1TCMA

Cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 201
structure length 686
sequence length 686
chains with identical sequence B
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tcmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tcmA01
5FYJU 3EYOB 3D2UA 3O2DL 4ZFZA 3FCTB 4TTDD 5ICYA 1UB6B 5HYIA 1RUAH 3D5HA 4KQ3L 3C6SB 5J0BA 2NY2C 1JGUH 3MZGB 4XHJC 1XR9A 3HI5H 2WHJA 4W93A 3KPOA 3CMJA 4YDVA 4Y4HC 1A3RL 4I5BB 2Y24A 3KXFD 5CJXC 1BVLB 2B1HH 4OCSH 4BSVA 4GZJA 3DXAE 5DJDA 1FE8L 2WXDM 2VLME 5T1LA 1KJ3H 1LO5B 3FL7A 1HP5A 2WMIB 1UWEL 1P7KA 3AIVA 2AJZB 4N8VB 4K94H 4LF3A 1BBDH 4IRZL 4XPGH 4E5XB 4H2CA 4TVDA 2MPAH 4QGTA 3VIOA 5FCUH 1IAII 2L4OA 4MDIB 4HUVB 1HX0A 5A2IH 1W72L 3K80A 1D9KB 4GRLA 5DJ6A 4GAGH 4QXGH 2C1PB 1KLUB 3EJUA 2PF0A 3UG3A 4U3XA 2PWDA 4PMXA 2J7EA 3PN8A 3A6BH 1T66C 4Q9QH 4YZFF 4PJ7E 3EYPA 12E8L 2CCRA 3C9NA 2IGTA 1E43A 1PLGH 4R0LA 3OKOA 5SWQB 5KZCD 4FQQB 5EC1A 1HIZA 4L4TA 4DEPB 2KUTA 2X4OB 1D3CA 1AE6H 1M7DA 4YXKH 4X4YB 2GK1A 4XNZB 4TOYH 1JFQL 5CUSL 4FNSA 5E8EA 5GGVL 1FG2B 4P9MH 2HVKA 1IEHA 2IAMB 4JRYE 3CC5A 2J25A 4M7JL 5JHLL 1MHCA 2AQ3A 3ULVL 1C08B 4GXUM 3KLLA 5F88B 4OI8A 3S5LA 1J1PL 4PRHA 1CWYA 3QP3A 4JHAH 2QQQA 2A9NL 3K4AA 3QH3A 4MNQA 4FLQA 2YKKA 4GI9A 4GO6B 4PJCB 2XVGA 2M2DA 1IAOB 2WBJB 5E8NA 4PMQA 4Q7DA 1EOMA 5EBGA 3PWLA 4K7PH 4ZUWB 3DTXB 4OZ4A 4WY7H 3WFDH 5JOPE 2OWWA 3T2NH 1GOFA 1KJVA 3VFGH 5JDSA 4MJIB 4YEFA 1MRCH 1AIFA 1M6OA 1OD7A 2R56H 2WMKA 3K8LA 2VDPL 1B3VA 1O0VA 5DJ6B 2CK0H 1DUYB 4FQLH 4U6XB 4YHKH 3A6BL 1HCFX 4BSWA 3ISWA 1UXWB 2CO6B 1PX4A 5MI0C 2YC1B 4WFED 3O6LL 1HINL 3PZ9A 3M45A 4WWKA 1A6UL 2H32H 1A4JB 1JZ5A 1VDGA 5ETUB 1YMME 4U49A 5L7XL 3UTQB 4JVWA 1YEHH 4AM0B 3K81A 1DVFC 4PRHB 3NN8B 4P3CH 4N8CH 2XWEA 3CDGA 1JGDA 4P9HL 5C86A 3RY6C 5GSRB 5MENA 4LHUA 3NDYA 2GJZA 2Q7YA 5IFHH 3PZNA 3S4SA 1DBKL 5I2IB 1FN4B 1NAMH 1LE9A 4B16A 3NIDF 4GS7B 3QUZB 1ZXQA 1WZLA 3KL0A 2NQCA 1MQQA 2ZUSA 3P0GB 4UQ3B 3VM7A 1Q6CA 3S37H 4JRXA 3L5WB 1E1FA 1I7ZA 2EH8L 5HDBE 4UB0L 5IHUH 3N9GL 4HT1H 3KPRD 1I7TB 4NNPL 2XWBA 4JFHD 2ADGA 4PTXA 1HQ4A 4IRZH 2CRZA 1F42A 5I18L 2SEBA 5GIRA 3RNQB 3K46A 3BGMA 5F1NA 1PZ3A 5FCZA 3MRPB 3CUJA 3MNZA 3BRGC 4K94C 3CUPA 4WY7L 1TQWA 3ARGA 1CNVA 2JB6B 5B3JE 4PGEA 4AMCA 4J6RL 3L1OH 4ZDHA 3ULUC 3O45B 1KJMA 1SMAA 1IAMA 2P8MA 3OR6A 4M9OA 2VVSA 5ECJE 4C7GA 2VKXA 1OSPH 5C0DB 2O61B 12E8H 1E55A 3PTMA 3NCJH 4GZEA 5SX5H 3HE7D 1H8OA 2DM2A 2C1OA 3LD8B 5DRXA 3W38A 3D85A 1BZ7B 3L5XL 1P6WA 3IXAB 4NKQB 1IAIH 4M7LL 2P24B 1P7KB 3G6AA 1M4KA 3RVVC 1CLZL 4ALAH 5D7KE 4HJGA 4PBVC 2BHYA 3ZTJG 3TA3C 5MHSE 2QBWA 4IBLT 3R06B 4PJEE 5IESH 1F4YH 4UFJA 1V02E 2ZE0A 1I8KA 4PJ8C 3CZFB 5GGVH 4MDJB 5HYQA 3C87A 2GJXA 5C07A 4YIQB 6TAAA 1E4WL 2VDNL 3BUDA 1MOEA 3S34L 2R1YB 4POYA 3NSXA 1QR1B 3CSPA 4YGVB 3ZYIA 5BCAA 3H9SE 4S0TD 1BD2A 4Z76B 1QBBA 5GRJH 3ZE1E 1A14H 4JANA 2XN2A 1T0OA 2I9TA 4A2LA 2YPVL 1NC2A 4Z2KA 4X83A 4G9DA 1WIPA 3PP4L 2D1ZA 1I8LA 2IADA 2JCCA 2O26U 2VIRA 5IROC 3BHBA 4K71B 2Q6WB 2F7QA 3WYRA 2FGLA 5L0QC 3CPUA 4V1DD 2MSPA 2O93L 4UQAA 1BAGA 1C8YA 1FNSL 4O5LH 2FYYB 3UYRL 1A6AB 3UPRB 5DJXA 2XTJC 3E3QC 4R7DB 2NY0C 1EO5A 3RGVA 3QIBD 4ZQKA 4MQSB 1G0CA 3WE6B 4GT7A 3RIKA 3EO0A 5D70H 5I8EB 3FQWB 1TMCB 2P5EB 5E94A 3RPKA 1JNDA 4M4RA 1V3LA 1WLHA 4OZHF 5IR1B 5JO5A 1ISXA 1R87A 1S7VB 4ONHB 1EUTA 2NZIA 5D9PA 4N8CL 3V5HB 4QHLA 5INDA 4Y8DC 5C0ND 2VQTA 4PGCA 2VRAA 1BGXL 4HZLB 1QOKA 1QSEE 1RU9L 1HT6A 4JFYA 3MNWB 5IW6B 1JNHA 4XH2B 4LSSH 4OLZL 5ABDE 4XBPB 1I8MA 2QSTA 4S11A 1LK2B 1UM5L 2QSVA 3HE6A 4G80A 1MFDL 4HDIB 3VSUA 3GK8L 4P5TB 3QQ3B 4ZXBA 1T7ZA 4CGTA 2OBGA 4OCXL 3TV3H 3GXPA 2GI7A 4LCUA 4PMVA 4GRWH 5IVXE 4KVCH 4Q9RH 25C8H 4XXDA 3PWVA 4NFBA 1FYTB 4MA1C 4QXWA 5DD6B 5GGUB 5A2FA 1R3HA 1DQQA 3BWAA 1J88A 4IRJA 5JW4M 3W53A 3ET9F 4AG4L 4X7DC 5HJ3B 3QQNA 3FB8A 3Q48A 3TBVA 3WF1A 1KCLA 3MLVL 3WDRA 3BEWB 3G6DH 4Y4FA 1UWXH 5JW5A 3JWNC 4MA7L 3N9KA 3EFFB 3RQ3A 1GGCL 4M03A 4TSBH 4U6VL 4M7KL 3S9DB 3L3HA 4AZBA 5AZ2H 4YFDB 1W3JA 2I9LB 4JHZA 1C16B 1FH8A 4L8CA 1GHRA 3GJFK 1UACH 2GT9B 4PB0H 4R9HA 1NCCH 3G5ZB 1YEKL 4EVNA 5D7JC 5TF0A 4HIXL 3VXPB 1H3PL 3BVTA 5A3ID 2GJJA 1YNLL 2BVOA 5TDNB 2P5WA 4G6FD 2R2BB 4J3TA 4LSSL 4ZMAT 1JF1B 3TESA 3IU3A 3GRWL 1QG3A 5EOQH 2ZOLB 1R86A 3T4AA 3VI4F 1QWUA 2YPVH 3T0EA 4MQ7B 4XNUH 5I2IA 1BBJB 3WS3A 4XCCL 3PP4H 3O3BA 4MNGA 1K2DA 4RISL 4AEFA 1KXHA 2GUOB 1GZJA 1MREH 1XF4A 2ZG3A 3WHXB 2D03L 3LPWA 5I19H 5J1SC 1T04B 4F7PB 1J0ZA 2NY1D 1A3QA 5DRWA 1CS6A 1NCUA 3VGGA 2GJ6B 3UC0L 1GNXA 4XBGA 4NF7A 4AG4H 1C16A 1TUXA 3MRBB 5C08D 5FKPA 2EH7L 5KZ6A 3TT3H 1XEDA 5L2KE 3RDKA 5DC9B 1NCNA 1B3XA 3FMGH 3CVHB 3W2DL 2PNDA 1TLKA 3IAQA 2FWOA 1F97A 35C8H 5ISZB 2NT1A 1S7XB 5GS1B 5ABEA 3DECA 4XWGL 5DFWH 3CX5J 4DZBA 5FKYA 4M62L 4NC1C 2C5DC 1KN2L 4HHAB 1JD7A 3IU4H 2ZUUA 3TONA 3AMKA 3O8XB 4PJ7B 4LL9A 2R0ZH 2EDEA 4AIZA 3VGDA 1UACL 3GBLA 4OGAD 3LZFH 5GRUL 2DD8L 3CH9A 4AENA 3BH9B 3T0AA 1H0DA 5TF1H 4ZG1A 1L7IL 4MA3B 2HLAA 4MJIE 4PJCA 5EA0L 5FHAH 4NNXA 2NW2B 2JALA 1LK3L 3P77A 5EU7E 5FUOL 3AXIA 3WIFB 1S7WB 1JGLH 4JFFA 4H25A 5E1HB 1NGQH 3GBEA 4PS4L 1OAKL 5IWLC 5E0QA 4ELMA 4Y16D 2XZZA 2E9JA 5EN2B 5I76B 1YYLH 4ZUUA 3T0DA 3BDBA 1UCBL 4OLUH 1CDJA 1IGTA 4JKWA 1W9BM 4BFIA 1T03H 1KEGL 3GBDA 5BXPA 4KUCD 2WMFA 1BQHB 4YBLC 5DFVC 2AABL 1XGRA 5C09A 4G9DB 4Z7QF 3QIWD 3G6DL 5HGGS 5A2AA 4OZFG 1MFVA 5DRZB 5B3JF 1F4WL 3NZHL 3MMDA 1DQML 1IKNC 5IMKB 1T1WB 4ZO6A 4FMFA 4ODUB 4LQ1A 1F90L 3O3EB 5CEXA 4Z5RA 1Z9LA 3CFJA 1LEKA 3C09B 1VESA 1CDUA 2E7CA 3LPGA 2V3EA 1H0IA 5FF6B 3EMZA 4FABL 4QO1A 1XYZA 2A6JB 1G6RL 3PXJA 5HI3D 4H0IA 3N17A 3IKCB 5SV3A 4MHHI 4YNYB 2GJ6D 4NP4H 3KPNA 1G1CA 4H88L 1SR0A 4Y4KB 1R3JB 3BRFA 1MW1A 1IGYB 1BVNP 3FO0L 2DTMH 4YHYC 3GMOA 1X5LA 5DQ9A 3MJ7A 2DQIL 3OAUH 5BZDA 1CFTB 1KJMB 1U8PB 4GRLB 1D9KA 3OR6B 4WI6A 3ZOAA 1A6TB 4RE3A 3DETD 2CDGA 4KJPC 1VGEH 1XF3B 3VPLA 5D7KD 3QO1A 1W72A 4S3KA 1MI5B 5IJVB 4JFEE 4YPJA 4ELMF 3IVKB 1HWGB 4L3EE 2P24A 1IT9L 2F7PA 3UPAA 4AYFA 1CLXA 5B22A 4PJEA 3GZKA 3MCLH 2NY2B 3IJHA 3UJIL 1U8IB 2OSLB 3VE0B 3F6IA 5E4EC 1UD2A 2VT0A 3L3JB 5HI4C 2YWZA 3T65A 5DJAA 5DMGD 4G6JH 4ODXB 4PRBB 4FK9A 4I18B 4OZGB 3K2MC 4Y4KA 3NZ8B 3LRSA 3C5ZC 3D1MC 1EH9A 2X42A 3CUPB 3CX5K 2DQTL 2WQ8A 4DUVA 4XVSL 1OAZL 4LP5A 3QYCA 3EDJA 4OQ1A 5DI8A 5DS8B 5KVGH 2HWZL 3WLWD 5TGBB 4JREC 2E9LA 1HQRB 2WUCH 1GQLA 4LVHC 3GSUB 2YN5A 3GM0A 3BIKB 4RX4D 2DTML 2MCG1 3HNVH 1R5WA 3WF4A 4CNIA 4JFDA 3UEZA 3AFLA 1OT2A 2XZQH 4FQCL 2OTWA 4JO2L 5FO8B 3ARBA 1HDMA 3B9KC 3NBNA 2CLRA 5D8ZA 4Z8FL 1TVBB 3MLUL 4ZODA 2GK0B 2DWEB 1WZKA 2HJKB 4ZTPH 5F9WC 4UU9A 4GQRA 1FZMB 1KC5H 2UYLA 2EDYA 4B3LA 1T1YA 3KLDA 2BNRB 5I5RA 3QXAA 1HVQA 4PJIA 4W81A 3PBGA 5HYJD 1E6SM 1XH3B 1FPTH 2B4CC 4QLRA 4IOFC 43C9A 5HY9A 4IM4A 4P7LA 4GXVH 4DKEL 4UIKH 5DO2D 4UNTA 1XSJA 5CJ8A 4QLJA 2OX5A 1RZGB 3TO4C 5ESAA 1AO7A 1P84J 4PB9H 4IRJC 3GMLA 4HUXB 4NI3A 4HWZA 5IMOA 3PF2A 4XP1L 5ITBH 4A2MA 3THDA 2YD3A 1RZ8A 3B2UC 3GB7B 4FNUA 1LL6A 1QHPA 1PZ2A 2XJ7A 2QLVB 2WUBH 3VDCA 1TVNA 1EQCA 1QHOA 2DQIH 2JJTC 1QA9A 2HLFD 3BAXA 4R2GB 3OBAA 1U2CA 2PXYA 2DQCL 1FG2A 3LKQB 4PRWA 4YX2L 1E27B 1Y6NR 5FO9A 1NUNB 4C56B 3BIKA 1VGEL 4S1RL 1G7QB 2HMID 5FOOA 2YL9A 5E08H 5D9MA 1XAUA 2OSYA 2F5BL 2NNAB 2KBGA 4P7QA 2J4GA 1CF8H 1KCUL 4OB5L 5K9QG 3RA7H 1HKLH 1TQBB 3ILQC 1P1ZA 1S3KL 4CCCA 4GUPA 4UTBL 2EC8A 2I9LA 2YHGA 4D0CA 3VVGA 1YHTA 4LCWE 3P4OA 2NXYD 5K33A 1FL5B 1Z9SA 4LLYA 3QUZC 1WAAF 3VRLF 4U1LA 4U3HA 1GGUA 3BZ4B 3WQ8A 5JHDE 3D0LB 4L8BB 2BVOB 2WBGA 4P5MB 4CU6A 2OQJA 2W63A 1OAZH 4CAGA 4PG2C 3G5ZA 1U8HA 1MIMH 4EN3C 4GFTB 4OFYD 1JPTL 5CJQH 3SO5A 1L8NA 1SYTA 3QHOA 4G43A 1OSZB 2LABA 4U1SB 2FECL 3BT2L 5DJCB 1DLHA 2X7LA 4GBXB 3WMSA 1KWKA 4FG6C 4ODHH 3T3MF 4YFEA 5FYLH 3X13B 3VSVA 3WIIL 3TFKD 2COQA 5GZOD 2F7RA 3QDGD 4DO4A 2DYPD 3QUXB 1URLA 3S35L 5F97E 1ZE3C 3P4NA 1XV8A 2NY6B 1W3HA 4Z7OF 1UADC 3K1KC 1XIWB 2VISA 5EUKB 4OCYL 4CN4A 4NO2A 4HPGA 4ZTPL 3I84A 1ETZA 4RMWA 3MV8A 4G6KH 3MMEB 3AIWA 1AJ7H 4AIOA 5JHDB 1YQ2A 3ARDD 1BWMA 2AJ3A 1B3WA 1V08A 4GI6A 3GSQB 3UMTA 1JHTA 1I7UA 3HR5B 3AHVA 3EJTA 4KJPD 1F4XH 4APQB 3J8F7 5I1CH 2FZ3A 3OZ9L 1U3HD 4QCFA 4EDWH 5L6YH 3OX8A 4PV8A 2MCPL 3G04A 3WUWA 5D9OA 4EBQL 4PRID 2RFXB 2AK4A 3LV3B 5E8DL 5J06A 4WI7A 3VI3F 1MFBL 3DDGA 1EZVY 4LRNH 1G01A 1CCZA 3C08H 2V2WA 3RWCB 2ALWA 4PLKD 4F57L 3KPPB 5J6HA 5L0QB 4LKCA 2ZWYA 2F2HA 3JWOH 1KQZA 4ODHL 3QEQA 2XRAL 3TH4T 4ELMB 1GGIL 3KYKH 5IW1A 1LP9B 3EYVB 3FB6B 4NCDA 5E08L 1N8ZB 4NN6B 3QPQC 2EYTB 5C07E 2WQRA 3LRKA 1LDSA 4OFIA 4WKAA 1AJ7L 2VH5L 4DVRL 4WSJA 1ZKAA 3OF6D 3OG4B 1JCKA 5D4QA 1S3KH 4NKOB 4JZJB 1UA6L 5AZEH 3PGDA 2IADB 4H8WH 2XFFA 1DE4A 1R5IA 1G9NL 3GJFB 2ITDA 1TTFA 1QTYT 3IJYB 4M8UA 3SDDC 5LGJB 3WFEH 1JPST 2WLYA 3QJHA 3RWFA 1DBAL 3G5VA 2J8HA 3ARBC 2N56A 4G8FA 1ZWIB 1EHAA 2XN9E 1FL3A 2J88L 3W25A 3INUH 2D4FA 1H4PA 4N5EC 2P8PB 4HCRH 3SDAB 2J7DA 2DKMA 2WBKA 4MLIA 1ERNA 3VXUB 1OTUC 5D7IA 4CD8A 5IEHB 4FTVA 1V6UA 5ALBH 5J56B 2PWHA 3WFCH 2GY5A 4WO4D 3TF7C 2EC9U 2HTKD 4M6NL 3KLKA 2YL5A 2AEPH 3MKKA 4FXGB 3D39B 3JVGA 1Q9OA 1KGXA 3WHXA 3S5ZA 4HV8B 3L2LA 5J1AB 4PJAA 1OT1A 1SYVA 2J5LC 3MRLA 1ZOXA 2XWJA 4HX1B 4P4KA 2VABB 3P4MB 5C0RH 3KJ6H 1V0KA 1T0NB 3LDBC 4BQ4A 4G9FE 1HSAB 1RZKC 2VH5H 4DVRH 4L1HA 4L4TE 1UZ6F 1ISWA 3AIQA 3P73A 5EG6C 4ZFGL 4D0BA 5EIIB 3WIHL 1G9NH 5DVMA 1JPFA 5DF0A 3SCQA 5DQJA 4FTVB 1HOCB 1KTDB 5FL0A 5KS9E 3L4TA 5FYKL 1B3ZA 3AMDA 3OZ9H 5ACZB 1ECEA 4IHOA 4V1DA 2GFTA 3DHMA 4JQXC 4WCYH 1Q0YH 5I78A 3GTNA 2V2TB 2AXFA 4WEMB 2ID5A 1LD9A 5ERWB 4X7CC 3MA7B 4LLYB 4WTWA 4Y2OA 3G6JF 2DQJH 2KPNA 4YHMH 5ICZB 3BH4A 3FTGA 1E6OL 5EFIB 1G7HB 2Q86A 4WFEE 1NGPL 1QVOA 1J5OL 4HA3A 3JWOL 3LIZL 5LA1A 1JGDB 4PJHF 4V28A 4J8RA 3X14B 1FNGB 2NR6C 4Z77B 3RWJA 1UM4H 3HE6C 1HHHB 3CFKB 3MANA 1NBQA 1XCWA 5C0FA 1QQDA 4CVWA 4XI5C 3C5JB 3DPBA 4X0KB 4X4ME 4X6BB 3RP1A 3S3JA 4P7NA 3S5YA 3PWPB 4EN3D 4ZYKA 1NGXB 1TTGA 1SEBB 1RURL 4N0FA 2QR0B 2X6MA 4UV4L 3KPSD 4LHJB 3CZLA 1KR0A 1SYVB 2ESVA 5GS1C 1VHPA 4KMLB 1QRNB 2D24A 4BQ3A 3TFKC 1FV1A 3S7GA 2F5AH 5FO7A 4NO0D 5GRWA 2GJRA 1X9QA 2FGWL 3LB6D 4U1MB 5DLML 1JGEB 1ZLVK 1H09A 3HUJE 1FOBA 1I1WA 3MUZ1 4WUKL 3MRHA 1A1MB 3W5MA 3H3PL 1UWEH 2VDQH 3R0NA 2BOBB 5T3ZD 1QBLH 3HC0B 5KAQF 2VDMH 1EXUB 3QH3B 5FCUL 5TDOA 5HYJA 3UDWA 4AD2A 2BOCB 3L5IA 2NY7H 2HTLD 5DT1L 1RZ8B 5GRYA 1N8ZA 3MZTA 3MV9A 4GG6A 3GSOB 1HL8A 4IRSC 3WMBA 2EIZB 1UKSA 3UTOA 4FZ8L 1AQKH 2VL5B 3CHEA 4M00A 3TBTA 3UPRA 1J87A 3MSDA 4MD4A 2EABA 4RBPH 1AGEA 4LEXH 4PJ9C 3F7QA 4Z78B 2V5SA 5LA0A 1OCWH 3V4PH 5I74C 3VFRA 3QHFL 3QIBB 5IOPA 1OY3B 2X1OA 1DN0A 2EDHA 2F74A 3SO3B 3VA2C 3CHFA 4IJ3C 1OM3L 1A7NL 1YA5A 3GMNA 2Y4SA 1C1EL 3SE4A 4PLKC 3ZT7A 4WNQA 1ZGLB 3H55A 1UC6A 3QNXA 4BQCA 1KNOB 3MXWL 3REWA 5CSYA 3UTSD 5TE7L 3L3DB 2IALB 2Z35A 1H5VA 1MWAA 1Q1JL 4OUEA 4NRZB 2V3DA 5H37H 5FKAB 3GHBH 4YAQA 1J1PH 3SDYH 1M71B 3PDOA 2VE6B 5DLMH 1QPKA 2GW5A 3AJ7A 4EI5B 1E4JA 1KJ2H 4HBQA 2X4SA 2XTJD 2JJVA 4NKDB 2H6PA 4PJGE 2W60B 1NCDH 2BVQA 3DVGA 2NY0D 3PDDA 2PW1B 4WF7A 4P8VA 3PL6D 2OR7A 4KI5E 4UAOB 5B39G 4MAYC 1NDMA 3CFIC 3W5NA 4MQXC 3A24A 3D0LA 2GJ6E 2DLHA 4LLDB 4BZ2L 4H1LH 1E6OH 3MBED 5INCB 3ILPB 3BZFB 1EVTC 3O4LB 2XHYA 3PV7A 2XGIA 3EO1A 3O6KH 3IJHB 1OARH 1YDPB 2ZCHL 3OKNA 4P2RA 3BE1H 1QD0A 3TNNB 2IGFL 2OR8A 4FNLL 4IS6B 1KTCA 5F72S 2OK0H 4GBXA 3I6LE 1A6UH 1F3DH 3H9YA 2EYSA 5IUSA 1HKJA 2VLJE 4KY1H 5CJ5A 3N12A 4HLJA 3MMEA 3H0TB 1IARB 2FH6A 3ARDB 4UV4H 3SE8L 1IFHL 3FFCE 1H8SA 2UVEA 4JJHA 4DVBA 3ZKXC 2ARJB 3BUIA 1LEKB 4BYHA 3MV8D 2AI0H 2UZIH 3MJ7B 5CEXB 5I6SA 5IK3B 4N0RA 3K3QA 1ZGLA 3CHDA 3WDPP 3DVIA 3S37L 2P5WE 5DGRA 3WEXA 4K23L 5CILH 3SPVA 4EI6A 3N9GH 1AGDB 4NUJB 2MQ3A 2VDQL 4XRCB 2NLJB 4ZD3H 1QBLL 4CCEA 4K9EL 2VCCA 5E56A 3VWJB 3L4XA 3NH7H 4LSQL 4KK9D 1FVDA 1DBBH 3CSYB 1F8TL 2YBRB 2QQNL 4F15B 1E4NA 1A9BA 2X4PB 3MGTB 3BGAA 3QCTH 1JNLL 3BCDA 1U92B 2J3SA 4K3EH 3GMLB 3GSNH 4XP5L 3KPTA 4L8DB 1MCRA 2CITA 1M05B 4Q58C 4OV5B 3NFSH 4P4KC 3LX9A 3M8OL 5ALCL 1IGJB 4UQDA 5CMAB 3BPLB 4PRPB 3LMYA 3HC4H 4HPOH 7FABL 2IH3B 4F7MB 2D20A 4G7VL 3SCRA 1INDL 3H42L 4ODSH 2VLKE 2W07A 4UT6L 3RX7A 3TPUA 2VZSA 5I79A 2WPGA 4PJHB 2DLIA 3RZCC 5CAYB 1BF2A 1OM3H 4KY1L 1WUNT 1N59B 5IW1B 3IDXL 4EUPA 2HA1A 1RZ7L 1D9KC 4G9FD 4U33A 4YHGA 1RZFL 3DX6A 5CEZE 4ZUUB 5IHLB 5EBMA 1R0AH 1OB1A 1ADQL 3HI5L 1J1XL 1KIRB 3LEYL 2VC2L 2C4XA 1T21A 1FVCA 3D87B 3SDYL 3KPQA 2LU4A 1MIEH 4X8JA 4H8UA 4XI5D 4YQXH 5CILL 5KS9F 1I9EA 5EZOH 4J3VA 4JFFE 3BRDA 1LLOA 4WKFA 1ZEAH 3EOAB 3FN3A 4BA0A 1DBBL 1MCHA 3C6LA 4LXFA 1C12B 2Z31A 4WJ5A 3TT1L 4OM0L 4O5LL 3JV6A 4PRAB 4XAWL 4YEEA 1IKFL 3ZYZA 5L9DH 3KPRA 3UYRH 1F3JB 1CFBA 2R1WA 5HXMA 5FL1A 2HG5B 1FA2A 3RVXD 3M8OH 1E28B 4FXKB 3VXOA 1EXPA 2K7PA 1M05A 2VLKA 4WU5A 4JFTA 2EPLX 3LCYA 3SE4C 5IF0A 2F7OA 2X4QB 1UFUA 5IB5A 1KOAA 5D70L 3A67L 5BVJB 3FRPG 1CG9B 4DKFL 3B5GA 4I3GA 3JTTB 1T6VN 5ESVA 3WJJC 4HUNB 5DHVB 4IRSD 4Z7UB 4OD3L 2XKNA 2X4NB 1J0HA 4TOYL 3SUTA 1OGTB 4OJFL 5E1AB 4XVJH 4ERSH 3PZGA 3H8NA 1GQIA 1SFSA 4QY8A 4UFMA 4YBHA 5E8PA 3QIUC 3HI1A 1DLHB 1AQ0A 3BZFA 3MOAH 2ZUMA 4OLZH 4ACYA 1PQZB 1C3FA 1ES0B 3IFLH 4AMKL 3HA0A 2EO7A 4PLJC 4MS8C 1QLFB 3IDGB 4BF7A 5KJRL 5B38G 1IGYA 1MH5A 3O4OC 2NY4D 1J8HB 2V2TA 4IPLA 5JMOC 4GPNA 3OJMB 5GS0L 5EBAA 4NKIL 3I3DA 2ADIB 2W59A 4FQHA 4K3EL 2DQUL 3P0YL 4GBXC 1X5ZA 1R3IL 1HVXA 5DJDB 3NGBB 4AH2A 3IJSA 4PRBA 3U7AA 3CFCH 1SJHB 3KS0J 4TNWF 2OW7A 1F4AA 2X4NA 4TX6A 2VABA 4Z7WA 2YD7A 3V6FA 4DCQA 2I26N 3SN6N 4LHUG 1OIFA 3VINA 2OZ4L 3MV7E 1IM9B 1OP5K 1HINH 5DYOB 3NOIA 3PWNA 2GDVA 1T0MB 4HKXA 3H3BC 1YPZF 1FZJA 3A67H 2IANA 4MAYD 3O4LD 1GGBH 3J7HA 5HDOA 4G9FB 3VFPA 5DDHA 4L3AA 2WM0A 3WS6C 3MROA 5J7CC 4U5IA 3ZKXB 4AXNA 1F6AA 1K8IB 4P9HH 1YUHA 5F9OL 2MANA 4EN3A 2Y8VA 2DLFL 2P5WD 4TUFA 2TAAA 5HGBA 3UETA 1K85A 2D9QB 3E0GA 5KSBF 1YEIL 1KTBA 2BC4A 5I15H 5C8BB 2VNCA 3MOAL 1UT9A 2FX8L 4YQXL 5LKNA 4P57B 1IQWH 2EH8H 4PG9B 1RUKL 4PMDA 4P46B 2EKSB 4JJ5A 1GCFA 3IJ9A 3R8QA 3E3QE 1GGTA 4LLAA 2GVYA 3P77B 4U1GB 2X1WL 3BDXA 3ALPA 3WL9B 1CGVA 5A3HA 2BOBA 5C0AE 3I75A 5C0FB 3UTZB 2VDOH 5KSAC 4F7EA 4NKIH 4OM0H 1KR1A 4J6RH 4KGJA 4KH2A 4MD4B 2M26A 4NQED 4MLSA 4B9YA 4DFIA 3QULA 1QLRA 4M1RA 4JZJA 4WNQB 1VFFA 3OXRA 3C5ZD 2E9BA 1F6AB 5K9KB 4DOHE 4DKFH 4FQXB 5GXBB 5HVFB 4YR6A 4KJQC 1JIBA 2VVNA 4TN9A 3G04B 4AEIH 1KN2H 1IV8A 3OJDB 5JW4N 3U2SB 1R75A 2X0HA 3VGAB 4MDJA 2H3NB 1QPXA 1NPUA 2ICWJ 1Q72L 4MQTB 3ZDZE 5C07B 3WLBA 3EOTH 1V0NA 3VRIA 4ODTL 4AIXA 2VQ1B 2OYMA 3DMMD 3I6KB 4U2ZA 5EU6E 4MNQE 3NIDE 4JFFD 2ED8A 4QEGA 1D7FA 3S34H 2XTJB 2R15A 3IFLL 5F7EL 4JRYA 4GZIA 1MRFH 1IGML 3RZCD 1DEDA 1EGJA 1YJDL 2BC4B 4QP0A 1OAKH 2GTWB 3QIUA 3O6AA 5JBFA 4F58H 5A6KA 1UZ1A 4YHOL 3SJVA 1S7TB 4MB3A 3D18B 4M1DL 2ZUQC 1OHQA 2GJXB 3MSGA 4QRRB 4D0CB 1KEGH 4OF3A 2EDDA 2IEPA 4PUBL 1P6AB 4H04A 2HJFB 3ZO0A 1XGYH 2FYVA 3U83A 3GO1H 4GRLD 1RZJL 1HJQA 1U8NA 5A2LH 3ULUE 3EOAA 1UASA 1R24B 3GXNA 1NANI 1E4KC 4GW1A 1L0YA 2SEBB 2YRPA 2E9IA 2BSRB 4LU5L 5GIRB 3QHZL 3NZHH 1TCRB 2F53B 4XP4L 2PWGA 1NDGA 1HXYA 2NX5E 1FZOB 1KIQA 3QUMH 2AJUL 1QQDB 3SCUA 5IVNA 3OAYK 1E28A 1DBJL 4FXKA 3C60A 3BAJA 3E6FB 4X5XA 4G42B 5IF0B 3VFUA 1E4KA 2VYRE 3DXAA 2ITDB 1JDDA 4AY1A 4LCIL 1GXEA 5FUZH 4Y19D 1LG1A 5DD5H 2YD1A 5I30L 5AD0A 2J74A 4UQ2B 1GZQA 1YN6B 4H20H 4TPRL 3D39D 4KDTC 5J1TC 4R96A 4JPVL 3RIAF 3FT3A 3L95A 4RZCA 1G94A 4FZEH 5IKCB 1N64L 2R69L 1NSNH 1BQUA 1OAQH 3F4VA 4AK1A 4KWUA 3POCA 5AUMB 2EE9A 2ADJA 5C0CE 2WINB 4H5SB 5FB8A 3QIWB 4EK7A 5ID1B 1KTLB 2MTPA 5KG9A 3L3KB 4M1DH 3QIUD 5DSCB 2YL6A 1E6JL 1DANT 4J23A 4K7FA 4IJ3B 4OQTH 4I8DA 1U92A 4I3SL 1OF2A 1PKQA 5HI3C 5HYSA 3P9LB 3OJ2C 5I9QB 2Q8AL 3SGKA 3MLVH 5JQ6H 2CHOA 1RZJH 5AAMA 2D31B 1KJ2A 1EHXA 1X6LA 2XM1A 2H41A 4QRPE 4NO0B 1WO2A 3WKML 3BW9B 4LQFH 3QIBA 5IOPB 1XF1A 4PRPA 3SPVB 4HG4K 4LNVA 2R2CA 2Q8XA 3LKOB 1GC1H 4PRDB 1MUJA 1Q4NX 1PYWB 2Y2WA 5DJXB 2QV2A 1BLNA 4L3ED 3DETC 4X6DA 2OI9C 3ZTJH 4GG6B 4PREB 1K5NA 5AUMA 3BP4B 1JV5B 4HA1A 4ENED 1GOMA 3AB0C 3QCVH 3VD5A 1QKZL 2OYKA 1CD9B 3U5YA 1RUQH 2WBJA 5E8NB 2HWZH 5KSAA 3LMJL 4PJDA 3V0WL 4O58H 4OZ4B 1F2QA 3VXSE 1KQYA 3KPQB 4U1GC 1GZQB 1YN6A 2R9HD 5HYSB 2IQAA 3SCSA 1FFNB 4MAUL 4XNUL 3PNWA 3GI8L 3FHQA 1V3HA 2UY5A 4MB4A 3O2WL 1JWMB 2ZCKH 1A4KA 5IVXA 4JFDE 4QF1B 5ACLA 4KMQA 4PJIB 2Q86B 4HZ6A 1R5IB 1SJEA 3SUWA 3FQRB 4QRUB 1CWVA 2X44D 3MMUA 3NAAH 1NWUA 2B1AL 3SGEH 2ZSVA 4PV9B 4U1KA 3WL9A 4AYGA 3WDJA 2VLRD 3JTSA 2FJGB 2CLZB 2EYTA 4ATWA 5A6AA 1UB5B 2V5YA 3VIHA 1MCBA 1WBXA 1W9PA 1JZ8A 1PS3A 2J2ZA 4YDVB 4HUUB 2ZKHL 2WMHA 1BIHA 2YZ1A 1DBJH 5FM5O 2VAAB 4QRPA 3WNKA 1W3KA 4C56E 3IU4L 2YPKB 3RWHA 1EJOH 4NRYA 4QCEA 4DGIH 2RGLA 3DUUB 1DWGM 4QY8B 4E41B 2C3GA 2N7AA 3D51A 2EJ1A 4LCIH 3FO9A 4DAGL 5I75B 4LCCC 2ARJA 3NSMA 3AROA 4FQHB 3MNVA 3VFMB 3U9UA 4KFZC 5ITBL 3MLSH 1BJ1J 4KK6C 2GDUA 4JFQB 4TPRH 5EB9A 4LSTL 3QO1B 2DQDL 3RVTC 3QCVL 1OD0A 5C7XH 4W7UA 2F9BT 4IS6A 2BERA 1NSNL 2LV4A 1CZ1A 3V5KB 3ULVC 1NGQL 2NLJA 4I5BA 2CLZA 3N18A 3DWTA 1WT5C 4HKBB 5C0CA 4Y8AA 4LVOB 3QEQD 3HPJA 2G3JA 1GPOL 5JTWA 3X11A 2QPUA 4XWOD 3VIKA 2CDFA 4X5XB 3O2WH 3C2SA 1KNOA 3IRPX 4AH2B 2XZAL 5DO2C 2YD6A 3AM8C 1HP4A 2YR3A 4QRPB 3QUXD 3LSOA 4UI2A 2NY6D 3AGVA 1BJ1H 2JF1A 4ZOAA 2LE9A 5SWSB 3BGMB 1CF8L 3IFPA 4MJ2A 5GJSH 4EI5A 4NM8H 1U0QA 2E3ZA 3FNDA 2ZSVB 4PV9A 4U1KB 1RFDH 1MNUL 3BKML 1RJZB 1MVUB 4KVNL 2W5FA 5I16A 4YFLI 2EO9A 2DKSA 3LN4B 4Y4KC 5HHVL 5BQ7A 1BIIA 1IGTB 2AJSH 4J4PC 5I0DA 3VIFA 1XH0A 5ENWB 2G3NA 1JRHL 2PXYB 4EXPX 2VOTA 4PJDF 4V1DE 1EEYA 5HYEA 5I73B 3ZSSA 5A6SA 2QHRH 2GKIA 5FYLD 3IKCA 5DRZA 1AI1H 5EU3A 4NKDA 5I24A 3VM5A 2F8VA 2FR4A 3ZTNL 1L6ZA 5AYUL 5DMYA 4AZHA 3CIVA 5CZVL 1DN2A 1FZMA 1U9KA 1JPGB 1QP1A 2W60A 5IVXF 5DUPL 1DVFB 3BWUC 3MNWA 2VLJB 3TZVB 1S7SB 1YQVL 5ESQA 1CBVL 3MJ8B 4JM4H 2YFNA 1D5MB 3PWUA 2XY1A 4N0CC 1MAJA 2VN4A 2W4XA 4XVUC 3F5LA 3S35H 2X70A 3VKKA 3RDTA 4BJLA 1AY1H 4W6XB 1C12A 4PBXA 3FQUB 5A1AA 2NY5L 1ISYA 1WC7B 32C2A 1BHGA 2XT1B 4RFNB 5K9KA 4P48A 5F7HA 1W9XA 5I8OL 5HYFA 1QLRB 3EMQA 1ITCA 4DO6A 3QDGB 3U82B 3ARXA 1I9RH 4K7FB 4EQ2A 2J7LA 1A21A 3CFDA 1UGNA 5DMIH 5HHVH 4HQQH 1GZPB 4XPBL 2CIPA 4KUCF 1T80A 4QTIH 2EE2A 3OA5A 2VXVH 4LPYA 3O4OB 4LCWA 4ONFL 5KZCB 1HKKA 3BW9A 4DAGH 1NFKA 3ULUH 2C1PA 1CGSL 2OP4H 4Z95L 1CR9L 3CVIL 3MLSL 2NX5B 3F5WB 1U3JA 1QW8A 1DQLH 3W39B 4UFLA 2F53E 4NT6A 4WHTB 3CHCA 3PHAA 3JUYA 3KJ4C 4IIQA 4GXPA 3TJHD 4OV6F 1D5IH 1N4XH 3NACL 4Y2DD 2EC9T 3N1PC 3MMWA 4N5UA 2H45A 2VZ1A 4RNRB 1FNEA 4NZRL 1PKQE 4BZ1L 2XIBA 5GS0D 4L29B 5EC2B 3O6FB 2A77H 5TH2B 3SJVD 3VGBA 3E6FA 3TYFB 4X5LA 3TO4B 4PGDA 2PB1A 1ETZB 4PJAE 1LO2H 1GSMA 4ATDA 2QQLH 3JBG7 3OB0K 5EIQA 1ES0A 5CLTA 3W11D 5F1IA 2H2PD 2UUDK 4FFZL 4S1DC 1XSKA 1QNPA 4NOFA 5E99L 4H8WL 5FKPB 1FHDA 4JQVA 1U3HB 1AVAA 2DJSA 2WBWB 4Y1AD 3QFDA 3T77A 5IEHA 3NCBB 5D93B 3EO1B 2MKWA 1JRHH 4PRIE 3CFDB 2NTFA 3GMRA 5L2KB 4PJ9D 5CEYA 5T1DL 3EJRA 1TETL 3SDXE 2QHRL 4RA3A 3EFFA 1FO0L 2NW3B 4U4BA 4B0MM 2XXMB 3SDCB 4NQSA 4Z95H 3EBVA 1P9MC 1DQTA 3MRLB 5TH2A 1H41A 4UQ2A 4TUJA 2GITA 2X9XA 3WFCL 3NZ8A 1KN4H 5GSVB 5BXTA 4S0SD 1WDSA 2RJMA 4QXUL 2APWA 4RCAA 1B31A 8CGTA 4AL8L 2WMGA 1XR9B 1T5XB 3WN6A 2ITCB 1KPVA 5IGXH 2NY5H 3ARBD 3D48R 3MV7B 2MJWA 4GMSH 2BHZA 1CFVL 5C0CD 1XF2A 5CCKL 5F9DC 1S9VB 3KPSE 4PJ5A 1CGWA 1W1TA 4ACZB 3LHPL 4Q7NA 3KPSB 3WBEA 1I1YA 2XWTA 4F8XA 2FEDD 5D72H 1C90A 1HF6A 3K8MA 3RY4A 3CGTA 4OFVA 1FP9A 1PFCA 1CK0L 2BVPB 5C0BB 2H26B 4P5TA 4ZXBB 4PRDA 5I16B 4GXUN 2PKDA 1XCXA 3DYOA 1ISVA 1FVDB 3OB0H 1TETH 2CBVA 3DYPA 2EDLA 3F7PC 1PG7W 4LNRA 1NGXA 5DUBB 4ETQA 1MIML 2X2YA 4YHML 3QZWA 4LIQE 4XHJD 3GUTB 1CGYA 1JV5A 1ACYH 4KRPD 4EKXA 2OTWB 2VLMD 4QHKI 3Q1SL 3RWDB 1XT5A 1K9EA 5E6ZA 1IAKB 2A6KB 5DMJB 3B9EA 1R3LB 2VL5A 1SJHA 2OWXA 2DBLL 2Q8BH 5J11C 1GHFL 4TRPH 1DQJA 2DIEA 2UYLB 3KPSA 5LQBH 3KXFB 3RDTD 4NN5B 2CDEA 3W0WB 3MV8B 4L4TD 1QSEB 3HS0B 1IM9A 2EEAA 4H25B 3Q3GB 3N1FC 1MAKA 1LO2L 1FZJB 4DUWA 1KTKE 3LRGA 3AS1A 1J18A 2PO6B 4ZSOA 1QSVA 2W61A 1OCQA 2VRKA 3MR9B 5ABFA 4NQVB 3BLPX 2FEEL 3MROB 2DLEA 1GH7A 3T4YA 1SQ2N 2P47B 3BLKA 1JAKA 2WVVA 5I1KL 4EN3B 1YC8A 3WFBL 1NC2B 4PY8I 1P4BH 3GNML 4H1LG 4BUHA 4LRIA 1AR1D 2BK8A 3IDMB 2NY7L 3U4BL 3BVVA 3DX7A 3O3UN 5JHDA 4P5KB 2R8SH 4HIEB 3U4AA 5HTSA 4XAKE 3SGDI 5J13B 5JR1H 3C5SA 2E8ZA 5E8DH 4LCWD 5DTFA 9CGTA 1JHTB 1I7UB 1V0MA 1QR1A 4QT5A 4Z2LA 3S2CA 1JPSL 4RE4A 5E1AA 4R4NC 3B4NA 2IALA 1N6QL 3O9WA 1D6VH 4CU7A 1Q6FA 1P7QA 3TC9A 4NQEE 4NT6B 1DLFH 3SUSA 1J05B 1Z0NA 3RHWF 3WS3B 1BAFL 3IDGA 2YRZA 4QTHA 3S6CA 3GZAA 3KWWA 1C1EH 3S5LG 4I9WD 4R90L 4LIQL 4B50A 5C9KA 2XYCA 5EOCL 1G0XA 3H9HB 5F8RC 3WUGA 4D72A 3FO9B 2VAJA 3LEVH 3WY4A 1WEJH 3LKRB 1C5DB 2EEDA 4XBPA 1I8MB 1NQ6A 1U8PA 1MRDH 1H3WM 3QG7H 1OGBA 4IIQC 1XZ0A 2WIMA 5AZEL 3MREB 3JV4A 4M48L 4JQXA 3GSXA 4UILH 1Z5LA 3O3AB 5ABFB 4NOBA 5D1QD 2X1PA 3GSRB 4XXDB 5E9DA 1NCDL 1G6VK 3V5DB 1NGZA 3LKPA 4I13B 4RGOL 5A69A 1OW0C 3UTSB 1P4IL 2VLKB 4NJAL 4MXQC 2YA1A 2FLBT 1W9DM 4UQ3A 1SM3L 2LFGA 3BP4A 3VFNA 1U2YA 2E27L 3L7EA 4L4OA 4W86A 4ZO9A 3VXPA 2OWCA 4IMKA 5CEZL 1AQDB 5D9SA 1GOGA 3HZKA 2Z35B 3KL3A 4YE4H 3WUFA 2VXUL 1F11A 1W1YA 1JPSH 4PBWD 1GAFH 2PO6D 5B4MD 3RUGB 4P4RB 4N68A 4M6NH 3RJQB 4H26B 4DN3L 1JD9A 3GB7A 4M43L 1WIUA 3RWIA 2A38A 1TIUA 1FIEA 3MV9D 3NA9L 3HZVA 3X3GH 1CZ8L 2CK2A 3PWUB 4PCSA 3N15A 3S4SG 4O51B 1N5AB 2AJYL 1EXUA 3I3BA 4HIHB 1KF9B 1OGGA 2L0DA 5MP6L 3ELAT 2AKRA 1KXQE 2QL1A 1CPUA 2PWEA 4IOIB 3LN5B 4XMPH 2J6EA 1WC7A 2EDFA 3B5TA 3VMNA 4RDQF 4FN0A 5CPQA 5K93A 1R5WB 2AI0L 5KSVB 2NY4B 2QHAA 3ARBB 4LAQH 3RKDD 4G42A 1IC4L 43C9B 5DR5L 1Y0LB 3GSWA 1GIGH 5E5RB 5I1KH 1QWNA 5F7DA 4OZOA 3MRGB 2ARWA 3KYOA 2Q6WA 4OCSL 5GNXA 4TQEH 3UROR 3BIBX 2IXVA 2QQNH 4ZPTB 2XVNA 1MFCH 4C55A 5BRZB 4YPGA 3QCTL 2R8SL 1WK0A 3ALGA 5L2JB 5TE4H 3QQ9C 3DRQA 4RRPG 3QJFA 3FQUA 4L8SA 1KSRA 1XH3A 3UTPD 5CXPA 4AC1X 2E27H 1K9FA 1JNNH 2YRLA 3UG5A 5KG9B 4OKDA 4LASH 2YPLB 3LKOA 3QIWA 2PYEB 2UWFA 4LLVB 1HHGA 1ZA6A 4X9BA 1YDPA 5ANME 4L3CB 4FTVD 3BXNB 1SMDA 4NDMA 3S3SA 3C6SA 3HPJB 5E8OA 2HKFL 1FBIH 3C60D 5DJCA 4M43H 1MCOL 2DJUA 2V3GA 1HSBA 2APVA 5MEND 5B3NA 2V3FA 3DVNB 3IDXH 2JCCF 2PW1A 4CADB 2H9GB 4E4PA 1KGCE 3TPKA 5KTEL 4I18A 1S7QA 2B4CH 2G75A 3EW3B 2DIBA 4ZS6D 3IS0X 3CLWA 3DUHA 5TQ2L 2VC2H 5INCA 4M8VA 1IGJA 1FL5A 4QOKA 4LAQL 3FRPA 2QTEA 5EZOL 1JVKA 2XIDA 4CUCA 3EFDH 4NQDE 3QIBC 1BZQK 3MUY1 1ZEAL 3OKLB 2PW2B 4WHYH 2ENYA 2JB5H 3CDCA 1QRKA 4JM2D 4M6OL 1KIPA 3P0VH 4QHMB 3W82A 3U7BA 3AFBA 3BVWA 3HJEA 1MFCL 1UENA 1H8NA 3K2UL 2IPKB 3O2DA 3WQ5A 5E9AA 5DQDH 5T1LB 2HH0L 5LCVL 4UOW0 1MCIA 1A4KB 3QHNA 1OW0A 3REVA 5ID0A 4O02H 2VXUH 4HIJA 3MXVH 4HKZB 2ZOKA 5HBFA 3FQRA 3MRIA 4QRUA 2MOVA 1GAFL 2XM2A 3L3HB 4WUUD 2H32B 3MUHL 4RAVB 1UA3A 4CVZB 1S7QB 2E7HA 2Z31C 4GQQA 3OAZK 2D0HA 3JUZA 2WNWA 1CICA 5C08E 3MNZB 4TVPE 2Y07L 5FDWA 3L3OB 1FGNH 3GBNL 4GQPH 5EO0A 3UJTL 4KI1A 4UFHA 1MCOH 2E8YA 2XPGB 3BD4A 4X99B 4RSVA 5I17A 4JFQA 5HDQH 1A6TA 1NMAH 4X8XA 2FATL 3KPMB 4M1CC 1AKJD 3LKSA 1HKMA 3U1SH 1D5BB 1YY9C 3SCMD 4KPHH 2Y72A 3CZGA 2CNCA 1OD8A 4OZIE 2IPTH 4WV1C 4Y0GA 1Y6KR 1M71A 1Q1JH 2R1WB 2YA2A 5I1IH 4R4FL 2MKLC 4XP6L 2E7LA 1T1WA 4N0YL 4S2SB 1NCBH 4A3YA 1FJ1A 3BP5A 3GMOB 3IDJB 2XFYA 2F74B 5E8EB 3ZM8A 3O3EA 2VX5A 1NAML 5D1QA 3PXHA 5E6ID 3TYGH 3MA9L 4PJDE 4X0VA 4FTVE 4Y4HB 1C5BH 1MHHA 3ARSA 2XKUA 4U6TA 1BQLH 5FF6A 3MC0A 4HT1L 1TQBC 7CGTA 4U1MA 3QCUL 2WCAA 1G6RA 3LXCA 3W6LA 1C8XA 1BSIA 1AXSA 2XN9A 3PABB 4JPKL 1N5YH 4U7SA 5CJOL 4XPAH 4PRNA 1VADA 5LCVH 5BXRA 3RGVD 2J78A 1IAIM 3VFTB 1ZGLP 1T83C 3QZWB 3O3BB 4OFPA 1KPRA 3L1OL 3UBXB 3W9DB 3IGAA 3DGGB 3NN8A 2YOCA 2IGFH 2CRYA 4HHAA 5ISZE 1I1XA 1VFAA 4P3WA 4KTDL 2ESVB 2OW6A 1JTPA 3IJ8A 4U3CA 4UDTB 5EBLA 3NCJL 4JHOA 3PE9A 5DUML 4MHHG 4NBYB 4NQUA 3PGCA 4R96B 1YC7A 5KVMC 1A6AA 1NMAL 3PHQA 4Q9CA 1XH1A 2R29H 3RWIB 3HUJB 1X5YA 3QEHA 3HZ3A 4X6DB 3LAFA 4FP8H 1FORL 5JPNB 2F1AA 1U8OA 4JZOA 3SDCC 2HFFA 2XY2A 2AEQL 1NH6A 1GVIA 3MYZA 4M9PA 4Y16A 4JZNA 1E6PA 4K3JL 2FX8H 2BY2A 2XTKA 4W88A 1IQWL 3OG2A 1E4WH 2DLTA 4N0YH 5EU4B 5SWZD 5A8PA 1MW3A 1ZHNB 4U3AA 4Z7VF 3DX4A 3CSYA 1CG9A 1NP0A 4JFPB 2J7HA 3BOVA 2JE8A 3HRZA 4MA8H 4C7FA 4R0LB 5FOBA 1I1CA 1I4FB 4F7TB 3T1WA 4OD1L 5JW4R 4FNQA 5T5FL 5ADOH 3JWOC 2Q3AA 3QUXA 5D4YA 5GRXG 1U93B 4C58B 1YUHB 3RKDC 4M29A 3W0KA 3HC3L 2XICA 3GGWA 1UZ8B 4Y4FD 4PG2A 2IAMA 5IIEA 2Y5TB 2JB6A 3VXUE 3BP6B 3MO1A 5EZJB 1YNTA 5DHYB 4BCEA 4F37F 2CGRL 1DANU 4Z7WE 1PZ5B 4APQC 5AYQA 4ML4A 4P2RD 4CMHC 4HPOL 7FABH 1ZWIA 1C8PA 3UO1L 5EFDA 3DARA 3WNLA 3O8XC 1GONA 1LP9F 3L5JA 3O9WD 1O7DC 3SGEI 2XWJB 1VBRA 2CBJA 4RAUB 3MUIA 1JF1A 3BKJH 4C56A 3PIQA 3WJLA 1HHIB 3G9VA 5DUMH 2H2SD 3L3GB 3CZ8A 3CFKA 2B0SL 2XUCA 1KIRA 2IQ9L 3WNNA 1TMQA 4RGMB 4MNGB 4G8IA 2BJMH 5EIIA 1ADQH 2RCSL 4LARL 1X6NA 3U4EB 3KHOA 3W27A 5GGTL 1Q0XH 2YKLH 5DFVD 1WISA 4XP6H 5F7EH 3DI3B 1MIEL 3QIWC 4KUZH 3BISA 4PJHA 2HN7B 1OGAE 2P7TB 4HWEL 4P4KB 4ZOBA 5KAQG 2D7TH 1LWRA 4ONGL 1UB6A 2GSJA 1U8QA 3QGVA 3QRFM 4MDOA 5C0AB 3V7MA 1UZ4A 5FO9B 1X7QB 4ZS6C 4GW4A 2W9DH 2R2EB 3GK8H 4HXAL 3RBSA 5D2NC 1MEXL 3WLBB 5BS0E 1CDGA 1VCAA 1W8NA 4R7NB 3KPOB 3GO1L 1AIFB 1M6OB 1LJYA 3X12B 2C3XA 4J1UA 2F8QA 5JO5B 2YSSA 3P4LA 3QHZH 2AK4B 3VWKB 4NN7B 1Q9LB 4FNTA 2F54E 3ROOB 4PG9A 3V4UH 2WW5A 5DZOA 2V2XB 5DJ0A 1T2XA 5ICYB 1UWSA 2H26A 4OM1L 1KACB 1WP6A 3NJ3A 1FSKC 4YHZL 2P49B 4DJMA 4MZ3A 4XVTL 3HE7A 3VIGA 2YLAA 3ZSTA 1Q94B 4ZQKB 4J27A 4OD3H 1GJIA 3TJEH 3BUTA 3U30C 2BCKA 2BNUA 1HE7A 1ND0B 1IGFH 1G6RB 4P2QB 2IFFL 2A73A 1PG7L 4N9GA 1VA9A 4BA8A 2ORBH 5I30H 2YBUA 1VFMA 3QEGH 5DA0B 4K3JH 4RIRA 3OGRA 5DMKB 4CW1A 1MCDA 1LE5A 3AZTA 1WE5A 4PJ8B 2JKXA 5GS1A 5SWQA 5F89A 1WCBB 4OCLC 5IW6A 4H0HB 1YNLH 4BUGA 3AM8A 1ONQA 3QDMD 1F5WA 1K4DA 4K07A 2P42B 3LDBB 5GS0H 3IJYA 4NZJA 4PYSA 3RAJH 4JFDD 1JGEA 1E6JH 4QCIB 5F44A 1B4RA 3LV3A 1XH2A 4R8WH 4HUKB 3UAJD 1YNKH 5LBSH 4NBZB 1CL7I 3U79A 3VXQB 3B3IA 3ETBF 3VFOA 4HCRA 3MV7A 1WZ1H 4XGZA 1GC1L 1SMOA 4I4WA 1LP9A 4APQA 2IF7A 1WAWA 3F58H 1BOYA 1XIWA 2VISB 2AK1H 5EUKA 3A21A 3RGVC 1NOUA 3K1DA 2IQ9H 4NRZA 2VIRB 2WW8A 4OSUH 1FFPB 2PC8A 2ESCA 1MF2H 4AD3A 2WP3T 4PMNA 2FEEI 1CTNA 2IPKA 3B9KB 3VRLE 5CZXC 5EDXA 3QEGL 1JZ4A 5HGAA 5H2BA 5DJ8B 1EMTL 4Z7UA 5IROA 2YIHA 4KTEL 3S96A 2FJGA 2VRQA 3ARFA 5TF1L 1JF5A 1E6ZA 1JXJA 3ZR5A 3GBML 4NDMB 3FB7B 3IYLW 3DX9A 5JUEL 1M01A 3A23A 4W68A 1EUUA 1ZVHA 1MFAL 1EJ6A 1I3RA 1HTYA 1C5CH 1PQZA 4PGJA 3ILPA 3AMCA 5I2UA 3UTTB 4MJ5B 2HVMA 3VCLB 3NCOA 4OI9A 5HDLA 3V0AC 3GXTA 3PWJA 1FN4A 1LG2A 4X9FA 2OL3H 5E2VH 4D6GA 1ORQA 3MBXH 3JTTA 5ESVB 3ZHDA 4Y5XB 2XPKA 4R8WL 1XGPA 4JFZL 3SCPA 5MHSD 2Z91B 3D3VD 5IB1B 1NGWB 5D1XD 3KYNA 1ED3A 2UZYB 1T7YA 1U33A 4Z7VB 3O4LA 1HH9B 4Q97A 4PGEB 1CLYL 1PZ5A 4RGMC 1BJMA 4OLXH 3BH8A 4QF1A 4Y4FC 1FFOA 4H8VA 4MD0B 3QNYA 1F90H 3WELA 3TVMB 4DGVL 1PG7H 3WN5C 1YEJH 5D71H 4XMLL 4APQD 4NRRA 5I74B 2X7LB 1JAEA 3FB5B 4OI7A 1EBAA 3WXVL 3SOBH 5SWZE 2A3HA 1EEZB 2FX7L 2DQDH 4CKVX 1HCVA 5C8JB 4R4BA 5JLZA 5CPSA 4YBQD 3TTYA 4C56D 5KSAB 3C2AL 3O9WC 4FQ1H 4CD4A 5GGQH 4FABH 3HHRB 1ZT7B 1NWRA 2WHMA 5DK0A 3MRGA 3N11A 3QUZA 2H2SC 2ICWB 2V6HA 1IBGH 4YHOH 3BKYH 4JRXD 3MI6A 2QF8A 3ALFA 2XZAH 2ZP0T 1JTTA 5CJBA 2Z1SA 3H2WA 2WVUA 3IS1X 1CENA 3FO1B 1XGQA 1G1YA 5KVFL 3LQAH 4M93C 3AY4C 3ZKNC 3VOCA 5K9JH 4I0PB 1WCQA 4G8GA 2OL3L 3VG9B 3VWJA 2BNQD 1TJGL 3MBXL 2ESVD 3PABA 5D5MA 4LU5H 4NGHL 5EO1B 2QHLA 5BJTA 2B2XH 4LBEB 3ARED 1E4XI 4X9IA 1RZGA 3EYQD 1QI0A 1U8LB 4G7YL 2I9TB 1XF5A 3ZYJA 2FR4B 3WY1A 2NYYC 3CH1B 1BQHA 5C8JA 4UAOC 5JLZB 1V02A 3BVXA 4OLYL 3OKOB 2VLKD 2DQGH 3FB5A 1NLBH 2AJSL 2Z8RA 3ZE0F 3BP5B 3IDJA 5EU5A 4WU7A 1OWQA 3MUGB 4AQ1B 2YFOA 1BOGB 3DX8B 4LVEA 3PQYE 1WBYA 1XF4B 3DO3A 4YIQA 3HZKB 3HI6H 2YBTA 2CYGA 2V17L 3OTTA 2PYFB 3ZTNH 1NDGB 1C8QA 1AXTH 1R47A 4PRIA 2J62A 2GFBA 3S6TA 4C57C 2IAMC 5I8EA 3OR7A 3NPSB 1NMCC 4KK5D 1YEFH 2R69H 4MJ6B 5HHQA 5A8NA 1EEZA 3ARDC 3RWJB 2YMXL 3QI9C 3GBMH 1BM3H 1DEEB 2OR9L 1WJ3A 1EEUA 2PTTB 3C8KB 2JJSC 2WUCL 3GMQB 3RL2B 4AEEA 3VXMD 1V3IA 3D2UD 1SY6H 3KNBB 1I1FA 3PHOA 1OAYH 1BEYL 1LD9B 3KLHC 2X9YA 3H0TA 4U1HA 1YZZA 2DIAA 1D6EB 1W2PA 5IKCA 1RZIA 5BW7C 5IQ7L 1LL7A 2XZQL 1AFVL 4JO2H 1IC1A 1DQDL 1INEL 3FZUD 4YC2C 4OKVB 1I9RL 1MVUA 4UBDD 3WKMH 2OQJB 3WO4B 3VI4E 5GGTA 2BNQA 2BZDA 2W0KA 3MU7A 3I50L 3LXAA 4QTIL 2CIIA 5HBBA 3BP7B 4KRPC 2HLFC 3H7BA 3OKYA 5E03A 2FO4A 1CVRA 4AW7A 5H94A 3STLA 3MPCA 1YEJL 5D71L 4O2EB 2RBLA 1N6UA 3OGCA 1VBUA 1NCTA 1HXYB 2GTWA 3CVIH 1U8IA 3ME0A 3RWGB 4P5KA 5EB8A 3SOBL 3ARGC 5BXFA 4GXVL 1E0XA 5JQHC 4QWWD 4XBEL 3C2AH 3RNQA 3M46A 2O5ZH 5BYWA 2E3VA 5E9DE 1CXKA 1AXTL 4JO1H 2ZPKH 5FUCE 5J89A 1Q9OB 4EXKA 4LGSB 4N8VA 3TWCL 1YEFL 3N04A 4J3SA 3PTKA 4PJFF 3ZJKA 1KELL 3FO2B 4EDXB 4L8CB 1GHSA 5FYJL 2HFTA 4ZUSA 2PYEA 3A0OA 4BK5A 2ZXAA 4YHLH 5BS0A 4JFSA 4WI3A 5C0IB 3TIEB 3V8OA 5KVFH 4LCUB 4LLVA 1ZHLB 5I77A 3EDKA 3QNXB 3L4ZA 4UT7H 3KLAB 1INQA 4UFKA 3ESUF 2A6JA 4J4PA 4KRUA 3O0RH 4P2QD 2ED7A 4WFFE 4MXVE 4C54A 1YN7A 3WH6A 4RWYH 5LGHH 4OLYH 2HT3D 5GGRB 4GRWF 4UDUA 5HVWA 1CD8A 5F7FA 2HTKC 5HDBF 1EO8L 5FV1L 2XWTB 2UY3A 4P2QA 1RIUL 4FQ2H 3GXMA 3HCVA 1TJHH 3PZTA 1IVLA 3SDAC 1ONQB 5E2TL 2JF6A 1KB5B 4BSJA 3DROB 3HR6A 5D1XC 4KGLA 4P7OA 4NQDB 1GC1C 1GJUA 2XG9A 5D96C 4HIHA 3M1BA 1T5WA 3CAFA 4PFEA 5GNYA 2X1QA 1CXIA 5DVKA 1AO7B 2CRMA 5DMKA 1E9LA 5GS2H 4I48B 4B7IA 4XB7A 4CMHB 4GQ9H 1Z6JT 4AIZB 3MA7A 1Y0LA 1SY6L 5BRQA 1TQCC 2DDQL 1BBJA 3ULUF 4HF5H 3MLTA 1Q94A 4UQCA 4JO3H 4GH7B 1ZT4A 5T33H 4PJ5D 2ICCA 1RULH 2X9WA 2Z0BA 3N0PB 5IQ7H 2ZCLH 1U8KB 4K3GA 2VQUA 2AKRB 4E2OA 2G5BB 3KS0H 4WRLA 4H1LA 4HXBL 1J86A 5HOSA 2QKIA 3KLAA 4BH8B 4PN2A 2R39A 2WWCA 1BPLB 4U1LB 3QEQB 3HI1B 1KG0B 1LO4L 4BFBD 2HVJB 3QDJB 4QHKJ 3ECBB 1K3ZA 4JR9L 1A6VH 4Z7VE 3ZKND 3PIQB 4BKLB 1W0YT 1LEIA 1P1ZB 4I1NB 1KIQB 5B4MC 1CU4L 1ZTXL 2MNUA 3GMPB 4YZFE 5SWSD 1WDPA 1UKOA 3EYQC 3VX1A 4P3DA 2NYYD 5J1AA 3R0MA 1S9XB 5DFTA 1E71M 1IM3A 1W9UA 5KS9A 1MCWM 1X5GA 3ARFB 4EDWL 5L6YL 1OSEA 5DUPH 5ADPL 1UZ6E 1SVCP 1QO3B 4NQDD 2Z8VC 5DJ8A 5IJKC 1I8IA 4IRJB 3GH4A 3ARQA 1IQDB 3LB6C 2UWEB 3N50A 4N90E 1A22B 4XPHH 3T77B 1NBYA 3QDAA 3A6CL 1EHNA 1FYTE 3PWJB 2A0LC 4R3SB 3ZJ6A 1OSZA 1XHGA 3LQMA 3ARWA 5I1EH 3BWAB 3F7VB 2DDQH 1RY7B 3QUKB 4C4KT 1GUVA 2HFEA 1RIHH 1MXDA 4HH9A 5EPMA 4UMGA 5FIPA 3LS4L 2PXYC 3ORJA 4K7PX 4L9LB 5JZ7C 3D3AA 5ACZA 3P4NB 1UYWL 2H1PL 4ZENA 4X8JB 2D7NA 1WF5A 1EAPB 4D9QD 1HWHB 4HJJH 4ISVB 5EU6A 1XGPB 5GPRA 2FECI 2BHUA 5I1JH 1W1VA 4BQ9A 2AMGA 5DMIL 2AXGB 5CP3H 5JPNA 2A9MH 1QO3A 3U9PL 5DHVA 3X3FH 4ONFH 3REWB 1X3DA 4AJ0A 3GGWB 4HUMB 5IT2L 3NIGF 5J9PA 1NGYA 4N1HB 5E7FA 1FLTX 3UTPE 1F3DJ 4ODWB 3DTXA 3RL1B 3GI9L 3C60C 3UR7A 5FCSH 3S98A 1ZHNA 3TBVB 1DUZA 4AEHL 2C26A 2P46B 2R2BA 4HGWA 3CSGA 4LSPL 4ZAKA 5DK2A 3EGSB 4MWFA 1D5IL 2KH2B 3INUL 2ZZUT 4KRLB 4OLVL 4GG6E 4OFYA 4UQBA 4GI8A 3BESR 4XNYL 4Y4HD 4GMTL 2A6KA 3BHBB 4UZUA 1CXLA 4N9OB 1CTOA 1QLEH 4HF5L 2AEIT 2YUVA 5JOEA 1AR1C 1TDQA 2V2WB 4YBLB 3RWCA 4FQJL 3S36X 3U5UA 3VJ6A 3SKNB 1RULL 1OP9A 2FIRT 5KVDH 3T2OA 1VJSA 1R46A 4YGVA 3EJQA 1WVZA 5KANG 1RVFL 4LNRB 1VIWA 3KG5A 3D0VB 5E2WL 1YPZE 3KLSA 3QRGH 5FECA 3JV5A 3TCLA 1A7BA 3VXRB 3ZE1F 5C0RL 2NXZB 3FFDA 3I2CL 4PRNB 4X7FC 2YDSA 5EZLA 3UYPA 2VTFA 4NC2B 1R3LA 5D7LB 3ROLA 1BVKA 4PJEB 1G7LB 3VXSD 1UR1A 5J12C 1AD9B 2G4FA 4QDMA 5TJWK 1E0OB 3F7RA 4YO0B 5GGRA 1KXVC 4R7DA 2FB4L 3AMLA 5DD0H 1Z2KA 3TN0C 2AK4E 4D3CH 3G08B 3K8KA 4JQIH 3EAKA 2AP2A 1U8QB 3LS5L 3ALWA 4MA3A 1OWWA 1N82A 4WUUE 4QXGL 1B0GB 4YE4L 5EORH 4NHCL 4P57A 3HMWH 2G41A 1UVQB 3JSSA 4TVPD 2ZG1A 5JMRA 4Z9KB 5BV7H 1QHZA 2DQJL 3Q5TA 4NNYB 2BY1A 1VB9A 3NA9H 4HD9A 2P43B 3QHTC 1BVZA 4TUKH 2X05A 1YEEH 3X3GL 1ND0A 4A6YH 3V5KA 1FGVH 5E1QA 1EO7A 2ADIA 3IXAA 4OUOA 1S5HA 2BSTB 1S8DB 1L4IA 5DRXB 2DWEA 4OBSA 2WP3O 1UM4L 4G3YL 4EUPG 1S9VA 2VXQL 3MS8A 3G6AB 1JYWA 4NXKA 2IBBA 3OX8B 2NY5C 5CBEB 3WN5B 3MOBH 1DSFH 4QYOB 3OHXB 2X10A 4UOW1 4F9PC 5IMLB 1KEML 1Q6EA 2OM5A 5E2WH 2IG2H 5LAXB 3PV6B 1KLUA 4XZWA 1GIGL 2EIEA 2EAEA 4JN2A 3O2LA 4I0PD 5IIEB 3MRRA 2F5AL 1NBYB 3IRZA 3C5ZB 3HNSL 3M17A 3MRQA 1WBXB 3BSZH 2WB5A 3MJ9L 4D94A 4WUKH 1HJUA 4JANB 3DRTB 4P2CG 5FHBH 1LNUA 3W0WE 3OGCB 1QNZL 4Y19E 5FV2A 5MEOA 4Y1AE 4XZUA 1JNNL 3QO0B 1A7RH 4R27A 3T04D 4URIA 3N85H 2WIIB 4ZUTA 1D5ZB 1KCVH 2HFGH 2UZXB 4E41A 5CD5C 4KKCD 1IMHC 1F6LL 2R56L 1NJ9A 1VEMA 3UBXG 4GMTH 4X9HA 5T3ZH 4UTAL 4CD6A 2HKFH 2DBLH 2Q8BL 3OHXA 2DDXA 4U5KA 3VG0L 1QFUL 4PEEA 1GHFH 4TRPL 1QLEL 4NZFA 1MI5A 1PPIA 2CIIB 5I1HL 3RVWC 4F33B 4ZPTA 3B3IB 3NGBC 4G80B 2NNAA 1CXEA 1I3GH 3G5VB 1E27A 5HVHB 4UQEA 5IB5B 3FQXA 5BVJA 3EHBD 5C0BE 4AZCA 4KZEL 1YPZA 2D7QA 3BSHA 3K4DA 2FHFA 3IDYB 1U3YA 3RIFK 4JY5L 3UCRA 3UBXI 5IFHL 1NAKH 1AMYA 4JHWL 2OL3A 4YUEH 4CJ0A 2ERJC 3WNOA 4JY6B 3DUSB 3HCVB 1PW3A 5EU5B 5SWZA 2HRLA 3EFDL 4PJCF 4L3EB 3QHMA 3QI9A 5B38A 1MLCB 4HLZH 1A3RH 1TQSA 5C0JA 4ORGB 3IF1A 5E4EB 1NEZB 1T7WA 3L5HA 5KW9H 5E2UH 5JW3H 2XFXB 5T1KB 2D7MA 1AO7E 1VFUA 3O8XD 5CSUA 4PJBA 1Q6GA 5JR1L 1EIBA 3L9RB 3TBYA 1D2KA 2I5YL 4LX4A 1UR9A 4PRIB 3OKEA 3I6GB 4PREA 4YDJB 1JL8A 4WWKC 1BFVL 1UH4A 4B9ZA 1RK0B 1A7RL 1ZLVH 2F8XC 3OMZA 1LEGA 1RJLB 5EN2A 4D6DA 2VCAA 1D6VL 3DX6B 1NM9A 5D7SL 2WIIA 3HRPA 4CDGC 1V7NL 3MUGA 1BLIA 4P8WA 2A1WL 1MJUH 1QFUH 2D7OA 3D9AL 1PEWA 3SE8H 2OK0L 1FAIH 4G3YH 2OMBA 2LU3A 3OB8A 4DGYL 1MLCA 3KR3L 4R90H 4Y4HA 3ARPA 1E3XA 4NJ9L 1F4YL 4P4KD 4LVHB 5C0JB 2P44B 5I1IL 4KK8D 3W81A 1FFOB 3BD3A 5HHNA 5A43C 3FTGB 5F9WB 4LOUD 4U7MA 1UA7A 3ZJ8A 2UY6A 4JHWH 3SDXF 3DX0A 2ADJB 3WS6A 1RK0A 2IFGA 5DC4B 1XGUA 2B1HL 2B20A 4OBRA 4F80A 1OVZA 1IEAA 1ISZA 1UHVA 4J3XA 1BQLL 4JL2A 4JHAL 2WMJA 2AEWA 1MCFA 4K94L 5E2UL 5JW3L 3SCMC 4W70A 4OCWL 4FOMA 3ZE2E 1F45A 2P5ED 4YHEA 1L7TH 1JMXA 4UNUA 1CLVA 1AGFB 1JUFB 4ESKA 3NABH 1JBJA 1J0JA 2R0KL 4KKLD 4XX6A 3N13A 5F8QC 4M7ZC 4WFGD 4JFWA 3CFBB 5T3ZL 3NFSL 1UG9A 4LEOB 1E3ZA 4EDXA 4ZFOL 3VG0H 3L4UA 3STZA 3I02A 5F3BB 4RDQG 6FABL 4FQLL 5I1DB 3T3ME 3ABZA 5BQ7B 3CFEA 1TJIL 3BN9D 1BGGA 5FGBC 2DM3A 1P2CA 5FYKE 3WKNA 3LXBA 1LL4A 2X4TA 3HLAA 4YNYA 3H42H 2R29L 3F7VA 5HGHA 3OR7B 5JIIA 1IEAB 4YDIL 1FO0A 5CHNB 2EYSB 4NJ9H 3MSPA 3CH8A 5T1MA 1B3JA 1YEHL 3UTTA 4JDTL 5DQ9B 5F71A 1N2RB 5F6HI 4ZUTB 1KLGA 5EFFA 2NMSA 4RRPA 2ESVE 1RU9H 3SJVB 3S88L 5BZDB 1EK3A 1WBYB 4OIFA 1PSKH 4XCFL 5CBEA 4XCNB 1DBKH 2CUIA 5IHSA 1SYSA 3H9SA 3UZVB 3QJHB 1HHJA 1K9TA 1H0GA 2LU7A 5KW9L 1QBAA 3BAIA 4OCXH 2OCFD 4RFEA 4KRTA 3QPQD 3HPLB 3RY5A 3JTSB 3JV0A 2JELL 2VLJD 1MW2A 2EE3A 3SDCD 3GDBA 1U8OB 4JZOB 2ZUTA 5B39A 4BFIB 1NANH 2XQYK 1MWAB 3TBTB 5DUBA 3SCTA 4YAQB 5FKAA 3B5HA 1U95B 1LO0L 3GUTA 3VFWA 2NY3D 3DHJA 2VAAA 2NCMA 2Y9RT 4KROB 1P4LB 1XGTA 5A2BA 4MSWB 5L2JA 5HPMA 4JG0L 3ROOA 3DI2B 5HVHC 3EOBA 4F9LA 2B0SH 1ZT4B 1KB5A 4J12A 2XFXA 3WIHA 4NM4L 3U7WL 2VDLL 5DD1L 3CUFA 4PJIE 1J8KA 2ZG2A 2X4UA 2CDEB 3UP1A 4D9QE 4CMMA 5HYQB 3PWVB 1LF1A 3HZVB 3I75B 1HNFA 3PTQA 4AT6A 2BCKB 5HNNA 4F7EB 1MPAH 3PZOA 1YEKH 1MW0A 4MCZB 3QXDA 4WO4C 1UM6H 4HC1L 4HGWB 2IANB 4GOSA 1VKXB 3DJ9A 4X6BA 1PSKL 1YMHB 1B30A 1B3YA 3N06B 3GRWH 1I9IL 3OKDA 1LDPH 5AEAA 2EZ0C 5EWIH 4EIGB 1UR8A 5KJRH 5DO8A 5E09A 3VXSA 1U95A 1MEXH 4ZNCD 5CBAA 1A14L 2J7FA 1ITBB 2D31A 2PYEE 1PGRB 3VJ6B 3UG4A 2W62A 2WC7A 3K0WA 2KKQA 4GAFB 4XNXL 4ZUSB 5IFJB 4UDUB 5ERWA 3UC0H 5T1KD 2ZWZA 1QSFE 2FGZA 1IILE 2ZUYA 1OP3K 5DVOA 3W9EB 5TPWL 3L3KA 3V4UL 4P2OB 5FGCE 1MYRA 4XX1G 1Y18B 3D5OF 7A3HA 4ZYKB 4Y1AB 3MBEA 4NO3A 4WI5A 1HJVA 3MGAA 4JG0H 4Y16C 5HD8C 4Q9BA 1G7PB 5FUCC 3U1SL 5L2KA 3CUHA 2FHCA 2APXA 3JWDH 3MRIB 2ZX5A 5DD1H 2GUOA 2ORBL 1XC6A 3ZKQD 3GJEA 2DJ4A 3HAEB 4JN2B 5MEPA 4D6CA 4NZDA 1GPFA 1MFEH 4ZUVA 1MPAL 4BQBA 1T7XA 3T0ED 2L7JA 1HQ4B 1A0QL 1FL6A 1MWOA 3CK0H 4G5ZL 1CFQB 2GSIB 3ZZ1A 4CJ1A 4KJQD 4GAJL 1ZVSB 2JEQA 3DRTA 2CETA 4DQOL 4GKZB 4PS4H 2BRRL 4RMQA 4HH9B 3WF0A 3CVHH 1E15A 1JHLL 1I1AA 2C9AA 1DQQB 1I1FB 3PHOB 3S35X 1J0YA 3EYSH 4KTYA 1WPCA 3H7BB 2PBGA 3DMMC 4GUPB 4MXVF 1ZS2A 1OB0A 3ZDYE 2D2OA 2HVJA 2NX5D 3U4EA 4CN6A 3SUVA 5D7IF 3RVUD 5IM7A 2YWYA 5ECUA 3ULSA 3KGRA 1NLDH 1QFOA 2GAZA 4Y4FB 4HX1A 1WFUA 4PP2B 1O6IA 1MLBA 3U46A 2OI9B 2DEPA 4U2YA 3JWDC 2HTLC 3WD1A 1QFPA 5H35B 3WFZA 1LQSR 3O45A 1GGCH 2HJLA 1R3HB 1U8NB 5JIWA 4W4NA 1KXVA 1UD3A 1FORH 2J5LB 4B41A 1GOHA 4POZC 4BKLA 4PJ7F 1TA3A 1ZHKA 1BGXH 3B9VA 5T3XD 3D69B 3ZDXF 3UERA 2X0YA 4QHNB 2XTJE 5D2LA 3B83A 3PGCB 4YXLH 1P4LA 2GJPA 1KPUA 4MA8L 5F7UA 3PJSB 4LCCA 3TVMD 5HPMB 1FL6B 1MFAH 4UBDC 3KYOB 4NFCA 4L4PA 5EOQL 1MCPL 2AJXH 4F58L 2Z8SA 3FOLB 1W2VA 4LLWA 4NO5A 3EYSL 4PMZA 4OF6A 4AT6B 3QDMA 1U91A 4JFZH 3TCLB 3VXRA 1A7OL 2F54D 4DWSC 3EO0B 2EIDA 3X17A 4F9PA 1NCAL 1OAUH 5KSBE 1Z9OA 2YD5A 3APGA 4X6CE 4XHQA 3BAEH 1UUQA 1VEPA 3HG1A 3D69A 2J75A 3U0PB 5CGMA 1BQSA 2LVEA 1VPOH 3NTCL 3NPSC 4FFWC 4RFNC 1RHFA 5E70A 4KXZH 1UH3A 3CUIA 5EZIL 3DIFA 5A2KH 1B9ZA 1BIIB 2X4OA 2YKLL 3EOBB 3DSNA 5J12B 2DWDA 3BX7C 4XNMB 4KMTH 4L4VB 1I1YB 1MCJA 4TNWK 2CXGA 1E5JA 4ZE4A 5C0AA 3WV0A 2VURA 5DYOA 1U42A 3GNRA 1LK3H 3LRLA 2YL8A 2IJ0C 4XNQB 1T3FB 1JGLL 5I1DA 5F70A 4HXAH 1MHPH 3X12A 1MCPH 2AJXL 3DVFA 3DX3A 1ZLWH 4LMQI 1RMFL 1U6AH 4KHTH 4KKAD 4P2OC 2V9QA 5I73C 3CPLB 1KGCD 4YBQC 1KXQA 4GAYB 4QRSB 3VSTA 2OTUA 2WANA 4OQTL 3VMOA 4EOWL 1U8MB 4QRTA 2DMBA 5IB1A 3CFEB 3VH8G 4UOJA 4MTVA 2GFBB 2HKHH 4NQCD 2DQGL 5GISL 2J7GA 1V05A 3EYUH 4L4VA 5IVOA 1QI5A 1VAHA 3B6SB 1BFOA 3VI3E 5I23A 1CICB 5JXED 5F96H 3SCWA 3TJEL 1YMMB 4XWGH 4HLZG 2EEBA 3H7LA 3QUYD 4OZFB 3BP7A 1H11A 2IFFH 4Y89A 2E4TA 1VPOL 4XNQA 3MJGX 1Q6DA 1J8HD 1XR8A 4OTXH 1J8HE 4ORZC 5BROA 1FNEB 2EXWC 1QSZA 2BVQB 3MLYH 3DVNA 3D25B 4DM2A 3JUGA 3BIAX 5M5DA 5IB4A 1OIMA 1KIPB 4JRWA 4XNMA 1J9YA 4OKVA 4FMKA 1LE9B 2C4FT 3H53A 4Q6IA 2G9HB 4NP4L 3QFJA 3TM6A 5TDPB 3STZB 1V7ML 3OLDA 3GXIA 1Q9WB 3MNVB 3VFMA 2NXYC 3W29A 3QOKA 2AJVL 1BEYH 3ZHKA 5I1AB 4PTTA 4W8AA 5CQ1A 3I6GA 3OAUL 3TIDA 3OZPA 3LY6A 1IEBB 4B3KA 4YHNB 1T03L 4CL7A 1DQDH 4S1RH 1A7OH 2LVCA 1YNKL 5FGSA 2Q76A 2O5YL 1W0WB 2DF3A 3G5YA 5ESAB 4JL1A 4EOWH 3AXLA 4RGNE 3CPLA 5HHQB 3CH1A 5D8JH 4GLRI 4MNHB 3NCCB 1KENL 3TO4A 4QRRD 3NCYP 4KDWA 4WI9A 2GSGA 2CKBB 3D85D 3KYMA 1S9KC 3R8BB 5D96B 1TCMA 3PG2A 2ARJQ 3TV8A 3NCEB 3KNBA 3CD4A 4OSUL 3OKEB 3V6BR 1MF2L 1FFNA 5A94A 1EJOL 5A6MA 1T89C 3VA6A 4JQVC 2X4UB 3Q6FB 3PHQB 3HE7B 4KMTL 3QJFB 4L8SB 2XQBL 4LBEA 4Y19A 2WC3A 2DQTH 3W11C 1S7UA 5E7BA 4GRMB 1OAXL 4HGMA 4JGMA 4S1DD 4NQDA 5IBLC 3BPNB 5JIPA 1QNQA 4H88H 3AVEA 1VKXA 1W0WA 1Z0MA 3G5YB 4PJDB 3RVVD 5C7XL 2JIEA 2E40A 4LLUA 2G3IA 3FFDB 2YD2A 1N26A 4JFXA 1YPZB 4PYGA 3QFJB 3AYRA 1HHKA 2CR6A 1RMFH 5L88L 4MDIA 4HUVA 3BUPA 1Q9WA 4QWWC 2UY7A 4HAGA 2ICEA 4XCEB 5H37G 3RUGF 3WEZA 1I7RA 3MFFA 1EFXD 1NC4D 2F58L 5EBLB 3RBGA 3RHWK 2HKHL 1F02I 1KPVB 1H3XA 3EYUL 1WSST 5FA3A 1IT9H 4N0CD 5D8JL 5JIHA 3P73B 1MNUH 1KENH 5EFIA 1RIUH 1RK1B 3CX2A 4F8QA 1EFXA 3PQYA 4CNIB 1QVOB 1T66D 4ODVL 3U7YH 3QEUB 4AZ6A 5JDJA 3RILA 2EXOA 3FOMA 4OF5A 3D4ZA 4FF5A 1RZKH 3BPLC 4XXCA 1FZKB 5FOJA 1HHIA 2WZEA 2A83B 3VG9C 2FX7H 4R5EA 1IRAY 3MLYL 4UIKL 5DVNA 5B8CB 2X2IA 1K6QH 2VXTH 2ICWA 2OTUB 1F6FB 3ZDZF 4WKHA 1A1NB 3MODH 4IMLA 4X6EB 4V2BA 5F7YC 5HHPB 1Z5LB 3O3AA 5IQ9A 5DRWB 2DTSA 1J10A 4YHYB 4YHPA 4NNYA 2J4WL 3QDME 3WD4A 2WUBL 3OAYH 1IZJA 4GO9A 1V0LA 4UOZA 3ZDXE 5F7KC 3UESA 4WW2B 4XGZB 2Q87A 4ZXOA 3WUBA 4YX2H 1AY1L 3BDYL 1R3JA 4AD4A 3BVNB 4QYOA 4P3DB 1CGUA 3CNKA 1FH9A 2A3EA 1R3KA 1MY7A 4CU8A 4R26H 5HJ3A 4JFYB 2AQ2A 2NPLX 4Z2GA 1NLBL 3LSOB 3QDGE 1WDQA 1A6VL 1L0XA 2KQMA 2WKLA 2ATPA 4X6FB 4M61A 1N3NA 1B0GA 4PMUA 4OF0A 5HHNB 2VZ3A 1UKPA 3OJDA 3U2SA 1UVQA 1G9HA 1A6ZB 3BZEB 1GVYA 3K7UA 3V4VH 1AQMA 4AM0A 3VX0A 2X1XR 1V3JA 1NKOA 5LJYH 1MQKH 3ARUA 3MACH 3FT2A 2D4DA 2OP4L 1BYCA 1UJ3A 2VXTL 3QIUB 1U91B 3QDMB 1DQLL 2KQNA 1S7RB 3ARTA 3U6RA 1WCGA 1BG4A 5A6JA 4JKKA 4BSWB 4P8XA 2ZSWA 1JPTH 5CJQL 2HP4A 2A3BA 4P46D 2J8UE 3IANA 2KZWA 5JNYA 3SKJH 4XC3L 2XACC 3V6OE 2YPKA 1SJEB 5AWNH 5FYLL 1S7WA 1KBGL 3HZYA 5DEZA 5L88H 3HB3C 4U0RC 2HISA 2ZWLT 4ODUA 4UTFA 2H1PH 3VDBA 2VLRA 3GYCA 5K59F 1SYSB 1GW1A 4WI4A 32C2B 4PUEA 3RU8L 3WO3B 4HKJA 3W26A 4Q0XL 5DD3H 2DSWA 4R4ND 2MQ0A 3GSQA 5D8WA 4I0PA 3RFZC 5C09B 4AY0A 1O7VA 5SWZB 1MCKA 4FXLA 4P2YA 2YSSB 3RWDA 3RIFF 1UR0A 5E99H 5T1MB 1K8IA 1T20A 1X5IA 1MFUA 4AZ8A 3HE7C 1ZS8A 3WL0A 4KRMB 3WUWB 3NFPB 4I77H 3IT8D 1H9VA 2QQKH 5A6LA 3SIMA 3TA3D 1P84K 4NHUA 4CVZA 1FNHA 3RI5K 2E7BA 1H0DB 3AC0A 5H94B 1TZIA 3EJYD 1E4XH 4I3RL 3ULVE 4NRXA 3QXUA 1I85C 1QFWM 1MI5D 3TH3T 4HPYH 3UYOD 2F19H 4U1IA 1I4FA 4KKBD 4OGXH 1XGTB 1E0VA 1DUZB 1TE1A 4DKAA 3IETA 4G6KL 2AXFB 1MELA 4RAVA 4GMSL 3THCA 3BP6A 5TQ0H 5ABGA 1CE1H 5IG7B 3P4OB 3I2CH 4MMXC 3MV11 4OOZA 2R23B 3MO4A 4PJBF 2AXGA 4O9HL 5T3XH 2M8XA 1IQDA 3OKKA 2DSZA 1P5UA 1UQSA 4YHPB 1AHWB 1FNFA 3DV6B 1UKQA 3MRPA 3PQYD 2F1BA 1TQCB 3H3PH 4EJ1C 4NN7C 4RAUA 5KSUA 1BFOB 5E2TH 2FB4H 2GITB 3QXWA 4TVPH 4TYUA 5HHXL 2CR3A 3AHXA 3ZKSD 3VU2A 4JCMA 1C91A 3G9AB 5DT1H 2NXZD 4YFLF 5J57B 5LA2A 2OJEA 4Y5VC 4YK4C 4CKQA 1EDTA 3WSQH 4DTGH 4KXZI 4LLMA