1TCMA

Cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 201
structure length 686
sequence length 686
chains with identical sequence B
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tcmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tcmA01
1GL4B 3LS4H 3LIZH 3HRZB 3IDMA 1WBYA 3AROA 5EC2B 2GKIA 2ZSWB 4PJDF 3QIUB 1BOGB 2D31B 2XPGA 4CMHC 5ICXB 1IAIH 3TA3C 3BP7B 4K3EL 4OFKA 4DKAA 3VFVA 1N82A 3VRIB 1OTUC 4XNZC 3RTQA 1I85C 4LLWB 1AR2A 4JANB 1BHGA 5IB1B 1HWGB 1INEH 2EDNA 1RZIA 2RCSH 4NUJA 4FFVC 1XZ0A 2YUXA 1XGYL 3AAZB 4NZCA 2FJHB 3DVNA 2ZCHH 1UM4H 1KIRB 4RGMB 3KR3H 4PTXA 1T20A 3V6ZA 3E8UH 2Y6SC 1R6VA 3EJSA 3RJXA 5KG9A 3SGEH 2GAZB 2BNUB 1KTKE 5I1GH 4HH9B 1WO2A 5KEZA 1DQQB 1WAWA 1JNJA 4JO2H 4XB7A 4MQTB 1EEZA 2YKLL 1Y6KR 2COQA 4JZJC 1WZ1H 1T4KA 1X5JA 4MJID 5KANG 5DQJB 4U6VL 4ZXOA 3FRUA 5DK0A 5CHNA 5J56B 4JFPB 1CXIA 1I9IH 3FFCD 4HZ6A 1XIWA 4HHAA 5HJ3A 1S78D 3PE9A 3PIQA 4ELKB 1E1FA 2WINB 4P5MA 1BGXL 1OM3H 1ZTXL 2OL3B 3MLRH 3C9NB 1NCTA 3QG6B 2DH3A 2CBIA 3PZTA 2VDRL 1I8KB 2M8XA 2XUCA 2VCBA 3MA9L 4ZO8A 3MJ7A 2J6EH 4PYGA 5E9DD 4AMWA 2ZG1A 1KLGA 2XYCA 3RKPA 5TE6L 1BM3L 1QSVA 3O6MH 1ZU8A 2WWCA 2XT1B 4V1DD 4FP8H 4U05A 3ZDZF 1E27B 1AC6A 5ECUA 3CVHA 3H9ZA 1IGCL 3VCLA 4XX1G 4AK1A 1WBZA 1UKQA 5DT5A 3T2OA 5AG9A 3O4LE 3DBXB 4I2XE 1V7MH 1LEKB 1I8LA 1YDPB 2R0KL 4M4PA 1O7DC 3PTKA 3O3EB 1CT8A 1OP3H 1JZ6A 1A7QH 4GAYB 4Y19E 1ZMYA 5I17A 4Y5XC 1H3GA 3MRDA 5FA3B 3VRJA 4ACPA 5FM5M 1ZJAA 3N18A 1QRNE 4FQLL 4NZJA 2D73A 5F6HJ 4ONHB 4OF0A 5IW6B 2ZWYA 4NRSA 5DMGD 3L7EA 4ZO6A 2AGJL 4L8CA 1NOUA 2R1YA 5ERWB 5DGQA 3QP3A 4JRXD 1HL9A 1R3KA 4E41A 7A3HA 1BQLH 1MRFL 1R3JA 5LCVH 3L2LA 2A3EA 2PYEB 3M1BA 3T65B 3D2UA 2XOTA 3BH9B 4OGAC 4IRJD 3KPRE 4HS8H 5ID1B 4KMTH 1BD2E 3CPLA 3ULVE 4LCWE 4KKLD 4X8XA 1KFWA 1LG2A 5C0AA 1BVLB 5C0ND 5CGTA 2JB5L 2AJYL 1SBSH 3RQ3A 4HCRL 2AEQH 5LKNA 4OV5A 2BVQB 4M7JL 1MJUL 4LP4A 5F89A 1T04A 4MNHB 2DLGA 3P4LA 3BH8B 43CAA 5D8WA 5KSAA 3TO2B 2ZUYA 5ETUB 2ED8A 3BD3A 4FABH 5IHRA 4OLUL 3GI9L 4LVEA 4X6BB 1CD1A 2VB5A 1QNZH 2A3AA 5HYSA 3LQZA 5HYJA 2H9GB 2AV7A 5C0FB 2W0FA 1PPIA 5L8LB 4PMRA 4G7VH 3UPRA 4BH7A 1Y6NR 2EECA 4YZFE 2ADJA 5C0IB 5SWSD 1FPTH 2Q3ZA 4BFBD 4CJ0A 1LO5B 4KXZH 1JNLH 1MCNA 1E4XL 4X7DC 3WQ8A 1XMWA 2X2YA 3HI6H 5FK9A 4OCWH 2X44D 4F7PA 4S2SA 5E24E 4L29B 4NYLB 5BO1H 1E0OB 1GCYA 3LN4A 1I7RB 2CKNA 1S7SA 4PJIA 3QXUA 4ZUUA 5JDSA 1E3ZA 3PGFH 2HH0H 1K3IA 1YZZA 5JBEA 3O6FD 4JFSA 5DYOB 4KVCH 4QXTB 1HKJA 5GJSL 2PR4H 3QHZL 2OWWA 2PXYA 3V79C 3FQNA 2UZYB 2IBGA 1J01A 3RY5A 5FECB 3IFPB 1DTUA 1QFHA 3V7AG 4X98A 2PO6C 2XZAH 4ONFH 4JAMB 2R0WH 5C0JA 2LFGA 1FE8L 4Y19D 2DSKA 1NH6A 5EOTB 4APQD 4DVBB 2WBJD 1NDMB 2Z1SA 1P5VA 4O2CB 1QRND 3C5ZA 4HV8A 2MWCA 3VGEA 1JMZA 1FLTX 4G6FB 3TZVD 2D3LA 3HPJB 5F96H 3CMJA 4R6UA 3PTMA 3DRQA 4GRMB 1XGPA 1FVEA 2BHUA 2GSGA 1RFDH 3MRLB 1MVUA 3HZVA 3I50L 4LPXA 1F4YH 1GGUA 3OSKA 5IVXA 1CU4L 3X14B 3GMLB 1ROWA 2VMFA 3GXNA 1YEEH 1OQOA 1ZWIA 3NMEA 3OXRA 1VADB 5AEAA 4OIIH 3DETC 4GKZB 4X6CB 1XGRB 2XSAA 1VFAA 3QQ9C 1AE6H 2W62A 1T2QH 3BCDA 1G7HB 2NLJA 1S7TB 3TNMA 2WC4A 3ZYOA 1K8IA 4LHJB 4XXDB 1QX1A 4XTRD 4ODTL 4AL8L 4YHNA 3LMYA 5I1DB 5TGBA 4YHPA 2EDRA 1U8KA 3HE6C 4HBCL 5IMOA 4D9QD 1N5YH 2Z35B 2XN9B 3VFPB 1FAIH 4W7UA 3GXFA 3OXSA 4B41A 1NMAL 3S5YA 3THML 4ZS6D 3VX0A 3CZFB 4EDXB 1BAFH 3WKNA 4GRLD 4F8QA 3IJHA 5AY7A 4J4PA 4NQED 3C08H 1K8DB 1D5MB 2DIEA 4OZHB 5L7XH 4NCC2 1KCRH 4JHWH 2UY3A 4P46C 1RUMH 4GRWE 3AICA 4M5YL 1HXJA 2VDPL 1KACB 1ZHLA 3T0XA 5A2AA 1AQDA 2W5FA 1TXKA 1V6UA 4AT6B 5C86A 4M8QA 3R0MA 3UYPA 2LVEA 3V0VA 4OD1L 1UEMA 4YDVA 4XPAL 4JZNA 1HXYB 4I3GA 3LS5L 4NNXA 1TDQA 1GAFL 3PZOA 3L3OA 1C5CL 5DHYA 3FO0L 4PJFE 5HY9A 1V0KA 4U5KA 1Z9MA 1LO2L 2VN7A 1UG9A 3QXDB 1RIHH 3WN5A 4ZXBA 1IEHA 5D71H 4A3YA 5FA4A 2BRRH 4X80L 5D6CA 3D5OF 3QUXC 1NCUA 3WLBB 4Y16C 1G7QA 4I9WE 1CGTA 4P4KC 2EACA 4CMMB 2UYLB 4KROD 2VLLA 1VACB 2H26A 4NZTL 3UTSE 4HPGA 3DUSB 2P49B 3LHPH 5D7JD 3WDRA 5HOSA 4MVBD 5DT1H 3SE8H 2ENSA 4TVCA 3ARDA 4JFDA 4MXWL 2BNRE 1UXSA 2HP4A 1FIGL 1WWWX 5FYLD 1GIGL 4QHMB 4BFGA 4U6YB 3P4OA 1T1XA 3VD9A 3W5MA 5A6MA 4X8JB 1YEJL 3H9SE 1A1MA 3WEXA 2E7LC 5DMKB 1FNFA 1SJEB 2OR8A 3PL6B 4H20L 4ZUSB 1UQSB 2EYTA 1JWSB 4FG6C 2ZCKL 3FQWB 3O0RH 3GSOA 3V6OA 2Y4SA 1TVPA 3MJ8A 4WTXA 1KEGL 2VX4A 5LJYH 1E6NA 2X10A 4ZD3L 3NFSH 3D3VD 1A3LL 4P2YA 2DLTA 3S88H 2V2TA 4WJXA 5GGTH 5J13B 3FQRA 4NJ9L 2BFVL 1ESWA 3HC3H 3J7HA 4YAQB 4YQXH 4RWYH 4X5XB 4QHLA 3ZDYE 2G3NA 5LBSL 2D7PA 1FJ1A 3MFGB 3S37H 4UDTB 1LNUA 1D9KD 4FXGA 3FY1A 3LD8B 2X4RB 2B1AL 5CILL 5GRXG 3WUFA 2JB6B 1V3IA 4L8DB 1QR1B 3WHXB 1AHWB 1E0WA 3KLHC 4Z7OF 2YPVH 1NKRA 2QQLH 4F2MA 1G7MA 1WV7T 2R2HB 4PRBB 4Z2JA 1VENA 4XNUH 3H0TB 5J4MA 12E8L 3PV6A 1ZBVA 2DICA 3AU1B 4R90L 3STLB 3RRQA 5BJTB 1R87A 4YFLI 1R5VB 1WIPA 3TH4T 1NPUA 5A8NA 4PJHA 3TONA 4TNWK 4ODHL 2EH7L 3AVEA 3GSNL 5TQ2L 4LASL 1UM6L 1FRGH 2R9HC 5DD0H 3G5ZB 5HHME 3F12B 4K7PH 5DR5H 1JGVL 3PWUA 4XB8A 3UDWA 4M1CD 5KVFL 1MCLA 4RIRB 4H0HB 1ED3A 3D87B 5IIEB 3ARFB 5JO5B 3TT1L 2XICA 4PY7A 2K7QA 4X9GA 1EHAA 5C0BD 5JLZA 1OBAA 3GH7A 1HKKA 3U4AA 1OSZA 1REIA 1CICA 3RDTC 3VXRD 5JPNA 5IG7B 3LPWA 3LKNB 4RQQB 5HYQA 2P5EA 4G9FE 4PUDA 2BJMH 2WBKA 4MADA 5HYSG 3GSXA 1YEHH 2X1IA 3FB8B 4ODSH 3CMGA 3EFDL 1GSMA 1JTTA 3RL1B 2APVA 4DN4H 4WFGE 1KPUA 1WP6A 1C5BH 3E0GA 2EE3A 5D9PA 2Y07L 2MFNA 7FABL 3B9EA 5DEFA 4TUFA 3ARBC 3U0TA 1T80A 3EO1B 3OGSA 5IFPA 3K81A 2HFFA 1ZS8A 2WAHA 4LSPH 1JGDA 1QSFE 2AJZB 4MNGB 5HD8D 3BZEA 1WB0A 4XMKL 1OGAE 4L3EA 5CJOH 2BK8A 4B7IA 1ZT1B 2HLFD 5FYKU 1S9VB 2PCPA 3RM4A 1GJWA 4HGWA 2DS4A 1WWCA 3MRGA 1R46A 3SUVA 1JPGB 1U95B 3P4NA 1W2VA 1GOOA 4XVTL 2F58L 4WGVB 4JG0L 4MDIB 4Y1AD 4HIXH 3EIFA 4OLZL 2X1OA 4I0PB 4HUXA 1T1YB 2RCSL 3P73A 4M93B 4DWSC 2OTUA 3LXBA 3T4AA 3BIBX 4PTUB 5C3TA 3IKKA 3VFUB 1UM4L 1OSPL 4HLZH 3F7VA 5BRQA 3KJ4B 2MCPL 1CR9L 3E8UL 3BKCL 4PD4K 1HHGB 3ZJKA 1AXTH 5IEKA 2F5BH 3MRJA 1PZUB 1CXFA 2GHWB 2LABA 4HJGA 5I1GL 4A6YA 2CDFB 1EEYB 4OCSH 4UAOB 1HH9B 4YXHH 5EO9A 3HZMB 4GXUM 3OZ9L 43C9A 4OGXL 2WQ8A 3WV0A 3O45B 4RA0C 4X7EC 3SDYL 4ETQA 5HVWA 1DANT 5HHMD 1FFPA 2D0GA 4JB9L 3C60A 3CFBB 5HI4C 4W4NA 1S9XA 2PYFA 1EGZA 3B8SA 4QTHB 3B5HA 3MOQA 1Q9LB 4O5LH 3SDDD 4JRYB 35C8L 1MCKA 1SM3L 3QIBA 1NCDL 2QR0A 4LPTA 1L7IL 2EEDA 1NGQH 1KTRL 5D7LE 5DJ8B 4F58L 3QUKA 3U48A 1UH2A 2J6EL 1CBVL 1DL7L 4NCC1 4BQ4A 2VZ1A 2N7AA 4Q58C 2VAAA 1KEMH 3AS3A 1KTLA 3MRNA 4YN5A 1NLBH 4O51A 5CBEA 3UG3A 4AMXA 2W0KA 5H2BB 5J89A 3SUWA 3CUFA 1INDH 2AJXL 3O81A 2DKUA 1LDSA 2VIRA 2WVVA 5I9QC 3QO0B 4G6ML 2D22A 4H04A 4K7PY 3L3KA 3Q0HA 1P84J 1CGSH 2Y1VA 3RFZC 4EKJA 3UJIL 3GMOB 4AZCB 5F1NB 4OLYH 3WDHA 3VIJA 4PIRF 5T5NG 5EBWB 2AJVH 5F8QC 4DKDC 3K2UL 3WN6A 4KY1L 4YR6A 1E1EA 1DR9A 4QWWC 1D2KA 5E2UH 3LKSB 1E5NA 3QO1A 4M1GL 1A7PH 4NP4H 5GS1A 2V3DA 4P5TD 3EGSB 5LCVL 5K9KA 3KAAA 1QBLH 3I6KA 3U30C 4CU7A 1IKNC 2IGFL 1JXKA 1N0XH 1S7QA 1TQCB 2K7PA 4HS8L 3SKMB 1I7TB 3CDGB 1BEYH 1S7UA 2NY3C 5SX4I 5CEXB 1C16B 2HVJB 1XH0A 3WELA 5D2LF 2EXWC 4JM2F 3NTCH 4Y2DB 3FOLA 2EJ1A 1V0MA 2X9YA 5B8CB 3FO2B 4ISVA 4ZEPA 3BXNB 4PMVA 3VTRA 1DBKL 3FFCA 4Z7NE 1N26A 3VPLA 1EOKA 3QWQB 5T1KB 2DQEH 1A8JH 5I8KL 5CGMA 4U1GC 1RVFL 2Z91A 3VSTA 2GFTA 2ID5A 1NFDB 1LJYA 3BP4B 1W9BM 3RVTD 5FO9A 4HKZA 3U0WL 3BH4A 1U36A 4JFEB 3LN5A 5E9DA 2D7TL 2G75B 5AC5A 2EYSB 4PRNA 5ABFB 4I18A 4UIKL 3AFLA 3MXWL 2WMHA 3H9YA 5E56A 1MHPH 3GBML 4JFFE 3W5NA 1BG9A 1J8HE 2ICEA 4N0UB 5BO1L 2VXUH 4HT1H 3GXPA 4WKFA 1PYWA 4OZIA 1AKJB 4K9EC 4PRPB 4OD3L 4X9FA 3KLAB 3TYFA 3VXSB 4FQJH 2IADA 2H2SD 1N6QL 2XWBB 4JFWA 4LLDB 5DJYB 2YD8A 3PDOB 4HK0B 3KHOA 4E0RB 4KTEL 2C4FU 3T0EC 3EYOA 4LRNH 4MHHG 4PGDA 2BVPB 4XXCA 4CVXB 3AREB 2Z8VC 5C0GA 2DF3A 4CBPA 3TV8A 4PG9A 1CZ1A 2FJFB 1OTSD 3GBLA 2BY2A 2YKKA 3U2SB 1K9FA 3BUYB 4U1MB 5FFLA 2DQUL 2N1KA 5IFAH 2VLKB 4GMTL 3VGAB 1JFXA 1INQA 4MDOA 3MPCA 4XMLH 5BVPH 3MNVA 3V5HB 2C3GA 1YEIH 5IESH 4I77H 3ULVL 3W81A 3ZKXC 3D85B 3VMOA 1FLRL 1MY5A 1T83C 4IS6B 2OTWA 3GK8L 2YD3A 1JNHA 4L8SC 1L0YA 3K46A 5F9WC 2E9IA 5DC0A 4OIFA 1YEEL 4I3SH 4GT7A 4WENB 2V7HA 5TPWL 1T03H 2ZOKA 1G1CA 5B39A 3MMUA 2R1XB 1JF1B 3JBG7 5HHNA 1G9HA 1LWHA 3HI5H 5EOCH 4MCYB 2WKGA 4G6KH 1VPOH 3QNYB 3EOTH 5F9OH 1ZOXA 2ZUWA 3SKNB 4C56E 3OJVC 5SWSA 4IHOA 4NRYA 5DWUL 1PIFA 2Y8VA 2F54B 3AIWA 1N5YL 3DX6A 4DZBB 1I1FB 3RGVB 2FEEL 4PJ5A 4KHXH 3WE6A 4J3OC 2CERA 3G08B 3I3BA 3RZWA 1UJTA 2FB4L 2NY7L 2VLRE 4KKBD 2EZ0D 2F9BT 1FL3A 1UD3A 1X5IA 2Q8BL 4HKBB 2KL6A 4H1LA 5LGJB 1HINL 4YHLH 4GAGH 3DGGA 4JHWL 1M01A 1RUML 5F7LB 3UJTH 3SCQA 2O9OA 2YZ1A 3CHEA 4Q9QL 1LEGA 3O6FA 3QXAB 4LU5H 4OLWL 5FHAL 2NY6B 4FFYL 3OKDA 4WRLA 1FFOB 5AUMA 1AP2B 2YEZB 1TZHB 3BJ91 4G6FD 4LKCB 2V2WB 4L4VE 3RI5F 5T3XE 1UD2A 4JRWA 5JW5A 1E6OL 2E7BA 1GC1C 3JXAA 2Q86A 3G5VA 4XCNA 5MEOA 5IVXF 5CZVH 5JNYA 3DX9B 3H3PH 5HHPA 1WUNT 1ECEA 4ZPTA 3WF4A 4WCYH 4PV9B 5DJ0B 4AD1A 5FO7A 1XCTA 1IAKB 5DEGA 5D71L 4Y0GA 3POCA 1MIMH 2Z4QB 5F9JA 3RUGE 4P2QE 1DANU 1XR8A 1DFBL 2FATH 2CIPA 2F1AA 2A6JB 3MODH 4EI5D 2I9TB 4U1NB 1QZ1A 1FVDA 3JV6B 2G3MA 3QUMA 4DM1A 3VI3F 1I7UA 2C5DC 3O11B 2VCCA 3BZ4A 5DK2A 3WQ4A 5DFTA 4PV8B 3A24A 2CBJA 3O4LB 4XHJD 1NWRA 2XN9D 4EIGB 1MFDH 2VITB 1KCVL 5HVFB 3CH1A 3WQ5A 2UUDK 1Z3GH 2W65B 4ERSH 2CMRH 3V4VL 3O0RL 4J28A 4Z76A 4S1SH 4JREB 2IAMB 3F5JA 3RWGA 4Z5RA 2CBVA 4KJQC 3DURA 5F7HA 3T3MF 1YC8A 4FOMA 5GGTL 2WWMC 3TJHC 3A5VA 4Y4KD 4GRLA 4M1DL 1W9XA 3E3QC 3HC3L 3TBVB 4QRSA 5D8JH 3RWEB 5GS2H 4OD2B 4YHZH 4NQXB 2Q7YA 4MCZA 3GMQA 4N0CC 4BFIB 3QDMB 1IGTA 5FF6B 1MAJA 5IMMB 2D2OA 5T3ZH 2Q6WB 4WLCA 3ZE0E 4X9YA 3W25A 4FQ1L 5A69A 1AGEB 3F4VA 4GKNB 3V6BR 4RE4A 2DD8L 1YEKH 4J2XA 2G41A 3WXWH 4HA3A 4LF3B 1B2YA 4LGXA 4W86A 2XWJA 1N4XH 2VDOL 4NKIL 5DFVC 1MRCH 2BOCB 5DR5L 1EJ6A 2VDQL 3HS0B 3IGAA 1A7RH 3OGRA 4D0CB 2Z93A 2HRPH 4GW1B 4WV1B 3EJTA 2YA1A 1Q0XL 5AZEH 3OGVA 1KOAA 3BJLA 4XP6L 4BKLB 2OSLA 4P7LA 3QR2A 5D7JA 1CLZH 3OKEB 5AYQA 1VBUA 1HVXA 1TNMA 4M81A 3GHEH 3TYGH 5A94A 1TITA 1ZVSB 1YN6B 3EYVB 3BEVA 3IFOB 4PMOA 1TZIB 4H5SA 3VXPA 5KVEL 4WW1B 1I8IB 5KVGH 3HCVA 4CCCA 1ZBCA 1YEDA 1UR0A 4RAUA 1JZ8A 1C08A 3B9VA 4POZC 4GQQA 3DGCR 2WMIA 1CL7H 4PJBE 3MRCB 1XIWC 1BVZA 5IW1B 3U7YL 1E6JH 5D93C 3K8MA 4WU7A 1D5ZB 5EIIA 3D3VA 2RHEA 3QDJB 4EXKA 1BZ7B 3H54A 4IOSD 3P4MB 2QKIA 2P8MA 4AENB 1NUGA 3IJYB 2O26U 5I1KL 4U1IA 2FLBT 4PJHF 4PREA 4F7CB 1QA9A 2WM0A 5E00A 4M9PA 3SEPA 4HIXL 4F15B 5EFDA 4OF7A 5F6HI 1PW3A 4ELMB 3HRPA 1I8LC 1O7AA 1J05A 1OQXA 1T7YA 4PJGE 4OUUB 4Y4FA 2XHYA 1QPPA 4RZCA 2Q1EA 4CMHB 1RMFH 3MGTA 4OZGF 4U1KB 3W26A 1LK2A 3TA3B 4YXKH 5DS8B 1PGRB 4KK9D 4XPHL 4S0SD 2NR6D 2OZ4A 1SVCP 1CE6B 3O3DB 4UFHA 4PJEB 1M7IB 1ISXA 4OCSL 1TETL 4LGSB 5GSRB 3LOWA 3RY6A 5IJKA 4KFZC 3Q6FA 1FCGA 5L6YL 1HHHB 3JWDC 1FG2B 3FQTA 3GBNH 3PWVA 2PWEA 3WS6C 4Y4HC 3EZ8A 2VLJD 5C0BA 4BQ3A 3VG0L 5TH2A 5ITBL 5GS3A 3P0YL 4HUUA 3VXRA 5B39G 4O5LL 3UTQA 2UVEA 3TO4A 1CXHA 4XVUC 4AZ8A 1NBZA 1HVQA 1M7DB 5FKAB 2HT3C 4K9EH 5A3ID 4C4KT 1XSKA 2X4UA 1B4RA 4XP5L 3QISA 4PG2A 1KT2A 1MCRA 1UACL 1WF5A 4JZJB 3NABL 5E2VH 5JR1L 1DQLL 1JPTH 4OUEA 1WK0A 3SDXB 4AIOA 2CLVB 3UXFA 4GFTB 1KJMA 2QQNL 1OAXH 5D6DC 5IBTH 3L9RA 2GJJA 1X5GA 4JGJA 4HK3N 4PJFB 3VFSB 3NCYS 1Q1JH 4G6AD 4OAWB 4FMKA 4OKVA 4XNXL 2XWTB 5KTEH 1CD9B 1IEAB 2J8UE 1Z9LA 1DN0A 3J8F7 2NTSP 5E6ID 3KPSE 1G6RL 4LFHD 4Y1AA 1JGUH 3ULSA 2R4SL 3SJVB 1U8JA 4WUKH 5CD5C 4DCQB 3EDEA 4CD5A 4XWGH 5KBNC 4V28A 5E5UB 1MUJB 5DMIL 4HWZA 5E2UL 3PWPB 1I3RA 3UBXI 5LAXB 2YD7A 5IK3A 4JGUA 2BNRB 3RA7H 3JV4A 3JWNC 3LRMA 4HPHA 5CAYB 5TDOA 1NDGB 4W68A 3MSGA 2A74A 2ZUMA 3MLZL 3MREA 3NCJL 3WFEH 4Y5XB 1QNSA 2GSIA 1QACA 4NXSA 2YPKB 4Z9KB 1BEYL 1Y0LB 5IHUH 3BHBA 5JORB 3SGEI 4JRYD 3ALGA 2E27H 1IGML 3H42H 4K23H 4NKOA 1XAUA 4KRLB 4IEFB 4DKEL 1G7PA 3I3DA 3N06B 2Y2WA 4LPUA 3TN0C 1UD5A 3ZHLA 1ND0A 1GVIA 1J5OL 2BVUA 3ZKQD 2XFXA 4NSKA 3SDDA 4UQ3A 4QF1A 1X5AA 3GHBH 3VFGH 4Z77B 2EDOA 2J2ZA 2GDUA 5F7MC 5D1ZA 3MROA 4JPKH 5EH1A 4DW2L 1MWOA 3QZWA 3RWIB 5HGBB 1EEUA 3L3HB 4DUWA 3U82B 3HRZA 3WFBH 3QEUB 5EC2A 5M94B 2ZSWA 1BF2A 3QIUA 1BOGA 2D31A 4N8PA 5GS0C 2WBWB 3C5SB 1DUYB 5ICXA 1C92A 4KK6C 4GKOA 3BP7A 5ABHA 2UVFA 1TTGA 1EA9C 3VRIA 1GC1H 5DRWB 4LLWA 5SWZE 5D72H 4JANA 5IB1A 4DGYL 2E7CA 5K9JH 2I27N 1UZ8B 5ADPL 5F6IB 3AAZA 3OX8B 2FJHA 3TESA 1F5WA 4PMZA 5MENB 1KIRA 2AXFB 3MRIB 5A2KH 2X5PA 3OZOA 4WNQB 4G3YH 4J4PC 2W0LA 2GAZA 3HJEA 1NARA 2BNUA 3N17A 1ISZA 3AIQA 2DQJL 4KJYB 4HH9A 5BXFB 4YPGB 4X4XB 1DQQA 3BKYL 2Y72A 2VUYA 4A4AA 5IFAL 1HKIA 25C8H 1IM9D 2R69H 1AY1L 5GRYA 5BXPA 4Y2DD 4EUPH 3MLXL 5DQJA 5KS9E 2XTJE 5A16B 1WPCA 5IESL 2NCMA 1J1XH 4JFPA 4C55A 4Y7MA 4JY5L 1QWNA 4WI9A 4ELKA 2WINA 1JF5A 5T1KD 2OL3A 3C9NA 2PO6B 3QG6A 1UC6A 3PXHA 4ZXBC 1I8KA 1V7NL 5EUKB 5HDQH 3WN5C 3V52H 4H7VA 2L0DA 4NQDB 3WQ6A 1XCQB 1E6PA 5HGGS 3U4BH 4P99A 2AW2A 4AIZB 4YLQT 5FYKH 4FMFA 4M5ZH 1OGAB 1UD6A 4HJ0C 3WO3B 4H2CA 1FC2D 3LB6C 4K71C 5HHOB 1E27A 5EOCL 2BXYA 1U8HB 3NCBB 2DIJA 3GJFK 1G6RB 4G6KL 5I66B 1N7MH 5DDHB 5BZWB 2QL1A 4XVJL 5JZ7C 2XIBA 3DRTB 4OZIF 3WNLA 2MSPA 3BAIA 3V4UL 3DBXA 1N2RB 3WSQL 4PMQA 1LEKA 1YDPA 3O2VH 4PRPD 5C0RL 4I8DA 5CCKL 4RFNC 4KHXL 3O3EA 4QOKB 2BNQB 4P2CG 3D51A 5FUOH 4GAYA 3VXSD 1ZE3C 4NN7C 5FA3A 2F53E 4ZOEA 5SV3A 2QV2A 3V6OC 3T0AA 2P8LB 4ONHA 1SJXA 4YHLL 5IW6A 4GAGL 1E4NA 4M9OA 3ARED 5ERWA 1QFOA 1BLIA 1Y18B 5C07B 1E72M 4GINA 1MQRA 3OB0H 3HE6B 2DWDB 1FORL 3RO8A 2A6IB 2PYEA 1KWGA 3T65A 2J7GA 5D9SB 3BH9A 4FQCH 4X4ZA 3IJ8A 1ZANH 4O2FB 5ID1A 5DJ6B 4KGLA 5I5RA 1MH5B 3MYZA 1BVLA 1MVFA 3D85D 3ZYZA 5CZVL 2ARJQ 2IANE 2E6PA 1VB9A 4DVRH 4F57H 4P46B 2BVQA 5L88L 1OT2A 4MNHA 2EEXA 2HN7B 3L3GB 1KULA 3BH8A 3MBXL 4QGYA 5ETUA 3TO2A 4GZJA 2X1XR 5JIPA 2WWDA 4X6BA 3JZ7A 4P2RB 3KL5A 5DHXB 3TC9A 2ORBH 5JW4R 1NBVH 1BGGA 2H9GA 3WUWB 5C0FA 2DT0A 4AC1X 2V9RA 3R0NA 3QDGB 3UZQA 3RWDB 1I1WA 2H6PB 4HXBL 4J12A 5C0IA 1D5IL 3EJZC 2A38A 1BFTA 1LO5A 2F54D 4WU5A 2J74A 4Z7VE 4HPYL 3RGVD 3QUXB 4Y16B 4W6XB 5LGHH 3ZKNC 2Q8XA 4L29A 4NYLA 1Z3GL 4P4KB 4YFDB 1O0VA 1I7RA 3BMWA 4PR5B 5A8MA 3BKJL 3KHQA 3EOYG 3GKZA 5HHVL 2NW0A 1OAUL 5IT2H 1BJ1H 2H32H 2NY6D 5DYOA 4QXTA 5HPMB 3WF3A 1TJHH 3OAYK 2AK4D 15C8H 2A83B 2X9WA 4WEBH 4MDPA 5FECA 3IFPA 4L1HA 2WP3T 1UD4A 3UR7A 4JAMA 1JZ5A 3H3BC 4QFUA 5EOTA 3MRHB 2F53D 1NDMA 4DVBA 4O2CA 4P23B 4Y8AA 3JWDH 3AIVA 4K2UH 5C7XH 2FJGB 1U3HC 4PRWA 5T3ZL 1G5AA 4X7TB 3HPJA 5TF1H 5MERB 1KJ2L 4X6DB 3SCUA 4WW2C 4GRMA 1JRHH 3A6BL 3BGFC 2P4AB 3MRLA 4PMUA 2DPEA 1LVEA 1MAKA 4HS6B 3X14A 3GMLA 2HFEB 2AABL 1N4XL 4PGEB 4B3KA 1VADA 5I78A 4ZO9A 1H5VA 4GKZA 5JIIA 4GW4B 4X6CA 1RUPL 3UZVB 1XGRA 2B8OT 2VZTA 2HRPL 2ZSVB 3CFDB 2VERN 1FYTB 1G7HA 3QPXH 1S7TA 2FX7H 4MTVA 4AY0A 4UR9A 1KBBA 3EYUH 4JFFB 5DC9B 4TQEL 4XXDA 1J8HB 5J6HB 5E2TH 5I1DA 3TYGL 1NAMH 1QFWH 2JF6A 1B2WH 3VDCA 3U9UB 2XZCL 2IAMD 2F19L 2Z35A 1FFQA 2XN9A 3VFPA 4MMZC 3E1F1 5KVGL 3QZWG 5L2KE 4O9HH 3QIWB 3PZMA 1YN7B 3O6LL 5F7EH 3CZFA 4EDXA 1H1NA 3VWKB 2XVKA 3CH8A 4QRPB 1Q9OB 4GG6B 3ECQA 1K8DA 1D5MA 3QIBC 4OZHA 1EFXB 1N8ZB 2Z9TA 3RDTB 4C54A 4JGMA 2HTLD 3RGHA 2PW1B 3QDMD 2AAAA 1AXIB 4HCRA 4AT6A 3VXUE 3OKMB 4JEGB 1ETZB 1VDGA 1HXYA 2EQDA 3DO3A 3DYOA 1GNXA 3MLPA 2A9MH 2YBRB 1WZKA 2BP3A 3II1A 4R97C 3DMMB 2YL9A 1SR0A 3QXDA 4TPRH 1C3FA 2NXYB 4JN2B 1AGFB 1RIVH 1QW9A 3B8YA 1OINA 2CSPA 2IBZX 1V6YA 4MNQE 3S8WA 3W0WE 3MV8B 3WLBA 4Q0XL 2YA0A 1DCLA 2RBLA 4J23A 3T04D 3UTOA 1OTTD 2GJZB 3M07A 2UYLA 4U1JB 4CMMA 3EHBC 1M7XA 5EFIB 2J7BA 3O2WL 2ZKHH 1VACA 4GLRH 3DUSA 1JYNA 3I9GL 3NCCB 3C6SB 3N85L 5LG1A 1FG9C 2OMNA 5SX5K 2DM2A 2NW3B 1MCFA 5GS0H 1KN2H 4QHMA 4U6YA 3ZT7A 4X8JA 3T0BA 3GBNL 3MV11 1LF1A 2XACC 1H3WM 3SKUD 5DMKA 1SJEA 3PL6A 1WAAA 4OSUL 4G42A 1L9NA 4ZUSA 1UQSA 3BRGC 1JWSA 3X13B 2VLRB 1OPGH 1BWWA 3FQWA 1A6TB 3PP3K 4WFHE 5JA8B 1C12B 3KS0H 1H4PA 4K9EL 1CXKA 1RHHB 1W72H 1CDUA 5A3HA 4WUUD 2EKJA 3QDJD 3TIEB 4LMQE 1IKFH 3U7WL 2Y36H 1A2YB 1DBAH 5E4IA 3H8NA 4XPGH 4MA8L 4YAQA 3W11C 1YEFL 3D50A 4M7ZB 4L4VB 5IHSA 5ACZB 2JJTA 5L2KD 1KCSH 4UDTA 2X4RA 2YZ8A 1U93B 4KPHH 1NL0L 2JB6A 1ACYH 4PPTA 4L8DA 3RVWD 3WHXA 1QR1A 1AHWA 1Q1JL 2F2HA 2EPMX 4JQXC 4D0DB 3VXOB 3QJHB 4HGKC 1OP5H 3OR7B 3QSKB 2R2HA 4PRBA 4G5ZH 3H0TA 1MW2A 4U0RC 2CO6B 2IBZY 4NBXB 1VKXB 3AU1A 4PJAB 3STLA 5BJTA 1R5VA 5HPCA 5IVZB 1R0AL 4HOWA 4B16A 1MF2L 1X4YA 4NQCD 5BOPA 1PG7W 3TA3D 3VXUD 4N5UA 2HFTA 3QULB 4WUKL 1MCPH 1H0IA 1MW3A 5MP6H 3BUTA 1I1AC 3G5ZA 1CBGA 1OTUD 3F12A 4KKAC 3RPKA 5T33L 2Q76B 3IDXL 3ULUC 3HZYB 5I9QB 2EABA 4RIRA 1FQ9C 3RA7L 5IIEA 3ARFA 4JO1H 5DSCB 5JO5A 4FFVD 1X6LA 4XXCC 4L5FH 1BYBA 2ZUNA 3WFEL 2WVTA 3SE9L 2GJRA 1KLUB 2X8RA 4M48L 1VEOA 3UETA 2QSQA 2Y6SD 3QGVA 1SEBB 5IG7A 2OYLA 3LKNA 4RQQA 4X0KB 1UJ3C 5D2NC 3H42L 2FYVA 5GISL 1I1YB 3FB8A 1CDYA 4LLQB 3EJUA 2O5ZL 4CU8A 3RL1A 4Q7DA 5BRZB 2YFOA 4WHDA 4S1QL 1IGFH 3U30B 1IQWH 4WSKA 2DMKA 1OARL 4U1LB 5HSFA 5JQ6H 3EO1A 5ANME 3BAXA 1P2CB 4B9ZA 4D6IA 3R8QA 1JGEB 2NY3B 4D6DA 3WFBL 3QFDB 2AJZA 4MNGA 1NGPH 4DQOH 1F42A 1YEGH 1GOIA 2W9LA 2X05A 3UC0H 1ZT1A 2X89D 2G60H 2OI9C 1S9VA 1UWGL 1FV1B 3EDDA 4UQDA 2O9TA 2YUWA 1J9YA 5KAQF 3DX0A 3P2TA 1MFCH 4FQQB 5E5RB 5EB8A 1JPGA 1U95A 3MCLL 5A2JH 1NMCC 5D72L 4MDIA 5IFHH 4U1GB 3SJVD 1J1OL 4I0PA 2VXVL 1T1YA 2BVEA 2PTTB 1DQDH 4PRIE 2NW2B 4EDWL 5DD5L 4PTUA 1CF8L 3VFUA 2D23A 4HC1A 4M6OL 3WIHL 5IWLA 1HHGA 3KVQA 3D39B 4MXQC 2R2EB 1JZ3A 1SYVB 3LH2H 3PHQB 2CDFA 1EEYA 5EUOF 1K9DA 1HH9A 3VIIA 1A9BB 3HZMA 3MI6A 4IDLA 4WFED 2EYRB 2HYMA 2C7FA 3N9KA 25C8L 3O45A 2R69L 3TT3H 1P4LB 2DYPD 3CFBA 4JM4H 4J3WA 4U49A 4KV5E 4QTHA 3NOIA 1Q9LA 3HG1E 3ZR5A 3FAWA 4JRYA 4PD4J 3FCTB 1OAQH 3AXLB 4OGAD 4PGBB 3U36B 1UB5B 4DK6A 1T7VA 5HDQL 5DJ8A 1RQ5A 5D7IB 5IXEA 3NIGE 4N5EC 5FYKL 1W8OA 4M5ZL 4LYRA 1ZXQA 2PB1A 2DT3A 1A1NB 1HDMB 2MQ0A 2P7TB 3C2AL 3LRGA 5H2BA 4LKXB 3QCVL 2ZOLB 1EJOL 1N7ML 1F58L 1CG9B 4JHZA 5IJVB 1D3CA 3QO0A 4GO9A 4RRPA 1MCOH 3GSNA 5F9WB 4ZUTB 1T66C 3NN8B 4F9LA 4NF7A 2VLMD 1JGLL 1KENH 3O2VL 3DXAB 4JO4H 4X4MA 4AZCA 5F1NA 1TJGH 1NMBL 3QEQB 4PJGB 5MEND 2E6JA 4RMUA 2X6MA 5EBWA 5FKPB 4Q9RL 4XZUB 4ZOAA 2NY1C 4KZDH 4YUEH 3VSUA 1HIMH 2FRGP 4CCDA 1VSCA 4LHUB 3CU1A 1A6ZB 3LKSA 1TTUA 4Z2KA 3RJYA 1IAIM 2Z31B 4JDTH 3EGSA 5IB2B 2I25N 1KTDB 2VXSL 5FHBH 1WTGT 3F58H 4FQCL 2EC9U 4PRID 3NACH 3PP4L 3SKMA 3VW3H 1I7TA 5IQ7H 1UR4A 3HB3C 1MCQA 2OQJB 1OGSA 4TOYH 5C71A 3CDGA 2XIDA 4GBXC 4OZFB 4XB3A 2EIDA 5AG8A 4KHTH 4PMDA 2E6QA 1S8DB 4HAFA 1BFNA 5CEXA 1VGEH 4M80A 7TAAA 5F7UA 1C16A 2HVJA 4PJDE 3BUQA 3D52A 4F57L 2PO6D 5FGRA 4Y2DA 5C3LD 4UINH 3BAEL 1RZ7H 4C58B 5B8CA 1K4CB 2GJ6E 3FO2A 4LAJH 3BXNA 5ID0B 4GI9A 5E08H 2IPUK 3KDMB 4B5EA 5T1KA 3SUUA 4GO6B 2XRAH 1KQZA 4LQFL 5HHOD 4Z95L 1NFDA 1ZHNB 3BP4A 4W84A 2HJKB 3MUY1 4JFEA 3ZL4H 3MO4A 2G75A 5A2FA 2EYSA 1OD0A 1V08A 4F9PC 5ABFA 1MRDL 2OCFD 5ALBH 3QHFL 3X12B 4LSUL 4QOKD 3DETD 1GOFA 3B3IB 4N0UA 4RSVA 4EKXA 2CJUH 3D4YA 2VC9A 4LSTL 5BW7A 3GSVB 4KJPC 2NT1A 1W9UA 1AKJA 1FFNB 3WD1A 5AYUH 4PB9H 4FQIH 1ZA3B 1NAKL 3A4AA 5C07D 3KLAA 3VXSA 2XWBA 2IQ9L 4LLDA 2LE9A 1VFBB 5DJYA 5HVHC 3HE6D 3W53A 3PDOA 4HK0A 5FUZH 4E0RA 4TRPL 2XA3A 3S5LB 4XNYL 2BVPA 4CVXA 4WEBL 4EUPB 4K3DH 3AREA 4OTXL 3W2DH 4S1RH 3KYAA 3EDJA 5ADOH 3QYCA 2FJFA 3SGKA 3RWHB 1UWQA 3U2SA 4KWUA 1F45A 4AQOA 2J7FA 4EQ2A 3BUYA 4U1MA 1V0NA 1UEYA 2VLKA 5IOPB 2APBA 4P46D 4E5XB 5K9QI 1OGBA 3V5HA 2J6EA 3ZDZE 5H94B 5CMAB 3W0KA 4MSWB 5E0FA 3WDPP 3BFOA 2YRZA 4H8WC 4LLYB 1MJJB 3D85A 2ICWI 4U3AA 2FEDC 4IS6A 3WFDL 2WUCL 3WFHB 3S7GA 3KEHA 4MAZA 3EKCA 4ZDHB 3GDBA 2DLIA 4OB5H 3MSDA 3QDGD 3IKCB 4N0YL 4Y4FC 3FB7B 2R1XA 4ZFGH 3G6MA 1JF1A 6TAAA 3WNOA 3BVVA 1BQUA 4MCYA 3MFFB 3ZZ1A 3BP6B 2PF0A 3CAFA 4S3KA 3QNYA 4Y16D 2CRZA 1KN4L 3C87A 3UCQA 3RY6C 5SWZB 4TUKL 3SKNA 4JFVA 3NVQA 5E2TL 3LEVL 2F54A 2LVCA 4PLJC 4NRXB 1D6VL 5HBFA 4DZBA 1I1FA 3RGVA 1NGWB 1WWBX 1HF6A 3G08A 3VJ6B 4O9HL 5FKYA 4MXVF 2WZEA 3HC4H 5F7EL 4GI8A 2CXKA 4HKBA 5LGJA 3TO4C 3B5TA 5KOVC 2Q87A 1HKFA 2D7NA 3ALWA 3MA7B 3ULUH 3KYOB 4FG6D 3QXAA 3ARTA 4YE4H 3BSZH 4QNPF 2DQTH 3N15A 1H3XA 1FFOA 2Y06H 1AP2A 2YEZA 1TZHA 1MCHA 4LKCA 1CTOA 2V2WA 3VE0B 1DVFC 3CLFL 1GPOL 2XTJB 3IETB 3VXMB 4X7SL 3WNPA 5JXAL 2KBGA 3GIZH 4QHUB 3OLIA 3P30H 3DX9A 4JZOB 3TH2T 4TPRL 5DJ0A 4PV9A 2YL8A 1IAKA 1QD0A 2J8HA 2G5RA 3TLRA 2CPCA 2Z4QA 1OP9A 2CPUA 4NZUH 3KLHD 2VZ3A 3O2DH 4JVPA 1KC5L 5CEZH 3MU7A 1B3ZA 2HG5B 2A6JA 1RJLB 5FOBB 3N1QC 4K8RC 4PJXB 5EO0B 1E0XA 3EFFB 2I9TA 2ZKHL 4U1NA 1FYTD 2GK0B 3JV6A 4YBLC 2RGLA 2OSWA 1MOEA 4YHKL 2WQRA 3M8OH 1UKOA 3BRFA 4KAQH 4PS4H 1AFVH 3S4SG 4FZ8H 3O11A 5I18H 1UKPA 4PV8A 2R9HD 3O4LA 1CQKA 3QCTH 4XBEL 2H32B 2DQCH 1EUUA 2VITA 1E6QM 2VH5L 4OCRH 4NN5B 5IUSA 3RIFF 4OZHF 1ODZA 1MAMH 2KZ1B 4QRPD 5C09E 1Q6EA 3NA9H 2MTPA 1RD6A 2IAMA 3ELAT 3MLWH 5BMFL 3PTQA 3MV7B 4D9LH 2OJZL 3A6CH 3CBWA 4AXNA 2Y36L 1JE6A 4RRPG 3TBVA 1NP0A 3OF6D 4Y4HB 5I76B 2I5YH 4CKQA 4P8WA 3RWEA 1HNYA 5D1ZC 1C8QA 4OD2A 1GGCL 1Q6GA 3E6FB 4NQXA 1MPAL 1LHZA 2DBLL 5C0AB 4BFIA 3QDMA 2EEBA 4KPHL 3ARBD 5FF6A 3RZCD 1BPVA 2HA1A 4N90D 5IMMA 2R8SL 3QIUC 1D6EB 2Q6WA 1CFVL 4RGOL 3W6MA 4XC1H 4PYSA 2DJSA 5CQ1A 1AGEA 4GKNA 1VRXA 1HHJB 2VVSA 5JHDE 1J87A 4HW6A 4R26H 4M56A 4ZTOL 1F4WL 4FXKB 4LF3A 1HKLH 1L7TH 3SKOB 5AWNL 5JTWA 1V6VA 2J3SA 1JD7A 1BQHG 4DJMA 2JEPA 5A40E 2BOCA 3HS0A 1UM5L 5TDPB 3OAUH 4RGMC 1NAMB 1M04A 2E9MA 4DWSD 4WHTB 4D0CA 3MUHL 1E4KA 4GW1A 4WV1A 1WAAF 2JEQA 3RUGF 3WJJC 1IC5H 1KCUH 4BKLA 4L5FL 3K3QA 3OKEA 5LXGL 1C90A 1Z9OA 2ESVE 4QEGA 4HG4K 4G8GD 4G7YH 4NBZB 1QNRA 1C5DB 2XG4A 4Z8FH 1XCWA 4RE3A 1MJ7L 5BOZG 1ZVSA 5KANI 1YN6A 4ZMAT 3EYVA 3IFOA 4Y5VC 2N56A 5GS2D 1AD0B 1G7LB 4RCAA 3PF2A 1MEXH 1TZIA 1W0YT 1I8IA 2JJSA 3IYLW 4WW1A 2ALWA 1DWJM 1G9MC 4AZ5A 1PAMA 4FNSA 3TBYB 2P5WB 5DTFB 3UTTB 2FECI 1IGFL 1RUKH 1MHHB 4MAUH 3MRCA 3SCSA 1IQWL 1F8TL 5IW1A 1BZ9B 2VSDA 3EJRA 4GO8A 1MXDA 4N8CL 1D5ZA 3TPUB 5HI4D 4ORZC 4M7KL 2G2RB 3QDJA 5BVJB 2FDMA 2MANA 1KGWA 4M61B 1XR9B 1BZ7A 4BZYA 2XG9A 1JZ7A 3GI8H 4DQOL 5SV4A 3P4MA 3V4PH 5C09D 1RZFH 4OJFH 4WI4A 4AENA 3OPZH 2G60L 3IJYA 4GKSB 3TN0B 2VYRE 3F7YB 4FNUA 1EAJA 3PWNB 5E4EC 5IB5B 3BGAA 3WEOA 2R56L 1DWAM 4F7CA 5M17A 2P46B 2FX8L 5IFHL 3L1OH 4J7RA 4U6HB 4ELMA 3LZFL 3NPZB 4XPFH 3TWCL 5DJAB 2H45A 3DX3A 4OUUA 2YPLB 4XX1E 2PW2B 4FNLH 2CBUA 2EDXA 3T0EE 2EDFA 1JWUB 5A6SA 5I1HL 3KNBB 4U1KA 1CZ8H 3TA3A 3AHZA 1GQKA 5DS8A 2ZUXA 4ZSOB 1KXQE 4XNQB 1CE6A 3O3DA 4YDIH 4PJEA 1M7IA 4LPVA 3AYRA 2GY5A 3LH2L 5GHWL 2G3JA 1S7VB 4NRZB 2EPLX 4B0MM 5GSRA 4MAYC 5JHDD 3AS2A 3AZRA 2BNJA 2A77L 3HI1B 4XPTH 3IU3B 1HHHA 3CSPA 1FG2A 1BVKB 3QFJE 4QWWD 5BRPA 1E4IA 1W72B 5I6XB 4M62L 4N68A 2XGBA 5BRZD 3WS3B 5GGTA 1I3VA 1Q6FA 1B3JA 3B83A 4XCFH 4HKXB 4L8BB 2R29L 1TZGH 4DGIL 1M7DA 5FKAA 4Z7OE 4MJ6B 4YHOH 1QW8A 4P9HL 3DHUA 4OT1H 4JPVH 1RURL 5I1EH 2V7NB 2NY3D 2ESVD 1A14H 2HLAB 4JZJA 4NO0B 1AD9B 3L4UA 3SDXA 1RULH 2CLVA 2EXWD 1AO7B 2DQGL 4P5KB 5AAWA 4NC2B 3NCYP 3QHTC 4GUPB 4KVNH 3DVGB 5EU6E 1A6AB 1CWYA 2BDNH 4PJFA 3VFSA 1IFHH 1HK6A 1H09A 2V17L 1EVTC 4OAWA 1MI5E 2HKHL 2XWTA 2DL2A 1IEAA 3V0AC 1QI0A 2QBWA 2MQCA 2FH6A 4GQ9H 5B4MC 4F79A 1NUDA 4H88L 1T7XA 2OM5A 5IBUG 3SJVA 1UR9A 2WVUA 3D39D 4DCQA 4NC1E 5FCUH 4Z78B 2QTEA 1MUJA 4UTAL 2VABB 1SEQH 3IDNB 3PWPA 4MA7L 5LAXA 1M03A 4JFDB 3FKUS 4I0KA 1DBML 4L3CB 3AHTA 1EVUA 2BNRA 3CNKA 5D7KE 5DRZB 1RK1B 4TVPE 3MS8A 1NDGA 5I1CL 3WL9B 1GH7A 5FYJE 3RPMA 5L8KB 2OSXA 4NN7B 4Y5XA 3NJ3A 2EDDA 4W85A 2V6HA 2YPKA 2GTWB 1Y0LA 1X44A 5J7CC 3T0ED 4NUGH 5JORA 4KHTL 4BZ1H 1BREA 4LLAA 3V7AE 5BROA 4IRSD 6A3HA 4XUYA 5F97E 3F5LA 5EULV 3ECBB 3CIQA 3GJEB 2XJ7A 1IAMA 4LOUC 4Z2GA 1B0GB 1TVBB 3SE4A 4Z7UB 4Z77A 3QFJD 5A6BD 4ZYKB 5C0CE 1WJ3A 2CKBH 1MNUH 3O41B 2JK5B 1BJMA 4HAGA 3RWIA 3L3HA 5HGBA 3VIMA 1WEJH 3QEUA 3LPGA 1ZEAH 5HHXH 3DX1A 3C5SA 1PG7X 1DUYA 1P5UA 1TQTA 1F3DJ 4P8XA 3DXAD 4GAFB 5BS0D 3ZYJA 3QEQD 5DRWA 3I2CL 2YRPA 5I19L 3G04B 2MOVA 2A9NH 1UZ8A 2AXJA 3SGJC 1SHMA 3T2NL 4DN3H 1P6WA 3OX8A 3W28A 4FQIL 3SUSA 5MENA 5D96B 4UQ9A 4NGHH 2AXFA 3IRZA 3MRIA 3PDGA 5F70A 4LBEB 4HPOL 2PNDA 5FGCE 2X4OB 4WNQA 4HF5H 4K8RH 2EE2A 1MI5D 4ENEC 1XV8A 3MBEC 3IANA 1JK8B 4KJYA 5BXFA 4YPGA 4X4XA 3I84A 1I9EA 5I15H 3UO1L 3V8CA 4M6NH 2YN5A 3IDGB 5JQHC 1R24B 4O02H 4ODBD 3KPQB 3AM8C 4J6RL 4HX1B 5A16A 1UADC 5JW4N 1LDPL 1KGXA 4IDJL 2VDKL 4YBQC 5GGSY 3VILA 3RX5A 1AJ7L 2PO6A 5ANMB 5HBBA 5EUKA 3KYKH 4R8WH 4NQDA 1XCQA 3HAEH 3A67H 4AIZA 1U3HB 2F5AL 1P7KA 1OGAA 3MRQB 1JAKA 3BDYL 3NCEB 5CXPA 1CIUA 1A4JB 4WW2B 5D9MA 3RU8L 1FP9A 5HHOA 4JHOA 1A6UH 3BGFB 1U8HA 4Z0BH 1G6RA 4UNIA 5I66A 2M2DA 5DDHA 5BZWA 2V3GA 4OZ4B 1MHCB 3DRTA 2XWEA 1KB9J 1JDAA 1MFVA 1N2RA 3DX2A 2E7MA 3PZIA 1JPST 4QOKA 2BNQA 4G8IB 1HCFX 3WD5L 2NTFB 2EXYC 2P8LA 2ZICA 4EBQL 1IAOB 3C6LC 1H8OA 5D2LE 3WD3A 1EHNA 1Y18A 3CLEH 5C07A 1EX0A 1R3IH 5HI5C 2A73B 3S98A 1PIGA 3LKQB 3BSZL 3HE6A 2DQTL 5J13C 4BYHA 2A6IA 1LP9B 3U57A 5D9SA 4V27A 4UT7L 1UH3A 4KJQD 4O2FA 3KGRA 2DTML 5CJ8A 5DJ6A 1DLHB 1ORQB 2WWMD 1MH5A 3Q2CA 5FYKD 2VE6B 5A1AA 3HG1B 2D7OA 1AHWC 1CD8A 3GIZL 3IFNL 1P84K 4P46A 2NT0A 3P30L 1W9DM 4WGWB 4YWGH 4N0CD 1NUNB 2HN7A 5ESVB 3L3GA 3M17B 3UEQA 2C1PB 1O7SA 4NZUL 4LSSH 4ATWA 2J4WH 4R27A 2HMIC 3O2DL 4PJ8B 4WTWA 4XVSL 1E6ZA 3BCFA 4RISH 4P2RA 2OL3H 5D1QC 1YNKL 1JRHI 3WUWA 3QWRA 4OI7A 3FN0L 1CFTB 2YIHA 2R4RL 3QDGA 3RWDA 2W9DH 4R97B 2H6PA 1OGTB 1AFVL 4WI7A 1RUAL 1U6AH 3ARFC 2XYLA 3TFKC 5DFVD 2VZSA 3QUXA 2YHGA 4Y16A 1WFOA 1M05B 2V38A 1WDQA 3BEWB 4P4KA 5D5MB 4AD2A 4M03A 2FDBP 1NCCL 2OK0L 1TJIH 3KJ6H 4PR5A 1B9ZA 3IJSB 1MJ8L 4KUZH 3P9WB 3HG4A 3MLVH 3WD4A 4ACYA 5IDIA 1N64H 1QFWI 5HPMA 1US3A 3O9WC 5HYJE 2GUOB 2E7LA 4PJCB 1UA6H 2A83A 2B5IC 2I5YL 5MHSD 1Z0MA 4POZD 3FQXB 3DNKA 1FBIH 4LEOB 4YC2B 1XIWD 2QHRH 4KU1A 3VXMD 3MRHA 4JR9L 5LQBH 1F4XH 4P23A 1IEBB 2OP4H 1WFUA 1RK0B 2FJGA 2P1YA 4X7TA 3M7SA 5MERA 4X6DA 2TAAA 3TVMC 3D9AH 1B4JL 3DI2B 3GXIA 1QLEH 4J3TA 3GKWL 1U2YA 3QEGL 4R26L 1GOGA 4PJIE 1W1TA 4HS6A 4I0PC 3EZJB 5HYIA 4WHCA 1S5HB 2YDSA 2HFEA 4XZBA 4PGEA 4YHGA 2C9AA 1ORSB 3WY4A 4TX6A 3FHQA 1YECL 4GW4A 5D7SL 2Q3AA 3BVTA 5IWLC 1K6AA 3ILQC 2YN3A 3TPKA 2D4FA 4ZAKB 5EU7C 2ZSVA 3CFDA 1KCUL 1FYTA 2DQIL 2W0PA 2W1NA 4JFFA 2AEPL 4BFEA 1E4MM 1J8HA 3IDJB 4K3HA 1DDHB 1X5XA 5J6HA 3MLTB 5EB9A 2ARWA 3ZTNH 1I1AB 3U9UA 3VH8B 5HHQB 1B1YA 2WPGA 3MV7D 3KLKA 2XY1A 3QIWA 4TN9A 4E41D 1KFAL 1YN7A 4TVSa 1JTPA 3D48R 1Z6JT 4MAUL 3VWKA 4GG8B 3D2UD 5IVXE 3P9LB 4QRPA 1Q9OA 3PUCA 5DJDB 4Y4HD 4GG6A 3CZNA 1TQUA 1OLLA 4OIAA 3GNOA 1EFXA 1N8ZA 4OCYL 3JVGC 3RDTA 3VWJB 4KI5C 3TJEL 1GJIA 2DMCA 4P59L 5C0AD 2PW1A 2YKLH 1MREL 4HLZG 2NY0C 1UJ3B 3D0VB 4XVUD 5D2NB 1EAPB 4LSVL 2HT3D 3GI8L 1AQMA 3OKMA 1C1EH 1ETZA 3G9AB 4U6VH 2ICCA 1V3MA 1T22B 5KSAD 3GB7B 5T1DL 2YBRA 3VI3E 3KXFB 1ZTXH 1XGUB 2BC4B 1T7ZA 3DMMA 2VDRH 3MA9H 3L6FB 4HJJL 4JN2A 4XC3L 4XPFL 1AGFA 3G6JB 1KELH 3OMZA 3MV8A 5TE6H 1BM3H 2DI8A 4UOZA 4BA8A 4AIUA 1CZ8L 1FSKC 2GJZA 4NWUL 2B1HL 1NC4B 4JFQB 4U1JA 5EFIA 4KGJA 2PWHA 1SJVA 1NGXB 4MJ5B 4EQ3A 1FHGA 2WWKO 1T2JA 3OGCB 1IGCH 2XTKA 1NMCB 3C6SA 2O5YL 2NSXA 5GGRY 3T3ME 2NW3A 1OY3B 3MGOB 3S35H 5CD5D 2R0KH 4PMYA 3R8BB 1PBGA 4NKMB 5KVMC 2CK0L 4Q74A 3BVXA 1DE4B 1TQCC 2DI9A 3K4AA 5KJRH 3HFML 1ZB5A 5F1IB 3X13A 2VLRA 2X09A 2OXGA 1KJVB 1A6TA 1C12A 2PXYD 5FEBA 2AGJH 2EEAA 3BW9B 3Q3GB 5C0EB 1HSAB 1J88A 3VGBA 1RHHA 3QUYB 1A0QL 5B8CC 1YQVL 2BVYA 3TIEA 3AMLA 3WH6A 4UCFA 2K9UA 1A2YA 5ALCH 3DI3B 5C1MB 1SQ2N 4L4VA 3TN0D 4H8VA 1QG3A 5ACZA 3ARQA 1IC7L 1U8QB 5IVOA 1KR0A 5E8EB 5DVMA 1U93A 2AJYH 2JB5H 1JYVA 4HCRH 4ELMF 5IGXL 2H2PC 4D0DA 4M7JH 5HGAB 3VXOA 3QJHA 1J7VR 5HDBE 4C7FA 1UWEL 5FL1A 3OR7A 2AVGA 1JYXA 3SBWA 5EBMB 2BSED 4H8WL 4PJAA 1PG7L 1VKXA 4Z2HA 2KDGA 3GI9H 3V6OE 4L9DA 3ZDXF 5GS0D 3IFLL 5IVZA 2A0LC 5E70A 3VIHA 1S9KC 1S3KL 4KK6D 4PJEF 3QULA 4NM4H 4WJ5B 3QH3B 5TFSL 4FNRA 4WF7A 1SEQL 3S35X 1QOXA 2Q76A 5GZNC 3AIRA 3HZYA 2ZOXA 2OW6A 3LPPA 4MHHI 1X4XA 5DSCA 1E4XH 4PRHB 2DTSA 4JFYB 3MV9B 3IDUA 4W7VA 2D0HA 1KLUA 4AEIL 4RGNE 4IOFC 1TMQA 4HU8A 1SEBA 1BECA 4J4PD 3RDKA 4X0KA 2MHAB 5DFWH 4QXUL 3SGDH 4ZOBA 4UV7H 2F7OA 1I1YA 5F3BB 2VAJA 4LLQA 1VIWA 1HKMA 2W91A 2VWEC 5CJQL 1BZQK 3ZQ9A 3MRPB 3SDXF 4BQ6A 3SPVB 1XD1A 5GJSH 1NCWL 3QHZH 4HEPG 4PJHE 3UP1A 2ZNWA 2C3XA 3TM6A 4AM0B 3CZGA 4Q7NA 1AO7D 1A6VL 4U1LA 2DAVA 1P2CA 3VDBA 2IPTL 3Q6GL 1FE8H 4GBXB 4M7LL 3CSBA 1JGEA 2B0SL 3QFDA 1WWAX 4Z6AT 1KTCA 4ZXBD 5JMOC 4OZGE 5JIKA 1FV1A 5DMGC 4X7FC 1WZAA 5ESAB 1U8LB 3NIYA 2J7HA 2UY6A 4FQQA 4PLKC 1L0XA 4HJ0D 3I50H 3CHFA 2P5EE 1CU4H 4FQHB 3LB6D 1A6PA 2PTTA 2NW2A 4UFMA 1GGTA 4DO6A 1NEZB 4R4NC 5JZ7D 4WI5A 1A64A 4JFDD 4X5WB 3U46B 5GRJH 3VDAA 3FL7A 1XF3B 4RL3A 4IJ3C 4W8BA 5A6KA 4BQBA 3LMJL 3D39A 5GJTL 2R2EA 1MIEL 3UPCA 3PHQA 1DBBH 5DO8A 2J78A 4ODTH 4AL8H 4M6NL 1V02A 4I5BB 1A9BA 5DUML 4TSAL 2BY1A 4HBCH 1RUQL 4XAKD 2EYRA 3O9NA 4TVPL 5BWFA 1NMAH 1P4LA 3THMH 2XQYG 4L9LC 5HVHB 2NPLX 5LWYL 4HGMA 1A7NL 3OA5A 4P2OC 3EYFB 3FCTA 1A47A 4W70A 3AXLA 4PGBA 5F7KC 3U36A 1UB5A 4CD8A 3IXTB 1HT6A 5GGSB 5IB4B 5D7IA 3A67L 3KPNB 4J1UB 1A02N 3W27A 4ODUB 1NM9A 1Q6DA 2JIEA 3AS0A 2XQBH 3OKLB 4JFTA 3LS5H 3F5KA 1A1NA 1HDMA 2P7TA 3WDIA 2XVNA 2YBTA 4LKXA 2G3IA 4L4TB 2NY4C 3BVNB 3FO0H 2ZOLA 1UWUA 1LO4H 1T83A 1CG9A 5KSVB 5I8EB 5IJVA 5GGQL 1RY7B 2X40A 4YGAB 3W29A 5KSBB 4MNMA 2H8PB 4ZUTA 3ZYIA 3NN8A 2BVTA 3B9KC 3FT4B 3DXAA 4R3SB 1WGOA 4PJGA 1NGZB 3QEQA 2JJVA 1I1CA 4G8EB 5FKPA 4MLSA 1QR4A 2WBJC 1CDCA 4XZUA 4PTTB 3FMGL 4DOHE 2V2XB 4PRAB 4NZTH 1F2QA 4JREC 4LHUA 4U33A 1TLKA 1AGBB 3ZKND 1A6ZA 2HKFL 4FZEL 3CLEL 1UYWL 4XV0A 1EO7A 1CICD 4CAGA 1CCZA 1FIGH 3ZO0A 1PZ5B 1GIGH 2Z31A 3DOSA 1R47A 8CGTA 5IROC 1ZJBA 2UWEF 3HNSL 1YEJH 5IB2A 5BXTA 1KTDA 3WJLC 4H20H 4ZUVB 2X7LB 3F7RA 3HUJB 6CGTA 2OQJA 3H3KA 1YMMB 3RVXD 3ULVC 4OZFA 3GNML 3GUTB 3OG2A 1S8DA 4U2ZA 1KEGH 5A8PA 1BX2B 4ZD3H 2DT1A 2XPKA 1HCVA 3L5WB 2CKBB 4FRWA 2YWYA 1K4CA 1G9ML 5ID0A 4DFHA 1GJUA 2CR6A 3KDMA 4CCEA 1I3GL 1YY9D 2BFVH 3HE7B 4L3ED 2VT0A 5A8OA 3M6DA 1DVFB 5LBSH 3RWFB 5DQ9B 3VMPA 2G4FA 3NFPB 4KV5F 3RBGA 1ZHNA 2B1AH 5CILH 2HJKA 3MKKA 4AEHH 3P9MB 4XCYB 3GMMB 3HZKB 4EN3B 3WXVL 1VJSA 1TZ7A 3SDCC 12E8H 4GOSA 3X12A 1T7WA 1H3TA 1ZHKB 4Q6IC 3ROLB 4UZUA 4CW1B 5INDB 1UWXK 3B3IA 1BFVL 3WIHA 3T08A 2OJEB 5DLML 5ISZB 4ODHH 2YD4A 2EH7H 3GSNH 4NPYB 5F1KC 1E0VA 4LASH 3GSVA 4MJIE 4P9ML 4ZUWB 4YBLB 1FFNA 1T89A 1JGVH 1ZA3A 3L7FB 5CP7B 3OTTA 5KVFH 2JJSC 4PBGA 5C6TL 3FFCE 4W8AA 5D1XC 1CDHA 1VFBA 3TT1H 2CUHA 5J1AB 3S5LA 3VMNA 2JELL 4PP1C 3NAAH 2AJSL 4EUPA 4EIZC 5FOJA 2DEPA 5E9DE 2VN4A 2W4XA 3RIAF 3RWHA 1OB0A 2BRQA 2QHRL 4LNRB 4URIA 2RIKA 1F4XL 3QIBD 2OP4L 5IOPA 4V1DE 4AWEA 3EFDH 1IQDB 4FMVA 4E5XA 1F11B 3HAEB 5H94A 5CMAA 5KVDL 3D9AL 3CVHL 2Y07H 7FABH 4LLYA 1MJJA 2MKLC 1DHKA 3T0VA 3EJYC 1KB5L 2Q8AL 3WFHA 1GYAA 4AYSA 5E99L 4OZIE 4F15C 3ULUE 4ZDHA 1B31A 1JNNL 2B4CC 3IKCA 3S34L 4MGXA 5IQ9B 4XMKH 3FB7A 3MJ9L 4P4RB 3DHMA 3HR5B 3FT3B 3ZHDA 4JRXE 4NM8H 3MFFA 3KWWB 1E73M 3BP6A 1XH2A 1JMXA 5TE7L 4XVTH 2F58H 4JG0H 5AAMA 2WMFA 4J3XA 5SWZA 2CUIA 4OLZH 1W9VA 3TOPA 3EHBD 3SCMC 3ZTNL 4NRXA 5D70L 1IT9L 5DVKA 2BVOB 2ICES 1NGWA 2P47B 4ALAL 1OSPH 4FTVB 3VJ6A 5HPOA 5CEZE 2MCPH 1CLOL 1CR9H 3BKCH 4RE2A 1A3RL 1V3HA 3V5KB 2WCGA 1E5JA 1HSBB 5E6ZA 3WH5A 4QY8B 1G9NL 1OWQA 3MA7A 1Q4NX 3KYOA 1I8MB 3OZ9H 1O7VA 4Y5VB 4OGXH 4X6DF 4J8RB 3SDYH 1VESA 2GVYA 1C1EL 1X7QB 3T4YB 3VIKA 3VE0A 3ARXA 4JB9H 1IL1B 3O8XB 4OLEA 3IETA 4I13B 1LK3L 2J25A 2GJXB 4QCEA 1MWAL 3VXMA 3WHE1 5SWSE 3DUHA 35C8H 1SM3H 1NCDH 4MB4A 3W11D 1L7IH 3GXMA 3MACL 2FZ3B 4QHUA 4RAVB 4JZOA 4PJ5E 3SY0B 4F58H 5IHZB 5CKAA 1CBVH 1DL7H 1KELL 2VXTL 4F8XA 4NQSB 1T0MB 2EIZB 2HG5A 3ETBF 4HIIB 1RJLA 5FOBA 4PJXA 3VXNB 1R33A 5EA0L 5EO0A 3EFFA 2AJXH 5E4EB 1XGTB 2GK0A 4PTVA 3RNQB 2EDKA 1ZAGA 4E4PA 2DMBA 4G6MH 1C7TA 4M3KB 2B20A 3KLDA 1GPFA 1H3PH 3W9DB 1S9YB 3S35L 5EBGA 5GGRB 1I1AD 1YC7A 2IFFH 2Z92B 4KKAD 3UJIH 3RILA 3ULUD 1KXVA 1N59B 2H32A 5FAAA 2JCCB 5KJRL 4JPIB 2KH2B 3K2UH 5KW9L 4GG6F 4LEXL 4KY1H 5EPMB 2O5XL 3OLEA 5EC1B 4YHYC 4D71A 1UWRA 3MV7A 4M1GH 4MAYB 5D2LB 4EOWL 3N50A 4JM2B 5ITFB 5HXMA 1QO3B 4YXLL 3AHYA 4X9BA 3VD7A 2VL5B 3PBGA 1QNQA 3P40A 3DWTA 5ALCL 2IGFH 2UV3A 3TBSB 4Y4HA 3WS6A 5I76A 3SE4C 4UILL 2NX5B 4KQ4L 1DUZB 3VXTB 1QFWM 3E6FA 1P69B 2GCYB 3VFNB 1IRAY 5CEZD 3PHAA 4D2NA 3L3IB 1KB5B 4BF7A 3BP5B 4IMLB 3KXFD 1D6EA 1ADQH 5B22A 2AJ3B 4LHUG 1KJ3L 3BIAX 1Q6CA 1HHJA 3RBSA 1DBKH 5I1IL 1JL8A 1JFHA 2I26N 3CSGA 1KCLA 4IPNB 4WHYG 2UWFA 3V6FB 5I8CB 2XV6B 5I8KH 4D9QE 4TTGA 4YGVB 1RVFH 4FXKA 5D6DA 2BSTB 3SKOA 5F6IC 4NM4L 1GQJA 3U0WH 2VVNA 2D7TH 2WP3O 2YXFA 1ZGLP 8FABB 1W0WB 4OZFG 5TDPA 1NAMA 4UIKH 3K2MC 4WHTA 3MXWH 4NQEE 2B39A 4WU5B 5F44A 1KIPB 4XBPB 4PJ5D 1DJSA 1P9MC 3W9EB 3GBMH 1EDQA 1RZJL 1PX8A 3T0DA 1L4IA 2LAGB 2EH8L 1I7ZB 1C5DA 1YUHB 4MXQD 4TNVF 3KPLB 4OD3H 3UJJL 2KQNA 1AD0A 5BV7L 1FP5A 1G7LA 3NCMA 4UV7L 1N6QH 3TBYA 2P5WA 3SE3C 5MEQB 5DTFA 3UTTA 4KTEH 1MHHA 3B6SA 1BZ9A 4ESKA 1LEIB 1J0IA 1CPUA 3TPUA 1E56A 2YD6A 2VDLH 4HG4J 2G2RA 3ZKMC 5BVJA 4QTIL 2DQUH 4M61A 1XR9A 3K1KC 4GMTH 2XG5A 5GRVK 4RNRB 3OB8A 5I2UA 3RAJL 2R23B 3W37A 2WIMA 3AISA 3ESUF 4PJAF 1CFBA 4GKSA 3TN0A 3F7YA 1A1OB 3BDXA 5ABGA 4N5ED 3ULVH 1CFSB 3PWNA 5IB5A 1FLRH 3GK8H 1FNEB 5FYLE 4PSRA 3PQYB 1LO0L 3S3JA 4P5TC 3CXHJ 5DRXB 1HHKB 3S5LG 4U6HA 3ES6B 2IBBA 1T1ZB 4EUPG 2MQ3A 5F7WC 1KIUA 5DJAA 5TPWH 2YPLA 1YJDL 2PW2A 1MVYA 2GSJA 1T66D 3WIFB 1JWUA 5GRJL 4CUCA 3KNBA 4IMKA 4PRHD 3T77B 3X11B 4QRRB 4ZSOA 4XNQA 1TQBC 1I9JL 2VUOA 3D3VE 3G9VA 3MV9D 1F2XK 1S7VA 1DBBL 4NRZA 2D9CA 5E03A 4NDMB 2NY1D 5DWUH 3WYRA 3HI1A 3IU3A 4OLXL 4WO4B 3HA0A 1WQVT 2J7CA 4MNKA 2PC8A 1BVKA 4HIEB 1CE1H 1W72A 1QYGL 3FN9A 1OHQA 2Y24A 4BS0A 2X42A 1M4KA 4JFHE 2J88L 4N1EA 3WS3A 5FGBA 5F88B 2FB4H 2NY7H 2Q8BH 3T2QA 4BSVB 2IALB 4HKXA 4L8BA 1HINH 3WDQA 3MBEB 4L3AA 1EMTH 3SO5A 4MJ6A 2D1ZA 1U30A 5JW3L 3HB3D 3OB0K 1QSEB 4Q9QH 1FYHB 4OLWH 5FHAH 4FFYH 2V7NA 2DGAA 3OKYA 2HLAA 5J57B 1VF8A 4NO0A 1AD9A 1GOHA 5H8DA 1LL6A 1AO7A 4XI5C 2XQBL 3CX2A 3CGTA 3IDYC 4P5KA 5E8NB 4GUPA 1E6OH 1JDDA 5CWSB 3H55A 1JD9A 2X4TB 3DVGA 3QOMA 1A6AA 1LO4L 3CFJB 1FVCB 4QXGL 2DIBA 2FGWL 4TUJB 3WEZA 4M6AA 5C0BE 3DVFA 2DJ4A 4G6JL 4X83A 1U3ZA 3GEWB 3VXRE 1JGIA 1DFBH 2WXDM 1S46A 1HNFA 3THCA 2VX7A 2FD6L 4OI9A 1FH5L 4Z78A 4K94L 4IISA 2B4CH 2VABA 3IDNA 2BSRB 4R96B 3DSNA 3RPIB 4PB0L 4L3CA 1HN1A 3DVIA 1H5BC 2MCG1 4F37F 4KJPD 5DRZA 1FAKT 1RK1A 4MD0B 2Z8WC 3WL9A 1KCVH 4G42B 1XCXA 2GTWA 3V4VH 4YNYA 4JFUA 3JWOC 5TE4L 2V5DA 4P23C 1RPKA 3C6LB 5D7IF 1JPSH 2FL5B 4HFUH 2GEEA 3ECBA 1NLDL 1K6QH 4JL2A 3GJEA 4Y1AE 4M1DH 5A6JA 3CMOH 1B0GA 1TVBA 4LCUB 1RJYB 1HEZB 4RBPH 1MELA 1QBML 4Z7UA 4JHAL 1B0RB 1H8SA 1G0YR 2DWEB 4ZYKA 4MS8C 3O41A 1JVKA 1W8NA 2JK5A 4GRWH 4JFHD 4L4TD 1SMOA 4XAWL 2ZXBA 5ILTH 2FEDD 4UV4L 4KTYA 4AEHL 5E0CA 4KKBC 4OCXL 5KN5B 3WIIL 4FQ1H 3NIFF 1FZKB 2IFGA 4Y4FD 4A6YL 2C4FT 2DD8H 5EUOE 3IU4L 3DDGA 3L5HA 2Y8KA 1KNOB 3G04A 5D1QB 2BS9A 4N9OB 3VNYA 2VDOH 2UZIL 4NKIH 2R2CA 1FH7A 1Z5LB 2VDQH 1AC0A 5GRUH 4KRPC 3QIWC 4LBEA 4OOZA 1PDKA 4PLJD 2X4OA 1OD8A 1ZSDB 3VWKC 4UQ2B 1Q0XH 5BYWA 4XP6H 1W2KT 3NAAL 1JK8A 3HG3A 3UTPE 1YMMD 2FIKB 1PSKL 4RGNB 3CU7A 3IDGA 1U8OB 3EJPA 3MGAA 3TO4D 1R24A 3TBWB 3VFRB 5KVEH 2FBJL 4A2LA 4EI5C 3KPQA 2WAGA 4HX1A 5C08B 4JHBA 1WFTA 3O9WB 1UZ6F 3U7YH 4FQXB 5DO2C 1PKQB 2B5IB 4F9DA 2J5LC 1EPFA 4D9RD 1DVFD 3DMMC 5ANMA 3ZT6A 4LYQA 2NXYC 4LIQE 4TXEA 4QHNB 4FQ2L 4AYGA 1U3HA 4GH7B 3MRQA 4N0RA 3GGWA 4YJZL 1A4JA 4OZGB 4WW2A 3TVMB 2OSYA 3OAYH 4K3JL 4NM8L 5I1KH 4JQIL 4M4RA 4NX0A 4FA8A 3D18B 1CNVA 4PTWA 2YD9A 4OZ4A 2OR9L 1B3YA 3ZJ7A 1KV3A 5INCB 1MHCA 1NSNH 4C57C 4K8RD 5ISZD 4E8DA 1AQ0A 2MKWA 3MLUL 4BUHA 2YL6A 2ZE0A 4K55A 3RI5K 2X4PB 5HDOA 1JI2A 3JUGA 3L3DB 1FL5B 1ZS2A 1PKOA 4G8IA 1TQWA 4PJ7B 1MLBB 2NTFA 2O9PA 5DZNA 1UZ4A 4XPHH 4JPWL 1IAOA 4LCIL 1TETH 1SFSA 1T2XA 2ZZUT 2A73A 1ZLUK 2G8ZA 3LKQA 1RZGB 5L6YH 1PEZA 3IDIB 1T3FB 3MSPA 3D6GA 4FK9A 1LP9A 2X1PA 1DSFL 5A2BA 3BPCB 4R4FL 2IG2H 3VG0H 3CPUA 4M7ZC 5ITBH 3P0YH 3WNKA 1DLHA 1ORQA 3S4SB 4Z7WF 2VE6A 1EHLL 2X0YA 3HG1A 2WZIA 2EDQA 4HTYA 5D1ZD 1KPVB 4XP5H 4OCMC 3H7BB 5ESVA 3M17A 4ACZB 3SBWC 1UACH 2C1PA 3CK0L 3UTPD 3BT2H 3NABH 5JR1H 2NY0B 3LEXB 1UA7A 1DQLH 5FCZA 1R3HB 3UYRL 3QIUD 4PJ8A 5FD0A 1JFQL 3N1FC 5T1LB 2QQNH 2O61B 2E8YA 3GSUB 2VR4A 1DP0A 4H8UA 2VZUA 1GORA 1CFTA 4UBDC 2GW5A 1MLCB 1OGTA 3MLYL 3GSNB 4XNXH 1H3PL 4K07A 1R5WB 1GQLA 4P7OA 5CIPH 1A7OL 2J77A 1JAEA 2IFFL 5DRNB 4CDGC 1KB3A 3S97C 1G1YA 2EO7A 2QLYA 2XSBA 4YX2L 1TUXA 1G6RH 1W3KA 4JLRB 4ZNCD 4FTVD 1M05A 4MZ3A 2XIIA 3BEWA 2XKUA 5D5MA 2R4SH 2ZXQA 1FSKB 2BMKB 4LQ1A 1PX3A 4URTB 2A3HA 5E94B 4KK8C 3IJSA 5DMIH 2EDEA 4HUWB 4HWBH 3BZDA 4WSJA 3QQ3B 4NO5B 3MRRB 1LD9B 4KK5C 3BKML 4CADB 1OIFA 2RAMA 2GUOA 4PJCA 3MLZH 2YOCA 4OF6A 3NCJH 1BQHB 5GQBA 5A6LA 2VISB 3QHOA 1QFUH 3FQXA 4LEOA 5JXEC 1IGMH 1IEBA 1RK0A 4O58L 1QVBA 4KC3B 4XP4L 1ADQL 4DKEH 1W9PA 1MFAL 2YK1L 4ODWB 4V2CB 2P8PB 3A6OA 2A6KB 1J5OH 3AYSA 1R3LB 1G7IB 4WY7H 4PJXF 1OAZL 2BSSB 1JP5A 4A2MA 5ICZB 2WC7A 4MYWB 4KZEL 3S36X 1UT9A 4DW2H 1S5HA 4NFBA 1T6VN 5DZLA 1TQSA 1RPQA 2B2XH 4HWEH 3Q1SL 1ORSA 2YFNA 4JQXA 6FABL 1K5NB 4MXVE 2XN1A 1GZJA 1LE5B 4ZAKA 2E3ZA 2YA2A 4NHUB 4PGCB 3FN3A 1NFKA 3IDJA 1DDHA 3HMWL 4DGYH 3MLTA 4NKDB 4QCIB 3QDHA 4F33B 4QNPE 5ADPH 3CUPB 1I1AA 1UUQA 4MJIB 3VH8A 4LPWA 5HHQA 1F4AA 1YPZB 3D25B 4LL9A 1ZLVK 2VJXA 4MAYD 4X0NA 4HQQL 3DSFL 2XVPA 3BLPX 1MHEB 2PYED 4HMDA 4GG8A 5L2JB 3P9LA 3I6GB 5DJDA 2L4OA 2DQJH 2OWXA 3MXVL 1PBYA 4WI2A 4U6XB 1R86A 3BKYH 3WFCH 2VDLL 3VWJA 3D0LB 2HISA 3CVIL 5J6GB 3D0VA 1UJ3A 1ZA6B 5D2NA 1EAPA 3O3AB 4V1DB 1AY1H 4U3HA 2APWA 3VGDA 3MANA 1OL0A 3MLXH 3QB7C 3GNRA 1T22A 1Q9WB 1F90L 4KDWA 2WHKA 1QQDB 3GB7A 4JY5H 3O2DA 3QUML 3JWOH 4O00A 4Y5YC 5IV2B 3CFKB 3KXFA 2WANA 3STZB 1XGUA 2BC4A 4EE9A 1V7NH 1FZJB 3A47A 2XN9E 3U7VA 3L6FA 2X2HA 1TIUA 1YY8B 3G6JA 4ZENA 3KL0A 4NO3B 5EN2B 3C09C 4BQ5A 2W9EL 2RGSA 1J18A 5DD1H 1FFRA 5SX4H 4OZHE 1NC4A 4JFQA 5B4MD 4UOW1 1NBYB 1NGXA 1A4KB 2WK2A 4JRXB 4MJ5A 3OGCA 4XVJH 4UMGA 2R0LL 4PJIF 4RDQG 3LKRB 1JCKA 2IGTA 4NOFA 2Z31C 2XWDA 3V4UH 3MGOA 5MEPB 3WSQH 2IJ0C 5C0RH 4IRJB 4NKMA 1E70M 1CE1L 5CCKH 1JHLL 2AK1L 1FO0H 4CU6A 3EYSL 1DE4A 5K9OB 1HZHH 5F1IA 1HNGA 1OCWL 2CIIB 4IJ3B 1KJVA 4GS7B 4QLLA 1IVLA 1EMTL 1UENA 3BW9A 3GSRB 3Q3GA 1HSAA 5C0EA 4HUVB 2ERJC 1UWIA 3L95B 3DIFB 3EW3B 4G9DB 4CNIB 4DAGL 3UTZB 4F80A 4BZ2L 3QUYA 2I07B 2H3NB 1TE1A 1FORH 5IBUB 3SGDI 3L5XL 3DV4B 3V0WL 3WKML 1OWRM 4L9LB 2V5YA 1PX4A 1OF2B 4P2OB 1U8QA 4LOUD 5E8EA 4ONOA 4Y89A 1XRVA 4NNPL 1ZLWH 3PQYD 3RHWF 2VRJA 5HGAA 5L88H 2AQ3A 1WAAE 4YBHA 2J12B 2V9TA 3MBXH 3PABB 5EBMA 1I9RL 4YO0B 1US2A 2NXZC 2BVDA 2VR5A 4W5ZA 2OTPA 5FYLL 5BCAA 4GZEA 4QRRD 5H35B 4WJ5A 2NY4B 3GSWB 1QKZL 3QH3A 1T89C 2B4CL 1ZVYA 1ZBWA 4HXBH 4OFVA 1EXPA 1D5IH 5IFJB 4X6EB 1WDPA 4I3RH 2J75A 4CD7A 3B9KB 3GRWH 4I2XB 5CKGA 4PRHA 4HPYH 1U92B 3DLQR 4MA3B 4UFIA 3WF1A 4JFYA 5DXWA 3MV9A 1GGBL 1GHRA 3ZTJG 4Y19B 2DQHH 4TULL 4APQB 2WBJB 4XWOC 3SCPA 1QRNB 3MC0A 4ENED 3BKJH 3MBED 5J12C 1MCJA 3TZVB 1RIUL 2MHAA 3T3PF 5HHVH 1OAUH 4TYUA 5T5NF 2P48B 5F3BA 1JPSL 4HFUL 4OJYA 2EIEA 3OJ2C 3MRPA 3HNVL 1K6QL 4YFEA 3SPVA 2XFRA 1YNLH 3CMOL 3Q5OA 4AM0A 3G6LA 5JOPD 2DLFH 3ZJ6A 3KPRB 2QSVA 3T0WA 4F3FB 1BD2B 2AEWA 4GBXA 4LCWB 1ZGLA 5ILTL 2X2IA 4MJ4A 3LQAL 1UCBL 3CX5J 1KJ2H 2OZ4L 3GYCA 5T3XH 3A6BH 4U4BA 1KTBA 3DYMA 5ESAA 2VX6A 1U8LA 3BQUC 2R0ZL 3HC0B 2VSCA 4DFIA 3U79A 4IRZH 1G01A 4QLKA 4EVNB 2NMSA 1EFQA 3MZTA 4FQHA 2DDXA 1ISWA 2AABH 2VLJE 3IJ7A 4I4WB 1NEZA 1R5IB 2IEPA 3SKJL 4WKAA 1EH9A 3QJFB 1ISYA 3SQOL 5GRUL 1BFOB 3BPNB 4F9PA 1RUPH 1S9WB 4X5WA 5HDBF 3U46A 5CJ5A 1L6XA 1XF3A 3SDCB 4NQEB 4FLQA 2VOTA 2WUBL 1WZMA 2DQFB 4Q6IB 1SYTA 3PL6D 1HOCB 3UG4A 4D8PB 4TQEH 2EXYD 2MNUA 3G5YB 4MNGE 1I3UA 4I5BA 4HOXA 2P43B 3VGGA 3LX9A 2XZCH 5C0DB 2F19H 4MD4B 3BYYA 5HI5D 2RGMA 2AQ1A 5D1XB 3O6LH 2WBGA 2XTJC 3O6KL 1KF9B 4Z7UF 5EOCJ 3UYOD 4JE4B 3EYFA 5BZDB 2ADGB 1BBDL 3R1GL 4UIMB 4NWTL 3IXTA 2YS4A 5GGSA 5IB4A 1JV5B 1UWTA 3KPNA 4J1UA 4FHBD 3X3FL 3N1PC 4ODUA 3QHNA 3W24A 2EDHA 3OKLA 4KROB 1FGNL 1QPKA 3VH8G 4FLRA 1MW1A 2NZ9C 4L4TA 3BVNA 2HMID 4CN1A 1NOFA 5KSVA 5I8EA 5J11C 3W4RA 1E28B 5I8OL 5KSBA 5D1QD 1NSNL 3T8XB 2H8PA 5AZ2L 1MQKL 1EO5A 5I30L 3FT4A 1P4BL 4R3SA 4M43H 1NGZA 1KBGL 4Q0XH 2ICWJ 1KXVC 4X7CC 5FB8B 3DC0A 1HIZA 4G8EA 4P3CL 4JRYE 3ARFD 4NN5C 4PTTA 4JKPH 4CKVX 2V2XA 3TFKD 2VC2L 3F62A 4PRAA 3O2WH 4BH8B 4U31A 3VG9C 2LU4A 5H37G 2VURA 3I9GH 1AGBA 2OYPA 3HTLX 3N85H 3GJFB 2D3VA 2KUTA 1PZ5A 3SCMB 4NZFA 1VGKB 3WMBA 2BV9A 4DGVH 2B7DT 4O2EB 3X3GL 4MPKA 2IG2L 4RDQF 2WC3A 4ZUVA 2UY2A 1D9KB 4OSUH 2X7LA 3HUJA 1YMMA 5CSZB 3GUTA 3O9WD 3PZVA 4XP1L 3RCNA 3D5HA 4JG1L 2RFXB 1BX2A 5KZCB 4X4ME 3L5WA 2CKBA 4H0GA 1U8IB 4GRWB 1H15B 5CGYC 5JBDA 4X6FB 2HT4C 3BT2L 8A3HA 5EMYA 3U7WH 3HE7A 1VFUA 4WW2F 4MA8H 4R2GC 1W1VA 1YEFH 2C1OB 1DVFA 3DJ9A 4NO2B 3RWFA 5DQ9A 3TVMD 3WBEA 3NFPA 1MFUA 1UKSA 3BD4A 3G6AB 4P57B 3FNDA 1NL0H 3S36L 4AEFA 3P9MA 4XCYA 3GMMA 1JF6A 3HZKA 4I0PD 4EN3A 3EO9H 2XA8L