1TCMA

Cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 201
structure length 686
sequence length 686
chains with identical sequence B
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tcmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tcmA01
1MJUH 4DN3H 3RKDD 1KBGL 2O61B 1NBQA 1MIMH 1UB5A 1A1OA 4JDTL 1X4XA 1GZPB 1B2WL 5CEZH 4UB0H 5EU7C 4WCYL 5F21B 4DGIH 1INQA 2X4TB 1M71A 1UQYA 3NACH 5IF0A 1EBPA 1FORL 3AS1A 2P24B 4YN5A 1TZGH 3U1SL 5JDSB 3OA5A 4NSBA 4YHKL 4GRWB 5BYWA 4PRNA 5EUKB 4DM1A 3TT1H 5JLZB 3RFZC 2XXMB 3RI5F 4JFZH 4U1GC 2CK0H 5BV7H 2ZXDA 5K9QG 2DQTL 1JGIA 3BGAA 2HP4A 4KUCD 1UB6A 4MVBD 5JXEC 2BFVH 1IAIL 4L3AA 4PRPE 3THMH 2Q87A 2HVJA 1WKYA 2UWFA 2VXUH 5C2UB 5H37G 2P49B 4QY8B 4X4MA 4F57H 5LGJA 4GMTL 1KN2H 4MHHG 5JORB 4PJGB 5CP3A 1HKJA 1LVEA 4UV4L 4NQEE 1BX2B 3F58L 3RZCD 3TT1L 4M8UA 3WN6A 1FC2D 2ED8A 3BH9A 5C70A 1OSZA 1CT8B 3GMQB 3MZGB 2ERJB 1D5ZB 1N6VA 3DNKA 2UVFA 4ZENA 3SY0A 2EPOA 5IMLB 4P2QE 2YPLE 4WHTA 4NHCL 4TNVF 4R2GC 3MR9B 2VCBA 3WH9A 4V2BA 3W0WD 2C8NA 4P5KB 4Y4FC 1W0WB 5C0IA 1OTUC 1X7QA 3IGAB 4YHIB 5E99H 3II1A 2ZUYA 3AMDA 3KPNB 4XMPH 1QBMH 1G84A 1DVFB 4XCNB 3CLFH 2I5YL 2IJ0C 4HFUH 5TJWK 4V1DD 3W37A 2GUOA 1OCQA 4ENEC 2W0KA 4KMTH 1OM3L 4WW1B 4PY7B 1FN4B 5JNYB 3HPJB 1T1XB 1WWWX 2CRIA 5T3XE 5F8QC 1UWGH 2XN9E 4OGXL 3QIUA 3CXDL 4UFIA 2GJ6B 3EGSA 2X1OA 1A8JH 3UDWC 3TJEH 3L4YA 1SBSH 4R4FH 5ADOH 3HI1B 1WDSA 3SOBL 2ZKHL 4QNPE 2VITB 4WIWA 1JFHA 5HBFA 5FK9B 4O9HL 3TPKA 3BUQA 3OB8A 2YBTA 4LLVB 4LX4A 4JVWA 1OP9A 5EC1A 4ZXBD 3PL6B 4YLQT 1SY6A 2VXTL 1QVOA 3H53A 2BV9A 4OCNC 1DQQB 4PJDF 3FZUC 4IMKC 3CFJA 4BSJA 5HYSB 5LGKA 4XP4L 1G6RB 3QFDB 4PGBB 2E27H 2G2RB 3IFPA 4XTRD 4YHNA 3OKKA 3SGJA 2YJQA 5ICYA 3P4OB 1ONQB 4G9FB 2YFNA 3VFPA 1LO4L 4RWYL 4JANA 3PP3H 1HKFA 3N1AA 5CEYA 5I8KH 4J1UA 4PJ8B 1OVZA 4NT6B 1CQYA 5F97E 3MREB 3UG5A 3AY4A 4S1SH 1ZLSL 3QUYC 1HH9A 3VOCA 3A3HA 4G6MH 1FLRL 1M71B 1F02I 2QV2A 1LWJA 4S0SD 5MEND 3L3GA 2K9UA 3CUPA 1NFDA 5ETUA 1XMWA 4MZ2A 3RUGF 5FKAA 3P9LB 4HZAA 2OS7A 5F7MC 4IIQA 2APXA 2EDEA 2J1KA 1IT9L 5CD3B 5A6MA 1VCAA 2AJ3B 2YPKA 5DJ0B 3ZYJA 3GKZA 3KNBB 3GKWH 2NYYC 3MMUA 1B1YA 4ZDHA 4PRHD 1A4KA 5KSBB 1HHGB 3K80A 4XAWL 3FO1B 2FLBT 1RJCA 3HI5L 2CLRB 2DTML 3IB4A 1SEQH 4F37F 1DWJM 2XPGA 2WVVB 4JFHD 4FFWC 2A0LD 5DA0B 4NDMB 2F8QA 4JJHA 4JY4B 1NARA 4N5UA 2WW5A 2Z92B 3BP6B 3P4OA 3PHAA 1YJDH 5EOCJ 1CT8A 3I9GH 5TFSL 4Q2ZA 4UFMA 3BLKA 4XNYH 5A2FA 3VXMA 4U3AA 1CI5A 3RGHA 3GXNA 3TM6A 2O9RA 1RSFA 4WKAA 1QHPA 4MHHI 1UWQA 3BGFC 2CJUL 3BSZH 5LVEA 4NZRH 1DBJH 2VKWA 3ME0A 3MUGB 4WIQA 2O9OA 4PRWA 1JGEB 3DV4B 5HOSA 2A38A 5EZOH 3D52A 1HHHB 3GHEH 1GQIA 4ZTPH 3U7YH 2Q6WA 3TIDB 3HAEG 1H0IA 1QR4A 1A1NA 4NQCB 1G6RH 2VC2L 2VITA 1UG6A 4B3KA 1T5XA 2DWEB 1TQCC 3QPXH 2GUOB 3N1GC 2E9BA 4JHWL 3RDTB 2NY3C 1H8OA 1QO3A 2R1WA 5LQBH 1VFFA 4LEXL 4PJHE 4TTDD 3LIZH 1QPXA 1UM5L 1T2QH 2JF1A 4WW2C 4WWKD 2NY0C 3PXJA 4EI6A 3DVGB 1GPOH 2GJZB 5C0CA 1JHTB 3G5YB 3OPZL 2ED9A 2P43B 3MBXL 5ECUA 3EJQA 2ID5A 3BIBX 3CIQA 2J88L 1J0YA 4WFGD 5HY9A 4JM2C 1HF6A 1HKLH 3RVXC 3WIFA 5FEBA 1AGFA 4R90L 1KLUB 3LS5L 3ZKMC 5AD0B 3VDAA 3GXTA 5D6DA 3RILA 1GHSA 1DANT 3R4DA 5CJXC 3E1F1 3L3JA 4J12A 1KIQB 1UEMA 2DMBA 1O7DC 5M3WA 1P7QD 5JW5A 1Q1JH 2V5MA 1ULVA 2JJVA 4AY0A 4YC2C 4XPTH 5IKCB 1RZ7L 4U1NB 1VFOA 3GFUA 5EOTA 1NCWH 5J13C 4U7KA 1J10A 3DDGA 4M7KL 3VGFA 2V9QA 3IFNH 5IW6A 1W8NA 5I9QC 2GJXA 2APBA 4KWUA 4B3LA 3BVWA 3DURA 3LN4A 5IVNA 4PJBB 2F61A 1LLOA 1RFDL 3VIKA 5GRVK 4HUUA 1FZJB 2ADIB 3G6JF 3N85L 3VI3E 3UYOD 2ZOLA 1TTGA 2JF6A 3INUL 2LE9A 3BQUD 3OL2A 3PWPE 4QWWD 4U2ZA 3PHOB 5E56A 5GGQH 2ED7A 2EXWC 1E6JL 4JREB 4L8CA 4L8SB 2ICEB 5JBEA 4HTYA 5SWZA 4CKVX 1OAKH 1ZGLB 1AGFB 3BP4A 4H2CA 3ARGB 5FM8A 3MBED 3FFCB 5K9JH 3KPOB 4WEBL 2HFEB 4KGJA 2BRQA 4YO0A 1OOAA 4K94C 1ZHBA 1EGJL 5L6YH 3VRJB 1HHIB 4E41E 1KIRB 3FRPA 3SGEH 4APQB 3AI0A 4JQVA 4PTXA 5M17A 3AXLA 2EYRB 3EOTL 2DSKA 1H0DB 3HZKA 4M3KB 5D8WA 3VXSE 4IOSD 2NXYD 1C5BL 4J3TA 3VE0A 1T6WA 4ELMF 5DTFB 4XMPL 2KKQA 3QUYD 2K3TA 2XG5A 5GISH 3NCYP 3MA7B 2UWEE 2Z31A 3QUMH 2E9LA 3NFPB 2X8RA 3O0RH 4MD4A 5A3IC 3QFJB 2J8GA 4KRMB 2VZTA 1OAUH 1I1AB 3RTQB 4NHCH 5A6AA 2VZOA 3O8XA 1JGVL 4AZCA 3E3QE 5F7HA 4WFED 1DWGM 4MB1A 1F97A 2GITA 3O6AA 1W2VA 5F7KC 2PWHA 1C92A 4RMWA 5GHWL 5IHLB 5J6HA 3FTGA 3OKOA 4KU1A 4PGCA 3RO8A 1GL4B 5GGRB 5ISZD 5JIKA 2R23B 1IMHC 4FF5A 1JDDA 3UJJH 1CE6A 1ZT4A 1MREH 3VRLF 5C0CE 2WSKA 1MFDL 1IC5L 1RZJH 1QHOA 3TO4D 3WXVL 4LPTA 1RQ5A 3D3VD 5HHME 3NPZB 5E2UH 4F7CA 3RWHA 2EO9A 3PQYD 3VGDA 4JL1A 4PD4K 4KKCD 4KI5D 1IT9H 2BVQA 3WO4C 2OL3L 4AD5A 2C1PA 2C9AA 1QO3B 2R1WB 2V5CA 3EJJX 3ARZA 2QADB 1QTYT 5HPCA 2A1WL 1MSPA 3U2SA 2YDQA 2MWCA 5IBUG 5C1MB 4PSRA 2YD7A 5ABEA 2VR9A 4KJYA 4PTTB 4DCQA 3PWUA 3EJZC 4YBQD 5HDRA 1ZWIA 4HXBL 1T1ZB 5DMGC 3EMQA 4J3VA 2RFXB 4K3JH 5D7JD 4FNQA 1T0OA 3PL6C 3D3VB 3LHPH 4ERSL 1RZJC 4W68A 1HKMA 3GNRA 1KBKA 1B0GB 2AGJL 4CADA 1NUGA 1A9EB 2P48B 3LH2L 4MCZA 1RUKL 2Z91B 4Z7VE 1D6EB 3V5HB 3OXSB 2UUDK 1BPVA 3SDDA 1GVYA 4L4VB 2BMKA 5CJOL 4EBQL 4QAWA 2PWFA 1R3HA 3A0OA 3AYRA 4JFDD 3SKOB 1QRNB 2VLKD 4WK9A 4NXSA 4UV4H 5ECJE 1MLCA 1OGAD 1OAZH 3RWIB 1BZ9B 5CJQH 2MQCA 2VDPL 2WC7A 3SO5A 5D7JB 1MI5D 1SJVA 3LHPL 4R90H 4Y1AB 1V0LA 2V3FA 3PWJA 4NXKA 5HVHC 1UWGL 3BWAA 4LCIL 2O5ZH 1DN0B 5FB8A 1HHJB 1URLA 1YN7A 1R46A 3ROOA 3A4WA 3DXAA 3MBXH 4U1JB 4KJWD 2W1NA 1QSFB 2B1AH 4BZ1L 2GK0B 3C87A 5DVKA 1IBGL 1QBML 4RAVA 4MCYB 2BOCA 4OZFA 1HILA 1OB1B 3GJEB 4OKDA 4KC3B 5I1LA 3QCVL 3AM8C 5FUOL 4P7LA 4ACYA 1U2CA 4UQ2B 3U4BL 2ZG2A 3VFUB 3X13B 4ONHA 4EZMA 4UBDD 1KELH 4CD4A 4NC2B 5DDHA 4QCFA 4PBGA 3INUH 5EFIB 2F7OA 4ATWA 3U7YL 1U8NB 1L0XA 1DQQA 4LU5L 1MJJA 3PN8A 3SDYH 3VFVA 4PJAE 1OAXL 1IGIH 4K7PY 4XC1L 4OCWL 2H9GB 4W4NA 4OLUL 1TQVA 5D9MA 4OLYH 1HI6B 3DO3A 4XX1E 1TUXA 4YBLB 5KANI 1T22A 3WF3A 2EIZB 3QXTA 2HYMA 3C08L 4N8VG 4D0DB 5C7XL 2PXYA 3PWLB 4D6JA 4G8GE 3U4BH 3HC0B 1BBJB 5C0BE 5KG9A 1KTLA 1B3YA 2BVOB 1G9NL 2D0GA 4JKLA 4XB7A 4WV1A 4KHXL 2XG9A 4JZOB 5FCSH 1FZOA 3K2UH 5ACZA 4TUOA 1GCYA 2J78A 5M03A 3QIUB 3WKMH 4X8XA 2NW2A 3HI6H 4YX2L 1CBVL 1J8KA 4TULH 5FYJU 5CZKA 3OKOB 3A67H 3PIQA 1S7VB 1TZGL 4QRTA 2CKNA 3U1SH 3BDBA 1JTOA 3O2VH 1NCUA 1YEJL 4L4TD 1NGQH 1QFOA 4I18A 3FB5A 1B3VA 4FTVD 2C4XA 5HDOA 4KI5E 3T0WA 1NGZA 3VIFA 5E8PA 1ZWIB 4PCTA 3V4VH 1HSAB 1QVOB 3DMMB 1UH4A 5DDHB 3H54A 1UWXK 2D31B 1UEYA 2VQTA 1CLYL 4XVSH 4U6YA 5J1AB 4HXAL 1CTOA 2OXHA 3IJSA 5DJDA 5GS0C 5I1JL 4X83A 4CVZB 3T0VA 2H9GA 3BIKB 1WBZB 1E6JH 3EOAA 5KEZA 1S46A 3FQTA 3UEZA 2H8PB 1OSEA 1DQML 3E3QC 1MCEA 1P5VA 3CZGA 3TWCH 1FFQA 4PJXE 2A6IB 1AGEB 5JXAL 5E8OA 4HPHA 3QO1B 2DICA 3NDZA 4FNSA 2HVJB 2Y36L 3AFLA 5EOQL 1RJYB 4WUUB 1A6ZA 3CDFA 2J8UE 3SCUA 5CEYB 3WUFA 1FE8L 4S11A 1CFQA 2X89A 2IBZY 4PTUA 4UILH 3WFCH 1C1EL 2VXQH 3GJFA 3UTTE 4NQXA 1DBKH 4JHBA 2BDNL 4UUJA 5FO8B 5JW3H 3DXAB 2Z93B 5KS9F 3EJZD 3CK0L 5JUEH 5EIQA 5MP6L 1RUMH 1IM3B 4FZEH 3VFSA 1JBJA 3BPOC 4CGTA 3S35L 4EOWH 5JHLH 1BLNA 1H3VA 4E41D 3TA3C 2WHKA 1BZ9A 1WCBB 5SV3A 2EZ0D 4W86A 3BD4A 2EADA 1YEGH 4OIAA 4I18C 1DR9A 5DZLA 4KJWC 5B39A 3G5ZA 4LAQL 4Y2DA 3L5WB 2Z31C 4X9GA 4U1HB 5GSRB 5IQ9B 5AYIA 4HP5A 1SEBA 3PV6B 4JFDB 3NFSH 3ZTNH 5D93B 3EYFB 3QJHB 4R5EA 3IXTA 4LCYA 1IQDB 5DURB 5E8OB 3S5ZA 1IL1B 3VFRA 2VX5A 3TVMA 1OD0A 1Y6MR 1NKRA 2V2WB 2VDOH 3EDKA 3PWNB 3ULVD 1MFAL 5BV7B 4U4BA 2VRJA 2DI8A 4GUPB 5EOCL 4L8CB 2F5AL 2X9WA 1L4IA 4Y5YC 3TOPA 5DFVC 4XWGH 3O2DA 1VACB 3BKCL 2DQCL 3ARGC 5AG8A 5BS0E 4PMXA 4AYFA 4C7FA 3D25B 4PB9H 3X3GH 5E9AA 1A14L 2YBUA 1FZJA 4YEFA 4PJFE 3STZA 4YO0B 3DSNA 3C6LB 4UNVA 4L8SC 5BRQA 4OLVH 3ZE1F 2DSVA 1T1WB 3GMMA 3LKRB 1BJ8A 4OCXL 3FB8B 1X9QA 4Q9BA 1JFQH 4Q6IB 5HGBB 1II4E 1RY7B 3SUTA 4AK1A 1JHLL 4S1RL 3SOBH 3BAEL 1T0MA 1G9ML 3RWFA 3QWRA 5IEKB 2E7MA 2C26A 1EFXD 1JRHH 1CD9B 2X7LA 4X0KA 1G7HA 2D22A 4RNRA 3U7AA 3H3BC 2EH7H 1FORH 4MD4B 3I6KA 3T0DA 3HS0A 1JK8A 5CGTA 4ZOEA 3AHXA 3DGGB 4F8TA 1YHTA 4NJ9H 3F5JA 1JAKA 3NOIA 3N11A 4U0RB 4QLLA 1TNNA 1HP5A 3QR3A 4KMQA 5JW4R 2OQJB 1GC1L 1GONA 3ZKND 3GB7A 4BH7B 3T2NL 4Z7UB 3W9DA 2UYLB 3K2UL 2NTFA 3VDBA 1G1CA 1LNUA 1O7VA 3SGJC 1D6VH 4XNMA 1EJ6A 1NFIA 2AABH 4HJGB 4WWID 4N9OB 1HNGA 2UZIL 3E8UL 3TA3D 1TQUA 4U1HA 1LG2A 1QI3A 3SN6N 3QG7L 4KI5F 3PE9A 4KRPB 2HLFD 1HWGB 2AERT 2W91A 4BZYA 2FX9L 4M5YL 3TO4C 4CN4A 1UWRA 5INDA 2E9IA 2HVKA 3QJHA 4OTXL 5IUSA 3GNPA 5EZJB 3S2CA 1DFBH 4M8QB 4CRPA 3KPTA 1BQHA 5BVJA 2PI6A 3OG6B 1JGEA 3DV4A 3QSKB 2PC8A 5DQDH 1US3A 5SWZB 5DFTA 4HCRH 2EEAA 2ZPKH 4LNVA 3L3HB 1X5YA 4XPHL 3GDBA 1MEXL 3JUYA 4POZD 4TX8A 4MQXC 4AD2A 2UZIH 3MU7A 4MX7B 2OWCA 5TH2A 4HX1A 3KNBA 5IFPA 1BJMA 1B90A 1LDPL 2EXWD 4PY8J 3UTQA 3A6CH 1E6NA 2DM4A 4XT1C 2GJ6D 1CL7I 4BYHA 1UWTA 3BQUC 4WUUA 3SDXA 4PYSA 3L7FA 4LPYA 3MV9D 2JIXA 5JZ7C 4L4TA 5I71B 1FLTX 4PY8I 5FKAB 3RVWC 1IAOA 1B4JL 4P5TD 4QRRE 3X13A 5LKNA 4P59L 4MAYC 5FDWB 5GRJH 5HYQB 4Z7QE 4LSQH 4X4XB 3ECQA 3SCWA 3MYJB 4LLVA 2DH2A 1FOBA 1CICD 3BVUA 1IGFL 1Z6JT 3VXSA 4PJAA 4H5SA 1JGUH 2CMRL 4PJBE 5L2KA 4CU6A 4OZHB 4YEEA 2LAGB 3FQUB 5FYLL 3BDXA 1XF2A 4MADA 3WMCA 5C0GB 4DKEH 5FUZH 3ZM8A 2ZZUT 3GH5A 5AZEH 3QRFM 4OI7A 3TYFA 5KSAB 5E8NA 1RHHB 5C07A 1WO2A 1ITBB 1P6AB 4PJCA 4KKNA 4FP8H 5AC5A 1LO3L 5EBMB 2FX7H 5TH2B 2MCPL 5FXCH 3WDHA 1IVLA 1GJUA 3GGWA 1C08B 2Q20A 2VURA 1DHKA 4HBQA 5JXEA 3BSHA 2X89D 5HYSG 4K23L 4DM2A 1CG9B 3RQ3A 5CSBA 1U58B 3NIDE 4LL9A 4QHMB 3DMMD 1UADC 1QRKA 1HNFA 1ED3B 1QD0A 3EDDA 4OCYL 1N26A 5A2JH 3RNQA 1KJ2H 1OTSD 2OCFD 3IDIB 4NN5C 1LQ0A 4NF7A 3OSKA 2VC9A 1KLGB 3ZDZE 5HHVL 4PV8A 5T1DL 3F5LA 4FA8A 2QSCL 3WIHL 4D1JA 1A64A 2BC4A 4Y19E 1W32A 1BJ1H 5DD5H 1LDPH 5D7IE 4NJAH 3NACL 4Y2DD 5F7DA 3U36B 4HC1H 1PX3A 4D9RE 3WDRA 2YPLD 1E4KA 3T3PF 2W0LA 1I8IB 2MKWA 3QNZB 3SPVB 3RCNA 2PW2B 2EE9A 4XNQA 1B0GA 2J6EH 4KZEH 5EN2B 5MEQA 4H8VA 4CW1A 5IVZA 3TO2B 3EOBA 3WUWA 2CDEA 4OQTH 1PYWB 5F9AC 4BUHA 3CX5K 1XGTA 3EAKA 2GVYA 4HLZH 1V6WA 2G4FA 3TVMD 3L4TA 3OB0K 4UFLA 5JR1L 2V5DA 2BX5A 4PB0H 2AW2A 2WVTA 5BMFH 3MJ9A 1Y7VA 4W8BA 1I9EA 5HBBA 1H11A 4GRLA 2FECL 1KULA 2VLJE 4XPAL 2GY5A 1G9HA 1BVKA 2HKHL 3OZPA 1G0CA 1OQOA 3N17A 2YD2A 3MXWL 5E9DE 1NMAH 2YPLB 3Q2CA 1P9MA 3C08H 4GO8A 3K7UA 4GG6E 4ZUWB 2AXGB 3HB3C 3ZR5A 1ORSB 1K8DB 3IT8D 5LQBL 2AEPL 3L6FB 2J8OA 1RJLB 7FABH 5EFDA 2E3VA 1BM3L 1YMHB 1S8DA 3I3DA 5IKCA 3BT2H 3ZKQD 2J88H 4X6CA 5IEHB 2JB6B 2GCYA 3MCLH 1BJ1J 1NDGB 1QBLH 1TMCB 4WI5A 1AO7B 4M02A 4ODVL 3RBSA 4M62L 2LTQC 3HR6A 5DGRA 4OLVL 4N0RA 3EZJB 4BFIB 4YPGB 2O61A 3O41B 3OKNA 5C0JB 1FG2B 4XV0A 3HNTH 3REVB 2EH8L 2XYLA 4LVOB 4TXEA 5C0NC 3KXFA 3GMRB 4XWGL 4GQ9H 3FCTB 1G9MH 1MLBB 3G08A 4NN6B 2VLJD 3O8XB 3W11C 3POHA 1M05B 4C83A 1WCGA 5FYLE 5K9KA 4HWZA 4RFEB 1BQCA 2E8ZA 2OXGA 2WUCL 4L5FL 3C8KB 1E0OB 3A6OA 1JNLH 2MNUA 4EQ3A 1W1YA 2JEQA 1Q38A 3GRWH 4PJHF 5D2LE 3BZFB 3MV7D 3TBYA 1E70M 2B7DT 4J4PD 5D96B 2X1WL 4Y7EA 1Q1JL 4TOYL 1X6LA 5FUCE 2W65B 5IVOA 5KVEL 4YHEA 4DVBA 4F66A 2IAMC 3WFDL 3GMQA 2P47B 1FZMB 5MI0B 3NTCH 1EGJA 1UH2A 1YA5A 1YPZA 4PGCB 4Z7WE 3QNXA 5IMKB 4DTGL 1GOWA 3KPLA 2QADD 3TTSA 1U3HC 4Y16D 3PZVA 5C0JA 1JK8B 4EAMA 5B39B 2ZX9A 2JELH 4APQA 4FZEL 1PZ5B 5CGYC 5KS9A 4M24A 1VA9A 1MIEH 4Y5XA 5FKPA 1R3JB 5DFAA 1PY9A 3PWPB 4JY5H 4MXVF 2FLRT 2QQQA 2YFOA 3AHZA 3NH7H 5MERA 3SDAC 3GBNL 3BEVB 2R2CA 3OJMB 2BXZA 3CCHB 2NY2B 2A74B 1TFHA 4FFZL 3RNKB 4I3GA 2MKLC 1M7DB 3MA9L 4RL3A 1SM3H 3IU4H 3UYRL 3SCTA 4H04A 1LQSR 4JRXB 1R33A 1A6AB 3O9WA 4LCIH 4OM1L 3F5KA 2CDGA 4RMTA 4PJAF 5JDJA 3CFCL 1YDPA 4K7PL 2G75B 1SBSL 4R4FL 5IB3B 1N5AB 1TCRB 5DRWB 2ZCKL 1MPAH 3MJ8A 4U2YA 4Q58C 3IAGC 1UCBL 3WUGA 4WI9A 3H9YA 3UJIH 3ABZA 5GHWH 1KTDA 2I9LB 4TYUA 5DRXB 4OM0L 5IFJA 1R75A 4ODSH 3EFFB 1CFVL 1U8LA 3IKCB 1HT6A 1CXEA 4KFZC 3N9GL 3QUZB 2YHGA 1SYSA 1UD4A 4LSRL 4MNQE 4PJCF 1RIHH 5B3JE 1H1NA 1C16B 2V9RA 4N0UA 5BVPL 2EE3A 2CUIA 2VDKL 2OYKA 5J4MA 3U4EA 1KB5A 3BPLB 1JF5A 3R1GL 3CZJA 4NT6A 3DI2B 5FM5M 4UT7L 4D6IA 1JMZA 1B0IA 5I1EL 5FECB 1LO2L 2OL3B 4QXTB 4W4OA 3WD5L 5GSVB 4ZFOA 3DVNB 2VWEE 2WWKO 4HS8H 2XRAH 3CXHK 2VL4A 3D1MC 2KQNA 1MAKA 4HGKC 4K7FB 4M5ZH 2ZOKB 4WI6A 1U8MA 3QH3A 3ZZ1A 3RY6C 4PMUA 5F1IA 3FT4A 3LDBC 3MO1B 4WO4C 4JPWH 4JO1H 1PQZB 2DAVA 4ODWB 4U49A 1KF9B 3IK2A 3MRDA 4PIRF 4Q2ZB 1PJ9A 2PXYC 4WU5B 3WY3A 5D6CB 2WMJA 4PJCB 2LVCA 3CZEA 3F58H 4LDEB 3LRKA 5DWUL 5IB4B 4PRIB 1KJ3L 2ICCA 4JG1L 5SX4I 5DK2B 4AIXA 1UD5A 2YL8A 2OTUA 2WNGA 3F12A 3MREA 3MLYL 2PBGA 4W93A 4XBEL 1NUNB 1AQKH 3SKJH 1S7WB 1A9BB 2AJVH 2F54D 4M7LH 3BZDA 5D5ME 4G3YL 1QNRA 4MS8C 2AJZB 1MWAL 2BNRD 1HHKA 3HG1D 4HIHA 1A7QL 3BUYA 3JWDC 4XP1L 3FFCD 4H1LB 5GNYA 1S5HB 4L8DB 3P9LA 5HGGS 3W11D 1A3LL 5C3TA 2O5ZL 1HSAA 4BJLA 3M8OH 4RA3A 2H26A 5C0GA 1CGSH 2AJ3A 2YPKB 1U8MB 2BC4B 3QH3B 5DJ0A 2WKGA 4LLYB 5B8CA 4Q9CA 3SDAB 1IBGH 1NGYA 5CSUA 3WNMA 1JGUL 3GMPA 2O9TA 3HE6A 1I1YB 5TF0A 4PJ7A 4IOIA 3C5ZB 5FHBL 3W25A 4FMFA 3FB6B 4QFUA 1K9FA 3IKKA 2ZSWA 5FUCC 3GSNA 2VZ1A 4KXZH 4MYWB 4XP1H 4JZOA 5B38B 1J88A 4YHZH 3GMNB 2GSIB 1E5NA 3WF1A 2FCBA 3FN0H 2YK1L 2FEEL 2VXSL 2V7HA 4NRXA 1AQDB 1UACH 3IU3B 1VKXA 3KLLA 2AQ1A 5FK9A 2E27L 4KRPC 1IJ9A 3LD8B 4NSKB 3IXAB 4P2RA 3OX8A 2FGZA 1LO5A 4NC1E 4HWNA 1QNOA 5EO0A 3EKCA 5JOPD 3K8KA 3JV6A 3NDYA 4LF3A 3U7VA 3JSSA 5F1IB 1NCCL 1UGNA 2FIKB 3P30H 2W63A 1G7JB 1XCXA 1FGVL 3A4AA 1OSPL 3U9UB 2QSCH 1EJOL 1P1ZB 4ODVH 1V08A 4QRSB 1OSZB 1F3RB 2R0WL 3EFDH 4LKCB 4Q7NA 1D5BB 1KN4L 3VA2C 3SUUA 4A6YB 4Y7MA 4YC2B 4OQ1A 3RMEA 1I1CA 1EFXB 2FJGB 2VWEC 2EAEA 1NBVH 1JNNL 4HZLB 3FT2A 3SDDC 3J8F7 4YGVA 3OJDA 4K7FA 4JHZA 3ZDXF 5DRNB 1R7OA 4LNRB 3BPCB 4LSVL 2HISA 3D87B 4OJFH 2DQUH 1YEHH 3PZNA 4I8DA 4WY7L 2NY4D 1LG1A 4D6FA 5JHDA 1KOAA 4R4BB 4BH8B 1MCIA 2OL3A 1PG7H 3VFWA 3IDUA 1QHZA 1NLBH 5L9DL 3V0WH 1ZGLP 1CD0A 3ARFD 3GO1H 3KYOA 3VRIB 4OCXH 1U36A 4WJ5A 4ODSL 1RVFH 3CHDA 3L2LA 3OG4B 3ZYIA 3THCA 5CILH 3AOFA 4IRJB 3RA7H 4D9LH 4MB4A 3HMXL 3HTLX 4ELKB 1JRHL 2V2TA 1K4DB 4AXNA 2ZCKH 3GGWB 5T1MB 4M6OL 1B6DA 15C8L 3SKUD 5IJVA 3VG9B 4Q6IA 1MFVA 2XTJE 2YD4A 5JORA 4NKMA 4YHPA 1TQWA 4PUEA 4DO4A 3I6GA 3PNWA 4O2EB 2VVNA 4ORGB 1EPFA 1W91A 3IDXH 4HJJL 1Q9WA 1E4XI 5AY7A 2BVUA 3BEWB 2OWWA 1F6AA 4QLJA 3S5YA 4UINL 3UPRB 2HTKC 5E6IA 3ZDYE 3VIOA 2FGLA 2DB8A 5D6CA 4FQXC 3OB0H 4UDUA 4YHIA 1R0AH 5C0DB 1IAKB 1DVFD 1I7ZB 7TAAA 2EYRA 4WKFA 3VRIA 5MERB 1TA3B 1MQ8A 3OKNB 4NO5B 2G8ZA 1C91A 4GKNA 1EOMA 3NVQA 3CLEH 1VFMA 3AISA 1HX0A 1TIUA 1IC1A 2PTVA 3L7FB 5DK0B 3AIVA 3WFHA 5IDIA 4WF7A 4P46C 2ESVB 3EYPA 1M7DA 4ZUVB 4OJFL 3ULUD 1C7SA 5E5MA 4JO2L 2C5DC 3KWWB 4ZSOA 4RGNE 3VXMB 4DO6A 3K81A 4LSDA 3QISA 1WP6A 3M07A 2WLZA 4ORGA 1UQSB 3IDNA 1BYAA 4H1LG 1JFXA 3STZB 1LWHA 2A6KB 3SO3C 4HC1A 5HGAB 1A22B 1RVFL 4ALAL 1QPKA 1OGTB 2VDQL 4NFCA 2VVSA 3N1FC 4L3EE 4GI9A 2N7AA 3ARBD 2XUCA 2VH5H 4HF5H 3QIWA 2WBWB 1JPGA 1KC5L 3DIFA 4UZUA 1G01A 3EDJA 1IGYA 4Z2HA 3UPCA 4D0BA 1JIBA 3HLAB 3K46A 4PGEA 5J1TC 2UYLA 2D7TL 5LXGH 3QDGA 4PGZA 3TA3A 1JHTA 4LVHB 5D1QD 5GGVY 5JHDB 4HWUA 2WAHA 4EIGB 3VD3A 3ULVH 3MV8B 3RUGE 3WD1A 3ALXA 1UD8A 2VC2H 3LSOA 1MI5E 1N8ZB 4APQD 3QDJE 1U3HB 1H15B 1EZVY 4LARL 3TFKC 4MNQB 4Z7NE 4PMNA 4RAUA 1OGAE 3O3EB 4ZTOL 5IMOA 5C0EB 3SGEI 1IEBB 4QLRA 2FX7L 4NQDE 3K1KC 5J6GB 3VWJC 3CH1A 3MUJA 4ELKA 5I75C 2D03H 3AU1A 2A3AA 4GXVL 3U36A 1JJUA 1QVBA 4O51A 1NCCH 2B1AL 3MMEA 4BZ1H 3O2WH 4N0UE 3SKMB 1KXTA 2ITCB 3CFBB 4HOZA 1MWAB 2FR4B 1IAKA 2H1PH 5C6PB 2J8UB 4Z8FH 2F18A 5HHPB 3QQ9D 1YMME 4PTWA 3AY4C 5H2BA 3LS5H 4M8VA 2W9DH 2ZUSA 3HE6C 3NCJL 4YDLC 4F7EA 4Z2LA 4ODTL 3CAFA 3BP7A 2DOCA 4QGYA 2FGWH 5C07B 4L3CA 1NUFA 1ZXQA 2VJXA 3SGKA 3WIJA 4TSBH 2EDHA 4WY7H 2E4TA 3IFLL 2CITA 1QOKA 3D0LA 2Q8XA 2BHUA 3T2PA 1P5UA 1XYZA 1YMMD 4KPHH 1NQ6A 3RDTA 4H88H 4XP9L 2XFXB 1RHFA 1UA6L 1Q6CA 2DLFL 1NANI 3MRDB 2W92A 4UQ3B 1FO0L 1FVEA 2FIRT 4PLNC 4QO1A 2G3IA 1MFCL 3FQXA 5CINH 3TZVC 1OINA 4JFFD 4WO4B 1BWMA 2ZPKL 4R6UA 3BKJH 3ZIZA 1ODAA 2IUZA 5GS2D 1T7XA 2QSVA 5GQBA 1RZKH 5KSBE 1ISWA 4PRHB 2DKSA 3ULVL 3MLVH 4LEOB 4OFKA 3NCBB 4Y4KA 3WD5H 3ZKXC 1TVBB 2DQDL 2BNQB 1DBAL 5BZDB 5ID1A 1VKXB 3Q48A 2D0HA 1I3RB 2LVEA 1U91A 3DX7B 2RB8A 5F9JB 2JF7A 4HJJH 4AEIH 4H8UA 2PCPA 4RFNC 5HPMB 3WNNA 5LA0A 2R29H 1GCFA 1DLHB 1A5FL 4JVPA 2DD8H 1YC7A 4LGSB 4QT5B 2F15A 1T0PB 2YUZA 4DOHB 1CXKA 2RGSA 4D0DA 4PRDB 2LU7A 1V7ML 1P4BH 1FL5B 4KRNA 1W2PA 4LKXA 5C0AD 4UNUA 3F7RA 4PGEB 2FHBA 2ZWYA 1OAZL 3G04B 2BSRA 4G9FD 3BKYH 4XVTH 3L3IB 5EDXA 1F3DJ 2NY4B 3QEHA 1MRFH 4JCLA 5IVXF 2EYSB 4ZODA 4OD1H 3FB7A 3E2HC 5FM5O 4HBCH 4KHTH 3QZWA 1QFWM 4CNIB 2IALB 4ORZC 2D3VA 1U93A 1TR1A 3CVHA 5A6KA 5FHBH 5HYIA 3PL6D 4P4KB 2Y5TA 1KNOB 4XAKE 4J1UB 4PJ8A 4TNWF 1W9XA 5AAMA 1UZ8B 3CDGB 3HNSL 5F6IC 2HTLD 3ARED 5DJAA 3DX2A 3IJSB 5BOPA 1S9YB 4QXGL 4O4YH 4HWEH 4RGND 2E9MA 1A1MA 5JUEL 1X7QB 3UG3A 5CPTA 3PWPD 3VFMA 3QGVA 2OYPA 4C59B 1JV5A 3H9SB 5JIHA 4KI1A 5F96H 4XPBL 1CDHA 1OPGH 3HE6D 3OKEA 2VX4A 5E1AB 3QPXL 2WQRA 4KJQD 1OTTD 4AZBA 1G0YR 2QQLH 2YA0A 3BP5B 3QUXC 1GGIH 1BREA 1G6VK 5IMOB 2XWTA 4TUKL 3EO0A 1U8JA 1R5VA 4XC3L 5D7SH 4OD3H 1OAXH 2Q8AL 1BZ7A 4K3DH 5I5RA 3X11A 5IVXB 2HG5A 5LGHL 1XCTB 4G6FD 3U0TB 4DTGH 3IDXL 1E6OL 2AK4D 4LLDA 1XZ0B 2GT9B 4W6XB 3U7WL 1KJ3H 2CK0L 4JB9H 4LPXA 4JO3H 4NQVB 2ZG3A 3MLZL 1MVFA 4S3KA 3H7BB 1QZ1A 4HF5L 5C6TH 3QQ9C 4JRYB 5I6XC 5L2KE 2B4CH 4G6AD 5GRZA 1AE6H 3RZCB 1CNVA 3TBYB 2BOBB 4OD3L 3ZJ7A 3ILQC 4WJXA 2H26B 2PBOA 4AISA 3HG2A 4TQEH 4D0CA 4H1LH 5TD4A 5JZ7D 3BT2L 4P46A 4XB8A 5D9NA 5DS8A 4KVCH 1NH6A 4UV7H 3RL1B 2GAZB 1U95A 1F4XL 3ELAT 2CKBH 3TPUA 5MEPA 4HWZB 1RUAH 1AXSB 3DTXA 4MJ5A 5DD5L 2VB5A 2JJUA 2EXYC 2R2HB 2VZUA 5FGRA 3F8UB 3PXHA 1I9JH 1HJUA 2VRAA 3KXFE 4BFEA 5H2BB 1T0NA 4TOQA 3HUJA 1T04A 2EDFA 2OJZH 1WZKA 3GMRA 1J0JA 3OLEA 4R4ND 4AMWA 4Z2JA 4ETQB 2EDTA 2QHRL 4L3CB 1MVYA 2VMFA 3TBTB 5T5FH 2F19H 2XG4A 4P9HC 3OG2A 1A6AA 3O9WB 1ACYH 3HFML 1FO0B 2D7TH 1YUHB 3MGTB 3M46A 1OT2A 3TLRA 4JPKH 1F4YL 2DMCA 3WLBB 3ARQA 4L5FH 3VSVA 5FA3B 4OFYD 4Y5VC 4TPRL 1CVSC 4MNLA 3SKJL 4KVNL 3RWCB 1Q72L 3S5LA 1BVLA 2JIXD 4GAGL 3SHSA 1FE8H 4LLQA 1JNLL 1R24B 4GKZB 4IOFC 2VQ1B 1JDAA 2WC4A 4UDUB 4ZXBB 1HN1A 3BW9B 1C5DA 2QQKH 4OCRL 4GSDL 3U0PB 4WNQB 1XHGA 2Y07L 1S7RA 4RMSA 3S98A 3CU7A 4M8QA 3V5HA 2NY0D 3CZNA 5IXEA 1F6FB 4XVJH 1Q4NX 4PP1C 1T6VN 4IRZH 3UETA 4QRPB 5GJTL 4PV9B 25C8H 3B2VL 3LEXA 4OLWH 5I76A 5ABHA 4RE4A 4LRIC 1T7VA 2R0KH 2WB5A 5TDPB 3VH8B 5D7JC 1FH9A 3B8SA 3IFNL 5CPQA 4GW4A 1BVZA 4X6DB 4P7OA 3VWJA 1IGJA 4WFFE 1A47A 4OZIE 3KLSA 4R8WL 3TBVB 1A3QA 1FG9C 1VEMA 1NBZA 3AB0B 5FYKE 2AEPH 4LOUD 5MENE 2IALA 3BKJL 1X1NA 1J7VR 1I7TB 3FO0H 3EBAA 3OQ3B 4JO2H 3VD5A 2DBJA 4GPNA 3S6CA 3V0VA 4AWEA 1EBAA 5HYJA 2VN7A 2NY7H 4GINA 2YBRA 4GG6A 4MAVA 4XWOC 5ESAB 2E7CA 5I73B 3EOAB 3S37L 3T65A 5I8OH 3ROLB 4JFFA 1FC1A 3GXFA 3NGBB 3CZSA 1A6VL 3MJ6A 4G43B 2CEQA 5CD5C 2DQIL 3M1BB 2BRRH 2V6HA 5FGBC 4ZAKC 1A4JA 1PVHA 1IQDA 2XWBB 3EDFA 1MQPA 5HGAA 4YR6B 4NZUH 4K8RC 3UBXG 4KK9D 4TX6A 5BS0A 1KCUL 3ARTA 2P8LB 3ZR6A 3MUGA 2CESA 3RZCA 4QHLA 4Z7VB 4NQXB 5F8RC 1NSNL 2PYFA 3MLSL 2IANA 2WPGA 5A2AA 4XC1H 4HIEB 5E6IC 1YYLH 1JZ8A 3TWCL 1S5HA 1FNEB 3OAYH 3CX5J 3VGBA 5I15L 5JOEA 1PPIA 3ARPA 2OMNA 1WFOA 4JM4H 1EZVX 1EGJH 2CLVA 3RZWA 2NNAA 3TT3H 3T0XA 1V3IA 3CFEB 3RIAF 4XHJD 2X5PA 2R1YB 5I78A 1D7FA 3DRQA 4FLRA 3P11H 4UQ3A 3F7QA 1I3UA 4QRRB 3X3FH 1GJWA 4V1DE 1X5GA 2ZSVA 5FO7A 2NXYC 3H0TB 1DQTA 1NCBL 4KUCF 1Q6DA 1XGQB 4ZQKB 3ULUL 4EVNA 1CWYA 1FFNB 4HS8L 4OIBA 5C08B 5C71A 3UPAA 2BY0A 5FF6A 2BVEA 5JBDA 3RVUC 1N5YL 5A3ID 1D2KA 1GQKA 2HLAA 4CJ1A 1N2RB 2A0LC 4KRUA 5FO9B 4JZ5A 1EXUA 4EOWL 3FCTA 2XN1A 3DX8A 4Z7OF 3B9KB 3FFCA 1YYML 4Q7DA 2R1XA 4YX2H 1WBYA 3TCLB 3KHOA 4OAWA 2GSGA 3NFNA 4G42A 4F33B 3FB6A 4OF8A 1S9XB 2NW3A 5JA9A 4JHAH 4ODXA 4PP2A 1XSIA 1W8OA 3SE3C 3LQAL 4POYA 3V6FB 1ZL1A 3C09C 1DBML 1J1PL 1EHLL 5I1AA 4NDMA 3AXIA 1NCNA 4PJBA 4P2OA 4L4OA 2AJVL 3GMLA 4K7PH 2R0ZH 3AB0C 4JN1H 5CSZB 1HKKA 4H1LA 1RUQH 3FL7A 5HJ3B 1WAAF 1ZHLA 5FYJH 2GI7A 4AD4A 5DUMH 2DMKA 1JPFA 4PGBA 4N0CD 5IK3A 1IILE 1UM4L 3QFJD 2R2BB 4Z2GA 2Q8AH 1NWRA 2VSDA 4NQEA 4G6FB 1OP3H 4BQ3A 3BPCA 1CU4L 5JMRA 1K9EA 3HZVA 4XNZB 4GAYB 3B5TA 3RPIB 2Y5EA 5MI0C 1LF1A 4MMXC 1U91B 4K9EL 1M6OB 4M1RA 4KDTC 2AXGA 4HFWB 4WRLA 5ADPH 4IOIB 4GG8B 5IM7A 4BQ6A 1F4WL 3L9RB 4M7JL 4V2CB 1JZ3A 4UFJA 1WFTA 1Z9SA 4PRHA 3ALWA 1JFQL 3O4LA 1ERNA 3D50A 2YSSB 3FAWA 5A3HA 4OCMC 1LO2H 2J8UA 5DA4A 1UT9A 5IQ7H 1FO0H 1BF2A 3VWKA 3AXHA 2M26A 4YFEA 1T1ZA 4Z2KA 1E4MM 3TONA 2DTSA 5F7NC 3O4OC 2SEBA 1R85A 1WDPA 1QFWH 1R5IA 1T80A 4Y1AA 3TIEA 1EIBA 3IFOA 3W28A 4JRXE 3CMOL 2CSPA 4HV8A 4KK9C 2VLMD 3TZVB 4F15B 4HUMB 4QDMA 5DD6B 3O11A 5DJ8B 2ZX7A 1E56A 1CIDA 1Q0YL 1MJ8L 3DOSA 1CLZL 4XZWA 2I07B 4HGMA 3DX8B 4FNUA 4WO4A 2JK5B 4QHUB 5DD0H 2KUTA 5F3HB 5E6ZA 4MB5A 2L0DA 3MV7B 3AHVA 5J9PB 2R0LL 2XKNB 3OGRA 3HNVL 1CICC 2WHJA 3RRQA 4W7UA 3W39B 3MV7E 4U1GB 1Q9KA 2W9EH 1I7ZA 3KPLB 3CDCA 5C09D 1F00I 5EOCH 1AXTH 3TH4T 1BTCA 3QB7C 2F58L 3FONB 1U8NA 3QNYB 1IAIM 1XFPA 2X4QB 4AMKH 3VMPA 3OGSA 4ZFZA 3QA3A 3TO4B 3LKPA 1E4NA 1V6VA 4JDZB 2OP4H 5CEXA 5DRZB 2BCKA 2EJ1A 3G6JB 2JFEX 4HSQA 4JG0H 3FQRA 3KJ6L 5DSCB 3SKNB 2Y8VA 2NT0A 2AV7B 1N8ZA 3MLRH 1E3XA 2GTWB 3E2HB 1S7TB 5K9OB 5F7YC 4U6HA 1QW9A 4WW2B 2M1KA 4FQXB 3REWA 1SHMA 1UKTA 1NCAH 4QHKJ 1MRDH 2R1YA 3WN5B 3MRGA 1I8KA 3EJTA 3HRZB 3MRIA 2HJFA 1BOGA 4I9WD 3BO8B 2CH8A 5ITBH 3PP3K 4R7NB 2CUMA 3WF4A 1MHHB 3HPLA 2R39A 1A6UH 2V3EA 1B3WA 5BWFA 2WKLA 1HEZB 3H3KA 4DZ8A 4UFKA 5BQ7A 4OB5L 5TQ0L 4PREA 2Z1KA 3N18A 1LE5B 2VDNH 5F6HI 3JTTB 5T5NF 2ILLA 3VJ6A 4E5XA 5BZWA 3B2UD 4LPCA 5HHQA 5DYOA 3RVTC 4DKEL 5I2IB 1LO0H 5CHNA 4JQXA 3MV9E 3DJ9A 4H20H 4M4RA 4HUVA 1IEAA 3EYVB 1KELL 5HHNA 4JDTH 3SE4C 1ZBWA 3DHPA 4WI8A 4NRSA 3UTOA 5FECA 5D71L 1IM9A 1X4ZA 2QHLA 3EFFA 3S35X 3NMEA 3MODL 5AC4A 4U3HA 3PZQA 4K7PX 4QXUL 4O5LL 4NKIH 3GI8H 4MDPA 1ZANL 4HPOL 1QI2A 3HKFA 2HJLB 1DWIM 4I3RL 1Z5LA 5I1CL 4Y1AE 1RJYA 4DGYL 3P40A 1S9KC 4P8VA 3MC0A 3C6SA 1U8OB 2UY2A 1OW0A 3HNTL 4RCAA 4BQBA 1HQ4B 3HCVB 2VLRA 4HIJB 3AIBA 4JFXA 4XNQB 1QFUL 4P9MH 5D2LB 1UM6H 2BP3A 3DVGA 4BSVB 3PGCA 1OARL 3BAIA 1PKOA 3HG1A 1MCLA 2G5RA 1ETZB 1QACA 3DIFB 4UILL 4EN3A 4Y19D 3IGUA 5AWNL 3L4VA 1XGYL 1IM3A 2WZPD 3SE9L 1G1YA 3FQNB 2ICEA 2CIPA 3JTTA 5GS1B 4H26B 4I3RH 1T1YA 4R96A 1U8KA 1FH5L 1I8IA 2NY5H 1UZ6F 4K71C 5IMMB 1A7OL 1Q0XH 3QG6A 3QDJB 4UOJA 1FV1A 4X7TA 3ARBB 3OHXA 2PKDA 3LEVL 3LY6A 2VH5L 4PGDB 1AGEA 1RD6A 1JWSB 2AV1B 3S36H 3UTZB 3AREC 1CDGA 1H3UA 4RAHA 1NFKA 4G8EB 1OW0C 3GKWL 1G9EA 4NNYA 3T2NH 2QL1A 2CMRH 1AIFA 2HFGH 2IXVA 2VDNL 3KR3L 5DEFA 4NRRA 2HJFB 3GM0A 2XVNA 3TIEB 4X7DC 3O81A 3VX1A 3L1OL 3EYUL 2CIKA 3MRMB 3UCRA 1YYMH 4IRJD 3DX4A 4L3EB 2Z93A 1DJSA 1GHFH 5F9WC 4PJXB 1A4KB 2XFXA 1HKIA 4K94L 3FONA 3O3UN 3QDMD 4LSVH 3QJFB 4DEPB 2XVKA 3OR6A 2VE6B 1YEIL 4JZJA 1E6ZA 4H0GA 1L7TL 4J4PC 3T8XB 3ZT7A 3EYOA 4CVXA 5GRVL 2V7HB 5J9PA 2O9PA 4M48L 4NQCA 4WI4A 4F2MB 1VBUA 1UWIA 1RIVH 3Q1SH 2C4FT 3B2UC 2GK2A 3U6RB 5F7DB 2Z8SA 1RU9H 2W9LA 5GJSH 3BVTA 1TFVA 2XFFA 3BOVA 1E71M 4X80H 3C9NB 4YFLF 1V3JA 5ID0A 2GJ6E 3BVXA 3TZVD 5DHVA 4JKMA 2WCGA 3TJHC 2X9XA 2APWA 3L4UA 2D20A 2X4NA 3VI3F 5F6IB 1JWUA 1WAAE 4X6DF 5FAAA 3SE9H 5IR1A 4HDIA 2Q6WB 4G5ZL 4JAMA 2YC1A 1EQPA 4D8PA 2LAAA 5DVOA 15C8H 3NGBC 5E9DA 4BQ9A 3VFVB 3ZOAA 4OFPA 3DBXB 1D6VL 1OD9A 4JRYD 2AABL 1BFVL 1X5JA 1H5BC 1NGXA 1T22B 2YD9A 5I18L 3MRFA 5A2BA 4KKBC 4A6YA 1QLEL 4PJDB 3CFKA 3D85B 2NY6C 3BO8A 5E8EA 1P1ZA 4PMQA 1LWRA 2E6PA 1GQJA 1TMQA 3C2SA 1L0YA 1U93B 2XA8H 3F6IA 3DYMA 1WV7T 4UQBA 5HVFB 3PDGA 4HS6A 2R56L 4NCC2 4TULL 5DO2D 3QIWC 1NWTA 4MPKA 4PMDA 3SCQA 1AO7E 3UTTD 5GGTA 1QI0A 2B39A 3UERA 4XNUL 3AMLA 3UTSA 5T33H 2E5EA 2AJSL 1BD2A 5C6TL 4F33A 4PJGF 1YZZA 4YHOL 5GGVL 2DYPB 1QQDB 4RDQG 2PYED 5CJQL 5KSVA 1JHLH 1Y6KR 4M03A 3G5YA 2ESVE 5I0ZA 3OJ2C 1I85C 2CK2A 1FL5A 1S7XA 1KJ2L 1BM3H 3W81A 4F57L 3D39D 2G3MA 1G7QB 2WZEA 5HDQL 3MQIA 5E95B 5FYKL 25C8L 1CGVA 4GW5A 3CJJA 4LRNL 2BSSB 1A0QH 3AMKA 4PJGE 4H8WC 1U6AH 3R8BB 3QWRD 2XSAA 5A6JA 2GDUA 1FL6A 1V8HA 2X2JA 4CKQA 2X10A 5CP7B 1JCKA 1CU4H 1HJWA 3JWOC 2FJHA 5AYQA 2VXVL 5EUOF 1QBAA 3DRQB 5H35A 3GSXA 1AD0B 4HC1L 3TNMA 5FDWA 1TJGH 1OP3K 1FSKC 3WEXA 5HGBA 3SGKC 4G8GB 4Z0XA 5J11C 3SCRA 3DSFL 2J4WL 5DI8B 4NYLB 5DJ2B 5KJRH 1FP9A 1MCWW 3VXSB 1U8QB 4G6JL 4X5WA 1UR4A 5ADOL 1KJ2B 1UA7A 5I1JH 1C08A 4HPOH 1A7PL 2XGIA 4X6EA 4JZJB 4DKFH 2VLJA 3VW3H 1FAIL 1N3NA 4OLZL 1VPOH 5KAQG 4TN9A 1H15A 4UDTA 1U58A 1T20B 3SDCA 5IB2B 3ARBA 4GBXB 4MAYB 4KV5E 4NQSB 4HA1A 4FXGA 1PIFA 3N85H 2PF6A 1FZKA 2BY3A 2I60H 3LXBA 1A7NH 1GW1A 7A3HA 2BSED 1O7SA 4G8GD 2CERA 3CSYA 1D5XB 1OLZA 4AEHH 1U42A 1MWOA 3ARDA 4HOWA 4ZTOH 3CSBA 4FP8L 3NTCL 1Q0YH 3ROLA 5DEFB 4FLOA 1W2KT 4QOKD 1OAKL 1CGTA 5MP6H 1W9BM 4X4XA 2NY1C 4F7CB 2WIIA 1RAMA 2VAAB 3AICA 1UB5B 4PMZA 4XP4H 2G5BA 3LEXB 5J57B 1MFEH 3DVFA 1U2HA 4RRPA 1DBBL 3QJFA 2XZZA 4X7CC 1OGBA 5DRWA 3AC0A 4W84A 1NLDL 3NSXA 3BW9A 4S1DD 3ZJKA 3QWOB 5C0AE 2DEPA 3VVGA 3QUZC 4CMMB 5HHOE 3OKDB 1UHVA 3D0VB 1ZHNA 3CUGA 4MJID 4HK0A 2MHAA 5DUBB 3MMDA 3QG7H 5F1SA 2DQIH 4PFEA 3DBXA 4WU7B 3R0MA 5E5RB 3SY0B 2B31A 5HYJB 2XN9A 1QFUH 3CXDH 4P9ML 3V9FA 3F4VA 4HU8A 3MA7A 5KZCB 3MRIB 4NQTA 4XPBH 3G6LA 4P8UA 2ZUVA 2A3BA 1DQLL 1BIHA 1QWUA 1ZHBB 3KYMA 3OWEA 1A2YB 2E6JA 2OX5A 3D9AH 1ZLWK 1GGBL 4DWHA 2B8OT 4JFDE 2ZCHL 1MXDA 4U5KA 1FAIH 4X6CE 2Q7YA 1HXYA 4UT9H 1IC5H 1TNMA 4JFFE 3LPPA 1MCDA 1T1XA 3VA6A 5CSYA 1Y18A 4A2MA 3EYFA 3QDGE 1H0GA 5KSUB 3VFGH 1HYSD 1A02N 5DJXA 1DDHB 4I0CC 1BAFL 1MHCA 5F1KC 4F7TB 4QRUB 4N8PA 4KROC 3WL9A 1G7MB 5CBAB 5I3DA 1AGDA 1X5KA 5F1OB 4MNGE 3HB3D 2XXCB 3BH4A 5TQ2L 3SDDD 3UTSE 4HA4A 1S7QA 3AAZA 1WTLA 1AO7A 5E7FA 1EX0A 1KCKA 1KEMH 1JRHI 4GAJL 1U8OA 4AEFA 2EACA 4BQ2A 3HC4H 2V5RA 3CHCA 1WWAX 1P4LA 1YY9C 3H3PH 1MAMH 3F62A 3CC5B 2XM1A 1N0LA 2PNDA 3MRMA 1AD0A 4X6FA 3VXOB 4OOUA 2XJ7A 2QQKL 4OCRH 2IPUK 4G80A 4NWTH 2XT1B 4NBXB 4WW2F 2DKUA 2EC8A 2P8MB 2YPLA 1UM6L 3NIGE 3VM7A 2Q7YB 3WFEL 3JTSA 5C0CD 2QMKA 4DGIL 2BVYA 5D4YA 1WJ3A 1EEUA 1J05A 1R5WA 2DKMA 2X2YA 3E6FB 1SEQL 2L7JA 3H9SA 2H3NA 3UZVB 3T0EC 4HFUL 1UWEH 2DS4A 3WH7A 3LVEA 4HZLA 1T7YA 4KTEL 5I30L 5E4EC 2NLJB 3BP6A 4RE3A 2P5EA 4NN6C 2ZNWA 4WFEE 3APGA 2W65A 4BK5A 2MJWA 5IFHH 5IVZB 3V4UL 3W53A 3GI9L 2VDLL 1MJJB 1DBJL 4RFEA 3SQOH 2DBLL 1CLZH 3SEPA 5CUSL 4OF7A 1OB1A 3GJEA 5CGMA 1A21A 1DP0A 3SCOA 4R0LC 2BVTA 5BROA 5ETUB 4Q6YA 4L4JA 4EANA 4ZXOA 1TQSA 2ITDB 4JY6B 4LSUH 2CYGA 1V3HA 1FHGA 2ZP0T 3FB5B 3ROOB 3ARSA 4TSCH 4DQOL 3CK0H 3GNML 4P8WA 2MPAL 6A3HA 1OF2A 4NN7C 4E0RB 4YHOH 1CDYA 1FPTH 3QZWB 1HXYB 4LSTH 2GDVA 1IKFH 2GJPA 2VR4A 5TDNB 5LA2A 2YD5A 2AI0H 5CAYB 5JR1H 3UG4A 1FVCA 1CL7H 3WEOA 1KR0A 2NY3B 2I60L 2DF3A 1ZLUH 3UYPA 5E7BA 2R9HC 3O8XC 5GGSA 3RUGA 3IVKB 3BWAB 1OIMA 1K5NB 5CCKH 4RQQB 3DLQR 4LCCA 3OKMB 4QOKB 2V2XB 1L7TH 1E4WH 1JGLL 2GSJA 5HHMB 2HMID 1NFDE 4L8BB 4KV5F 5A2CA 5DJZB 4ELMB 3B9KD 4LBEA 4B7LA 4LEOA 4YHGA 5H8DA 3MOAL 4HHAA 3IDMA 1WEJH 2SEBB 5DUPH 5DRNA 1IGCL 3JV4B 5DO2C 4HUXB 4GMSL 4DWSD 3OBAA 1OGSA 1AFVH 4LDLB 4AENB 1BGXH 3C6LD 4OCYH 4FMKA 3T08A 7FABL 4IISA 2DGAA 3X11B 5IVXA 4UZGA 3DYPA 4OI8A 3DROB 3O11B 3P0VL 4ZNCD 5CCKL 4FG6D 5K9OA 1MCSA 4OD2B 5TGBB 1R3IL 2A3HA 3HNVH 4G9DA 3GSQB 4Z9KB 1M7XA 4KH2A 1NDMB 1VB9A 1T3FA 4OZFB 5F9WB 3D18A 1FNGA 3NCFB 4Y5VB 1DFBL 4WENB 4ZOAA 5JHLL 1F11B 3QFDA 4H0IA 2EIZA 4X5LA 3L3IA 3VFUA 5E2TL 2WLYA 2E7LC 4XPFH 2C3HA 5FHAL 4CBPA 1HQRA 4ACPA 1P7KA 3TYGH 1ADQL 1J9CT 1RZIA 1HJVA 4L4VE 3KLHD 3KLAA 4IPLA 1A7RH 3SBWC 5FYLH 2GTZA 4TUJA 3TO4A 4BK4A 3CUPB 5E4EB 5E8DH 3WQ4A 1MJUL 4MQ7A 4DN3L 3ORJA 3QHOA 1CG9A 4GBXD 4LXFA 1D9KD 2ENSA 5CP3H 1AD9A 5DJ8A 4IM4A 4Z95H 4GBXC 1ZLWH 2G41A 4YXKL 4ZUTA 5DVNA 3CMJA 3IS0X 4PJFB 1XAUA 4CMHC 5FIEA 3ULUH 2AEIT 5IVXE 1GSMA 3QIBD 1SYTA 4GO6B 4NN5B 4K9EH 3SDXB 4OZGA 2C3XA 4OT1L 2VNCA 1GPFA 2QSQA 4R0LB 4KY1H 5D7LB 5AZ2L 2A9NL 3KLHC 4LYPA 2AXHA 5IR1B 5E1QA 4L29A 1KJVA 1MAML 2BSSA 3SE8L 1MI5B 4HIIB 1NLDH 3RL2A 1BBDH 3TGXA 3QOKA 3FQNA 4E42B 4UT7H 1RUQL 3GSNL 3S3JA 3MRLB 5C6WH 3DV6A 4LGRB 3IGAA 4PUBL 4O02L 1FP5A 3FHQA 4P9HL 2HFGL 3RDKA 3C60D 2BNJA 1JWMA 5JW4N 1GOIA 3HUJF 4MAUL 5I77A 4R26L 2X4OA 2NCMA 3ZHKA 1RZ7H 5CS7A 4EN3C 1JUFA 3IKCA 4TVUA 1PLGH 3CMOH 2YKLH 1V3LA 3PV6A 1IGJB 4HH8A 5BOZG 3OZ9H 6FABL 4PJ5A 3SBWA 4AG4H 1MCPL 1A3RL 4GW4B 3RU8L 4P5MA 5IGXH 5EBLB 4UIMB 5JPMA 3N0PB 2XFRA 3H0TA 4FQIL 4P23A 1XSKA 4R3SA 5BMFL 1TJHH 5IFHL 3W9DB 1KBGH 4FHBD 4GW1A 4EJ1C 3CZKA 1NC2B 3HJEA 1V02A 3DXAE 4URIA 3NIYA 4UQAA 1I1AA 3RTQA 2HTKD 3WV0A 4ZFOB 2F1AA 3RX8A 3ZE0E 4I2XE 2DSUA 4D6DA 2NR6D 2V2XA 3WLWD 1TVBA 4PJXA 1KSRA 4M56A 4RISH 4EEEA 4NFDA 4Y16C 4WSJA 3ZHDA 4JM2D 2GSGB 3NFNB 4G42B 3RGVD 4JVUA 1VESA 1ZVHA 2UV3A 4P57B 4BZ2H 4Z78A 5FA3A 2F53E 3KPPB 3IJYA 3QEQA 3FAXA 3GIZL 1T1WA 5FKPB 4R7NA 1NFIB 3KPRA 3PGCB 2VL5B 5EWIL 4NQUA 2MOVA 3RY4A 1I1FB 2P5WE 4ODXB 3KJ4B 4QRQB 5H37H 2VRKA 2ZJSL 4AT6B 4XHQA 2Q76B 3BPOB 1IAII 4MB3A 1GUVA 2OSLB 4ZTPL 3IETB 2Y24A 2ZXQA 1V3MA 2PTTA 5ID0B 1S7RB 2ZWZA 4HGWA 5GS1A 4FNPA 2RGMA 5BRZD 3GSOA 1AMYA 5TPWH 3NJ3A 4M6ML 5IB1B 5JMOC 2NY1B 3KYMB 3ZKXB 1RFDH 4QXWA 4FLSA 3N13A 1JL8A 4Q97A 5T3XD 4JJ5B 3IDJB 3CDYA 2ZJSH 5EA0L 4DVRL 2O26U 3QQ4A 3TBVA 5C8JA 5LJYH 3WXWL 4MD5B 1FH8A 2DQEL 2NY2C 2QTEA 4NNYB 4LSUL 1HE7A 4XNZC 5EU6A 1CE1L 5FUOH 1ZANH 1G9NC 1HKLL 5TE4L 3B43A 2W0FA 5GXBB 1AXTL 1ISZA 4W81A 1OM3H 3HAEB 1H3GA 1WFNA 3BUTA 1GC1C 1XF3B 3BX7C 4OKVB 5IT2L 1MCFA 2UWEF 2OK0L 4OD1L 1D9KC 4QYOA 2X4SB 1ZEAL 3VI4E 4TOYH 5J13B 1JZ5A 2G5BB 3RWFB 4PYHA 4X98B 4OZIA 1ZHKA 3DDFA 3MRJA 3I3BA 1W3KA 4NQED 4U1KB 3J7HA 3LN4B 4UIKL 4PRHE 2HRLA 1T83A 5ISZB 3L4ZA 1PD6A 5IJKC 3ESUF 2I25N 4MXWH 1DANU 4PJ7E 4D6GA 4JE4B 2MPAH 5E2VL 3BVNB 3AQUA 1JPSH 3A6CL 1KCSL 1ND0A 3IRPX 2AEWA 1TJGL 4MA3A 2QF8A 2WCSA 3PHSA 1ORQA 3AIUA 2GW5A 4AJ0A 3BXNB 3RVWD 3WFCL 4XC3H 2FEDD 3WY2A 1K6QH 2YD1A 3KPOA 4HPGA 1P53A 1ZJAA 1QFWI 3UP1A 4D2NA 2GT9A 1TCRA 1RK0B 1UXSB 4ZUUB 2R2BA 2CCRA 5T1MA 1NL0L 3T77A 2IH1B 3UPRA 2UWEB 3PWVB 4I9WE 5I15H 1DZBA 2A73B 3I3EA 2YZ1A 2C7UB 3EO9L 3P73B 3NA4A 3SCMA 5L6YL 2YUXA 2I9TB 1KLUA 5DI8A 2PW1B 1Q8MA 4D6HA 5KN5B 3QA3B 2V3GA 2JCCB 1UQSA 4K07A 3ZTJG 1JD9A 2AJUL 4XCEB 2JCCE 3MBEB 4FQXD 3D85A 5I16A 3NZ8B 3V6BR 5DSCA 4NRYA 5IIEB 4GQPH 2VLJB 1DCLA 2DBLH 1TXKA 4U1IB 4W6WB 4OF3A 2W0PA 1T2XA 3OF6D 3LKSB 4ZUVA 3CLFL 3A22A 1KBBA 3SO3B 4TTGA 1R5IB 2WWKT 3UEQA 3D69B 1I8MB 4FQCL 1VGEL 1FZOB 3SQBA 4HMEA 4J3UA 3QCUL 3RIKA 5BVPH 1KCRH 4GKNB 2YOCA 3MUHL 1BVLB 5E5UB 4V1DB 3FRUA 4KUZL 4ZUSA 3C5ZA 3GXPA 2HN7A 1LP9F 5IG7B 2UY6A 5BXFA 2D7MA 1U8JB 2NY5C 3MNWB 3EO0B 3EMZA 2Z35A 2X4PA 2BDNH 5DO8A 4S0TD 1NM9A 1TPXB 3T0EB 4JJ5A 1A3LH 3PZ9A 3WKZA 2I07A 2VAAA 3B5HA 4OZ4A 5LCVH 3BH8A 5DR5L 3MRCB 5EFIA 5HYJE 1EEZA 4R97B 2APFA 3IS1X 2BJML 4P4RB 2CBUA 4RMQA 5CZXC 3MR9A 3AREA 2IPKA 1VADB 1EOKA 3V5DB 2DQHH 5CP7A 1S9WB 1KB3A 4U1SA 4FNLH 5D5MB 2Y9RT 2QSTA 1UYWL 4WKHA 2ARJA 2IPTH 3QUKA 3S8WA 4JRXD 1S7WA 5T1KB 4WU5A 3O45A 4YDJA 1JZ7A 5DRZA 3PTMA 1XF5A 1VGKB 2ARWA 3LZFL 3W38A 3BD3A 2RCSL 4H8WL 4XAWH 5A8QA 3KYAA 2NY2D 1JYVA 5FUZL 1SJEB 3JV4A 4PRPD 2WV3A 1KLFA 5I0DA 4RWHA 1FG2A 4C58B 5C2BL 3WFBL 4CMHB 4KZDL 3CUHA 1JGDB 4JHWH 4LLMA 4UU9B 4QTHB 4XCYB 3WQVA 1OAQL 1A6WH 1SZNA 2L7UA 5FGSA 1ONQA 4OI9A 3AJ7A 4QXTA 1ED3A 5IEHA 3KAAA 3OAZH 1LL6A 3L5IA 1QRNA 3P3YA 5MENA 3D0LB 4A6YL 3ZLQC 1KB5H 4G7YL 3GJFK 4Z0BH 1GGYA 3LKNA 2CLRA 3OXRB 1NCTA 3D25A 2PTUA 1CFSA 1UC6A 2AK4B 1A9EA 4Q6IC 4NQCE 1O7AA 4R27A 5F89A 4CDHA 4JY4A 2VCAA 2HRPL 1HQRB 4WI2A 3T77B 4JAWA 4S1RH 1R3HB 3X14A 4LSRH 1W9UA 2QQNL 1MWAA 4Y19A 2FR4A 1A5FH 1QX1A 3IDYC 2FRGP 4GZEA 3RI5K 1NUDA 5HDQH 1E27A 3D3AA 4AIOA 3SJVE 4JPKL 5EIIA 1XGRA 1HP4A 1KN2L 3MSPA 4I1NB 1CN4A 1RK0A 1UXSA 1GZQB 2FX8H 5IK3B 3DRTA 1J8HE 5AYUH 1F4WH 1K8IA 4OLZH 5CBEB 5HGDA 5JW4M 3S88L 1UJTA 1TDQA 3IJHB 3G6AA 4P3DB 2BVPB 4HOXA 2HLAB 4YGAB 4PRDA 4TVPE 1KEGL 1IM9B 2JJTA 1WEJL 5JHDD 3KLDA 4TRPL 8CGTA 3QUZD 3Q3GB 2X1PA 4HIXH 1JAEA 3ZYZA 4OLXH 5J6GA 5I66A 5JO5A 5BVJB 3R06A 1PDKA 4LPVA 2AK1L 2Z91A 3ARFA 4D3CH 3GUTA 4RWYH 5ICYB 3MODH 2J2ZA 2Z35B 3GBDA 1B0WA 4PD4J 1V7NL 3D0VA 2DJ4A 3B3IA 5DHYB 5DK3A 2FHFA 5E1HB 5DHVB 3U83A 1BWWA 5KN5A 4U1LB 3M45A 1MY7A 5GZOD 2G60H 1IC4H 4X0KB 3WH5A 1W0VB 4IHOA 4S2SA 3JVGC 3TV3L 1KENH 4YR6A 5L0QB 1KIQA 4YFLI 1E1FA 1JPTL 1KB5L 4S3JA 3HI6L 1CBVH 5IGXL 2H32B 2YMXH 3ILPA 1TZIB 1I7UB 2X4UB 3X12A 2HT2C 2DJSA 3ISWA 2C3WA 3EDEA 1QW8A 3RWEB 5BW7A 1JNEA 3JUGA 3C09B 3MLXL 4HJGA 1QFHA 5A8PA 5CZXD 1W9DM 2NX5E 4I3SH 1JF1A 3QUML 1R34A 1FV1B 2EPNA 5DXWA 2VXVH 3BPNB 1I8LC 4PJFF 4M80A 1N6QH 4L3EA 4L1HA 2NR6C 2BHZA 4HH9B 3IANA 2VDML 3SQOL 5C86A 5F7LB 1Q72H 3NPSB 4U6TA 2J7CA 3NSNA 4M81A 1GNXA 2I9LA 1U8HA 5CBAA 1DSFL 4YDKL 4MQSB 3KG5A 4NFBA 1INQB 2E0PA 2FBOJ 3F7YB 5ALCL 3RVXD 1N6UA 1YDPB 4MNMA 4WEBH 4FFZH 1K4CB 3WFZA 5DHVH 1WCQA 5C0DA 4KROB 4QY8A 1HTYA 4K3GA 1MF2L 3R8QA 3QDMB 2JALA 2OR9H 4RNRB 4H88L 3TT3L 3ZO9A 1DWFM 4GRWE 1AKJD 4X0VA 8A3HA 1ND0B 4WFFD 1OTTC 5KVGL 2D24A 3TH3T 4JFPB 1RV6X 1B2WH 4MD0B 5CEZL 4GIAA 4XUYA 3AAZB 1C5CL 2XTJC 1Q9LB 3OGCB 4GMTH 1HZHL 4MD5A 4P4KC 3VIIA 1T2JA 3SJVA 3AU1B 3PGFH 1TQTA 3HU7A 1KEML 2OW7A 1CFQB 4PTUB 3MRNA 3RWGA 2J6EA 4NC0B 1ZS2A 3UJJL 3HRPA 4PB9L 1LP9A 1J18A 1NOUA 4EI6B 1DBMH 1MFEL 1GXEA 3SIMA 2V2TB 2F54A 2OW6A 5E0FA 1A6VH 4G6KH 2DD8L 2X9YA 2PN5A 2OSXA 5D1XA 5CBEA 1YJDL 4LCWE 2WWDA 4FNRA 3B6SB 1MHPL 2CO7B 32C2A 1ZKAA 3BISA 5IOPA 1MJ7H 1EHXA 3VSTA 4N0FA 3K1DA 5HVGB 3PABA 2Z31D 3HA0A 3MGTA 2IF7A 3DUUB 1A1OB 2APTA 4RMVA 3LPWA 1E6OH 1GRWA 5MHSE 1IC7L 4PLKC 3I6LE 4XI5D 3QT2A 1I1FA 3QI9A 2XNAA 3BQUA 5F7EL 5FL0A 3ZE2F 2P5EE 3L1OH 1FYTE 3CIVA 4FQJH 5J1SC 4FXGB 4X6DA 4Z78B 4TVPL 3A5VA 1JNHB 1A6WL 2I27N 3VCLB 3X14B 1C5DB 2C0HA 1W3HA 2QR0B 2VUOA 3RBGA 1V6YA 2GK1A 3OGCA 4JKPH 4MXVE 5ISZA 5IROA 3KXFD 1UG9A 2IFGA 3ZE0F 4AMKL 1ZA6A 4XP9H 3KE0A 4LEXH 1UCBH 4P2OD 3WFEH 4JDVA 2DL9A 3MRNB 3RWGB 4PJHB 2UY4A 1PS3A 4YHYB 4U3XA 4IIQC 4P2OC 5E6YA 3C60B 2NY6B 5C3LD 1FIEA 2O93L 5DMIL 2P5WD 4CCCA 3B2VH 2HJKA 4OLWL 1ZVSA 2GFBA 3MSDA 1A7OH 1Q0XL 1Z0NA 4YBQC 1BYCA 3FO2A 3GH4A 3SDCD 2F53D 1V0MA 3HC4L 5I75B 5H35B 4NI3A 1E4JA 5L2KD 2X0HA 2NX5B 3H7BA 4QGTA 4DAGL 1KG0B 1NGWB 2VYRE 4Z77B 3C6LA 1TJIH 1WZ1H 4FQIH 4GS7C 2MANA 1WK0A 3KDMA 3OIHA 1Z3GL 2WC3A 2EDXA 4W5ZA 4PG2A 1NANH 3M6DA 2KZWA 5C07D 5E0CA 4W6YB 5E8NB 1HWWA 3VNYA 1CICB 1W3JA 2WBJA 2CGRH 4L8DA 4P2QA 4EBQH 4ZDHB 1NCWL 1B4RA 4PRIA 3KLAB 1T89C 4A2LA 1WF5A 4P2RE 2JELL 1QSEA 3MRRB 1O6IA 1CTNA 3U46A 2R2HA 2YR3A 4MJ2A 4C56E 2YS4A 2XPKA 4LMQE 5HHPA 5BXFB 4Z2IA 3VDCA 4I0KA 1XH0A 2P5WB 2VIRB 3CXHJ 1FDLL 1FQ9C 2Y4SA 4Y4KD 4TSBL 3M17B 3F5WA 1IAMA 1ZVSB 4BUGA 1IFHL 5LG1A 4QHNB 2GIYA 3TV8A 1SMAA 4PJAB 5T1KD 1YEKL 1YEJH 3QO0A 4PV8B 1FVDA 1HILB 1Y0LB 4XAKD 2HT4C 1UR2A 2YL5A 5DT5A 1XF4B 3KHQA 3GSWA 4PEEA 1EMTL 1HI6A 3MOAH 2VZ3A 2FSEB 1RPKA 3OV6A 2DQJH 3D5HA 4R0LA 4EUPA 3L3HA 1CK0H 4KQ4H 5EULV 2J7EA 1F4AA 5D1QB 5EB9A 4YXHL 1G9NH 1PKQE 1BBJA 5C0AA 4WHDA 1WIUA 4G9FE 1CGWA 3HZ3A 4BFGA 1V6UA 3KVQA 3QWOA 3CPLB 3IFLH 3DECA 1A14H 4ZUTB 5EZJA 5TE7H 4HZ7A 1QSFE 1UKQA 3NZ8A 5CJXA 4TPRH 4Y4FA 4UU9A 2IAMB 5I71C 2COQA 4KVNH 2W5FA 3LQAH 3DPBA 2V9TA 1XD1A 3NABL 2CBJA 3I9GL 3UDWA 3VXNB 1CIUA 1WBYB 4HG4K 1QLFA 1K3IA 2AJXL 3MYJA 2MQ0A 3DARA 4R97C 4HW6A 2XWJA 4U1JA 2WIMA 1CF8H 4JRXA 5KSBF 1NEUA 1INEH 3DYOA 5HPOA 5FF6B 3BUIA 3KLKA 2HFEA 3PABB 3EYSH 5HI3C 1KG0A 3LPOA 4OJYA 4PJDA 4Z7UF 4NCDA 3A6BL 3HN3A 3BRGC 2WMGA 1MFBL 2WMIB 3SCSA 5KSAA 2O5YH 2ZSVB 3T2QA 1GH7A 5M95B 5IB5A 2CKBL 5E8PB 2F74B 5IESL 3UJTL 5C8BB 3TN0C 2I24N 4OZIB 2ZXBA 1ZGLM 4HAFA 3UTQB 3UTPE 5CWSB 3V79C 3AROA 1MPAL 1CCZA 4N90E 4GKSB 3C5SB 4AIUA 3QHTC 3W24A 2AK4A 4J23A 1YN6A 1HIML 4M7LL 5HGHA 4L4TE 2KQMA 4PUBH 1JWUB 2B4CL 2WXDM 3CHFA 1U3ZA 2XSBA 3GSNH 4WUUE 5DQJB 5IW6B 4W8LA 3BYTA 4HWBA 3WUWG 1ZK9A 1DBKL 2OI9C 2EDJA 4G6ML 2RJMA 4YQXH 2XZAH 1Z9LA 1CYGA 3H6JA 2YIHA 4F15C 4IRSC 5D9SB 4Y5XB 5TE6L 5H94B 3OAUH 2F1BA 3QQ4B 2WZIA 3DX3A 1JXKA 4NUGL 1BGGA 2EEBA 3G5VA 3UAJD 5F6HJ 4BSWA 1JZ2A 2CDGB 4R9HA 4DUVA 5E08L 4YXHH 2DSZA 4Y5YA 4LLMB 1YPZF 5DLMH 4OZGF 2OYMA 1U8PA 1HIMH 2IANE 5E94B 3QUYA 3QXAA 4RZCB 3OKLB 2BY2A 4TUKH 5ALCH 2OSYA 3H9ZA 4MWFB 4PLJC 3O4LE 1JDCA 1KPVA 1MAJA 4XCFH 3BWUC 4YZFE 5T5FL 5I76B 5DD3H 1RZKL 3A23A 1RZJL 3WXVH 4CN1A 1EDGA 1XF2B 4YHKH 5JBFA 4KGLA 5D1ZA 1LK2A 3IXTB 5ELIA 1SR0A 1ZBCA 3MS8A 3LQZB 2P44B 2DI7A 4QTIL 4J2XA 4MA7L 3F12B 3O2DL 2VTFA 1CXFA 1FNAA 3KXFB 4ODWA 4H41A 1LD9B 2V2WA 3RWEA 4Y2DB 3P0YL 1EEYA 4I2XB 3BZEA 1I7TA 5A95A 2OSLA 2VX7A 4PRIE 4U6XB 1ORQB 4GLRI 4HKXA 4RRPG 1HCVA 5DQ9A 2YMXL 5D1QC 1PZ3A 1PAMA 1Z9MA 1BFSA 1GPOL 2E9WA 3VXPA 2XQBH 5EB8A 35C8H 4JM2F 4XBEH 5ADPL 4TVSa 2J79A 1RULL 5JQ6H 5C0EA 3FRUB 4M7ZB 4OV6F 1RP9A 1UD2A 1CENA 5GGUA 4Z7WB 4K3JL 2A74A 1OWRM 4QF1A 3RWJA 3AZTA 4Y8DC 1OCWH 1MCHA 1OGTA 1RI8A 2R4RH 3IJHA 3NIDF 43CAB 3KYNA 1WWCA 3I84A 4KK6D 1MW0A 4ONFL 1LEKB 4QCIA 3IDNB 4LRNH 3T1FB 3O3EA 1XCQA 4P23C 1BFOA 3O2WL 1AHWA 3O4LD 5E2WL 2AOSA 5FV2A 5T3ZL 3FO9A 3ESVF 3GM8A 2XVGA 4GO9A 4X80L 4C55A 3GBML 4WWKB 2N4IA 2H8PA 4PG9A 1HDMA 3ARFC 5DMKA 5KZCD 4NCC1 4LHUB 1I4FA 5A40E 1UD6A 3TBSA 1PYWA 5D7LD 3WE6B 3WDJA 5FDYA 2A9ML 3QHFL 4HCRL 5INCB 1X5ZA 4DW2L 1VACA 4YAQA 3MLPA 1AXSA 3K2MC 1T66C 4LLUB 3UBXA 5IBTL 1PG7L 1UWXH 2EYTA 2WP3T 3VXRE 4CU8A 4NKIL 4L4PA 1JZ4A 1T20A 3VH8A 2J12B 3A24A 3BESR 4KPHL 1RZ8B 5JIWA 2FYYA 1RUML 1MVUB 3QQ3B 4W7VA 3UTPD 2MQ3A 4X5XB 4AEEA 2XOTA 5A8NA 2FYVA 3HPLB 2NZIA 4R8WH 1ESWA 1T2QL 4G6KL 2XWEA 1YUHA 1NFDF 1MCQA 4I5BA 1OGAB 1ZSDB 5E94A 1HVQA 4ZG1A 3JUZA 5DJCB 1C5BH 1S9YA 3SGDH 2F7PA 4W88A 5B3NA 4U1NA 2ZUWA 2Z4QA 4HAGA 1FH5H 4Y8AA 2X2HA 5F93C 2ORBL 1VFUA 2IADB 4JPIB 4YE4H 4F9DA 5I1GH 1C8YA 2D9CA 4Y4FD 1S9WA 4TRPH 1J5OH 2AQ3A 2D03L 1ZOXA 1K6QL 4XH2A 5ANME 5IW3A 2VXUL 3WDQA 1GYAA 4KROD 3ARWA 3O3DA 5IBLC 1YEKH 4LSSL 4ONHB 4B0MM 4PJ7F 4Q9RH 3MLVL 5IHZB 4PRAB 1N3NB 4XTRC 5D4QA 2CKBA 4IIQB 1CD8A 3GHBL 3DHJA 3DROA 4P4RA 1H2JA 1AD9B 5IWLC 3QRGH 1PQZA 1QLRB 2OLDA 1Q6FA 3DX6B 1F4HA 4Z18A 2J47A 3MRLA 4WCYH 4QRSA 1Q6EA 3K4DA 3O6FA 4IMLA 4RGNB 2XGBA 1KC5H 1E40A 4QOKE 3V5KA 4K71B 3GI8L 2NX5A 4QRPE 2I5YH 4CNIA 1UKOA 1RH9A 2NW2B 4YXLH 4IS6A 3W5NA 1FYTA 4KVCL 4UV7L 3P77B 2FDBP 4E8CA 1RZIB 3FN0L 1SJEA 4WVRA 1TVHB 2ESCA 1VHPA 1BECA 3I2CH 3FN9A 2PWGA 3WQWA 2BSRB 5JUVA 3HC0A 3CVIL 4OFIA 5B38G 1QSZA 1LE9B 4GZJA 5GSVA 3QHZL 5DD6A 2GEEA 3O45B 4YDJB 4GQQA 1A3HA 3GTNA 1S7VA 1GJIA 3LKQB 4Q74A 5CSZA 4Z7NF 4JHAL 4J6RH 1S5IH 4E0RA 1QSEB 3MRRA 3OKEB 1E4LA 4YBLC 4ACZA 2D7OA 3W6LA 4JFVA 1NEZA 2FBJH 5T1LD 2D2OA 4DWSB 4XVUC 4UQEA 2GK0A 1A0QL 3S35H 4CVWA 2DQEH 3KL0A 5F96L 2H6PB 2C1OA 4F9PC 1EXPA 2HFTA 4ZS7L 3NUKA 3DRTB 3MROB 5TDOA 3QXDA 4JO1L 2WZHA 4LKCA 4PLKD 2QQLL 4ZXBC 2VO5A 3GNOA 3LPFA 4GAFB 5D1ZC 4W89A 4ZQKA 3TNNB 4XCNA 3E0GA 1WIOA 4WFGE 3TH2T 3BE1L 2GJ6A 1F3JB 3EGSB 3AMGA 3FO2B 3QIUC 2QPSA 4MA1C 4XVJL 5D7KE 1X44A 5EU6D 4GAYA 1FLRH 3VXNA 3IF1B 3EW3B 4IJ3B 4E41A 4PCSA 1MRCL 3GK8L 4MA3B 4M62H 2R0KL 2PB1A 3OR6B 1V5JA 2XA3A 2VABB 4Z76B 2XV6B 2D4FA 2PW2A 2VUYA 3L3KB 5DEGB 1MFAH 4NO3B 1U8IB 1BYBA 4ISVA 2W9DL 4F9LA 4YNYB 1U3HA 3V0AC 2ZOXA 5CIPA 3GIZH 2XQYK 4QHKI 5I2UA 2EPMX 4MNHB 1S3KL 5ACZB 1QG3A 1F13A 3GSVB 3GMMB 5J12B 2BFGA 3S5LG 2B20A 4P7QA 1ZBVA 4TUFA 4MCZB 5D6DC 3PP4L 2MCG1 3EJYD 2C7UA 4F9JA 3C5ZC 3MXWH 3HAEH 2DPEA 2PO6D 4I0PD 1BAFH 3QO0B 2ZWLT 2J3SA 5DFVD 5F1NB 4EDXB 3O2DH 4ZMAT 2BRRL 1UR8A 1YEGL 1DBAH 2DDXA 3F7VA 3P0YH 2QHRH 1HXJA 1QLRA 1WDRA 4AEIL 4I48A 2DQUL 4JFHE 1EQCA 3LKSA 4PLJD 3AXLB 1PZUB 3N1QC 2J7LA 5DMJB 1J05B 2YPVH 3EYSL 1R0AL 1AC6A 2ICES 4KJQC 3MNZB 3V4PL 1DVFA 4JGUA 4AH2B 1HVXA 1QKZL 3GSQA 4FG6C 3PGDA 2UZXB 4O58L 5EG6C 2VX6A 3N1MC 4OV5A 2HN7B 4MGXA 1QI5A 1U8PB 3DX9B 5DUPL 4OF0A 3NAAL 4AENA 2Y06H 4OM1H 3CC1A 4NKQB 1UASA 3WHXA 1F3DH 1Q9OB 1FNEA 2FGWL 2R69H 3T0BA 3AUVA 5F9DC 4JPVH 5IV2B 1J0IA 1QNPA 2WINA 1LEIA 3NZHH 3SKMA 1T1YB 4RX4D 4YPGA 3FO9B 3QIBC 5CD5D 4B15A 1I9RL 2AKRB 4LGXA 4FQ2H 1PX8A 3UO1H 5F9OL 4HU0A 1UZ6E 3GRWL 3HZMB 5E6IB 3LKOB 5L7XH 4M00A 3JWOH 2DT2A 3T4YA 1G7HB 3WBDA 5J7CC 1FVCB 4YIQA 1MIEL 3VPLA 2VZSA 3B9VA 4FFYL 1MFCH 4HKXB 4NRYB 5CINL 1HH6A 3T4AB 3D4YA 2WYSA 2IQAB 5KZ6A 2EXYD 2NW3B 3W82A 4KXZI 3FOMB 5EBLA 3S37H 4XRCB 2AAAA 4DZ8B 1UOKA 3A67L 1CE1H 2QKIA 3QNXB 4X98A 4OV5B 2F5BL 2QJDA 3VDHA 3V6ZA 1GOMA 3JWDH 4XNMB 3WFHB 1ODZA 3QR2A 3BQUB 3FFDA 5HI4C 3NSMA 3LEYL 5D1ZD 2F54B 2DIEA 4EN3D 4JFOB 3VXRA 4I77H 3D2UB 3WDPP 3FB7B 1KGWA 1IZKA 4P59H 3MV8D 32C2B 3MJ7B 5I19L 1WAWA 2VDRL 1OAYL 4NQSA 1TPXC 1S7TA 4XBPB 2G75A 5IB3A 1CZ8H 3GIVB 4M82A 4QF1B 5F89B 3Q6FA 3L3OB 4LHUD 4AMCA 3JVGA 4DZBB 3W0WE 1Y18B 5BW7C 2ZUMA 4NBZB 1BEYH 5BXSA 4BF7A 5JHDE 2VDQH 2WMKA 4ZO6A 4Y2DC 3LXCA 5JXAH 4ZO9A 3ALFA 2FH6A 2HRPH 4TUOB 3VI4F 5EO9B 1H09A 1ZHNB 4AL8H 4ZEPA 2DT0A 3DMMC 4ZYKB 1QRND 2VLKB 5IHSA 4CVUA 3CVHH 4PJGA 1KCLA 2A1WH 2VCCA 1LD9A 1XR8B 3UAJC