTR A;  2FX0 A;  3S16 J;  3OOU A;  3FK7 A;  4B4C A;  2K9N A;  1IG7 A;  2CUF A;  2ME6 A;  2NVX J;  2CJJ A;  3JRB A;  3LNQ A;  1NTC A;  2MGQ A;  1TWG J;  2LFB A;  3HB9 A;  2MSY A;  1GUU A;  3Q3S A;  3UKG A;  2XGE A;  2ZB9 A;  2FQ4 A;  1FJL A;  4DYC A;  1D5Y A;  2VKE A;  5IOY A;  1RET A;  4CYC A;  1ORK A;  2IBD A;  1JT0 A;  2DA3 A;  3TP0 A;  1BW6 A;  3BR5 A;  1B8I A;  4UUS B;  3Q0W A;  1YRN B;  3IV5 A;  4I6Z A;  2DA4 A;  2Y30 A;  2ME0 A;  2E2H J;  3BR0 A;  3G1O A;  1ETK A;  2HDD A;  2JA5 J;  5C44 J;  4A3B J;  2CQX A;  4IHY A;  3VPR A;  3S1M J;  1T33 A;  1GVD A;  5F0H A;  2L9R A;  2TCT A;  2DA5 A;  3LSG A;  1T56 A;  3A03 A;  2WV1 A;  2CQQ A;  4GFB A;  2Y0S N;  5F27 A;  3IH4 A;  4JP0 A;  1EF4 A;  1K83 J;  3HOY J;  3BTC A;  1JUS A;  2M2E A;  2Y9Z A;  1A5J A;  1ENH A;  3LOC A;  3SJM A;  3RZD J;  1IDZ A;  4QSH A;  2DMT A;  2XPV A;  2IAI A;  1TWH J;  1ZK8 A;  1E3O C;  1BA5 A;  3HGG A;  2KDZ A;  5JLX A;  3JRC A;  3RQI A;  5E3L A;  3QPL A;  2GBY A;  2R92 J;  1IV6 A;  3ZQL A;  1MSF C;  4DZP A;  5EG0 B;  3F0C A;  1ETQ A;  3A01 A;  1IGN A;  2NS7 A;  1U9N A;  3ZOB A;  3JRD A;  5GP9 A;  2MG4 A;  2XRL A;  5E3M A;  1FTT A;  2M0C A;  2R93 J;  2LP0 A;  1ETO A;  2FJ1 A;  3GTP J;  5M5W J;  3DCF A;  2W48 A;  4M3F A;  4A3F J;  1JUM A;  2COB A;  2DJN A;  2LVS A;  4EEF G;  4XRS G;  4XIC A;  1H8A C;  2M9H A;  2EZK A;  2L7M P;  1JKO C;  5M5X J;  3BTJ A;  2B63 J;  3S2H J;  4A3D J;  3ZQC A;  1GV2 A;  4M6V A;  1Q1V A;  4C2M J;  4IHX A;  3LSP A;  5IYB J;  1TWF J;  1RES A;  3I4N J;  3GBG A;  1JKQ C;  3CCY A;  5M3F J;  1UMQ A;  4Y7N J;  3H0G J;  1CQT A;  5FKM A;  5C3E J;  3GTO J;  4IHW A;  1X2N A;  1IC8 A;  2K40 A;  5J1U A;  2PMZ N;  5K7H A;  2QF7 A;  5E3O A;  1WI3 A;  3S2D J;  2ID3 A;  3JRE A;  2HOT A;  4A3J J;  5IOZ A;  1HLV A;  1ETW A;  2E2J J;  3I4M J;  3E7L A;  2HI3 A;  2EZL A;  1AHD P;  3HEF A;  2E19 A;  1IUF A;  1QPI A;  3QPS A;  2HQ5 A;  3BQZ A;  2Y9Y A;  3B6C A;  5EZG A;  4M3E A;  3BG5 A;  1RR7 A;  1MBJ A;  4X1E A;  2M34 A;  3GTG J;  1W0U A;  1NK3 P;  2E1O A;  3BTL A;  3JRG A;  2EQR A;  1O4X A;  4A3G J;  3PM1 A;  2M8G X;  1HCR A;  1X2M A;  2NVQ J;  1FIP A;  3GTK J;  2JN6 A;  3Q0V A;  2JA6 J;  1PUF B;  3ZQF A;  3SDG A;  1LE8 A;  5K7F A;  1MH4 A;  5EG0 A;  1MBH A;  1UHS A;  5J1R A;  3A01 B;  2AHQ A;  4C3J J;  2L0K A;  5EF6 A;  4I76 A;  3IH2 A;  1WH5 A;  2CUE A;  3PO2 J;  1Y1W J;  1UG2 A;  2DA6 A;  4MFE A;  1JGG A;  4BKX A;  3BR2 A;  2G0E A;  3ZQG A;  4AC0 A;  2O9L A;  2CRG A;  3OSG A;  4MIM A;  4MLO A;  3S1R J;  3NAR A;  1A6I A;  1MBE A;  1BJZ A;  4G12 A;  3G1L A;  1OJL A;  3A02 A;  4XK4 A;  1U8B A;  5C4X J;  3O8H A;  1IRZ A;  4W97 A;  4IHV A;  4XRM A;  1BL0 A;  1POG A;  1W0T A;  2EZH A;  1H88 C;  3JR9 A;  1MBK A;  1Z0X A;  2R7Z J;  1QVU A;  2JK3 A;  2XB0 X;  1P7I A;  2DMN A;  4A93 J;  2DMU A;  3ZQH A;  2JA7 J;  3HBL A;  1WGX A;  2VUM J;  2Y2Z A;  1APL C;  5EYR A;  2R5Z B;  3L1P A;  4BY1 J;  1X58 A;  2XGC A;  1GV5 A;  4A3L J;  1ETV A;  2DMQ A;  2P81 A;  2LLK A;  3FKI J;  1I6H J;  4D7M A;  2DA7 A;  1RKW A;  1ITY A;  5DTD A;  1U9O A;  2EBI A;  2O7O A;  5EEA A;  4BBS J;  2XGD A;  2DMP A;  3MVP A;  3DEW A;  5J3L A;  3ZQI A;  2DA2 A;  4FE4 A;  3O8G A;  5F08 A;  4JX4 A;  2HOA A;  4W1U A; 
#chains in the Genus database with same CATH topology
 3C3W A;  5HOO A;  1BW5 A;  2VJI A;  5BS6 A;  3MAJ A;  5F0C A;  2K27 A;  4NHJ A;  3DBR B;  4RA2 A;  3OR2 C;  5L3E A;  2G7H A;  5CVJ A;  5DDG A;  4HNT A;  5EZH A;  4BJ6 C;  3TDZ C;  4CZC A;  4XID A;  4YEJ A;  2QGU A;  4BBR J;  3IC7 A;  4BGD A;  2F5C A;  2R7Q A;  1K61 A;  3RPQ A;  1P7J A;  1J0R A;  2DTZ A;  2K9Q A;  1T0F C;  1R22 A;  2CS3 A;  2NOG A;  3WU1 B;  1JJ6 C;  3OSF A;  3H3V K;  2EFP A;  3PFY A;  2HQA A;  2JSP A;  2Y31 A;  3PL8 A;  4Q47 A;  1R9T J;  4IX7 A;  4RBO A;  1HKT A;  4YII A;  2VOP A;  1FT9 A;  1TP4 A;  1SFK A;  2W82 A;  1PYV A;  4X6A J;  3EYY A;  1I3Q J;  3M7G A;  2V6C A;  3K4J A;  1JJ8 C;  2NVT J;  1HOM A;  1YE9 A;  4B3A A;  1ETY A;  3H1C A;  3CO7 C;  4FT8 A;  2KL4 A;  1GXP A;  2UWM A;  4U0W A;  1J5Y A;  2OTL I;  5FLV A;  1W5S A;  2A68 F;  2IJL A;  4L5I A;  1A35 A;  2JQ7 A;  3K1M A;  1U5T A;  4PSX A;  2BY0 A;  4ON0 A;  1QNT A;  3DF8 A;  3LSR A;  3QU3 A;  3TW7 A;  2R5Z A;  2WAQ N;  2V1X A;  5IP6 A;  2ADU A;  4G7H F;  2O8K A;  1PUE E;  3DTI A;  4OIR F;  4DGW B;  2FRH A;  3AG2 H;  3I4P A;  3PJR A;  3GZ5 A;  2EZI A;  1PP8 F;  4NDL A;  1G3T A;  3WHC A;  2R7O A;  2FF4 A;  2VOD A;  1VQL I;  3N4M A;  2H27 A;  3L2V A;  1SFX A;  3V7C A;  2QZ8 A;  5F6F A;  4Y3O A;  2DK8 A;  4BEH A;  4QIW N;  4BEH B;  2YSR A;  1WJF A;  3HM5 A;  1V5G A;  2V9K A;  1B9N A;  1HSJ A;  2DDB A;  1XCB A;  2FE3 A;  2NS0 A;  5FKN A;  3RKQ A;  4BQQ A;  3HKZ N;  3FMR A;  5IY5 H;  4XRS A;  4A12 A;  1B59 A;  3DKX A;  2R7R A;  3F8F A;  3FHZ A;  3GTM J;  3KZY A;  3CTA A;  4EM0 B;  4CXF A;  4ENK A;  5IT9 K;  4NQW B;  3E6C C;  4LJZ F;  1VI0 A;  2VBW A;  3O2P E;  2RAE A;  3A4C A;  3RKX A;  5EGO A;  3CC7 I;  3TO7 A;  1RZ4 A;  1TT0 A;  4CCJ A;  4XNF A;  1LEB A;  5LEK A;  5KAI C;  2MA3 A;  3DKY A;  1X1B A;  4F92 B;  2HR3 A;  3OYE A;  1SFO J;  1GT0 C;  2X0L A;  4RLQ A;  2ZC2 A;  1QO0 D;  2ZXJ A;  5F1R A;  1JXS A;  1K6O A;  3CC2 I;  1Z6T A;  2A61 A;  3PSI A;  4DW6 A;  5JHU A;  4HX4 A;  2XPW A;  1E2X A;  4Q4Z F;  2LK2 A;  3BR3 A;  4HRI A;  2KZV A;  1FSE A;  4LLG F;  3U2R A;  2E1N A;  4BQN A;  4A3C J;  4U7D A;  1ZH5 A;  3H5N A;  4HEA 2;  3HRS A;  3RIR A;  4PSW A;  2V4J C;  1ZAO A;  4BHP A;  1X19 A;  3ZMU A;  3QP5 A;  5GAE J;  1WPK A;  3SFI A;  4EGY A;  1TTY A;  4A0Y A;  1RPW A;  3F8C A;  4BE0 A;  2VLA A;  1X4P A;  2EFQ A;  4KIT B;  2ISZ A;  1R23 A;  3BG9 A;  3ZMT A;  1ZLK A;  2KRC A;  5IYD J;  1QRY A;  3E5U A;  1UHW A;  1EV7 A;  3G1M A;  1K79 A;  2XAU A;  4Y15 A;  2FBK A;  4AIH A;  5EGO B;  3OY9 A;  3DBL B;  1R71 A;  3K0L A;  1H89 C;  4I7H A;  5CJ9 A;  3PNT A;  4CCN A;  3I56 I;  3NRV A;  4D5F A;  1BI2 A;  3F23 A;  1G6N A;  1B72 A;  4XON A;  5FD6 A;  3GYH X;  2Z33 A;  2XPU A;  3K70 C;  3PIP F;  4A6D A;  1ZKG A;  3OYA A;  2YU9 J;  3QWL A;  5CVV A;  2EH3 A;  2E35 A;  3BR1 A;  1CF7 A;  5CQG A;  2OU2 A;  3O6B B;  4B3X A;  1D8K A;  2QCO A;  3TGN A;  2BY2 A;  3HTU A;  2FNA A;  4BE2 A;  2E1C A;  2PJR B;  3ESW B;  2AXT C;  4ENN A;  4RB3 C;  4C3I J;  3C2B A;  4FIS A;  3DTE A;  3CF5 F;  4F3Q A;  4IL6 C;  1NG7 A;  2CYY A;  3MKW B;  4H4K C;  4PDK A;  5CKT A;  2Q2E B;  3LWF A;  2XSD C;  1LJ9 A;  5J1Y A;  3JTH A;  2HKO A;  4HYE A;  5K5Q A;  3OYC A;  3VWB A;  4BJ5 C;  3S15 J;  3TO6 A;  4UUT A;  5LGU A;  5EEH A;  2FX0 A;  1T6S A;  3OOU A;  1V4R A;  3JSO A;  2ME6 A;  2CJJ A;  3JRB A;  4XSX F;  2M4K A;  5HLI A;  2FEZ A;  1TWG J;  1A04 A;  1QZY A;  2XGE A;  5GAG J;  4UVC A;  1E17 A;  2E34 A;  2ZB9 A;  2KKO A;  1FWZ A;  2MLK A;  4EAT A;  5IOY A;  1C0W A;  3W2V A;  3CCL I;  3WTZ A;  1LVA A;  2DLL A;  1ACI A;  5DEQ A;  2L9V A;  2LC2 A;  3LL7 A;  2IS6 A;  4LLL A;  2BZT A;  3IKV A;  4MEX F;  2MLG A;  1YX5 A;  4WXD A;  5HS9 A;  4MTE A;  1O3S A;  2RRE A;  2E2H J;  2ME0 A;  3HYI A;  3G1O A;  4LG0 A;  5LRS A;  4F93 B;  4IOC F;  2Q2E A;  1SD7 A;  5F0H A;  2V1D A;  2L9R A;  3MD2 A;  2TCT A;  4PJL A;  3E0J B;  2CFX A;  5H6R A;  1MJB A;  1OCO H;  4HX7 A;  4S05 A;  1T56 A;  3A03 A;  4I98 B;  3RPU A;  3CCQ I;  5LHG A;  2Y0S N;  5F27 A;  1IAW A;  3KP7 A;  1K83 J;  3K4N A;  3BTC A;  1MD0 A;  3R0A A;  4CZZ A;  1A5J A;  3LOC A;  4G6T B;  3F8B A;  3T8R A;  3SJM A;  3C1D A;  3H9Q A;  1IDZ A;  2KRH A;  1W1W E;  2L9N A;  2XPV A;  2ZJ2 A;  5TIS C;  3DQV C;  2FOW A;  4I0B A;  3X2Q H;  1MSF C;  1LVK A;  5EG0 B;  1OPC A;  3F0C A;  2VXZ A;  1YIJ I;  2UV1 A;  2NS7 A;  1P6R A;  4LIU A;  2IA1 A;  3S8P A;  3QOD A;  2XVC A;  4WCG A;  1TNT A;  2DO7 A;  3ERE D;  1FTT A;  4HST A;  3ZN0 A;  4QLC U;  1BR1 A;  3C2H A;  4P1W A;  1ETO A;  4KIS A;  2K86 A;  2ZSI B;  3DCF A;  5CLS A;  4OMY A;  4M3F A;  1MMG A;  3GLL A;  2NNN A;  3HSE A;  4ENM A;  4NNJ A;  4HLY A;  1R1U A;  2GWR A;  2W1O A;  3BTJ A;  1BM9 A;  4M9S A;  5FGM A;  2EWN A;  2PMH A;  4O5V A;  1OKR A;  1S7A A;  1Q1V A;  2HQR A;  2RQQ A;  2CO5 A;  2MD0 A;  2HEO A;  1I3A A;  2LMD A;  2ZNY A;  3RJP A;  5IYB J;  3LSP A;  5ILS A;  4IHX A;  4UV8 A;  4LIV A;  3GBG A;  1OQY A;  3BZC A;  1AOY A;  5C3E J;  3FXU A;  1X2N A;  1R1V A;  1K6Y A;  3KEY A;  3QPH A;  2QEX I;  4ZDO A;  2VPL A;  3GUD A;  4I2O A;  1SEU A;  1G59 A;  1F5T A;  3LFK A;  2E2J J;  2K3P A;  1W5T A;  4G7Z F;  2MD5 A;  4B44 A;  1SFE A;  1Z7L A;  3CUO A;  4BS9 A;  1WJD A;  4IRI A;  2K9M A;  1QPI A;  3PNV A;  2OJE D;  1ZGJ A;  1HQC A;  1HKQ A;  4M3E A;  2F2E A;  3K9T A;  2EV5 A;  2M87 A;  3EYI A;  1LNW A;  2EIN H;  4HDU A;  3PQJ A;  2VE8 A;  2FU4 A;  1VQ4 I;  4AWX B;  2KIF A;  2DOA A;  2EIK H;  4RMN A;  1Y8R B;  4AM3 A;  2QQ9 A;  4XLE A;  6PAX A;  1FIP A;  5JI6 A;  2F6C A;  2JN6 A;  1P4A A;  1U8R A;  3J81 Z;  3CUQ C;  1EJ9 A;  2JA6 J;  4ZJZ A;  2PX9 A;  1RNL A;  4XN0 A;  1XGS A;  2CW7 A;  1LE8 A;  3ECH A;  3ABT A;  3FM5 A;  1MH4 A;  1R5G A;  4CCK A;  3N05 A;  5E1Z B;  4HF2 A;  1WVR A;  1QU3 A;  2AHQ A;  2HU9 A;  1SMT A;  2XC7 A;  2X1E A;  2W84 A;  2R3S A;  4K2E A;  3BPV A;  4AVZ A;  2CH0 A;  2P7V B;  3ERM A;  1LPQ A;  4AC0 A;  2V1N A;  3QYB A;  2A3S A;  4I0A A;  2LRE A;  4YFX F;  1GVJ A;  2ZJP F;  3NAR A;  3WU0 A;  3EUK L;  1QZZ A;  1RUN A;  1GLN A;  3LQR A;  3FM3 A;  3OOP A;  1ZRE A;  2F5D A;  1S9H A;  4KMU X;  3A02 A;  4ZTF A;  4W97 A;  4IHV A;  2EJR A;  1K4S A;  1KYW A;  1WQ2 A;  1BL0 A;  2R7U A;  3QU6 A;  1POG A;  3U1K A;  1W0T A;  1VQP I;  1MBK A;  2R7Z J;  4ANJ A;  1R00 A;  1QVU A;  2JK3 A;  2F5V A;  3NEU A;  1P7I A;  1MNE A;  2DMN A;  3SEZ A;  1KU7 A;  2QBY B;  4A93 J;  2QKL B;  1P9Q C;  2EA4 A;  2K9L A;  2VUM J;  1BI3 A;  2HVR A;  2PQ8 A;  2ZFU A;  5EYR A;  2IGM A;  4BY1 J;  3OL3 A;  3S3M A;  1TZL A;  4M72 A;  4XKV A;  4A3L J;  1UEL B;  1MDM A;  2HTJ A;  4GRI A;  1IN4 A;  4UB6 C;  2FOK A;  3BZ6 A;  2DFI A;  3RQ4 A;  3FKI J;  1I6H J;  1W36 D;  3U9G A;  4D7M A;  2DA7 A;  3C7J A;  3ZR8 X;  2K4J A;  3IRR A;  5EEA A;  3AL0 B;  3C2G A;  2KIS A;  3FMS A;  3MVP A;  4EGZ A;  4P9U A;  1V3F A;  2R4G A;  2O0Y A;  3BWG A;  3O8G A;  1XMA A;  5LRR A;  4R1H A;  2A6T A;  2E71 A;  4JX4 A;  4MEY F;  1IN5 A;  5DS9 A;  3VYT B;  3K1N A;  2VPR A;  3GTL J;  2DW4 A;  5B3S H;  2V26 A;  5BOX A;  1R7J A;  3BDD A;  5JHF A;  2I10 A;  4A3M J;  2XAS A;  4L9N A;  1PUF A;  2GOX B;  2XF5 A;  3PUB A;  4EVI A;  4XLF A;  4EJW A;  2HXI A;  1AKH A;  4ZTJ A;  3I71 A;  1REP C;  2H09 A;  1MBF A;  3VB2 A;  3ZN1 A;  1WJB A;  3M8F A;  3IAS 2;  2CV0 A;  4CO8 A;  5D5U B;  2VE9 A;  4IQJ A;  2PMZ A;  3QOE A;  4V19 K;  3DU6 A;  2VON A;  3K4L A;  1RIO H;  1FP1 D;  4JX5 A;  4RS8 A;  3IUO A;  4RDU A;  5LBQ A;  2VIX A;  4RAZ A;  4FCY A;  3O3K A;  3HDD A;  1YYV A;  5ERI A;  1ZYR F;  2P5K A;  1B8I B;  1O57 A;  2JPB A;  5HS7 A;  2LTP A;  1KYZ A;  4E7S A;  2XB5 A;  1VQ6 I;  3G2B A;  3DWL E;  3GZN B;  3I0T A;  2G9W A;  1XX5 A;  2OZU A;  1LEA A;  1J7K A;  5TJJ A;  1SD4 A;  1T8I A;  4M6X A;  4M3D A;  1OCC H;  2ZXH A;  2WAD A;  4L5E A;  1VQ9 I;  3M4O J;  2X1D A;  1VND A;  3W6V A;  2DYR H;  4BXF A;  2JJ7 A;  2NS8 A;  2W4S A;  5C4J J;  1B72 B;  4BXX J;  4A3E J;  2ECB A;  2EFO A;  1OYI A;  4YFK F;  2LBF B;  2WC2 A;  5CVU A;  3FF5 A;  4FQG A;  3HUG B;  1BOB A;  4ABZ A;  4B09 A;  3D5L A;  1TBX A;  4NC7 A;  3MN2 A;  4KFC A;  1HF0 A;  5DD4 A;  1LFB A;  3CUQ A;  4QPO A;  2A6H F;  2P7C B;  2DN0 A;  1P2F A;  2DYS H;  1S6L A;  2ID6 A;  4B1R A;  4A3I J;  3KFW X;  2R7S A;  2PMU A;  2OF7 A;  2HXO A;  1HKS A;  4LOC A;  3CCS I;  1PP7 U;  4GO1 A;  4PZJ A;  2VT2 A;  2E7X A;  2KLO A;  5H20 A;  4IXA A;  1Z21 A;  4NUB A;  2VKD A;  4MQV A;  1HW5 A;  4WX9 A;  2Z1D A;  2M7A A;  2E5N A;  2JA2 A;  3HRM A;  3Q5F A;  5K5O A;  1Z91 A;  1U0J A;  2WB1 A;  3D1N I;  1S7O A;  3I5U A;  5F0F A;  4BYY A;  5EDN A;  3MZY A;  2D45 A;  2HDW A;  3GZ6 A;  4R8H A;  2CMP A;  1V5E A;  5D6F A;  3BY6 A;  3D5R C;  2VN2 A;  5GAD J;  2RV8 A;  5IP9 J;  4M3G A;  3JAM K;  2CV1 A;  3L2C A;  5J4V A;  4E7K A;  1JE8 A;  2LF7 A;  3IAM 2;  3CP8 A;  5FD5 A;  2F4O B;  2H94 A;  3ZMZ A;  3L9F A;  5BNG A;  4BH9 A;  1K7A A;  3HJE A;  1N75 A;  3MQ0 A;  1E0E A;  2IXS A;  3K2A A;  5E3N A;  3L00 A;  4EMS A;  3OIO A;  2EIJ H;  4L9V A;  4RB0 A;  2FXA A;  4OU0 A;  5FRO A;  3MZ8 A;  5A2Q Z;  4DOZ A;  3IRQ A;  3L09 A;  2BW3 B;  3W2A A;  1OR7 C;  2LNB A;  1NG6 A;  5ICG A;  1DPU A;  5FO5 A;  1OR7 A;  4IVN A;  5ICE A;  1IN8 A;  1OCP A;  2XF7 A;  2STW A;  1UG0 A;  2LR8 A;  2V9P A;  1K4T A;  3HOV J;  4H0E A;  3TOA A;  5E1W A;  3ONQ A;  3OYJ A;  1ERD A;  5DD8 A;  2AO9 A;  4OOI A;  5K1Y A;  3AL0 C;  4EQQ A;  2AQF A;  1JKP C;  1MMA A;  1XGM A;  3T1B A;  1VFC A;  2DPD A;  3CME I;  1YRN A;  4O3M A;  1KU9 A;  2TRT A;  2N8G A;  2ISY A;  3DEU A;  3BOQ A;  4U88 A;  1XC5 A;  1QVT A;  2YS9 A;  5E18 F;  1ETX A;  4XRF A;  2FQ3 A;  1XS9 A;  4DBR A;  3OR1 C;  1NK2 P;  1YLF A;  4MO7 A;  4ESJ A;  3K7A J;  3DLL F;  1FY7 A;  5KAF C;  4ITV A;  1QGP A;  2XSJ C;  3JRI A;  3COA C;  3GTJ J;  5J47 A;  4U7B A;  1XMK A;  2VBZ A;  3GF2 A;  2OPT A;  3DPU A;  3OS0 A;  1DQU A;  1IDY A;  3LSJ A;  1XG1 A;  2CSO A;  1V5F A;  1YIO A;  2VI6 A;  2CGP A;  4ZYE A;  2E2I J;  3WTT C;  3WTS C;  4UUS A;  4D5C A;  3F6V A;  3TW6 A;  3FIW A;  5FKO A;  1ZR2 A;  4BJT A;  4AUX A;  3PNY A;  5FKK A;  3MMY B;  2CWE A;  3FIS A;  5M5Y J;  2MW8 A;  2QEN A;  5J6X A;  4P5O A;  3KE2 A;  1ZLJ A;  3P7N A;  3PO3 J;  4D7N A;  3S32 A;  2H8R A;  1MH3 A;  5FFX A;  1I27 A;  1ZTR A;  2I8D A;  4HBL A;  4B4C A;  1E3H A;  2K9N A;  2CUF A;  3TBI A;  3G73 A;  4PFP A;  3CCV I;  3HC7 A;  2MGQ A;  3QPT A;  3HB9 A;  2OA4 A;  3RTR A;  4E7Z A;  1BJA A;  3UKG A;  2Z16 A;  1FMW A;  4CGZ A;  1USS A;  2FQ4 A;  5ILU A;  3HSR A;  4DYC A;  1D5Y A;  4B43 A;  2IRF G;  2LG4 A;  1RET A;  1R5I D;  1WRJ A;  4KT5 C;  3Q9S A;  3TO9 A;  4S04 A;  2Q8K A;  3TP0 A;  2DOE A;  3BR5 A;  1XB4 A;  2HFH A;  2VKH A;  4UUS B;  4A0X A;  2PN6 A;  3Q0W A;  4HQE A;  1S8N A;  2K4B A;  4DNC A;  3CLO A;  3IV5 A;  2Y30 A;  1Y6I A;  4HA8 A;  2E60 A;  5BMZ A;  4RAG A;  2NNY A;  4A3B J;  2CQX A;  1YJW I;  4LMY A;  3VPR A;  3ZP5 A;  1T33 A;  2HQN A;  1GVD A;  5BPD A;  2ZME C;  1UAA A;  2DA5 A;  4F55 A;  1IRF A;  1TLH B;  3A1Y A;  4UY8 I;  4GFB A;  1IW7 F;  4XLA A;  4YFN F;  2XAH A;  2KZG A;  4JP0 A;  1YQA A;  1MZB A;  2GAU A;  3LAJ A;  3BJ6 A;  3ABL H;  1FBQ A;  2PBI A;  4YIR X;  4QSH A;  4HV6 A;  5D5W B;  2GA2 A;  1BA5 A;  2BY1 A;  3KP4 A;  4NB5 A;  3RYR A;  3A2K A;  5JLX A;  2X6W A;  3WTU C;  5E79 C;  3CDI A;  3I54 A;  4IHT A;  3M8E A;  4HQM A;  1OCZ H;  2J5P A;  2VC0 A;  2LY1 A;  3ZQL A;  4DZP A;  3VFZ A;  5KNL A;  1IGN A;  2I5U A;  3H5A A;  3ZOB A;  2XRL A;  3K4M A;  1QQI A;  1WJA A;  1WI9 A;  5B1B H;  2DCE A;  2R7F A;  3CJN A;  5A2Q K;  2ZJR F;  2LP0 A;  2DJI A;  1W7P A;  1JHH A;  2OQG A;  3HKZ A;  2FJ1 A;  2K02 A;  5ILV A;  5J40 A;  4JBA A;  1XGN A;  1SVM A;  4A3F J;  5AON A;  3VSK A;  3CMM A;  1P92 A;  2COB A;  2DJN A;  2Y48 A;  4EEF G;  2OCC H;  1YS7 A;  4XRS G;  2KRF A;  2KIM A;  4DBQ A;  1O3T A;  2L7K A;  2M9H A;  2QBY A;  2L7M P;  1JKO C;  2B63 J;  3MCZ A;  3CJT B;  2BYV E;  1S29 A;  5IT9 Z;  4YG2 F;  2IT0 A;  1XTA A;  3AKZ A;  2R7W A;  4N0B A;  3JSP A;  2EPF A;  3I4N J;  3CJR B;  5E8G A;  1TT5 B;  3H9J A;  1UCR A;  2ELJ A;  2K7L A;  4Y7N J;  1S5L C;  1SVO A;  4GYG A;  4CDG A;  1W5C C;  3BLY A;  2VT3 A;  4LD5 A;  4UVA A;  2BBY A;  2HTS A;  2Y75 A;  1VQN I;  2M30 A;  2QF7 A;  2VOO A;  1WI3 A;  1I1S A;  3A0H C;  1H9G A;  3ZMS A;  3S2D J;  3RCO A;  1CGP A;  2ID3 A;  2RQP A;  3JRE A;  2HOT A;  4A3J J;  1BOA A;  5IOZ A;  2M4G A;  3I4M J;  2MC3 A;  1Y56 A;  3E7L A;  3FWE A;  4FX0 A;  3M9A A;  2EZL A;  3ABM H;  1AHD P;  4JOM A;  1A6Q A;  5FFZ A;  2CV2 A;  2LH9 A;  2E19 A;  1IUF A;  3K6G A;  3LA7 A;  5J4Y A;  3BQZ A;  5EZG A;  2BVM A;  1D3Y A;  4IHS A;  1RC9 A;  2X85 A;  4RGX A;  3L2R A;  2D1V A;  4WXH A;  2EFW A;  3GTG J;  1Q1H A;  4XLC A;  1T2K A;  3H5R A;  3H92 A;  3JRG A;  1A31 A;  2NXN B;  2EQR A;  2P6T A;  2KFD A;  3AAF A;  1HCR A;  2M8G X;  3CUQ B;  4DQ2 A;  2DK5 A;  1W7P B;  2NVQ J;  3GME A;  4E6K G;  2A07 F;  1ZEL A;  3Q0V A;  4KT6 A;  3OYI A;  2HVS A;  5KVR A;  1LB2 A;  1T38 A;  2PJR A;  2AQE A;  1PUF B;  2GXA A;  2M7B A;  5DM7 F;  2DOD A;  4IRG A;  4PCQ A;  5K7F A;  2JUC A;  3OIQ A;  3GCM A;  4E7L A;  1UHS A;  2DTR A;  4JQF A;  3L7W A;  3NWS A;  2X4H A;  2NRA C;  1DUX C;  3B02 A;  2DAO A;  3M1E A;  1VQO I;  3GLX A;  2QQA A;  1U5T C;  3PO2 J;  1FOX A;  4BKX A;  3BR2 A;  3SFZ A;  2G0E A;  4L9T A;  3ZQG A;  5FRM A;  3HIF A;  2L3D A;  2DFH A;  4OIN F;  2O9L A;  3ASN H;  4MIM A;  4MLO A;  5JR3 A;  5ICF A;  4XM3 A;  3H9G A;  1P4W A;  2Q1Z B;  1OJL A;  4XK4 A;  1U8B A;  3SEQ A;  2AXL A;  1I6X A;  3OV8 A;  1A36 A;  1H0M A;  3K70 D;  2ELH A;  3CCJ I;  2EZH A;  2M1B A;  2KJB A;  4IJA A;  3ULQ B;  1ODD A;  5FLX Z;  1IZ1 A;  1HA8 A;  2ZKZ A;  2IVM A;  5D5X B;  3GX4 X;  4CYD A;  2H8W A;  1ON1 A;  4BAC A;  3LQQ A;  2X6Y A;  1WGX A;  1FSH A;  2BW3 A;  2Y2Z A;  3WTY C;  1RUO A;  2R5Z B;  1LKX A;  2WV0 A;  4PGG A;  1X58 A;  2YX4 A;  1TW2 A;  2XGC A;  1GV5 A;  2X51 A;  2QYO A;  5FRN A;  1ETV A;  1V54 H;  1R1T A;  2L4A A;  1MND A;  2LLK A;  2WY8 Q;  4G9Y A;  3WE3 A;  3P9K A;  3R0J A;  1RKW A;  2VQC A;  3V4G A;  3BJA A;  1ITY A;  1U9O A;  4X0G A;  2EBI A;  2O7O A;  1ZRD A;  1J59 A;  3I53 A;  4BU2 A;  2P4W A;  1SFU A;  3PUF A;  3DEW A;  2EB7 A;  3ZQI A;  4FE4 A;  4RGR A;  3F21 A;  3TQN A;  3F9K A;  5F08 A;  3QOP A;  4KYW A;  1ZAR A;  3H3U A;  2HOA A;  3FXL A;  2XV4 S;  1UHM A;  3DPL C;  2O6G E;  2OCE A;  3TL4 X;  4RGS A;  3RSN A;  3T0Y A;  5HOD A;  3JRA A;  2GM4 A;  1WH7 A;  3FHN A;  1F4K A;  4XL9 A;  2W7N A;  3GTQ J;  4CHU A;  2WY7 Q;  1HW1 A;  2IGN A;  2VJ5 A;  5DM6 F;  3E5Q A;  1TQP A;  2QQB A;  1J09 A;  3AG3 H;  1QZE A;  1AU7 A;  1R36 A;  1KQ0 A;  2K9S A;  2PEX A;  1TW3 A;  1ZG1 A;  1HC8 A;  1G2H A;  2XAF A;  5DUK A;  1JUP A;  3OYL A;  4KIG A;  3LMM A;  3J7A Y;  3K4K A;  4OMZ A;  3JAM Z;  1HDP A;  1AKH B;  3QYF A;  1IO2 A;  1G3W A;  2Y0M A;  1CF7 B;  1Z9C A;  1VQ7 I;  1IV8 A;  2VC1 A;  5JLW A;  3HRT A;  2R0Q C;  4FET A;  3FBN B;  3GO5 A;  4L5J A;  3OYH A;  1VF9 A;  4JK1 X;  5B66 C;  2XUB A;  1VTN C;  4BAY A;  2JA8 J;  5F1J A;  1YOV B;  2ZXW H;  3OS1 A;  4DJA A;  5DUI A;  3BG6 A;  2LYC A;  3GXO A;  4ZZL A;  1DU6 A;  1MKM A;  1HW2 A;  1JTY A;  3BZK A;  4G6Q A;  3EET A;  2YPR A;  2VQH A;  2VBY A;  4EM1 A;  2X9D A;  4F52 A;  3FXQ A;  5DCM B;  4LLN A;  3V8J A;  4LB5 A;  3TED A;  2DDA A;  2JVH A;  4PK4 A;  3JTG A;  1UST A;  3DFG A;  2L01 A;  3EUA A;  4HZF A;  3NAU A;  3CMY A;  3R6S A;  2P5V A;  4KJZ A;  4Q48 A;  4ZZD A;  2X6X A;  4XR6 A;  3HOT A;  2JRM A;  4KUM A;  4M73 A;  2X48 A;  5LHH A;  4UXN A;  3BT9 A;  3ZRG A;  1DU0 A;  2HS5 A;  3M07 A;  2EV0 A;  4N9I A;  5CVI A;  2RN7 A;  4IQ4 A;  3WG9 A;  2HYF A;  5IYC J;  3OWT A;  1EH8 A;  2IA0 A;  2VJ4 A;  3J7Y J;  1ZHF A;  3DXJ F;  3RZO J;  2CUZ A;  1YO5 C;  2JUG A;  3PFI A;  1IRX A;  4Y33 A;  4OIQ F;  4AU7 A;  2KMU A;  2B9S A;  1J2X A;  4QTR A;  4M71 A;  5H2F C;  4UV9 A;  3F3X A;  2L7Z A;  4DZJ A;  5M3M J;  2CQ7 A;  3OYF A;  1ZGW A;  2XKP A;  3BR6 A;  1MBG A;  3VYR B;  1N25 A;  4ZDP A;  1D1A A;  3BG7 A;  3TP3 A;  4PJJ A;  3OIP A;  3P5J A;  1Y0U A;  2DT5 A;  3Q0U A;  4F91 B;  2WA0 A;  4E4H A;  1HST A;  2DA1 A;  1QHH D;  4OAY A;  2D5V A;  5EJC A;  2ZXI A;  1JKR C;  2H1L A;  2OAZ A;  2R7T A;  2RNJ A;  5JVG F;  3RKW A;  1LUJ B;  2FBH A;  3BG3 A;  3KPH A;  3FXR A;  1D1C A;  3SZG A;  3S17 J;  2ICW G;  4LB6 B;  1DDN A;  4XOT A;  4V2F A;  4ZH4 F;  4KIC A;  2H1K A;  3JRH A;  2HOS A;  2L54 A;  2E7W A;  4B48 A;  3VSL A;  5FKL A;  5FLM J;  5HLH A;  4BNC A;  3LSH A;  1U3E M;  3FMQ A;  1YHQ I;  3E1S A;  1IJW C;  3FBI B;  4WF2 A;  2RKH A;  4CUG A;  2FSW A;  1WHU A;  2XAG A;  2OD5 A;  3DTK A;  2MAB A;  3VDX A;  2XRN A;  2YUS A;  4WXC A;  2Z99 A;  1F43 A;  4AYB N;  1LFP A;  4RM3 A;  3MKL A;  1HDD C;  5BPI A;  4KIB A;  4RGU A;  2V6E A;  4CH7 A;  4BUP A;  3T5X A;  2V1U A;  4C3H J;  2NVY J;  2EFN A;  4G94 A;  2BOL A;  1SD6 A;  4JX6 A;  2HYJ A;  4I02 A;  2GXB A;  2P6S A;  3KYC B;  1W4M A;  2FD5 A;  3NWT A;  4BY7 J;  4HLX A;  2JWT A;  2PLY A;  3GFI A;  1IUY A;  2KT0 A;  2GOM A;  2IGO A;  3BTI A;  4C9Y A;  4DIQ A;  1WZ2 A;  4D1Q A;  1Z77 A;  3R4K A;  1G3S A;  3U1D A;  3F22 A;  3HOU J;  5HLG A;  3OYM A;  3W2W A;  1FOW A;  1WJC A;  3R61 A;  1XCV A;  1JI8 A;  3SHF A;  2L7F P;  4XOR A;  4CA0 A;  3HOX J;  1X1A A;  4CYC B;  3HGY A;  4ESB A;  3RYP A;  4C2U A;  4XN3 A;  5FB2 A;  1TC3 C;  4PFO A;  3G6E I;  4O6J A;  5DV5 A;  3S16 J;  1VQ5 I;  1D1B A;  3SXY A;  2ESN A;  4GCV A;  1P4X A;  2CQK A;  3LNQ A;  1BI1 A;  1KQ9 A;  4RLF A;  1W36 C;  4KNY A;  3PSF A;  2LFB A;  1FP2 A;  1LDJ A;  1FBU A;  4QWQ A;  1ZG5 A;  3Q3S A;  4XBF A;  4C30 A;  3WGG A;  4XOP A;  3RPU D;  2AS5 F;  2HNH A;  4IPA A;  1FJL A;  1ZN2 A;  2VKE A;  3TDU C;  2H6B A;  4A5N A;  2HYG D;  3HZJ A;  4IO9 F;  2E1M C;  1XSD A;  1JT0 A;  2DA3 A;  4RB2 C;  1BW6 A;  3FXK A;  5D4R A;  3QP6 A;  3WGI A;  2BHZ A;  2JRT A;  2E1M B;  2BXY A;  1X3W B;  5L3G A;  2MYS A;  1T0F A;  4FAS D;  1KGS A;  1U2W A;  1ETK A;  3KET A;  1BN5 A;  2ZME B;  3V8K A;  2ZFW A;  1QBJ A;  2WWY A;  5J8C A;  3IL2 A;  1N77 A;  1O7F A;  1VQ8 I;  1YI2 I;  5KK1 A;  3LSM A;  4ETS A;  2WV1 A;  2W00 A;  2BEO A;  3IKT A;  2M5W A;  3IH4 A;  5ICC A;  1SD5 A;  1EF4 A;  3FXO A;  3F8M A;  3H35 A;  1JUS A;  2Y9Z A;  4ZYD A;  1DGR M;  5HVQ C;  3KYD B;  2DOF A;  3MWM A;  3RZD J;  1X1C A;  5LFA A;  2QSG X;  4AD9 A;  2DMT A;  1E3O C;  3HGG A;  2VAS A;  2KDZ A;  3JRC A;  2FUG 2;  1IN7 A;  3RQI A;  5CPR B;  5E3L A;  2CUJ A;  4E7I A;  1XD7 A;  3EUH A;  1I5Z A;  4YRV A;  2Z5U A;  2DU9 A;  4P55 A;  2LY2 A;  2CG4 A;  2HWV A;  2M3A A;  2OV7 A;  2OTJ I;  1ETQ A;  1NHA A;  1OYW A;  4XKW A;  3BPX A;  3VOE A;  1GHC A;  5E3M A;  1N78 A;  2M0M A;  2ZBK A;  3OYB A;  3R60 A;  1S72 I;  3GTP J;  4M74 A;  2DXI A;  3EPZ A;  4PGH A;  3IP4 B;  1K78 B;  2W48 A;  1IXR C;  2WAF A;  3K1P A;  4A2U A;  2LVS A;  2Z2S B;  1E3P A;  3OYK A;  3OYD A;  4G7O F;  3TMO A;  4GGG A;  3ZQC A;  4G8X A;  3HUG A;  3DEE A;  4C2M J;  3MZH A;  2F5E A;  1RES A;  4E70 A;  2VBX A;  1R6R A;  2LKP A;  4ASN A;  2D1H A;  2Z3Y A;  4PJ0 C;  3ABK H;  3GTO J;  2RC4 A;  3KYL A;  2MH2 A;  4ZDL A;  1IC8 A;  4GYI A;  2VJJ A;  2HPM A;  2HOE A;  5CVR A;  5E3O A;  1R4N B;  1QPM A;  2CQN A;  2Q0O A;  1HLV A;  2E36 A;  3ELK A;  5BQT A;  3I3L A;  5AIP A;  1EH7 A;  2XAQ A;  2LKS A;  3HXL A;  2HI3 A;  3L2W A;  3LSK A;  2JSC A;  4EM2 A;  2WAE A;  3QPS A;  4I09 A;  2HQ5 A;  4YEL A;  2Y9Y A;  4EJV A;  1G8X A;  1BC8 C;  3CD6 I;  4WWC A;  3BG5 A;  2IS4 A;  3WTX C;  2NYX A;  5D8K B;  3J80 K;  1G4D A;  1Z3X A;  2GQQ A;  2M34 A;  1KU2 A;  2V7F A;  1V55 H;  2FMY A;  3HHH A;  1W0U A;  1NK3 P;  4P96 A;  1Z67 A;  3BTL A;  2LSO A;  4MTD A;  3S3O A;  1O4X A;  4A3G J;  3PM1 A;  2OZ6 A;  3ISP A;  4KA4 A;  4PUS A;  3I64 A;  3KP2 A;  2F48 A;  3P9C A;  3FXM A;  1RR8 C;  4HW0 A;  5ED4 A;  2XF6 A;  2Y0S A;  2YU3 A;  3SDG A;  3LA3 A;  1M1E B;  2V79 A;  4OWR B;  2BV6 A;  3J7Z I;  3A01 B;  1R58 A;  1Y8Q B;  4C3J J;  2L0K A;  5EF6 A;  2W25 A;  2HZD A;  2VQL A;  1TL8 A;  3RKY A;  3OL4 A;  4M6Y A;  1BI0 A;  2CUE A;  3DKW A;  1Y1W J;  1UJ8 A;  2DA6 A;  1JGG A;  2R7V A;  3VYS B;  4BQO A;  2EA2 A;  2UXX A;  3K10 A;  2CRG A;  3OSG A;  2DPU A;  2VB6 A;  4ENJ A;  3S1R J;  2QVO A;  1WSU A;  1XDS A;  3QAH A;  4G12 A;  1AA7 A;  3MEX A;  3K4C A;  5C4X J;  2P5L C;  1WJE A;  1OMI A;  5D8L B;  3O8H A;  1IRZ A;  1XGO A;  5D4S A;  3FXJ A;  3OYG A;  3P9I A;  4II2 A;  4A0Z A;  3JR9 A;  4NBQ A;  3G4S I;  4R79 A;  2XB0 X;  3F72 A;  1MJA A;  2J5O A;  4CCO A;  2HPI A;  4F7Z A;  2DMU A;  3H3Z A;  3ZQH A;  4BHC A;  4BE1 A;  5JFR A;  1APL C;  4EJT A;  3M1C A;  4OIP F;  1STZ A;  3BCA A;  2V9V A;  1YTY A;  3ABU A;  3DP7 A;  2DMQ A;  2KHM A;  1BBY A;  1IXC A;  1Y0N A;  2P81 A;  2DFF A;  4RAF A;  3JCU C;  2DBB A;  4KN4 X;  3FDY A;  4HDV A;  4BBS J;  4C2T A;  2L4M A;  4L9J A;  3E3V A;  4XSZ F;  1T98 A;  2DMP A;  2XKO A;  1DP7 P;  5KCM A;  3SQN A;  2JTV A;  1SAX A;  3CES A;  4BDZ A;  3DV8 A;  1EH6 A;  2O61 A;  2K85 A;  1UZC A;  2XAJ A;  2FNP A;  2HGC A;  3FZV A;  2B0L A;  4W1U A;  2X1C A;  2G7U A;  3HPG A;  2WBM A;  1TQI A;  5HLT A;  1VQM I;  4BHB A;  5GPA A;  5HNH A;  1FYM A;  2LRD A;  2NOJ B;  4KMF A;  2R7D A;  2VKV A;  4WK8 F;  2QA4 I;  2QLZ A;  1LE8 B;  4M9X A;  2EIM H;  5LEJ A;  3IH3 A;  2LY9 A;  4LK0 F;  4AYB A;  1T39 A;  2GZW A;  1TWA J;  1FIA A;  2ZCW A;  3S1N J;  1WWX A;  1IXS B;  1U78 A;  2UUZ A;  3VEP A;  1JT6 A;  2XIG A;  2L2O A;  5IP7 J;  2W24 A;  2BGC A;  2HKX A;  2ETH A;  3ZCO A;  1XSX A;  4V2G A;  1OCT C;  3SZP A;  5GTI C;  3WU2 C;  1KZH A;  3IWZ A;  4KIF A;  4CCL A;  4J19 A;  4A3K J;  2PFB A;  5DCM A;  4I99 C;  1X1D A;  1LFU P;  3F6O A;  5CQE A;  2R5Y A;  2TDX A;  4XMY A;  2GA1 A;  3DBH B;  4AIK A;  3IWF A;  2O8X A;  3S1Q J;  3KCC A;  1OYY A;  2IEK A;  2XHK A;  3CQZ J;  2EK5 A;  1QHG A;  3GFM A;  2A6E F;  4M3B A;  3PIO F;  1ONV A;  3G3Z A;  5LGT A;  2L02 A;  4XQF A;  2O5R A;  4LG3 A;  5F04 A;  2XRO A;  4IEJ A;  2W57 A;  1LDK B;  3C18 A;  3H0D A;  2OUM A;  3J81 K;  4UHT A;  1KON A;  4PJN A;  1FEX A;  4Z6Y A;  4U0V A;  3HL2 A;  1Z7U A;  3HOW J;  3EDP A;  1KA8 A;  1MNM C;  4BQA A;  3AFH A;  4FHT A;  5LHI A;  4JYK A;  2RNG A;  2COM A;  1I39 A;  1SAN A;  1IF1 A;  2JVG A;  2STT A;  2VQG A;  5FJ8 J;  4U0Y A;  3ZMV A;  4TV7 A;  4NC8 A;  2QSH X;  1S7E A;  4CSW A;  4FTH A;  5HS8 A;  4OIO F;  5GPC A;  2ZJQ F;  3J7A O;  1MIJ A;  2DQL A;  3QQA A;  3W6K B;  2VXD A;  2JMW A;  4MFD A;  3M3Y J;  1PDN C;  5LGN A;  2LF8 A;  1D0Y A;  2ZME A;  4E7H A;  1BIB A;  1SVL A;  4BL0 B;  3OYN A;  2R5Y B;  3S3N A;  1D8J A;  4J01 A;  3DPT A;  3CJQ B;  2PJP A;  5LLQ A;  4J00 A;  3PQK A;  1FTZ A;  1TWC J;  1JTX A;  2F4M B;  1ZG3 A;  2PI0 A;  4II3 A;  5JVT A;  3CDL A;  2BE5 F;  3D5S C;  1TNS A;  1JGS A;  1U5T B;  2ACJ A;  4A69 C;  2IPQ X;  3OMY A;  4Y52 J;  4CIC A;  3VYU B;  2FBI A;  2D2W A;  4L0Y B;  4S0H B;  1ZR4 A;  5LD2 C;  4G6D A;  3CLQ A;  3LSI A;  2ELK A;  2KPM A;  1DPR A;  4HPQ A;  4QPQ A;  1XMX A;  2IP2 A;  3W3C A;  4DYR A;  3ASO H;  4MGR A;  3E6M A;  2EV6 A;  4Z2Y A;  3T8T A;  3MKY B;  4ZYA A;  1X3U A;  1GDT A;  2JZY A;  1YG2 A;  1Y1V J;  3CO6 C;  1IRG A;  2IS2 A;  1XN7 A;  2ECC A;  2ZO4 A;  5IT3 A;  4KN7 X;  1Z3Y A;  5E17 F;  1X4O A;  2A05 A;  2CU7 A;  2ESH A;  4DYQ A;  2FA5 A;  2YR2 A;  4N4O B;  1BIA A;  4HF1 A;  4IRH A;  3ZQ7 A;  3L2Q A;  1MMS A;  2XDV A;  2O3F A;  2CW8 A;  5D6E A;  5K7Z A;  5H6Q A;  1MSE C;  2Y69 H;  4XLP F;  1NH3 A;  2A5W A;  1OFC X;  4KDP A;  2EIL H;  2P0W A;  2OC6 A;  5HDN A;  1PJR A;  4NQW A;  2A5Y B;  3KP3 A;  2RDP A;  5J8F A;  4HOB A;  2KIU A;  4ZYG A;  3L2U A;  3EUH C;  3KLN A;  1J75 A;  1I50 J;  2GXG A;  3I58 A;  1R49 A;  3GFJ A;  2E5Z A;  1WCM J;  1YFH A;  2M8E A;  3FK6 A;  9ANT A;  3V8L A;  3OS2 A;  5IPA A;  4XKC A;  1B1B A;  1Y39 A;  2GLO A;  3WGH A;  3S14 J;  2KDO A;  3CCU I;  1U6G A;  1XSV A;  4LGW A;  3CCM I;  2LKX A;  1ZRF A;  3K69 A;  5HNF A;  1F36 A;  2O03 A;  1LQ1 A;  3BQY A;  3B6A A;  3REO A;  1XDU A;  1RKT A;  5FLX K;  2BHY A;  1RRJ A;  3JRF A;  2X6O A;  3SYT A;  2DT7 B;  2WB1 N;  3FKJ A;  3LFU A;  2CW0 F;  4HNV A;  2GIV A;  4E7J A;  3BCB A;  3CZ6 A;  3BP8 A;  1MGT A;  4B47 A;  1ZQ3 P;  3BRO A;  4HSR A;  1O7L A;  1YW7 A;  4UUV A;  2W85 A;  1EA3 A;  4XKB A;  4YIF A;  1FNN A;  3KEO A;  5L3F A;  2LD5 A;  2WTE A;  1XPX A;  3HOZ J;  2ZNZ A;  3KEQ A;  2RVC A;  3WHB A;  2YX7 A;  4XLN F;  3CCR I;  2RGV A;  3F8N A;  4AVP A;  4BDY A;  1K78 A;  4FE7 A;  2IA2 A;  4M9Z A;  3IHU A;  5L3B A;  2OBP A;  3RDI A;  1B4A A;  2QSF X;  3FK7 A;  1DGW Y;  5DCF A;  1FZP B;  2H6C A;  4HX8 A;  1IG7 A;  1L0O C;  2HZT A;  1YX3 A;  2K3F A;  2NVX J;  5KHD A;  1NTC A;  1RI7 A;  2P8T A;  4Q5S F;  2IS1 A;  3H36 A;  1T08 B;  2MSY A;  1GUU A;  3V7S A;  3GEZ A;  4LFU A;  2WAQ A;  2R7X A;  3FX3 A;  4UVB A;  5TGT A;  1HXD A;  3KZI C;  3TOB A;  1X3Z B;  5CYV A;  1TQM A;  3N97 A;  1FOY A;  4CYC A;  3AG1 H;  4Y13 A;  4Y4R A;  5D5V B;  1ORK A;  1YW9 A;  2IBD A;  3KLO A;  3CP2 A;  4D0P A;  2UXN A;  3ZQQ A;  3B73 A;  3JW4 A;  1H9T A;  1B8I A;  2PG4 A;  1YRN B;  4I01 A;  2CFO A;  1EKE A;  4I6Z A;  2DA4 A;  4IZZ A;  3J80 Z;  1YIT I;  3BR0 A;  2HDD A;  2JA5 J;  5C44 J;  3CCE I;  4IHY A;  1WJ5 A;  3HOS A;  3S1M J;  3AG4 H;  1D0Z A;  1D5V A;  3ROU A;  3K4B A;  1OIS A;  3LSG A;  1OCR H;  3U21 A;  1R4M B;  4Y17 A;  2CQQ A;  1PVE A;  3A0B C;  5HDG A;  4RM2 A;  3HOY J;  3ZPL A;  2M2E A;  2LBF A;  1ENH A;  4EJO A;  3ZGK A;  2K5C A;  3HPH A;  1FYL A;  2IAI A;  3WTV C;  1TWH J;  1ZK8 A;  3DLA A;  5L3C A;  1W7P D;  2JT1 A;  4CCM A;  3QPL A;  2GBY A;  2R92 J;  2LDU A;  2BXZ A;  4MQ9 F;  1O3Q A;  1IV6 A;  3HRU A;  3I55 I;  2QUF A;  2KQR A;  1F9N A;  2A69 F;  4RB1 A;  2QKM B;  3A01 A;  1Z1D A;  1U9N A;  3I59 B;  3KP5 A;  3JRD A;  1F1Z A;  2F4I A;  2JPC A;  5GP9 A;  3I59 A;  2MG4 A;  1ON2 A;  2BVL A;  1VQK I;  3KP6 A;  1BC7 C;  4MHG A;  4HF0 A;  2M0C A;  2R93 J;  1FYK A;  4HV5 A;  3WOD F;  4GDF A;  5DYM A;  3GFL A;  5M5W J;  2C6Y A;  1FOK A;  5E8I A;  2HDC A;  1L3L A;  2NAZ A;  4ZC3 A;  3ECO A;  1JUM A;  1S3J A;  3SZT A;  1YS6 A;  3UR3 C;  4XIC A;  1B6A A;  1H8A C;  4L0Z B;  2EZK A;  1KQ8 A;  1X1P A;  5M5X J;  4A3D J;  2DI3 A;  3S2H J;  1VZ0 A;  1GV2 A;  5AIQ A;  4M6V A;  1WFX A;  4LIT A;  1TWF J;  5E20 A;  1JKQ C;  5B5E C;  3K2Z A;  3CCY A;  4HNU A;  5M3F J;  1UMQ A;  4UB8 C;  3GVA A;  1JHF A;  3H0G J;  2MH9 A;  1CQT A;  2LOO A;  5FKM A;  1QA6 A;  4IOA F;  4IHW A;  1I1G A;  2K40 A;  5J1U A;  2OQR A;  2PMZ N;  3MKZ A;  5K7H A;  4EJU A;  2IGK A;  3DU5 A;  4P9F A;  1ETW A;  1KU3 A;  5E1X A;  1ZGA A;  2B7E A;  3S93 A;  4EV0 A;  1YW8 A;  2NVU B;  3HEF A;  3RI4 A;  4HG2 A;  4AID A;  4GXO A;  3KX2 A;  1UB9 A;  3B6C A;  3E97 A;  1FPQ A;  1RR7 A;  1MBJ A;  2QM3 A;  1G3Y A;  2BY3 A;  3GW2 A;  3HG9 A;  1LDD A;  3LST A;  4NC6 A;  4X1E A;  3E6D A;  3V42 A;  2E1O A;  1O3R A;  3Q9V A;  3TKY A;  3G71 I;  3E6B A;  1D0X A;  1X2M A;  3GTK J;  3CDH A;  4XLH A;  4B8X A;  1B9M A;  2KJC A;  2GIZ A;  3EQL F;  4ESF A;  3W6J B;  1R5H A;  1T95 A;  3ZQF A;  2F5F A;  1BR4 A;  4IF4 A;  2L9S A;  4FX4 A;  5K5R A;  5EG0 A;  1MBH A;  5J1R A;  1BR2 A;  4OAZ A;  2KIQ A;  2MFZ A;  3M8J A;  2MC4 A;  4HAM A;  3I9V 2;  2IW5 A;  4I76 A;  3S2W A;  5TRD A;  2DT6 A;  3IH2 A;  1WH5 A;  3LAP A;  1UG2 A;  4ZYH A;  4MFE A;  2QWW A;  5EEG A;  2KP6 A;  3UNG C;  1MJ9 A;  3ZXS A;  1DP3 A;  1SMY F;  5F64 A;  5GTH C;  1FMV A;  2DQR A;  2ZSH B;  3QYE A;  4N9H A;  3SDB A;  3KZZ A;  4L18 B;  3ML6 A;  3GWZ A;  2MBF A;  1ZRC A;  2UZK A;  1A6I A;  2HVQ A;  1MBE A;  1BJZ A;  2M45 A;  4RAY A;  3G1L A;  3NQO A;  3WE2 A;  1OLT A;  1GXQ A;  1MDM B;  3CC4 I;  4XRM A;  4LG0 B;  5L3D A;  3QRF F;  4AIJ A;  4LK1 F;  3HTS B;  2DFE A;  1H88 C;  1FX7 A;  1Z0X A;  2XGX A;  1Z05 A;  1Z6R A;  2FML A;  3BJO A;  3HSF A;  2QQ8 A;  3WG7 H;  3WTW C;  1MW7 A;  4IKF A;  2JA7 J;  3HBL A;  3KIO A;  5B1A H;  3LA2 A;  1FBS A;  4U87 A;  2VL8 A;  3CMA I;  4UNO A;  4N4N B;  3MFK A;  3L1P A;  2Z9O A;  4PJM A;  3E5X A;  1YJ9 I;  1UFM A;  3ZMD A;  5HDK A;  1SC7 A;  1FLI A;  4A5M A;  1J9I A;  3BC8 A;  1ULY A;  2L5Q A;  3D0S A;  5GAH J;  4D9J A;  4A6E A;  1YJN I;  3VOD A;  5DTD A;  1SAU A;  2XGD A;  4BXU A;  1HBX G;  1MMN A;  3V7R A;  1AWC A;  1IN6 A;  1MMD A;  5J3L A;  1WKM A;  2DA2 A;  1FC3 A;  4MNU A;  3CF2 A;  3HHG A; 
#chains in the Genus database with same CATH homology
 2VPR A;  1BW5 A;  5GPA A;  3GTL J;  2VKV A;  5F0C A;  1LE8 B;  2I10 A;  4A3M J;  5HOD A;  3IH3 A;  3JRA A;  1PUF A;  2LY9 A;  2GM4 A;  1WH7 A;  1TWA J;  1FIA A;  2HXI A;  1AKH A;  3S1N J;  5EZH A;  3GTQ J;  1U78 A;  4XID A;  1JT6 A;  5IP7 J;  4BBR J;  1MBF A;  1K61 A;  1P7J A;  2DTZ A;  2K9Q A;  4V2G A;  1OCT C;  2NOG A;  1JJ6 C;  3OSF A;  3H3V K;  1AU7 A;  2K9S A;  4J19 A;  1R9T J;  2Y31 A;  4JX5 A;  4A3K J;  1G2H A;  4RBO A;  1LFU P;  4RDU A;  1JUP A;  2R5Y A;  4FCY A;  3HDD A;  1B8I B;  3S1Q J;  1HDP A;  4X6A J;  1AKH B;  1I3Q J;  2IEK A;  3CQZ J;  2LTP A;  2XB5 A;  1JJ8 C;  2NVT J;  1HOM A;  4B3A A;  1ETY A;  4M3B A;  5JLW A;  2R0Q C;  4M3D A;  5F04 A;  4IEJ A;  4L5E A;  3M4O J;  1VF9 A;  5FLV A;  2JA8 J;  5F1J A;  1VND A;  3W6V A;  2JJ7 A;  2NS8 A;  1FEX A;  5C4J J;  3LSR A;  1B72 B;  4A3E J;  3HOW J;  4BXX J;  1MNM C;  3TW7 A;  2ECB A;  2R5Z A;  1DU6 A;  2WAQ N;  4JYK A;  1JTY A;  5IP6 A;  2O8K A;  4ABZ A;  1SAN A;  2X9D A;  3MN2 A;  5FJ8 J;  1HF0 A;  1LFB A;  2DN0 A;  2EZI A;  4NDL A;  1S7E A;  3WHC A;  4FTH A;  2ID6 A;  4B1R A;  4A3I J;  5GPC A;  3TED A;  2OF7 A;  2HXO A;  4LOC A;  3QQA A;  4MFD A;  2JMW A;  3M3Y J;  3NAU A;  4QIW N;  2R5Y B;  3CMY A;  1FTZ A;  1TWC J;  1JTX A;  3HM5 A;  3CDL A;  2X48 A;  5FKN A;  3RKQ A;  3BT9 A;  3HKZ N;  1DU0 A;  4A69 C;  3D1N I;  4Y52 J;  5F0F A;  5IYC J;  4XRS A;  5EDN A;  4S0H B;  1ZR4 A;  3GTM J;  3RZO J;  5IP9 J;  2ELK A;  4M3G A;  4DYR A;  1VI0 A;  2RAE A;  4QTR A;  5EGO A;  5BNG A;  2L7Z A;  4DZJ A;  5M3M J;  1ZGW A;  1GT0 C;  1SFO J;  1GDT A;  3BR6 A;  5DS9 A;  1MBG A;  3K2A A;  5E3N A;  3OIO A;  1Y1V J;  3TP3 A;  2ECC A;  4DW6 A;  2CU7 A;  3Q0U A;  2XPW A;  4DYQ A;  2DA1 A;  2LK2 A;  2D5V A;  3BR3 A;  1JKR C;  4A3C J;  1OCP A;  5K7Z A;  2LR8 A;  3HOV J;  3BG3 A;  1MSE C;  3S17 J;  1OFC X;  1WPK A;  2AO9 A;  3SFI A;  4V2F A;  1JKP C;  1VFC A;  1RPW A;  3JRH A;  2H1K A;  2HOS A;  1YRN A;  3BG9 A;  5FKL A;  5FLM J;  2TRT A;  2N8G A;  5IYD J;  1QRY A;  1XC5 A;  1IJW C;  1QVT A;  3G1M A;  1I50 J;  2YS9 A;  5EGO B;  1ETX A;  1H89 C;  1WCM J;  1XS9 A;  3FK6 A;  9ANT A;  1NK2 P;  4MO7 A;  4D5F A;  5IPA A;  2YUS A;  1B72 A;  2GLO A;  3K7A J;  1F43 A;  3JRI A;  3S14 J;  4AYB N;  1HDD C;  3MKL A;  3GTJ J;  2XPU A;  2LKX A;  2YU9 J;  1ZKG A;  2OPT A;  1F36 A;  1IDY A;  2EH3 A;  3BR1 A;  1XG1 A;  3BQY A;  3B6A A;  3LSJ A;  1RKT A;  4C3H J;  2NVY J;  3JRF A;  2VI6 A;  2X6O A;  4JX6 A;  2HYJ A;  2WB1 N;  4HNV A;  2QCO A;  2E2I J;  2FD5 A;  4BY7 J;  2JWT A;  4UUS A;  1ZQ3 P;  4D5C A;  4C3I J;  2KT0 A;  3BTI A;  4FIS A;  3C2B A;  3TW6 A;  3FIW A;  5FKO A;  1ZR2 A;  4AUX A;  1Z77 A;  5FKK A;  3HOZ J;  3HOU J;  3FIS A;  2LD5 A;  5M5Y J;  2XSD C;  2MW8 A;  5J1Y A;  3WHB A;  3PO3 J;  4D7N A;  2L7F P;  3HOX J;  2H8R A;  1MH3 A;  4CYC B;  3HGY A;  4FE7 A;  3S15 J;  1TC3 C;  4UUT A;  1ZTR A;  2FX0 A;  3S16 J;  3OOU A;  3FK7 A;  4B4C A;  2K9N A;  1IG7 A;  2CUF A;  2ME6 A;  2NVX J;  2CJJ A;  3JRB A;  3LNQ A;  1NTC A;  2MGQ A;  1TWG J;  2LFB A;  3HB9 A;  2MSY A;  1GUU A;  3Q3S A;  3UKG A;  2XGE A;  2ZB9 A;  2FQ4 A;  1FJL A;  4DYC A;  1D5Y A;  2VKE A;  5IOY A;  1RET A;  4CYC A;  1ORK A;  2IBD A;  1JT0 A;  2DA3 A;  3TP0 A;  1BW6 A;  3BR5 A;  1B8I A;  4UUS B;  3Q0W A;  1YRN B;  3IV5 A;  4I6Z A;  2DA4 A;  2Y30 A;  2ME0 A;  2E2H J;  3BR0 A;  3G1O A;  1ETK A;  2HDD A;  2JA5 J;  5C44 J;  4A3B J;  2CQX A;  4IHY A;  3VPR A;  3S1M J;  1T33 A;  1GVD A;  5F0H A;  2L9R A;  2TCT A;  2DA5 A;  3LSG A;  1T56 A;  3A03 A;  2WV1 A;  2CQQ A;  4GFB A;  2Y0S N;  5F27 A;  3IH4 A;  4JP0 A;  1EF4 A;  1K83 J;  3HOY J;  3BTC A;  1JUS A;  2M2E A;  2Y9Z A;  1A5J A;  1ENH A;  3LOC A;  3SJM A;  3RZD J;  1IDZ A;  4QSH A;  2DMT A;  2XPV A;  2IAI A;  1TWH J;  1ZK8 A;  1E3O C;  1BA5 A;  3HGG A;  2KDZ A;  5JLX A;  3JRC A;  3RQI A;  5E3L A;  3QPL A;  2GBY A;  2R92 J;  1IV6 A;  3ZQL A;  1MSF C;  4DZP A;  5EG0 B;  3F0C A;  1ETQ A;  3A01 A;  1IGN A;  2NS7 A;  1U9N A;  3ZOB A;  3JRD A;  5GP9 A;  2MG4 A;  2XRL A;  5E3M A;  1FTT A;  2M0C A;  2R93 J;  2LP0 A;  1ETO A;  2FJ1 A;  3GTP J;  5M5W J;  3DCF A;  2W48 A;  4M3F A;  4A3F J;  1JUM A;  2COB A;  2DJN A;  2LVS A;  4EEF G;  4XRS G;  4XIC A;  1H8A C;  2M9H A;  2EZK A;  2L7M P;  1JKO C;  5M5X J;  3BTJ A;  2B63 J;  3S2H J;  4A3D J;  3ZQC A;  1GV2 A;  4M6V A;  1Q1V A;  4C2M J;  4IHX A;  3LSP A;  5IYB J;  1TWF J;  1RES A;  3I4N J;  3GBG A;  1JKQ C;  3CCY A;  5M3F J;  1UMQ A;  4Y7N J;  3H0G J;  1CQT A;  5FKM A;  5C3E J;  3GTO J;  4IHW A;  1X2N A;  1IC8 A;  2K40 A;  5J1U A;  2PMZ N;  5K7H A;  2QF7 A;  5E3O A;  1WI3 A;  3S2D J;  2ID3 A;  3JRE A;  2HOT A;  4A3J J;  5IOZ A;  1HLV A;  1ETW A;  2E2J J;  3I4M J;  3E7L A;  2HI3 A;  2EZL A;  1AHD P;  3HEF A;  2E19 A;  1IUF A;  1QPI A;  3QPS A;  2HQ5 A;  3BQZ A;  2Y9Y A;  3B6C A;  5EZG A;  4M3E A;  3BG5 A;  1RR7 A;  1MBJ A;  4X1E A;  2M34 A;  3GTG J;  1W0U A;  1NK3 P;  2E1O A;  3BTL A;  3JRG A;  2EQR A;  1O4X A;  4A3G J;  3PM1 A;  2M8G X;  1HCR A;  1X2M A;  2NVQ J;  1FIP A;  3GTK J;  2JN6 A;  3Q0V A;  2JA6 J;  1PUF B;  3ZQF A;  3SDG A;  1LE8 A;  5K7F A;  1MH4 A;  5EG0 A;  1MBH A;  1UHS A;  5J1R A;  3A01 B;  2AHQ A;  4C3J J;  2L0K A;  5EF6 A;  4I76 A;  3IH2 A;  1WH5 A;  2CUE A;  3PO2 J;  1Y1W J;  1UG2 A;  2DA6 A;  4MFE A;  1JGG A;  4BKX A;  3BR2 A;  2G0E A;  3ZQG A;  4AC0 A;  2O9L A;  2CRG A;  3OSG A;  4MIM A;  4MLO A;  3S1R J;  3NAR A;  1A6I A;  1MBE A;  1BJZ A;  4G12 A;  3G1L A;  1OJL A;  3A02 A;  4XK4 A;  1U8B A;  5C4X J;  3O8H A;  1IRZ A;  4W97 A;  4IHV A;  4XRM A;  1BL0 A;  1POG A;  1W0T A;  2EZH A;  1H88 C;  3JR9 A;  1MBK A;  1Z0X A;  2R7Z J;  1QVU A;  2JK3 A;  2XB0 X;  1P7I A;  2DMN A;  4A93 J;  2DMU A;  3ZQH A;  2JA7 J;  3HBL A;  1WGX A;  2VUM J;  2Y2Z A;  1APL C;  5EYR A;  2R5Z B;  3L1P A;  4BY1 J;  1X58 A;  2XGC A;  1GV5 A;  4A3L J;  1ETV A;  2DMQ A;  2P81 A;  2LLK A;  3FKI J;  1I6H J;  4D7M A;  2DA7 A;  1RKW A;  1ITY A;  5DTD A;  1U9O A;  2EBI A;  2O7O A;  5EEA A;  4BBS J;  2XGD A;  2DMP A;  3MVP A;  3DEW A;  5J3L A;  3ZQI A;  2DA2 A;  4FE4 A;  3O8G A;  5F08 A;  4JX4 A;  2HOA A;  4W1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...