1TCMA

Cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 201
structure length 686
sequence length 686
chains with identical sequence B
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tcmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tcmA01
3PP3H 2APXA 5DQDL 5IQ7L 2B5IB 3EDFA 4UZSA 1BGAA 2APBA 4ZO6A 1CXKA 1YMMB 4HA4A 5JW5B 3CZLA 3A6OA 3QISA 3CUFA 1G94A 1TVDA 4FZ8L 5IP4A 4GQ9H 4ZSOB 1OGAD 1BFOA 5IB1A 2AV7A 4L3CB 3FTGA 3A5VA 3DURA 1W9VA 1BAGA 3GXTA 3GSXB 3MLZL 4I13B 1KCVH 2QSCH 1YEGH 3VH8A 2IGTA 35C8H 2BS9A 1G9ML 3FQXA 3UTZA 3BW9B 4O5LH 3RA7H 4XWGL 1DTUA 3S34H 1FC1A 1N64H 3O3BB 1T21B 3RFZC 1BYDA 2MFNA 4PJ5A 3SCUA 4ACYA 1CI5A 3P4NB 5J6GA 1UACH 4FQ2H 1AP2B 3RJYA 2O9PA 4D8PA 5A6LA 3DUSB 3ARGA 4O00A 3ALWA 4XVJH 1U3HC 4QRSB 3VFPA 2DJUA 2ADFL 4JFVA 1H5BC 2H32A 1K8DB 1S7UA 4K68A 3FT2A 1NCCH 5CD3A 1QR4A 2NY0B 1WV7T 3H3PL 4UAOC 3OZ9L 1YEDA 4HS6B 2B1AL 5IFTA 3MRNB 1BZ9A 5IFAH 3N12A 2BRRH 1P7QA 1X6LA 3QEGH 5DJCA 4NSBA 3IDXH 2X4QA 1IC5H 1KJ3H 2P46B 4HC1L 3MUHL 1RUKH 5AZ2L 4L4VD 3UEQA 4JQIL 2DQDH 2ZNXA 2IFFH 3MLSH 4FNRA 3QIWB 2WAGA 3P9MA 2Z4QB 5IUSA 2R23A 3D25B 1LLOA 1Q6DA 4HMDA 3TT1L 4FLRA 4OSUH 4CNIB 3GIZL 4NRXB 2O93L 1UA7A 2A9MH 1BTCA 1MFCH 2APFA 1DCLA 3B8SA 3WXVH 3RUGB 3OXSA 1TMCB 3M8OL 4JAMA 2DICA 5IMKA 4UV4H 3DIFA 4G7YL 5TE6L 5IG7B 4F2MA 2HJKB 4OF0A 3BSZL 2XM1A 1U92B 1I7TB 5DK2B 4DFHA 1MF2H 4JPKL 3WV0A 5KANG 4JLRB 4KI5D 2XQYG 2OZ4L 5CZVH 5HTSA 5IW6B 1XYFA 5HYJA 1MXDA 5EWIL 3VFNB 4NC1E 4Z7QF 5TGBA 2YD5A 2W59A 3A22A 1BFNA 1IGYB 1YYLL 2PW2A 5CEZD 4IS6A 4YHLL 5ECJE 3IDJA 3OLGA 1LK3L 3PP4H 3MQIA 4QP0A 1DQDL 1U8KB 1QUNA 2N7BA 1JYWA 1JN6B 4HTYA 4UV7L 5EU3B 1QSFB 3TV8A 4ATWA 3NJ3A 2C9AA 3NIYA 3CFEB 4ZOEA 3BZEA 3L7EB 5IEHA 1LF1A 3RWDA 1WDPA 3D39E 4JFDA 3KLAA 4N0YL 5L2JA 3C5ZC 2XRAH 5EU7E 3VVGA 3ES6B 3MJ9A 4ONHB 1TQSA 3C9NB 2IXVA 1WWWX 3G6JE 4MNQB 4PJGF 4XNYH 4GQQA 3JUGA 3WUEA 1E6NA 4B3KA 3D3VE 2R0ZL 3EGSA 4XTRD 3QWRA 4MHHI 1RJZB 4X9HA 2X10A 3GKWL 3BOVA 5GQBA 1RSFA 1YEHH 3C2AH 1MRDH 3FQNA 1A14L 4JFXA 1S9VA 2WIMA 5GS1C 3QEQB 4IDLA 4LGPB 3NZHL 1DFBH 4ZUTB 3ZKSD 3QNXA 4YPGA 4PRBB 1SJHB 1EFQA 3W0WE 5BVJB 1CXFA 1JMXA 1IM3A 5A6MA 3NABH 1PY9A 5DZNA 4NJAL 5HDLA 4PJAE 3PQYA 3QRGH 3FO0H 3WH5A 4PS4L 3SCRA 5IVNA 2FJHB 2WP3O 2ZNWA 3KPNA 1RZKL 4L9LB 5EFIA 3RDTD 3ELAT 2VITB 4O2CB 2DDQL 3BD3A 4O9HL 4ZPTA 5LA0A 3JWOH 2QPUA 5ISZD 3QDAA 4OTXL 4WEBL 3NA4A 4UCFA 5BXRA 4LKCB 3IF1B 3H3KA 2G60H 4EN3B 2XSAA 3HNVH 2ZKHH 1HHHA 3JV4B 3TM6A 1X4XA 2FSEA 4UQ3A 1WDQA 1ZLSH 1V08A 5GGSA 5BO1L 3DXAA 2FGLA 4L8SC 4RQQB 5DC9B 2FX8H 1XF1A 3VXQB 1KUMA 4ZPVA 3HZ3A 1KCUL 5DT7A 3IFNL 2K1MA 1Y6MR 4DO6A 3QG6B 4V2XA 1RMFL 2GTWB 4BKLB 3ZTJG 4OZIF 5D2LF 4D3CL 4K3DL 1OGAE 3PWPB 3VXMD 5I18L 2D3VA 4TNWF 4JN1H 3F6IA 2XGIA 1OP5K 3LQZB 3HG4A 4MQXC 3RGVD 5KVDL 3D0LA 3ZR5A 1M6OA 2EYRA 12E8H 1BQUA 3UC0H 1G6RA 4I18B 3KJ4B 4U6YB 1LE5B 4L3EE 1GZQB 3HZVB 4ZUUB 3CDGB 1IKNC 1TQTA 4DTGL 2OSLA 5DLMH 3VIHA 3WEZA 1JFQH 4LGSB 43C9B 1H49A 2GSIB 2DQCL 3IDIB 4QY8A 4FZEL 1UKTA 4HZ6A 4EDXB 3EOTH 8CGTA 5K9KB 8FABA 4PGBB 3AYRA 3TYGL 1CR9L 1G7IA 5MEQA 3PZNA 1MWAH 5IR1A 2WWKT 3S37H 1CU4H 2EKSA 3PDOB 1MVYA 5E9AA 1UJTA 4HH8A 3T2NL 3O11B 4DKDC 2C8NA 2J5LC 3P0YH 4YHGA 1HYSD 4OZFH 2RCSL 2VQUA 3CMJA 3MRKA 3O8XB 3MTRA 1PEZA 1KFAL 5D1ZC 5HPOA 3HAEG 3D0VA 4Y1AA 1C12B 5T1DH 2DWEA 2IANA 1WZ1H 1ZHNA 4IOIB 1G0DA 3TVMD 3LXAA 1E0OB 4JY4B 1NEUA 2BJMH 3AIEA 1B6UA 4JO2L 2DH2A 3DDFA 3DRQB 2VXVL 3GJEB 2G9HA 1SVZA 1B2YA 4M9PA 2P8LB 2OR7A 3G04B 3AIBA 5A16B 1P69B 3FN0H 2HH0H 4TNVK 4Z5RA 5E00B 4ODXA 1I8KA 2Z31B 4AZCA 3F5LA 3WIHL 4R7NA 5AC4A 3W24A 3VA2C 1MWAA 4WI2A 1K9DA 4GZIA 2F53B 3QAZC 4TUKH 2GJXB 2CDFB 5HHMB 3IGUA 4OLYL 5C0JA 1ZA6B 2EKJA 5TDNB 5EUOA 4MD0A 1OF2A 4PB9L 3MZTA 4GRLA 4U3CA 5HYSB 3ZDYF 1D5IH 2Q3ZA 5SWSB 3GSVA 4CVUA 5DZLA 5TF1H 3P2TA 4LCWB 4X6DE 4R6UA 4YBQD 4EJ1C 3IJSA 2YSSA 3V9FA 2EDNA 5GIRB 3ARDD 4X7DC 3BCDA 1KN2H 3MMDA 4UUJB 2EH8L 4JR9H 3LKPA 3ZYIA 4J3VA 1MEXH 1BD2E 4JKPL 2OSWA 4W86A 4GUPB 5IOPB 5F7EH 1WITA 5I0DA 4NZUL 5IV2A 1KXTA 5GJSH 4JZNA 3CDYA 4GS7B 3T8XA 2VWEE 1ZHBA 3AXLB 4QCIA 2BFGA 2DTMH 1T7YA 5FYJE 3VD5A 3DYMA 1RZIB 2APTA 1JVKA 1R3JA 1TJIL 3BUPA 2YPVL 5D1ZA 3RWCB 5ABFB 5E99L 1XGYL 1E70M 1S7VB 4EI5C 3ZE0E 5GZND 4AIEA 3ARFB 1EQPA 4B16A 4F9DA 4X9FA 4WI9A 1FP9A 3A4WA 1IGCH 1I1RA 5KVGL 1HT6A 1JZ5A 1E71M 4GLRH 2EDXA 4EUPH 1FZKA 1QNZH 4XBEL 3IGAB 1OM3L 3WH7A 5EO0A 1GOKA 5TH2A 3BH9A 1GOWA 3SGKA 4DN3L 1Y6NR 2VMFA 1DE4A 1RIHL 2ZUSA 3E6FA 3FCTA 3KLKA 1A6UL 5LGHH 1GHRA 3PWJA 3HE7B 3V4UH 4AT6A 1NLDL 2APVA 1JWUA 1INDL 2FCBA 1U8MA 3WD4A 2R56H 4BFIA 4PGEA 3PV7A 1UCBL 3EFDL 2Q76A 3LX9A 5FUZH 1A6AA 2AABL 4RL3A 4LAQL 3LXCA 3NAAH 2VABA 1BFOB 5BS0A 5IB1B 1HKKA 5MP6L 2AV7B 2C4FU 4P7LA 1PJ9A 3FTGB 1OD9A 3DURB 2V3FA 4HK3N 4YDLB 1TPXB 5FHAH 1ZGLM 2YD1A 3V0WL 1GPOH 2VSDA 3VH8B 3FQXB 3UTZB 3MV01 3DO3A 4MNGA 4JHBA 4P9ML 4P2QA 3TFKD 2VLJD 1OL0A 4PJ5B 4EUPA 1P7KA 1WJ3A 2TAAA 5J6GB 1IGJA 1XMWA 4ONFL 4FFYL 4JM4L 5HHXL 4D8PB 4KTDH 5LWYH 2X5PA 3ARGB 3VFPB 2DMKA 2CJUH 1TITA 5C09A 3IJYA 2H32B 3R4DA 4AQ1B 2EDJA 4LSQL 3TA3C 4RGNB 1S7UB 3FT2B 5CD3B 4F15B 4HOZA 3NH7H 3SUWA 5FGCB 2J7LA 5TE4H 1YEDB 3UTTD 4U0RC 1JNEA 1BZ9B 2JELL 3HNSH 4WUUD 3CUGA 1P7QB 3L2MA 5DJCB 2X4QB 3ILPA 1CDHA 4JEGB 1A3RH 4Z2GA 2EDDA 3WMBA 1NCWL 3S7GA 5ABEA 4KQ3H 5IVXF 3P9MB 2R23B 1UH4A 1N59A 4S11A 4D9LL 4FFWD 2E7LA 1RP8A 1RP9A 2X4UA 3AQUA 3ABZA 3MU7A 4K8RC 1MHCA 4RWYL 3UZEA 2J79A 3OXSB 1EIBA 4JAMB 5IMKB 4LVNB 2MJWA 1S7QA 2C3VA 3GJFH 4M1CC 3DIFB 5C70A 1UD2A 4HZ7A 4IPNB 3OGVA 5DVOA 4F2MB 3AC0A 5DJZA 3BP6A 3OAZK 1Q4NX 4ERSL 4XC3H 5CSZA 1E5NA 5HYJB 5A8NA 2ZUMA 2HT2D 5TGBB 2OJZH 1QTYT 1EJOH 2PW2B 4YC2C 5FYJL 4NQXA 4HS8H 4IS6B 2WZEA 1E6JL 3BP4A 1DQTA 3KLDA 3FB7A 3IDJB 1QFWI 4AEHH 1UD4A 2WUBH 2E3VA 4ZNEA 5AYUL 1QRKA 1U6AL 1B30A 1HSAA 2IXUA 3THDA 4XV0A 3BZEB 5IEHB 3RWDB 5L8JB 1J0ZA 4JFDB 3KLAB 2IBBA 4S10A 5JUEH 4KHTH 3GJFA 5L2JB 1PG7X 3DMMD 5DJDA 5I3DA 1SBSL 2I9TA 2JF1A 1OBAA 1WDSA 1I7UA 1M7IA 1Z9MA 1HL8A 2WCGA 3M6DA 4P7QA 4WWKC 4Z95H 2VB5A 3EGSB 3OSKA 3V2AR 3R0MA 5GRXG 1EAJA 4MMXC 1H3GA 1HZHH 3ZR6A 3L5IA 1OPGL 1WCBA 3KS0H 5C7XH 4PJCA 4M4RA 2ORBL 2F61A 4HG4K 4YXKL 3GUTA 1R3IH 3FQNB 2JF6A 1AJ7L 4JFXB 2AJSL 1S9VB 3FOLA 3WL0A 3BKJL 4ZAKD 5M7QA 1G0CA 3QNXB 4YPGB 4CJ1A 1RU9L 3ET9F 2Q6WA 1GGCH 1IM3B 3IAQA 5CSBA 4HP5A 5I1IL 4NP4H 4PG2C 3QWOA 4CJ0A 3PQYB 4MS8D 4LYQA 2VTFA 4U7KA 3GM8A 3MXWL 4OF7A 3S35L 1DWFM 1HKLH 2YLLA 2ZSVA 1AY1H 3AY4C 3KPNB 2VXSL 5EFIB 3UJIH 2CK2A 1R47A 2ZXBA 1HIZA 1KGUA 4ZPTB 4NFBA 3OV6A 2Y4SA 4XMPH 4OCLC 1EEQA 5K9JL 2VERN 1HVQA 4JFPA 5FV2A 2DJSA 1HHHB 1R3KA 5E1HB 2YD3A 3SQOH 2FSEB 2WMHA 3FQTA 4UQ3B 5C08E 1M01A 2FD6H 5GGSB 1B2WH 3DXAB 3CFCL 4ZXBD 1I1CA 2R2HA 5DT1H 3OKKA 5JBEA 5T3XD 4M7JL 4ZPVB 1FE8H 4HIJA 4KQ4L 4UTAH 1AQKH 1N7MH 4L4JA 5DURB 4YXLL 2VURA 4KZEH 4RMRA 4HCRH 4Y2DC 5DUPH 1YC7A 3D0LB 1DQMH 3PZUA 2BVEA 2A2QT 1QBLL 4KKNA 1M6OB 2EYRB 4E9LA 1PGRB 1IJ9A 4HPGA 1G6RB 4TOYL 5KVMC 3TNNA 3WSQL 3CJJA 4U6TA 1VSCA 3U9UA 4LIQE 1U3ZA 3GSNH 3P9LA 2PWHA 4W7VA 2OSLB 4FFZH 5GRUL 4BQ9A 1QI2A 4AD3A 2UY7A 4NCC1 5FGSA 5AZEH 4LKXA 3WO3B 1PLGL 3E8UH 4QY8B 2XG5A 4JHWH 4Y19E 1UZ6F 5JA8B 1GGBL 3ZKXC 1A7PH 1FJ1A 2MCPL 5EIIA 3SE8H 8FABB 5I66A 3L5HA 1WBYA 4LPXA 1W2KT 4PJXF 1G7IB 4LSPL 5MEQB 3MC0A 4NQDD 2J7HA 1QRNA 4Z7UF 1CLYL 5IR1B 5GGTH 1DWAM 1OTTD 2EKSB 4PG2A 2PTTA 4QCEA 3CUPA 2D7QA 2P5WA 5JMRA 4HCRA 2P4AB 1NCUA 3MRKB 3E3QE 3HUJF 5JZ7C 2YN3A 1TVBA 3D0VB 4Y1AB 1PBGA 2EDBA 1IQWH 2DWEB 2IANB 1ZHNB 5DVKA 1VDGA 1S3KL 2JJSC 1KJ2H 2H6PA 3IVKA 4CN1A 3FMGL 4AIOA 2G9HB 4TSAH 3TJHD 2VDKL 4I3RL 3NIFF 2IAMC 2QR0A 1P4BL 5DUML 4Z5RB 4ODXB 1I8KB 3OAYK 4LFHG 3TNMA 2PXYD 4TULH 5GGQH 3VXSD 4BQ5A 1YNLH 1CDUA 4K71C 4AZCB 4XPFH 4R7NB 4NGHH 4OUOA 1KXVA 2EC8A 2Q8XA 3MROA 1OARL 3NUKA 1MWAB 5DMJB 5D7SH 5GGTA 3F62A 3Q5YA 3WEOA 5C0JB 3FRPG 1LILA 5EUOB 4MD0B 2YJQA 2J12B 4JG1L 4PJDA 1OF2B 2IQ9L 1RAMA 1TQCC 1XCQA 4GRLB 1XF4A 4PJAF 5IHZB 2WK2A 3D51A 4GOSA 2X4SA 4CMMA 3WY4A 3TF7C 2DM3A 2MOVA 3DWTA 5FCUH 1OGGA 3GSVB 1YEFL 1KCKA 3EYFA 1CF8L 1YN7A 4X5WA 2WYSA 4MD5A 3IJSB 3GSWA 1HX0A 2YSSB 3EJQA 3C60D 2BOCA 3G9AB 4XMLH 1KJ2A 4P5TD 4HV8A 2BNQD 1L9NA 2VLRD 1NWTA 5I71B 3LQAH 3LKPB 4JJ5A 4KY1L 4IMKC 3L9RA 4KI1A 5IV2B 1KXTB 4JZNB 4ML4A 3QI9D 4GINA 3T8XB 3STBA 3TCLA 1UKQA 1ZHBB 3OR7A 3WF3A 2I60H 4QCIB 3RILA 4PTWA 3IFOA 4GAFB 4LGRB 1T2QL 5D8JL 3O4OC 1R3JB 4YHKL 3BVWA 1DWGM 1ERNA 2NY4C 1YZZA 3DLQR 5D1ZB 3UJJL 4QOKE 2NY2D 2AJVH 1XSKA 4V2BA 5F6HJ 1QFHA 3MCLH 1QPXA 1TQBB 4H41A 5KSBA 4UFLA 2A74A 2BX5A 2J25A 3O4LE 1UG9A 5MEOA 3T2QA 1FZKB 4YX2H 4NCDA 1J1PL 2IAMA 5E5MA 5EO0B 1UB5A 4PLNC 5I0ZA 4AXNA 5TH2B 3BH9B 1ADQH 1QD0A 4R26L 4MDPA 1QFWH 2NZIA 3O81A 3FHQA 3NFSH 4YHIA 4LIQL 3IU4L 4U3XA 1DE4B 1CZ1A 3E6FB 3FCTB 3PZ9A 2VDRL 1HE7A 4I3SL 4JB9H 1W1TA 3PWJB 1AXSA 4OCWL 4LOUC 4AT6B 4GBXA 1JWUB 2XNAA 2VDQH 4NT6A 5CSUA 1U8MB 3EJZC 5I1KL 43CAA 4PGEB 4BFIB 2W62A 2FHFA 2BY2A 2DQFA 4NJ9L 1UGNA 2Q76B 3VFVA 1CBVH 2V2TA 3QCUH 1A6AB 4WV1C 2ICEA 2XIBA 3HC4L 4OV5A 2VABB 5BS0B 2VKWA 2WW5A 2NY6D 1UJ3C 3OB8A 4MA3A 3ZKQD 1MW3A 1C7SA 4B9ZA 4LSVH 1G0XA 3KVQA 3JWDL 5BXFA 4MA8H 3NVQA 1YEJL 4MNGB 4GW5A 4X0KA 4P2QB 1UHVA 1JE6A 1OB1A 3L3HA 3RM8A 5I6SA 4EUPB 1P7KB 2E9BA 1J0IA 2EBNA 4LEOA 4ZXOA 2FJFA 3B8YA 1IGJB 1P6FA 1ADQA 1NP2A 4NNPL 2A6JA 4R2GC 1PAMA 3EO9L 3ARVA 3WQ6A 4PJEE 4XNZC 1P4IL 2B8OT 5EA0L 4PB0L 4OZGA 5C09B 3IJYB 3I85A 4H88H 1E1EA 4O02L 5ICXA 4HK3J 3MLTA 4JFFA 1US3A 2CLVA 3MLXH 1RUPH 6A3HA 1LMKA 2YRZA 5KOVC 2R9HD 3W9EA 2ZX6A 3N18A 4PLOB 3ILPB 1WIPA 3SUUA 3LD8C 3W82A 5H94A 5JOPD 3MLWL 1Q1JH 2AEPL 1QNOA 2A73A 3T2PA 1AXIB 4AD4A 1W9XA 1N59B 4DO4A 5ID0A 1KACB 1A2YA 3Q5TA 3INUL 2X4UB 4NFCA 1MHCB 3H42L 1V3JA 3QXAA 2FEDC 3TN0C 4LLMA 5E4EC 2K9UA 4KK6C 2WZPD 5EC1A 1S7QB 2C3VB 4P8UA 3SE9L 5DC4B 4S1DD 4PRIA 4XNXL 5HHOA 3IFPA 2VUYA 2X89A 1QZ1A 5DJZB 3RJQB 2GUOA 3BP6B 2QSTA 1Q0YL 5KS9A 4WV1A 5A3ID 5H35A 4XWOD 1F4XH 5CSZB 3SY0A 1UJ3A 5CGYC 5CINL 3HMXA 4TTUA 4ESKA 4YHZL 5F88A 4OZ4A 4PRHA 4L4OA 1ZVHA 2FB4H 1DBAL 4A6YL 4NQXB 1U41A 4KRMB 3BP4B 1BVLA 1BWWA 3VWJA 3MRJA 3FB7B 4OQTL 1I9JL 1JI1A 1CWYA 4LVHC 3E2HB 3L7FA 4Q74A 1T7XA 1E6XM 1HSAB 5E24E 1A7RL 3CXHK 3ESUF 3HE6C 2X1QA 3IS0X 3MV7A 3OF6A 4FP8H 3B9DA 2XTJD 2EZ0C 3JTTA 2OL3L 3QDJD 4EI6A 2YFOA 5E0FA 1MJUL 1AC6A 2YD2A 3UZVB 3IJ7A 4W93A 3GJFB 3BAEH 4UQEA 4WY7L 5DJDB 2XACC 5DZOA 2I9TB 3WLWC 1I7UB 1MI5D 1M7IB 5FV1L 1IM9A 4YHMH 1W8OA 4P7NA 3TESA 2UUDK 4XNQA 4U0RB 1S7SA 4LEXL 4QXGL 5EB8A 1V7MH 5E8DH 1W3HA 2WMGA 4P23D 1WCBB 2YL9A 4Q6YA 2R0WH 2XA8L 2XTLA 4PJCB 3MLRH 4X8JA 2HVKA 3GUTB 1E0VA 1D7FA 3FOLB 1Q9OA 4OBSA 4GSDH 4WNQA 4UBDC 2IQAA 2VAJA 4GQRA 1DANU 1LP9E 2VC2L 2G5BA 5D1XD 2Q6WB 4U1KA 4ZO9A 2ATPA 4TVCA 3QWOB 5B38A 3ULUE 5HHVL 4GAJL 3LB6D 1UR1A 4JFZL 1V0KA 4P2RA 3SKNA 3SE3A 2ZSVB 3ZOAA 4R0LC 2YL5A 1BEYL 4RMTA 1FL6A 4I48A 2NNAA 5EOCH 1WTLA 3VXRA 3D18A 3WH9A 4GG6A 4JFPB 4P59H 4WW2F 4KKCD 3ARBC 3U30C 4E41A 1R3KB 3MCKA 4YC2B 5DR5H 3FQTB 1JHLL 5GRVL 2XT1B 5GHWH 1H4PA 4MB1A 3Q6GH 2AEQL 1M03A 5AYBA 2J8UE 5F3HA 3X3FH 2R2HB 2Q8AL 3OKKB 4RFOL 3T2OA 5L88H 4HH9A 4HIJB 3RTQD 1JPST 1DN0A 4CAGA 2LTQC 5IJKC 4MSWA 5HSFA 3L5XL 1X44A 4JZJC 1QWUA 1IAIL 3L4TA 4PLJC 3PIQA 4PTTA 5E6ZA 2DSVA 2XWTA 1J87A 1W3LA 2O9TA 3WD5H 4M62L 4JFHE 3H8NA 5DTFA 1D5BA 1VFUA 5E5UB 1FO0L 3KPSA 4U49A 5F71A 3TNNB 3U9UB 3O9NA 3P9LB 3RY5A 3LDBB 4ALAH 1F4AA 4KK9C 1B3WA 3P77A 1F6AA 3UESA 3CAFA 3CZGA 4FTVE 4LKXB 4UT6L 1KXQA 2EACA 4WKHA 1U2CA 2X42A 1FJ1B 5EIIB 3V7AE 5I66B 3QDMA 2JJTA 1WBYB 3ZHLA 4IRJD 2NXYC 3FFCE 1QRNB 5F96L 3GI8H 1CQYA 5D7JC 3SO3B 2PTTB 4RAVA 4WDIA 3WN5C 3CUPB 1AGDA 2F54E 1YC8A 3PXJA 4IJ3C 3ALXA 5I74B 2P5WB 3K2UH 4XPGL 1TENA 5C0BA 4DOHE 4RMVA 3WO4C 3TLRA 4R0LA 1ZS2A 1MIEH 5ACMA 1TVBB 1ZT4A 2FRGP 3AIQA 2DI7A 1DBJL 4JHAL 1T89C 4H26A 2H6PB 3O41A 3ARBA 3IVKB 4MXWH 4EIZC 1KGWA 3L4XA 1V02A 4NC2B 1UA6H 4ZUSA 1J8HE 4X6CE 4MAUL 4NM8L 1PX8A 4Z7WE 1KBGH 3ULVE 2QR0B 2XKSA 1CDIA 1T03L 1JGVL 2D03H 1R5VA 1V0NA 4XP9H 1U93A 3TNMB 1NCAH 4MAYC 3ZSTA 1VHPA 4PJBE 2QQNH 2ZP0T 2O92A 2LAAA 3V52L 3VFOA 3MROB 4D71A 3C8KA 1JJUA 1YNKL 4M61A 3BD4A 2AJUL 3GO1L 3QFDA 4HJJL 4JZJA 4APQA 3BPNC 2R2BA 2CKBA 2GJRA 3LEYL 5ACLA 4PJDB 4HGKC 1KB5H 5F1SA 5JPNA 4EANA 1I3GH 1XCQB 4HIXL 1XF4B 2P5EA 4X7FC 4PP1C 2X4SB 4CMMB 4KJPD 4CMHC 1WWCA 1JPSL 2HRPL 3ULUL 2QPSA 3EYFB 2ZCKH 1AI1L 1KGXA 1YN7B 4HW6A 4X5WB 3UPCA 2J1KA 2G4FA 4MD5B 4M56A 3GSWB 3P0VH 2DLHA 2BOCB 2XPGA 1KJ2B 1G7JA 4HV8B 3BAIA 5CS7A 1H0DA 1HCFX 1GJIA 2EPKX 1MVFA 1UWGL 1YQ2A 2X4RA 4LLAA 5E8NA 1BVNP 1Q6GA 4JJ5B 1KC5L 5E56A 3OIHA 3IJ9A 4M03A 4QRPA 3EYSL 3L9RB 4OLUL 5F1KC 1PSKL 4GFTB 1KELL 4QLRA 3MRMA 2AK1H 3DGCR 3WFEL 3QHZH 3TCLB 3OR7B 2QSVA 3RAJH 1IFHH 3G5XA 3IFOB 3S2CA 3DV6A 4PJHE 2I07A 4W8BA 2YMXL 4LLVA 4XHQA 5H2BA 2R2CA 3CFJA 1KB5A 2IGFL 1UR0A 1F3RB 4EBQL 1UA3A 3BN3B 5K59E 5IIEA 5FD0A 1A6ZA 4V2CB 2HLAA 1CD1A 2AEIT 4JDTH 3FONA 4DM2A 1R0AH 5AG9A 2Z91A 3IRPX 4DW2L 5KSBB 3ARSA 4WO4C 1F42A 5K9QG 2A74B 2XQBL 5MEOB 4OGYH 2DIEA 1I8MA 3VD4A 1RZKC 1FYHB 1LE9A 5E5MB 2IAMB 1UB5B 5J56B 4N1HB 4YHIB 5D7LE 1I1AC 5JHLH 4H1LH 3H9HA 3O3EA 5I1DA 1ZMYA 5IM7A 4PRPA 2CQVA 4ZFZA 3K74B 1AXSB 4NI3A 2YK1H 4GBXB 2XNAB 4DUVA 4NT6B 1FPTL 4PMNA 43CAB 5GISH 2DQFB 4QYOA 3VFVB 4PYHA 5EBGA 1E27A 2NTFA 1TQCB 2ICEB 4OIBA 2V2TB 4OV5B 2Y5EA 4NZDA 4MA3B 1W9UA 4OFYD 4ZD3H 2AMGA 4Y4HA 4PRDA 1NBVH 4NN7C 5BXFB 1BFVH 4XAWH 4EN3D 4GW5B 4U6XA 4X0KB 1OB1B 2NY1B 3L3HB 4ZOBA 1F3JA 1A5FL 5IFHL 2O5YH 3SJVE 3WFDH 1ZB5A 3GSRA 5FYKD 4LEOB 4RMSA 4M3JA 2FJFB 5D2NC 2ITCA 3GZKA 3W0KA 2A6JB 5TQ2H 1EJ6A 1MH5A 3FB6A 1WTGT 4IBLT 1YMME 5BVPH 1LWRA 2Y6SD 1AR1D 2VX4A 5D4YA 3G6DH 1M04A 1D9KD 3UTPD 3F4VA 2GJPA 4OZGB 1JD9A 1BQCA 1FBIL 4ZSOE 3ULVL 4XCEA 1MVUA 4DWSC 1A4KA 4JPVL 5ICXB 4QRRA 4GRWF 3MLTB 4JFFB 3U7WL 3O4OB 1RZGA 1PKOA 3SQBA 2NY4B 3O6FC 4QHUA 2CLVB 4NC1C 4XCFL 3BWAA 4OUUA 3TZVA 3W9EB 3G08A 3RVUD 3V4PL 3BPLB 3PL6C 5H94B 1R33A 4RRPA 4JZOA 4KFZC 2PI6A 5B4MD 1CENA 1KR0A 1RPKA 4AMXA 1JWSA 2QQKH 2A73B 1C92A 4OLVH 1UQZA 3U1SL 1EUTA 5ID0B 1A2YB 4QXUH 4M6ML 2D7MA 2G3NA 3RY6A 4FLSA 4AH2A 2C3XA 5F6IC 1D5XA 4TUOA 3QXAB 3CIVA 4LLMB 1BQSA 1MIMH 4JQVC 4NUJA 2F7PA 3OA5A 5EC1B 5DS8A 4MGXA 3M07A 5IWLA 4QO1A 4QFUA 3NYDA 4PRIB 2WSKA 5HHOB 3IFPB 5E4IA 3VNYA 2GUOB 4IMLA 3DHMA 5KS9B 4WV1B 2AXGA 5E2VL 1A1MA 5ALCH 1A6WL 4ZYKA 5H35B 2N4IA 2OBGA 5J06A 4XAKE 3SY0B 1UJ3B 5F88B 4OZ4B 4S0SD 2F5BH 4OF3A 2AK4A 4PRHB 2YD4A 1ZVYA 2AW2A 1U58A 3AVEA 1BVLB 3VWJB 3MRJB 4EZMA 1I9IL 1MREL 5ITFA 5J13B 3LVEA 1IRAY 1C16A 1NAKH 3RUGE 3NDZA 5ADOL 5D2NA 1AGEA 3L7FB 5HI5C 1FG9C 1E0WA 1FL5A 4EDWH 4R2GB 3DETD 4NNYA 3QSKB 3MV7B 4LVOC 1NC2A 2WUCL 4XNZB 3KPQA 3JTTB 1CE1L 1J12A 4EI6B 3T0EC 4BM7A 2F53D 3S5LG 4HF5L 1AO7A 5D71L 5LXGH 4KK5C 4XVSL 1IM9B 1FHGA 2BXZA 2YA0A 3OXRA 2VZ3A 4XNQB 1WZLA 3O6FA 1S7SB 2XGBA 2E27H 1EBAA 1JGLL 5D96B 5LJYH 4YGAB 3UBXI 1WWAX 4HPYH 3EYQC 1B0WA 1OT1A 3LD8B 4X8JB 4G80A 2HVKB 4H8WL 1ZLWH 2EDTA 4G6MH 1QSFE 3ZL4H 3KL5A 1Q9OB 4UQBA 4WNQB 2UZIL 2AQ3A 2IQAB 3ZMRA 4DUWA 2IPTH 2G5BB 4U1KB 1JGUH 1FZMA 4UT7L 3B5HA 2ATPB 5E4EB 2EPOA 5B38B 3SUVA 2CUMA 2F8XC 3BN9D 4MNQE 3V8CA 4M6OH 4G6JL 4P2RB 3SKNB 3N1QC 3X11A 4B50A 4N9OB 1C5BL 3MRQA 1HQ4A 3EO1A 3MMEA 4K55A 3K1DA 4U3AA 1FL6B 3FO2A 4I48B 2NNAB 3LPGA 3VXRB 3D18B 5IHRA 5KVEH 3ISWA 5F1IA 5C6TH 4GG6B 5FYLD 3IJHA 5C2BL 4UT9H 1J0YA 1JPGA 3U0PA 3ARFD 3QEQE 4E41B 1VIWA 3MCKB 2EDEA 1B9ZA 1FZOA 3BX7C 3UYPA 1MNUL 3MLVH 1CGWA 5F3HB 3QWQB 5F7MC 3CVIH 5ESAA 3BAXA 5AAMA 4HH9B 1KTKE 4JO4L 1DN0B 4NNXA 2HKHL 5IGXL 4MSWB 2AOSA 4PY7A 1NMBL 4HPHA 3MO1A 2HFGH 3PIQB 1EFXA 4PTTB 3R06A 1OAZH 2YR3A 4F37K 2XWTB 4LSTH 4MHHG 4HIHA 3MSDA 3B2VL 4NQSA 1D5BB 1REIA 5DTFB 2PKDA 2RB8A 4H20L 5MHSD 3KPSB 4MVBC 5B3JE 3S36X 3O0RL 2G5RA 2V9RA 4WIQA 4F9PC 4MXVE 1GVIA 5FYKE 3QUZD 1TNNA 1HJVA 3WCYA 1W3KA 2XZCH 1NKOA 3U57A 5F7KC 3P77B 2DIBA 1F6AB 2OX5A 4M6NH 4NZFA 3U0WL 4HUXA 1F4WH 3QG7H 4PJ5D 4NX0A 1U30A 3PWPE 3QDMB 4RE2A 4UILL 4KI5C 3WBEA 1CICA 3WUWA 3P11H 3WFLA 2MHAA 2VSCA 4WTXA 2YHGA 3OGCA 4MJ5A 4RAVB 4WDIB 1AGDB 1OAXH 4N8CL 3ARGD 3A24A 4NHCL 1MAMH 5CCKL 3B3IA 2PWGA 5C0BB 3ARTA 4MB4A 4R0LB 3QIBC 4JDVA 1F45A 1ZT4B 5JR1H 2XXCB 4KHXH 2AQ2A 2QTEA 4P3DA 4RGOH 4F3FA 1OP3H 5B3NA 2VDNL 4H26B 1FP5A 3O41B 5D9SA 3ARBB 3NCFB 4P2OA 3NIGF 1ZGLA 1GGTA 2CGRH 3SOBL 3ZYZA 1CLCA 4ZUSB 4QTIL 2Z35A 4JFEA 4WI4A 3JV5A 2QKIA 3SDXF 2LU7A 4UOW0 2BVYA 1R5VB 1H2JA 1L7IH 1U93B 3MO4A 1NSNL 3VFOB 2VWEC 2DH3A 3C8KB 1NGQL 3BJLA 4M61B 2LTQB 2D0FA 4XTRC 4YHOL 3AMDA 3V7AG 4K7PH 3QFDB 3S4SG 1EUUA 4ZTOL 4JZJB 4H0IA 4APQB 1PPIA 5CEZH 3U0TA 2R2BB 1LP9F 2CKBB 1GXEA 2EO1A 2NT0A 3BVTA 3ALFA 4PMUA 3MACH 3MMUA 3BAKA 1MLBA 2HTKD 5L9DL 5JPNB 2P5EB 3QZWG 2ARJQ 1AXTL 1MFUA 4ZOAA 4NF7A 1BOYA 1BGXH 3DSFH 4F9PA 1XT5A 5EDXA 5HYJD 1E1FA 2W61A 3QXWA 3WFZA 2BSSA 3R8BB 2XPGB 4ACZA 4FFVD 1G7JB 2F19L 3LH2H 4UNTA 1H0DB 1UD3A 5IMLA 5I1EL 3JVGC 1EHXA 2X4RB 5E8NB 3UROR 5GRWA 1FNEA 2WBKA 5C71A 3EMCA 5FGBC 4LLQA 3WN6A 5FAAA 2VH5L 4QRPB 4YQXL 1IZJA 1MCOH 3B9AA 4K3EL 1A7NH 5HHME 1JHKL 1RZ7H 4PRWA 1BG9A 1NFDF 5DJ8A 1VFFA 3MRMB 4XRCA 4FK9A 5IJVA 4H0HB 1F8TH 4IJ3B 2R29H 1TJHH 1U3YA 3TJEL 1DN2A 3G5XB 3X13A 3DV6B 5SWSE 2I07B 3WO4B 4LLVB 5H2BB 3CFJB 1KB5B 3AAZA 3AMKA 4LCWE 2ICWJ 4N8VG 2D3LA 5F1OB 5E5RB 2JB5H 4NO2A 3TONA 5BCAA 3VW3L 5IIEB 1A6ZB 5B21A 3A4XA 4FQLH 2HLAB 1ND0A 1CD1B 5DD0H 4WCYH 3FONB 1W8NA 1VACA 3QUMH 5A95A 2Z91B 1QSZA 5F9WC 5INCA 4PPTA 4U2YA 1I8MB 3TIDA 3MA7A 1LE9B 2BP3A 5E09A 5JLZA 1MQPA 1EXUA 1J05A 2GUYA 1YDPA 5BXSA 3H9HB 3O3EB 2DBLL 5FYKL 4HG4J 5I1DB 5IM7B 4PRPB 1A7QL 2VZSA 2NYYD 1MELA 1O7VA 2EYSA 4ZFZB 5F6HI 2CMRL 1EEZA 1LO2H 4GW1A 1RZFL 1FVEA 3BPNB 4WLCA 1O7DC 2DD8L 4QYOB 3QUYD 4ODHH 4U6VL 4XX1E 1E27B 1JCKA 2NTFB 2V5DA 4OCYL 3HI6H 3QCVL 4M8VA 1KPUA 2IC2A 1S8DA 3QJFA 4JVWA 4S1QH 2X1WL 4Y4HB 4PRDB 1H8SA 4OD1L 25C8L 2VR4A 4U6XB 5DMKA 3HRZA 4F80A 1F3JB 1ESWA 1F90H 3JVGA 3RPMA 3HG1D 1OCQA 3GSRB 3O6AA 4NSKA 1HYSC 3RDTA 1PBYA 2ITCB 1G7PA 1OTUD 2J4GA 5FEBA 1MH5B 3FB6B 1S78D 1FH7A 4XZBA 1MHPL 5FA4A 1KYOK 2AXHA 1KJMA 1U91A 2B4CC 3S97C 2GAZA 2EEBA 4XCEB 3N85L 4PJBF 4X9YA 1MVUB 1DEDA 5TDPA 1A4KB 1OSPL 4NWTL 4QRRB 4X83A 4YEFA 1AGFA 4RAHA 1RZGB 4XVUD 3K81A 4W85A 4Z0BL 4QHUB 3VI3F 3BWAB 4OUUB 4KZDH 3TZVB 1F2QA 1IBGH 3VIOA 2YUZA 1E6SM 3G08B 3TH3T 1XV8A 2AGJL 3AZSA 3OB0K 3BC9A 2WINA 4JZOB 5FHBH 1YYMH 3VFUA 5F44A 1T0OA 1JWSB 2VNCA 3VXMA 3SCVA 4ZDHA 2R69L 3S5YA 1JRHI 3VG0H 5HDOA 4YO0A 3RGVA 4GKNA 5I1HH 4AH2B 3MLYL 2NY3B 4P9HL 1D5XB 4LCYA 4M00A 4TUOB 3PHAA 1DVFD 5D4QA 4AZGA 4ODTH 4NUJB 4RGNE 9CGTA 3QDGD 4ZS6C 4F7CA 5DS8B 5EOQL 1ACZA 2GW5A 4KROD 1LDPL 1QSED 4YBQC 5FGCE 2A3AA 5HDBF 3OAUL 4Z2KA 2W9EL 4HT1H 1GCFA 3ARDC 4IMLB 3TV3H 2AXGB 1A1MB 4ZYKB 2HMID 2EEDA 1YECH 4LPWA 1I1WA 2XIDA 1VAHA 1QNSA 4C83A 3KJ6H 2J7EA 2AK4B 2J62A 4UFJA 3HFML 3ROOA 4NN7B 1U58B 1XIWD 5K59F 2D23A 4GXVH 1GIGH 2XI9A 5ADPL 3CSGA 5ITFB 1OY3B 3MUIA 1C16B 2MKLC 4JHZA 4XGZA 3WDIA 4PLKD 1QQDA 1AGEB 5D2NB 1FL5B 2PWDA 3PZOA 4NNYB 3ZTNH 1NC2B 2GITA 3VIMA 3KPQB 1H3PH 4YDIH 1TVPA 2YUVA 3MGOA 5GZNC 4BS0A 1FFQA 2ZOKA 3TVMA 3UCRA 3G5ZA 2D24A 4ODVH 1AO7B 4FNUA 5HYJE 2GIYA 3LIZL 3PDDA 5DMGC 4WSKA 3LRHA 3SDCC 3OXRB 3O6FB 4Y4FC 5T1KD 4GRLD 4PJFA 1AVAA 4GJTB 2BK8A 4Z18A 1UWSA 1I9RL 4M5YH 4UDTA 1FV1A 1T83C 4G80B 4K94C 5CLTA 4J3TA 5D7IA 5JW4N 3DX8A 1HF6A 2ENYA 1QBMH 2J74A 4AG4L 4YK4B 3V5DA 2KKQA 3T77A 4GKOA 5D70H 5SX5H 2PYEE 1UYQA 3MA9L 4JFDE 1E4XL 1FZMB 4QEGA 5C3LD 1UH2A 3N17A 1TVNA 3BE1L 4P3CL 3V0AC 5J3HD 3X11B 3QCTH 3MRQB 1HQ4B 3EO1B 3MMEB 3QQ3A 2DYPD 2D3NA 5DUBA 4GKLA 1FNGA 4O4YH 1FGNL 1ZHKA 3TFKC 5AAWA 2NT1A 3FO2B 3RIAK 2JF7A 1NUFA 2VR9A 1RJLA 1KGCD 4FQQA 4IIQC 4Q7DA 5F1IB 5JW4Q 1JYNA 5LKNA 2NX5D 3IJHB 3BMVA 2HFTA 4DJMA 1SMAA 2H1PH 1JPGB 3U0PB 3LKNA 3UZQA 2H41A 2HN7A 5CP3H 4L5FH 1V3KA 1FZOB 4Y5XC 2JEPA 4AD0A 1A7OH 5ESAB 2DSUA 4LARL 3PQYE 1NEZA 3RM9A 5HI4D 4KRPB 2DQIH 4JVPA 5GRJL 3HR5A 4NNXB 1N4XH 3QXDA 1CD9B 4PY7B 1DUYA 3JWDC 3E0GA 3MO1B 3MOBH 4HZAA 5C92A 1EFXB 3R06B 3E3QC 2BXYA 4OZHF 1IC7L 4HIHB 2GY7B 2P48B 2AVGA 4PN2A 4J2XA 4NQSB 5BXPA 2OYLA 3ZE2E 4FFWC 3BSGA 4OFIA 3P4MA 4N9GA 1PG7W 5A1AA 2V5TA 3DXAE 2FHBA 3V6OA 3CIQA 3VMPA 1U8HA 1XGPA 1A8JH 3C09C 3L3JA 5D1QD 3IKCA 2MQCA 2QADD 2X9YA 5CP3A 5K9OA 1NBZA 4HUXB 1IT9H 4U1LA 3BQUD 2CLRA 2QSCL 5T33H 35C8L 1E4WH 1FFRA 4O5LL 2W9DL 3RA7L 1CICB 3WUWB 1ACYH 5IXEA 1N64L 4XPBH 2MHAB 3ORJA 3OGCB 4MJ5B 5L2KE 3FRUA 3CDCA 3HHRB 3CPUA 2HT2C 5I1JL 1ITBB 1UACL 1ZTXL 4DGVL 5C0RH 3WJJC 5C09D 1FIGH 3B3IB 1TZIA 4DKFL 5H8DA 5CP7A 2NY7H 4PR5A 2BDNL 4JDVB 2VLJA 1GHFH 1MCSA 5IBUG 1NKRA 4P3DB 4F3FB 2HYMA 3C6LD 5D9SB 4P2OB 4CU7A 1TETH 1ZGLB 2MANA 3WJLC 4GKSA 3CFBA 2HTLD 1WAWA 2Z35B 4JFEB 1QACA 2QKIB 3DMMC 1ZLUH 1KJ3L 1UG6A 4UOJA 1RUKL 1ZV5A 2DQDL 3BIBX 3P4OA 3QULA 3TYFA 5JORA 3UTTA 4K3HA 4PV8A 1EPFA 2F58L 5A8MA 3U0TB 5TD4A 3HNTH 3UPRA 3U5UA 2R2EA 4Y1AE 4RA0C 3S3SA 1MLBB 2IANE 2VCCA 5A40E 2DQHH 3CMOH 4UV4L 4PSPA 3AOFA 3VINA 2EDHA 1QLRA 4ZAKC 2CESA 3MJ9L 3TWCH 5IMMA 2QL1A 4OI7A 2BSSB 1M4KA 3BDBA 4LK4A 2V5SA 4ACZB 3LMJH 2RAMA 5CZVL 1LJYA 4DVRH 4YIQA 1RI8A 3W11D 5IMLB 3AS2A 5I8OL 1L0PA 2I5YH 3BISA 1FNEB 3H7LA 5CJOH 4LLQB 2CBJA 4S2SA 5K93A 2VZTA 3RWIA 5DJXA 5KG9A 2ZX7A 2ZJSH 4QKXB 1JRHH 4B53A 3IS1X 5HDQL 2R1YA 5DJ8B 4XRCB 4PMQA 5CJXA 3PP4L 1A22B 5IJVB 3L4VA 5DWUH 1U8IA 2ZUQB 4HJ0D 2A1WL 4PUBL 3X13B 1TDQA 2X70A 4OLXL 5AWNH 3AAZB 5D93B 3SIMA 4NO2B 4ZXBC 1EHAA 2BSRA 1ND0B 1B3YA 2XZAL 4PJGA 3V5HA 3FKUS 2OQJA 4GZJA 1V3LA 4U31A 4W5ZA 1VACB 3WEMA 5INCB 3EJRA 1J9CT 2HAZA 1F11A 4OT1H 3WJLA 1PYWA 1MW1A 3TIDB 5B3JF 3O9WD 3RO8A 3MA7B 3GMPA 5JLZB 3WS6C 1EXUB 1RZJH 3LAFA 5JXED 1J05B 3DMMA 1A6VL 4BQ6A 1YDPB 4R9HA 1XR8A 1PQZA 4X7SH 3C2AL 5AUMA 4F58L 2EYSB 1NAMA 1RJCA 3HG2A 1VFAA 3WFBH 2D9CA 1EEZB 4GW1B 5KW9L 2AS5M 1FVEB 5DJYA 2BHZA 1I1XA 4LF3A 4TXEA 3NABL 4GT7A 2OWWA 5GGSY 4QHKJ 3QRGL 4HOXA 3FO0L 4ZAKA 2QBWA 1KPUB 3EDKA 1S8DB 3QJFB 1XGRA 3L3IA 2WWKO 1VENA 5CGMA 3RKDC 3ZYOA 1G6RL 3A6CH 1JGDA 4JG0L 1CGSH 2NSXA 1IGIH 1MCLA 1F2XK 5DMKB 1OGBA 3KLHD 3HRZB 3QUXA 5JNYA 2FE0A 1NC4D 1OSEA 4UR9A 2G60L 3EYUH 4NSKB 2W38A 4YZFF 3RDTB 1BYAA 1L6XA 1G7PB 3N1PC 5F3BA 4DGIH 3I3BA 1ZAGA 1RPQA 1CXIA 2DQEH 4L1HA 1KJMB 5FA4B 1U91B 3RZCC 2E9LA 2NY5C 2NR6D 2GAZB 4TX6A 2FX8L 2FYVA 5DHYA 4J6RL 4OZIA 1P84K 5D2LA 5BS0E 1NOFA 5DSCA 5TDPB 2PBOA 3GBML 1XH3A 3TJHC 4HFUH 1AGFB 3CHFA 3PGFL 4ELMF 4OCNC 1DJSA 3OG6B 1N2RA 3VE0A 4M1DL 5CIPH 2WNGA 4D0BA 4JN1L 4HGMA 4MNGE 4P2QE 2EXOA 5D5MF 4YPJA 1C5CH 3QEHA 5F9WB 2WINB 12E8L 5L8LB 1MCPL 3VFUB 4FQXD 1OAQL 3VXMB 3TBVA 4ZDHB 3WH8A 4I77H 4NBYB 4YFLI 3WS6A 2X44D 1QW9A 4YO0B 4OAWA 3RGVB 1S7WA 4GKNB 1JFQL 1P9MC 3VG9C 3WFCH 4LCYB 3QOMA 2OI9C 4IDJL 1HKFA 1QRND 5C9JA 4F7CB 3BH8A 3ZTJH 1V6YA 3EOTL 4KH2A 3C60C 2B7DT 5DEGA 2ZXAA 1IC4L 4POUB 1MWAL 5JXAH 2P5WD 5KVFH 5CUSH 4AL8H 4JGUA 3CUHA 3DX7A 3F58L 4DK6A 2XKUA 2R0KH 3BIKA 1Q94A 3QYCA 1R3HA 4C83B 4NQDA 3GHEH 3ROOB 5IB3A 1T5XA 2VLMD 2RQ8A 1QFOA 3M1BA 3WDPP 3QI9C 3UDWC 3RU8H 1QPKA 4S0TD 4RE3A 1WZ1L 1WEJH 3HJEA 4XGZB 4CD6A 4XP5H 1W72A 1QQDB 1DZBA 2BJML 2ADIA 2VN4A 3CU1A 1EZVX 2R4RH 2GITB 2NY2C 3ARED 3VFRA 4MXQD 3VSTA 3MGOB 4EVNA 2ZOKB 3TVMB 3D9AH 3D5HA 3G5ZB 3QR3A 3RIAF 1EO7A 1JXJA 3AFBA 4TVSa 2BFVH 2K3TA 1KTBA 4OKVA 2PNDA 4PJFB 3HAEH 1TR1A 3LPFA 3WIIH 1HINH 2PXYA 4JRXD 3VXSA 4LNRA 2UVEA 3QFJD 4UDTB 3Q2CA 4WFEE 3JTSA 3STLA 4C57C 1FV1B 5GS0H 4OLZH 3W4RA 4JM2F 4ZNEE 4LPTA 4FN0A 1BBJA 1GJUA 1SZNA 5D7IB 3UPAA 15C8H 1LO0H 3DX8B 4HMCA 3BEVA 1KPRA 1KT2A 4KTYA 3MOQA 3V5DB 2QEJA 3T77B 2F1BA 2VZOA 4WK9A 1MFAH 3GK8L 2VYRE 4HGWA 4YDJA 2CERA 4V1DE 4NQVA 3BIAX 5IQ7H 2VOTA 3AXHA 2NY6C 3S9DB 2WC7A 2OM5A 1MEXL 3DHJA 3FJTA 5ICZA 3P4LA 3ZE1E 1HXJA 4RNRA 4FZ8H 4RFNC 3TBSA 3QQ3B 3W39A 2D73A 3C60A 5EU4A 5DUBB 1FNGB 4P5TA 4TSCL 1ZHKB 5SV4A 4PGJA 5GJSL 2VLRA 3JV0A 2XWDA 4PJCE 1RJLB 4FQQB 4L3AA 1Z2KA 3MLZH 5FIPA 3RPKA 4M43L 3V8OA 1G9MH 4LASH 5EFDA 3HAEA 4FQHA 3EYPA 3T0BA 1XZ0A 3RRQA 3LKNB 3PBGA 2B39A 2HN7B 4G9FD 2XY1A 4AMKL 4W8AA 3CH1A 3RNQA 1N5YL 5HY9A 5F97E 4BA8A 4OGZA 4ACPA 2QSQA 1IGCL 3M45A 2X9WA 1NEZB 4W70A 4F9LA 1E72M 1HKIA 1FYTA 2CIIA 5I24A 3HR5B 3MOAH 2CXGA 1CXEA 2ADFH 5EBWA 4TVUA 3QXDB 1ZT1A 3AHVA 2XFFA 1DUYB 1GC1H 3WKML 2W65A 3KXFD 5DGRA 4MJIA 5BXTA 4OM1H 3H3PH 1CPUA 3K2MC 5T1MA 3ZT5A 2XHYA 1AD0A 4PJ8C 4JVUA 4UINL 2G3JA 2VN7A 3P4MB 4HC1H 2R56L 3VDAA 4N9GB 4W7WA 3WF4A 5GZOD 4JQIH 2DM2A 4IRZH 2MQ3A 3SDAD 3ULVC 2XTKA 3NAAL 3RMEA 1U8HB 1XGPB 5C8JA 3L3JB 3TT1H 3IKCB 5BMFH 5MEPA 2V3GA 1O0VA 3BVXA 5K9OB 1NBZB 3GIZH 5CD5D 4U1LB 2CLRB 4CCCA 1VADA 3AXXA 1U36A 1BHGA 3ARUA 2UZYB 3W53A 3MJGX 1IKFL 4MA1B 1QI4A 2ZZUT 2EDKA 2W07A 5A3IC 4XWOC 1N3NA 3MUZ1 3H54A 1ZE3C 5TE6H 5IVZA 4JHOA 3FRUB 3BSZH 2WBJD 1QYGH 4JPKH 1OAKL 1TZIB 3HB3D 5CP7B 2VXQL 2ED7A 2OZ4H 4PR5B 5JIKA 4WU5A 3LPOA 5LWYL 1OB0A 1H3UA 2VLJB 5EWIH 3RNKA 2A0LC 5A69A 1MCQA 3L95A 2D7TL 4J27A 1LO5A 1TZ7A 4Y7MA 2ZUYA 6TAAA 1A3LH 1WE5A 1AE6L 4Z76A 5FECA 4S1SL 3W6MA 4RX4D 2VJXA 1D6VH 4GKSB 3CFBB 5TE4L 4N42A 1HK6A 1DQDH 2AQ1A 3HNSL 4I2XA 4UV7H 2FEEL 4OQ1A 5IVXA 1F58H 4UFHA 4U1SA 3P4OB 3QULB 3TYFB 5JORB 2VZ1A 1GSMA 2P5WE 2R0LH 3UTTB 1VRXA 1EX0A 3C5JA 4N0YH 4PV8B 3MXVH 4P23C 2YPLD 4YDVA 5E6IC 4XMKH 4GO6B 3UPRB 3W5NA 1B3ZA 2R2EB 2VVNA 1FZJA 4B7IA 3CLWA 2FDMA 1QLRB 2F8QA 2E7CA 2XWJA 4K23L 3U9PL 2BRQA 2B20A 3GKWH 5IMMB 5CXPA 1C7TA 2BVTA 5T5NG 5D1XC 2JIEA 1FFNA 1A14H 4HLJA 1J1XL 3K4ZA 3O2VH 3B2UC 5E2WH 1V0LA 4YIQB 3NZHH 1SM3L 3C09B 3KDMA 4CBPA 4S2SB 5KG9B 3RWIB 5DJXB 1EJOL 4NJAH 5FUOH 2BNRE 4HS8L 4JY5H 2R1YB 1NFIA 3WD0A 1NWRA 4PJDE 4ZFGH 4MCYA 4PS4H 3MV7D 1OP5H 5KEZA 1KBKA 4Q22A 2WUBL 5C2UB 2Y06H 4K8RL 1U8IB 4H8WC 2DDQH 4KKCC 3WNPA 4O9HH 3CHCA 2X70B 4WEBH 2O26U 3RBSA 5HVFB 4FQCL 3GSOA 2BSRB 4WFGD 5L0QC 4PJGB 3BSHA 3V5HB 4P0DA 2OQJB 1YY9D 3R8QA 4POZD 1G9NC 3ZE2F 1F11B 3RJXA 5BO1H 1PYWB 3QDJA 1G1CA 3GMPB 4HHAA 2EQDA 3C5SA 3CSBA 1KCUH 1KLUA 2B5IC 3DMMB 3VA6A 2IBZX 2Y72A 3IFNH 2OK0L 2A3BA 3P30L 2Q87A 1MI5A 2Q7NA 1RMFH 1XR8B 1PQZB 3GHBH 1R3IL 4K3DH 4D3CH 3A21A 5AUMB 1NAMB 5I18H 3L4YA 1VFAB 4P23A 1GGIH 3IXTA 1S9WA 4NKDA 5DJYB 3ULSA 4D9QE 1QHZA 4PGCA 4LF3B 4S1RL 2VXUL 1HTYA 3DO7A 3DVIA 5EORL 1UWXH 1WAAF 4NP4L 1A9EA 1GGYA 5HNNA 1SHMA 3MCG1 5KSBE 4ZAKB 3CZ8A 1G6VK 1MRFH 4U1IA 1CDBA 1XGRB 3RIKA 1AY1L 3L3IB 3JV6A 4FMVA 1ZT7A 1W9PA 4IRJC 1V8HA 1T6WA 5T5NF 2DQCH 5D1XA 1JGDB 5HI3C 2DQUL 4FZEH 4ZFOA 4XMPL 5JNYB 1DP0A 3QUXB 4GMTH 1SVCP 4MQTB 5LYRA 3T0VA 4L1DA 1CR9H 1UUQA 1GOOA 4KV5F 2WP3T 3KPLA 5F72S 5F3BB 5ETUA 2E6QA 4LQ1A 2J6EA 2NY0C 4JQXC 4KMTH 3VM7A 1NWSA 1B2WL 5A6BA 1X1NA 1MCEA 2YIHA 5DT1L 2RCSH 1LQ0A 4LHQB 5DHYB 3KG5A 4OZIB 3VXTA 5D2LB 5DSCB 1G7LA 3VXUE 1KFAH 4P4KD 1XH3B 2EXWD 3OQ3B 2VXTL 2JLLA 5I6XB 2J7DA 1IEBA 3NPSC 1N2RB 2FBOJ 3VE0B 1UM6L 4K3JL 3QIWC 1V6WA 1CWVA 3CPLA 4GIAA 4AYSA 4LNVA 3LPWA 4D0BB 4JO2H 2VXVH 3KPSD 1DQML 4UMGA 3QEHB 3RTQA 2LVCA 3A0OA 3SDDA 3WUZA 3TBVB 3MPCA 4OAWB 3WIHH 1S7WB 4QF1A 2SEBA 4FFZL 4OZGE 4U5KA 4KJQC 4KJPC 4PJIE 2BERA 4JHWL 3EOYG 4OLYH 5C9JB 3BH8B 4PJXA 5D8ZA 1CGVA 1A7PL 4Z7UA 4JFFE 1IILE 4PB9H 4TOQA 3SE8L 1V7NL 3BYTA 5DEGB 4X99A 3QHOA 5J0BA 2FH6A 4R4ND 5GGTL 3QOKA 3GDBA 4TSBL 3DX7B 4OBRA 3LS5H 2R8SH 4JFYA 1VEPA 3HUJA 4Z7OE 3BIKB 3KAAA 1QNRA 3WKZA 1Q94B 1R3HB 1UM5H 4HKXA 1E4LA 4IRJA 5EO9A 3B9KD 4NQDB 1KF9B 4TQEH 3ME0A 2EH8H 4WENB 5IB3B 1VPOH 1T5XB 4C7FA 4FNPA 3M1BB 3EJYC 1IQWL 5SWQA 1BVKA 4JKPH 3CHDA 1W72B 3MRPA 4F7MA 4J23A 1KJ2L 3DHUA 1O7AA 3STZA 2ADIB 3MRLA 3GRWH 4G43A 1Z9OA 4PRIE 5HHOE 4M5ZH 1IL1A 2MWCA 3VFRB 4EVNB 5KS9E 1WICA 2OYMA 3WY1A 3LN5A 4TULL 4W8LA 3RL1A 4UOW1 1YNLL 4APQD 4XPFL 2YPVH 3O3AA 4LLUA 3QT2A 4R3SA 4OJFL 4WI7A 5E99H 1XGYH 4OCSH 4PRHE 5D7SL 3BKYL 4OKVB 4U3HA 2YXMA 4PJAA 5D9PA 5DMIL 2PXYB 3VXSB 4LNRB 2OMNA 3JTSB 3STLB 2KPNA 4XBEH 1OM3H 4AZBA 4ODBD 4Q2ZA 1BBJB 4J3WA 4U0QB 4DN3H 1XCTA 3BEVB 1OD8A 3MV7E 1KPRB 3ZYJA 5C6WH 1KT2B 4MNJA 1RIHH 5A3HA 4N0CD 2DI8A 4W5UA 5D6DC 1A6UH 4XMLL 4HGWB 4L9LC 4YDJB 3B43A 1HL9A 4NQVB 1WVZA 3VUPA 1INDH 3GRWA 5C0CD 1ZU8A 4UI2A 2Y8VA 3KPRE 5ICZB 4W6WB 1UCBH 3EFDH 1VEMA 4RNRB 1BPVA 3TBSB 1B6DA 2AABH 2WWMD 3W39B 3DV4A 3C60B 5BOZG 5EU4B 5GS2H 3WS3A 4EN3C 4FS0A 4P5TB 4FQ1L 4JREB 1ZJAA 3B4NA 3KHQA 5MP6H 4ZE4A 3MBED 2VLRB 1E3XA 1N8ZA 2XKNA 1UWRA 1KWGA 4XNUL 3V0WH 1BBDL 2I60L 2KQNA 3VIFA 5D6CA 1E9LA 3HAEB 1HVXA 1Z3GL 1GNXA 4FQHB 1XZ0B 1TFVA 3RX8A 2XICA 2Y6SC 1AR1C 2Z8RA 4TVPE 1BF2A 3LEXA 1LO3H 3CH1B 3RNQB 3CZEA 1EA9C 3IDYC 5HY9B 5JIPA 1PX4A 5HHXH 1UXWA 2BMKA 1FYTB 2CIIB 4P2RE 3BPCA 4LPUA 5D7KE 2NY2B 5EBWB 4P2YA 3GXFA 1ZT1B 4I18C 2W65B 3GBEA 1UEYA 4LSQH 5HVGB 4X0VA 4MJIB 1OQOA 3RVUC 3OAZH 5JOFA 3SDYH 2CBVA 3VXRE 1K9FA 5E9DE 5B4MC 1JD7A 4GG6E 4JB9L 4IOSD 4Q9RL 4GXUM 3FRPA 5T1MB 1JHTA 3VGAC 1D2KA 1CS6A 1AD0B 3WHE0 4NRRA 4E41E 3F6LA 1OW0A 1US2A 3FQUA 1MPAH 4W87A 1FCGA 3GMQA 5TE7L 4LPYA 3F5KA 1CBVL 4OV6F 2DLGA 1RIUH 4WGWB 5BROA 1PIGA 5C8JB 5MEPB 1JNDA 1CK0L 4K7FA 2UV3A 4G8EA 1VADB 3OR6A 1N6UA 2AXFA 3KWWA 3DYPA 5D9NA 5BW7C 3VTRA 1N3NB 1RQ5A 5IVZB 3BJ91 3ZDXF 4OFYA 5F9AC 4OOUA 1KCLA 1MCHA 4KC3B 4NOBA 4Z6AT 1ECEA 4RFNB 2FECL 3KPSE 2CEQA 4ERSH 3U7BA 1KYOJ 4WU5B 4R97C 1MYRA 2X0HA 4MTVA 2IPKA 5DD5L 3RNKB 1GAFL 4G8GD 3L95B 2GDUA 1LO5B 2D7NA 3U46A 4PJ7F 5C0ND 3U7YH 3D2UD 1CFSA 3TZVD 1KXQE 3DETC 4KDTA 2ED9A 4Z76B 5FECB 2Z31C 5KJRL 1CXHA 3QBTB 5KSVA 3HMXL 3MLXL 1D9KA 1NQBA 3QDME 3Q0HA 4IM8A 4YH6A 1X5FA 4I2XB 5BRQA 1U6AH 4CCEA 5F7HA 4WTWA 5IVXB 3MUGA 1JXKA 1Q1JL 3TPKA 4U1SB 4K9EC 1EHNA 1CVRA 3C5JB 5C0BE 2ICWA 5AD0A 1E6OL 3MYZA 1OP9A 1SBSH 4YDVB 4LLYA 5AG8A 2PC8A 4L8BA 4H8HA 1FZJB 5CSYA 3QA3A 3H9SD 3MR9A 4MDJA 4NUGH 4KUZH 1OPGH 1V02E 3SBWA 2W0KA 2XWJB 1W2PA 5B39G 4G6AD 4RZCA 1C5DA 2ORBH 4PJ9A 3C08L 4WEMB 4YXKH 1FFNB 5IB5A 1AJ7H 3X3GH 4ZO8A 5FA3A 1XEDA 3IK2A 2LVEA 1IT0A 3UG4A 4WW2C 2VQTA 4UFMA 5TF0A 3BN9C 3KDMB 1MCJA 4GS7C 1QHOA 1LNUA 4YEEA 1LGVA 3CX5K 1GH7A 1NFIB 5SWZD 4M80A 4M7ZB 3IAGC 4MCYB 3MXWH 4XZUA 2A83A 2JCCF 3PNWA 4TVPL 1NDMA 5DA0B 2P5EE 4KUCF 3ARFC 4G7VL 3I75A 2HFFA 1BECA 2EAEA 4FP8L 3VRIA 3B5GA 5JHDD 1AO7D 5K9JH 4F7EA 4HWBA 3GSOB 4G9DA 2FX7L 3RVVD 1WGOA 5EOCJ 2F5AL 3BAEL 1KULA 2CCRA 2NW3A 5FOOA 5DFWH 3NCYS 4W4OA 1MCCA 4LX4A 5GGRY 2E9IA 2XTJB 3CFCH 3QDJB 3VX0A 4QRPE 2YLAA 3ILQD 4UTBL 4XC1L 2BY0A 2NW2A 3C5ZD 4BZ1L 4TN9A 1YQVL 4HHAB 4M7JH 1HDMA 3C5SB 4BFBD 1KLUB 2J77A 4OF8A 1MUJA 4AZ5A 1MI5B 4U2ZA 3L5JA 4W68A 4YXLH 3WF1A 3H9ZA 5AY7A 1T80A 3TTQA 5DXWA 4P23B 1BQHG 3QUZC 4GSDL 3IXTB 1S9WB 1BJ1H 4H5SA 4NKDB 3ULSB 4YDLC 1TPXC 4PGCB 2O5ZH 3DO7B 3MV8D 2BSED 2Q8BL 1SJEA 4QTHA 2P8PA 5ESVA 1VEOA 3OLIA 1A9EB 1MFDH 3MI6A 2G75A 1PIFA 2YPKA 3RZWA 2CK0L 3EDJA 4U1IB 3BT2H 1KTDA 3JV6B 1ZT7B 5GRUH 1GW1A 5D1XB 4OCRL 5LAXA 1R6VA 3N11A 1PLGH 5LCVH 1UZ8A 1TLKA 1GGBH 4WW2A 4ZFOB 1UD6A 3WQWA 3ARGC 5GGUA 3OAYH 2KL6A 2MCPH 4PRPE 2M2DA 3L1OH 5GNXA 1CLYH 3QUKA 4RGNC 3KPLB 5DR5L 5IKCA 5J6HA 2F74A 1TXKA 1VGEL 5ETUB 1EEUA 5JUVA 3Q6GL 4KRPD 1MCDA 1R34A 1AGCA 1BQLL 3X3FL 5I1AA 4R90L 5J89A 4X4MA 4E8DA 1U2HA 3VXTB 1UZ4A 3S36L 1G7LB 2E8ZA 5L88L 4M1GL 3SHSA 3L4ZA 4JO1L 4N90E 1IEBB 3GSQA 1EHLL 1WZAA 1T2XA 1E4KA 3CPLB 2XYLA 1S3KH 1LEIA 4AIZA 3SCWA 3VMOA 2NPLX 2QLYA 4F57L 4DQOH 2V6HA 5A2LH 3WD5L 4BFGA 2VDKH 3RTQB 5E95B 3FN9A 1MY5A 3SDDB 2Y9RT 1P4BH 1QA9A 1NCBH 3ZO0A 1QBAA 1CFVL 2NTSP 4KDVA 4MQXD 1NANH 1J1OL 4QF1B 2SEBB 2HTKC 3EDEA 4U1HA 3RWHA 1OARH 3QR2A 3VMNA 3ZKND 3QHFL 4QRRE 1CICD 3H9YA 4PJXB 1NJ9A 4NWUH 1GUVA 4JG1H 1T4KA 4Z7UB 3QUZA 2MMXA 3GH7A 2IQ9H 1R5WA 3L4WA 4X99B 1M7XA 4HKZA 1ULVA 3RWFA 1C1EL 2MPAH 2CKBL 1PFCA 1NGYA 3BP5A 4G6FD 4JFYB 3HUJB 4HKXB 4X9GA 2CKNA 5JPMA 1XD0A 2V7NA 4IRJB 4WJ5A 4L4TE 5EO9B 4P2OD 2XWBA 2ZG2A 5BOPA 4PMOA 3VO0A 1FNHA 5SWQB 1WLHA 1BVKB 1QOKA 3MRPB 4F7MB 4JFED 3STZB 4I0PD 1B1YA 3MRLB 1IAII 2GTZA 4GI8A 4G43B 4MYWB 1CXLA 1IL1B 3G9VA 3CFIC 5FB8A 1KBGL 4M8UA 4FQJL 2D03L 4HBCL 2PF6A 4MLSA 4XP9L 3AROA 3LN5B 1T2QH 3RL1B 5D8JH 1OT2A 4YHKH 5CG0A 3O3AB 1KOAA 4LLUB 4R3SB 4HS3A 2KUTA 2J8HA 3NPSB 2AK4E 1N6VA 1UWIA 4PJAB 2MSPA 3W9DA 1I3UA 1KB5L 5CHNA 3MREA 7FABL 1J1PH 4BZ2H 1ZANL 4LDLB 5D2NE 4Q2ZB 5I1LA 1XCTB 5HBFA 4LIQH 2ZCKL 3IU4H 4N1CA 4BZYA 2VDRH 3QUYC 1HNGA 3W37A 3OKMA 4MAVA 2VAAA 5DFVC 1I7RA 1TMQA 4R4BA 3VI4E 5FK9A 3DV4B 5IB4A 3HC4H 3WS3B 3H53A 1TCRA 5DO2D 4N0FA 1MCNA 1N8ZB 2XKNB 2L0DA 5HDRA 1KNOA 1ISWA 3BP7A 2HWZL 2HKFL 3Q48A 1OTUC 4Z77A 3JWDH 5D6CB 1DLHA 1UYWH 4HPOL 4I9WD 4LBEA 4WKAA 1YEJH 3NBNA 1R86A 1S78C 1HWGB 2XPKA 1E4JA 3ZIZA 1E28A 2WIIA 4E8CA 1FC2D 2GJ6D 4JRYE 3RIFF 3CZJA 5GJTL 2EECA 2EDFA 3BWUC 3LEXB 4AC1X 2W5FA 4JDTL 4NNPH 2AV1A 4Z8FH 1R0AL 3EO9H 5H37G 4OCXL 1KSRA 1P4IH 1UXWB 2BMKB 4HBQA 4XVUC 5EA0H 3ECQA 4OGYL 4Y5VA 4WFFD 3BPCB 1CT8A 4EI5D 1QNPA 2EE2A 2VZVA 4O02H 4WHYG 1R8LA 4OZGF 1OLZA 3DVNA 5JOFB 3CXDL 4PJIF 2UY3A 2WQRA 3APGA 4GRWH 1JHTB 2RR3A 2OYKA 2DI9A 3FQUB 1V3IA 1AGBA 4C4KT 5INDA 2AEPH 2YD8A 3GMQB 5GISL 2E7BA 3BDXA 1A3HA 3RM4A 5I15H 4HEME 3VIJA 3ALGA 3WXWL 2XVGA 2BVDA 3WYRA 1F4HA 3INUH 4PCTA 2CO6B 5KZCD 1GQLA 4K7FB 4CKQA 4G8EB 3OJDA 4ZD3L 3AM8A 3H42H 3OR6B 3QUYA 2AXFB 2GKIA 1NBVL 3ARQA 3KWWB 3T0EE 1BFVL 2HMIC 3K4DA 4JO3H 4UB0H 1QFPA 3SE9H 2VLKD 4QAWA 3WFDL 4XNXH 3I6LD 4NRZA 3I2CH 4P5KA 1FNFA 5T3ZE 1JNJA 1QBBA 4NBXB 5TQ2L 2ARJA 1XIWC 2UUDH 4C56E 1KEML 2IPKB 3G6DL 1UWEL 5CINH 3HG1A 4YNYA 3O2WH 3KPPA 4YHZH 4M48L 3U46B 4D9RE 2OTUA 4NN5C 1CFSB 1DBAH 4A6YH 2PYFA 5C1MB 5I1CH 3LKOA 2A3CA 3OX8A 4A3HA 5KSVB 2OLHA 1D9KB 2FIKA 1X5IA 2I9LA 1RV6X 1RH9A 3OG4B 3TA3D 3RX7A 3IDYB 5AEAA 1A7RH 5J4MA 3MUGB 5FDWA 5CBEA 4G3YL 2OL3H 3NA9H 4BQ8A 2D7OA 2QQKL 5JW3L 1MHHA 1MJUH 4GRLC 4QNPE 4LAJH 2ICWB 5AD0B 3WQVA 1RFDL 4QXUL 3PG2A 1B4JL 1DLFL 4LLYB 4L8BB 3QA3B 4PBXA 4HU8A 3MR9B 4MDJB 3VGAB 2XA8H 5I71C 4RZCB 1C5DB 1KFWA 4XPHL 3LS4L 4I5BA 4PJ9B 2W66A 4BELD 2D9QB 3WBDA 5IB5B 1DVFA 5FA3B 1A9BA 5DD6A 3O2DH 1KWKA 3T4AA 4M1CD 1DUZA 2JB6A 3QDGA 3BUQA 5J3HC 4YJZL 4QLLA 1QSEA 2JTDA 2VC2H 4F8XA 4UZUA 1LNUB 2OP4L 4NRYA 2FZ3A 4GAJH 1MW0A 2OL3A 1H3WM 2EH7H 4JFZH 4XZUB 4YUEL 2A83B 4L4VE 3IFLH 3PNWB 5IQ9A 1NDMB 4Z7VF 4N8PA 5CZXD 4EDWL 1YA5A 2JE8A 3I75B 2WHLA 2HFFB 2J78A 1XIWA 5F8RC 3VRIB 1FNSH 4YN5A 1TQBC 1UVQA 3BDYL 4R97B 3PV6A 4P57A 1FCCA 5EZLA 1MFBL 4F7EB 1OVZA 2XVPA 1EGZA 4G9DB 5I8KH 4EKJA 3HRPA 3W2DH 1LEGA 3JUZA 3SGKC 2NW3B 3K80A 3RJDA 1M05A 4LDEB 2YBUA 1JHLH 4HWUA 4X7CC 1G0YR 2AEQH 2PUQT 1UT9A 3MKKA 2YD9A 2E27L 2Q8AH 4BUHA 3O2DA 4PTUA 2NW2B 3SN6N 4RFOH 4KI5E 3OZPA 1HDMB 1WSST 4HPYL 1DWIM 3W27A 4U1MA 1MUJB 3RX5A 4HFWA 3KR3L 2NCMA 1E15A 3HI5H 3L5XH 4OZFA 5T1KA 1QVBA 5CEZE 3ZL4L 1TA3A 3G6LA 3V79C 4OD3H 4Z78A 4H5SB 1DSFL 2IPTL 1WC7A 3MNVA 3K1KC 4NQEA 1JPTL 5EBLA 3RWGA 4Z7NE 1W9BM 3RVWD 4QTHB 1SJEB 4P46A 2VDPL 1JGUL 2YEZA 3PJSA 3GXMA 2P8PB 5ESVB 5D1QC 3U4BH 2QADC 2QLVB 3NCBB 2G75B 1QI0A 3MMWA 2FGWH 3EJPA 2YPKB 2DBJA 2XA3A 1KTDB 4CD5A 2IPUK 2IUZA 4AD2A 5LAXB 5T3ZL 5GNZA 4UT6H 5F9OL 1UZ8B 2GK0A 3C8HA 4WW2B 1RD6A 3RCNA 4YGVA 5GGUB 2P45B 2XN2A 4OI9A 1Q0XH 4FXLA 3TO2A 1II4E 4JL1A 4W7UA 1CLXA 5DA4A 2DYPA 4JE4B 5F96H 1P1ZA 3QUKB 5IKCB 2QQQA 5J6HB 2F74B 4D72A 2YWZA 4UQ2A 1BP3B 3T0DA 4ENEC 3MLVL 1AGCB 4D6EA 2NX5A 5I1AB 4XPGH 2DLTA 3DX2A 3X17A 5I8EA 3T0XA 2HTLC 4RMWA 1V3HA 1DBJH 3F12A 3GSQB 3S5LA 3WNMA 4BJLA 1HJUA 2VO5A 2HFGL 1LEIB 2JKXA 4AIZB 2BVQA 3VKKA 3A6BL 3K8KA 5DVNA 4UQ9A 4I8DA 5KN5A 2E7LC 4E42A 5D72L 4HUMB 1X3DA 4NM8H 3A67H 1CDCA 4DCQA 5HYFA 2DSKA 1DBBH 1QA9B 1JF1A 3HKFA 1JGVH 4Y2DD 4F66A 2ESVA 3SE4A 1V6UA 1H11A 3N06B 2DL9A 2DQJL 1BGGA 3AHTA 2XZCL 1SMDA 5ISZE 4U1HB 3RWHB 4LYRA 2FATH 4Q7NA 4HJJH 3DI3B 1NJ9B 1T4KB 3W29A 3QUZB 5KSAD 2DLFL 3FFDA 1R5WB 5TPWL 4HIXH 2YDQA 2AJYL 3AI0A 5TFSL 4HKZB 1DWJM 3FOMA 3W11C 4GQPH 3RWFB 1NMAL 5D1QA 3ULUH 1JPSH 2HRPH 4PY8J 1QI3A 6CGTA 1OAXL 1AI1H 1NGYB 3BP5B 4Y5YA 3BQUA 3PTKA 1AFVL 3VXME 1K6QL 5JPMB 2V7NB 3E2HC 4WJ5B 2FDBP 3IDGA 3THML 5BV7B 2OSYA 2E0PA 1UWGH 3LY6A 2XWBB 2FO1A 3F5JA 1FHDA 2BVOA 1EMTH 4HJ0C 5LG1A 2BHYA 3EYSH 5CFHA 1KELH 1DWHM 3TT3L 4LYPA 2GTZB 3TPUA 3SDXA 3WFEH 2V5RA 2DKUA 4K07A 5FB8B 2GCYA 3C6LA 4FNQA 5E8PA 1N26A 4I3GA 1MJ8H 3SGDI 1L7IL 2YMXH 3QXTA 4HZLA 5D9MA 2IGFH 3BAYA 4HS3B 4YXHH 4NQCD 1LP9A 3HI1A 1MRCL 1NDGA 5I1GH 4NRSA 4K7PL 1BJMA 5JXEC 2JFEX 3MUY1 3KHOA 1NGXA 5CEZL 2HG5A 3QH3A 4DW2H 3W9DB 4G8FA 3MACL 2XQBH 5CHNB 4ZFMA 3GNPA 5DHVH 2FNBA 2QHAA 3MREB 3MLUL 4LSRL 1KCRH 3EZ8A 1ZBWA 3BPOB 5I1LB 4PMYA 3DSFL 1HP5A 3HA0A 2ZG1A 2XFRA 4KVNL 3EFFA 3WUFA 1SBBA 1FSKC 2P43B 3N9GL 1C91A 2BHUA 2J2ZA 3OKMB 2VAAB 1I7RB 2WHKA 2DL2A 1FAIL 1NFDA 3V4VH 5CEYA 4R4BB 4AZ6A 5FK9B 3BYYA 5IB4B 1R87A 1A7NL 1TCRB 2OJEA 5F7DA 3KLHC 1A4JA 4N0FB 2BCKA 4XXCC 1MAKA 1KNOB 1T1WA 3BP7B 3F7QA 2R29L 4F33A 4Z77B 1KN4H 2FWOA 4U1NA 5C07D 1DLHB 3LMYA 5D7IE 4LBEB 3OKEA 4O2EA 1PD6A 1E28B 2WIIB 1A5FH 2MNUA 1TQVA 3FB5A 3MV9D 3SGEI 5DHVA 2JB5L 5IESL 2NR6C 5JBFA 2UWEF 5DD0L 2AV1B 3BD5A 2D22A 3IETA 1AR2A 3VPLA 3I3DA 3WHXA 4M9OA 1C3FA 1CFNA 2G8ZA 4Y5VB 1CT8B 1FBIH 3G6AA 5F7FA 4M7LT 2FLRT 1MCKA 3PZQA 1XGTA 4ZOCA 2WC3A 3OWEA 3KZSA 3DVNB 1OWQA 2VX6A 1AKJD 3LDBC 1GL4B 3FFCA 3O9WA 5ANMA 2UZXB 1GQKA 3V4PH 3VFTA 3WKNA 5JXEA 1AGBB 3MODL 4Y16D 4IUGA 5INDB 4F79A 2R4SL 1F13A 3QZWA 4ODHL 4YFLF 5DT5A 1P7HL 3OGRA 3J7HA 3VFMA 1CLZL 4M6MH 3EJZD 3SO3C 1TIUA 2ZIDA 3QUXD 4HIEA 5I74C 3OJDB 2YL8A 3QUYB 4IOFD 5GNYA 1QLFA 2PR4L 5BJTA 3L5WA 1EAPA 4RMUA 4KU1A 3B6SA 1F90L 3SGJC 2IMNA 2XWEA 1B0IA 1J8HA 5CQ1A 4KJYA 1WNOA 4NRZB 2QQLH 3WIJA 3WSUA 4P5KB 5E2VH 2X40A 2ARJB 1A6WH 3K0WA 4XB7A 1F6LL 2IPUG 4UQAA 1NC4A 3HG1B 4XXCA 4GRWB 4Y89A 4YNYB 3KPPB 1SR0A 3V6OE 1FNAA 4AEIL 1IGML 3RVTD 2OTUB 1MW2A 3TBTA 2GQHA 3AB0B 1OWWA 2PYFB 2X1OA 3O6KL 3LKOB 3QPXH 3GFUA 3OX8B 4KGLA 1I9IH 1MREH 1UR9A 2V17H 4MXQC 3FW6A 1KXVC 2D0HA 2FIKB 4LCUA 2I9LB 4KZDL 2H26A 5ADOH 1IBGL 4L8DA 5IBTH 3S88H 2XSBA 4KMLB 3POCA 5FDWB 4RGMB 2WUCH 5CBEB 4OF5A 2W0LA 1P4LA 4PSRA 2C1OA 1YYML 4QXWA 1CE1H 1P2CA 4DZBA 1MHHB 2Z93A 3PWNA 2VDML 1OINA 5M94B 4HXBH 5SX4I 3BRGC 4LRNL 4HF5H 1I75A 5D71H 1DBMH 1JDDA 2VLJE 4XVSH 1JL8A 4MX7A 2ZICA 4FQXA 5IROC 2XZQL 2B4CL 3FO1A 1JGLH 4BFEA 1EK3A 4TNVF 1ZEAH 1T1XA 4M8QA 1ZL1A 2DWDA 3HZMA 5HGDA 2NXZB 2D31A 4I5BB 4M7LL 3TV3L 1U8OA 3TN0D 1DVFB 1A9BB 2FX9L 2EEAA 2GSGA 4KK6D 4OFVA 5DD6B 3UJTL 4FABL 5LBSL 3T4AB 3PZTA 4LHUG 4NIKB 1DUZB 2JB6B 3QDGB 2C7UA 4TTDC 2BZDA 4TUFA 4XB8A 1QFUL 2UZIH 4KROB 3S96A 1QSEB 2WVTA 3CK0H 3UTTE 1S9YA 3VSVA 3BRFA 4NRYB 2FZ3B 4WUUE 4X9IA 2HA1A 5MENA 4UT7H 1YEEH 1R85A 4UFKA 1RURH 4GXVL 4JY6A 2LFGA 2CR6A 2OL3B 4FNLH 5CGYD 3WUWG 3SGJA 1EZVY 1C5BH 2ZUWA 5C0AD 5IQ9B 3WELA 4UNUA 5J12C 4NM4H 1E5JA 1UWTA 1XIWB 3ZTNL 3G6JF 1UVQB 4MLIA 5DK3A 3S37X 3PV6B 4HUNB 1JAEA 4P57B 3GSNA 2AI0L 5EZLB 5C2BH 2AKRA 3AIRA 3QO0A 4Z7QE 4OCMC 4CVWA 2L7JA 1LEGB 4ODVL 4NN5B 3EYVA 1M05B 3HE6D 3LQAC 2GSJA 5JBDA 3FL7A 1FVCA 5KAQG 4XI5D 4TTGA 3DARA 3T1WA 1MNUH 3AREA 2Y8KA 2CETA 4PTUB 2DQGL 1AIFA 3GMNA 2P24A 4GBXC 5EFFA 3TA9A 2BVUA 4U1MB 1HOCA 4M5YL 4HFWB 4JO4H 1A47A 2QV4A 3GBDA 2YKLL 5IGXH 3T65A 1Q9KA 2A9NL 3WNKA 1H0GA 4IEFB 3RBGA 1T7ZA 4OZFB 5T1KB 1TA3B 4LDOB 1QBML 4Z78B 3VX1A 3QPQC 4JRXA 5GZOC 1WC7B 1A64A 3MNVB 3QFJA 2VDOL 4NO3A 3CLEL 4NQEB 5EBLB 3RWGB 4XBPA 4P46B 2YEZB 3PJSB 3GEWB 1EVUA 4PJGE 4AZHA 5IROA 1A0QL 1T66D 2X0YA 2FYYA 2YDSA 4Q58C 5CD5C 2NY1C 5IBLC 4UBDD 4CW1A 1MLCA 5F7NC 1A6TA 3BMWA 5I8CA 2DM4A 4O4YL 3CV5A 1NUDA 5DMYA 3OPZH 3P9WB 2GK0B 1UKPA 1HH9A 3U0WH 3HPLA 4YGVB 1DANT 1SYSA 1BMGA 1LVEA 3TO2B 5GS0D 2XN1A 5LGJA 2CRMA 4UU9A 2H1PL 4WI8A 3HB3C 5DC0A 2F9BT 2DYPB 2ZG3A 4K94L 3NCJH 1P1ZB 2FBJL 2OR9H 4UQ2B 5EU6A 3LKQA 4H04A 4N8CH 5EZOH 1FYTD 5CCKH 2WKGA 2NX5B 4WTZG 2X05A 1FNLA 1L0XA 4N0UA 4X80H 2GFTA 4MJID 3BPLC 5I8EB 2DQIL 4QNPF 4G9FA 1JNLH 3F12B 3S5LB 2EEXA 2VDNH 4OZHA 3BLKA 3MOBL 2BVQB 4J3SA 3CTTA 3BXWA 5KN5B 4E42B 3SOBH 3POHA 2HT4C 4DK3A 4KRUA 1AQHA 4DCQB 1QLEL 2W60A 4HUVA 1JF1B 1BLIA 3KXFA 2GK2A 2ESVB 1JTPA 1VFBA 4PREA 1E4XI 3SGEH 3WHE1 4IISA 1X5GA 3BVUA 3U5YA 1NSNH 4XP6L 1NGQH 4J1UA 3NACL 4C55A 4OZIE 4J28A 4WVRA 5D2LE 4ZTOH 1RUAH 2DT0A 3GXIA 3FFDB 4OFPA 4KK9D 2A6IA 5L9DH 4E0RA 3AYSA 3IAPA 2F8OA 5F9JA 3SDAA 1ODZA 1WWBX 2Y36L 1ACYL 3FOMB 1AXTH 5B22A 5T3XE 1ORQA 5D1QB 4OIIL 4YHNA 2QADB 2I25N 3VWJC 3U82B 1QVOA 5J11C 3FT4A 3BQUB 4Y5YB 5J13C 1FIGL 2NXYD 2YD6A 2F19H 1GRWA 4R27A 3IDGB 2EPLX 5ITBH 2HVJA 5D7JD 1ROWA 4NKMA 1GHFL 1T0NA 5HVWA 2BVOB 2WBJA 2VH5H 3MGAA 1S7RA 4YQXH 4AISA 3WE6A 2X7LA 4K3EH 5CPQA 1JHKH 4L4PA 4JFWA 1L7TH 3TPUB 3SDXB 2IWGA 5EIQA 1G1YA 4EXPX 2AJ3A 2GCYB 3C6LB 5E8PB 5D96C 4POZC 4HZLB 4RX4A 3GH5A 3BUIA 1JP5A 2F2HA 3VW3H 3WD3A 1LP9B 3HI1B 1DQLL 4XPTL 1NDGB 3PE9A 3WNOA 4NQDE 4MB5A 3TTYA 1NGXB 2HG5B 3QH3B 3HNTL 4X6DF 4MAYD