1TCMA

Cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
total genus 201
structure length 686
sequence length 686
chains with identical sequence B
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tcmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tcmA01
3IAGC 1E4WL 2YD1A 3ESUF 3OAYK 1S9WA 2XWBA 1NCTA 4G3YL 4KY1L 1A9EA 4M93B 4N0FB 4JZNB 3UYRL 1LO5A 4PTUB 3ZT6A 1WBXA 1XGYH 4JO1H 5EZIH 2VLRD 4Q6IB 3CLEL 3MNZB 1IKNC 2OBGA 3VA6A 4XI5D 3C09B 4OUEA 3NAAL 3ALWA 4F79A 1T7VA 3BVTA 2X4TA 4TUJA 4ACYA 3KLLA 3IGAB 4AT6B 2ERJB 1AD9B 5H35A 4H25B 1A0QL 2C3WA 1KF9B 1NCWL 2OSYA 2I07B 4P2QE 1A21A 4O4YH 1IAOB 3WN5A 4K3DH 2CGRH 4YAQB 1BOGB 1T22A 5D70L 4MWFA 3LDBC 3UJTH 4CAGA 4KXZH 4HUWB 1NCUA 3RAJH 4LLDA 5IHUH 1QR1B 3K2UL 1TZHA 5IK3A 2EC8A 4HIJB 3NH7L 4XVSL 1CBGA 4HKZA 1HE7A 1FG2B 3RU8H 3KPSB 2PCPA 1LGVA 1IC5H 4LCIH 3IK2A 3UTQB 3FRUA 1BVLA 1REIA 4BFIB 1GAFL 1WDPA 2WMJA 1EXUB 1M05A 5SX4I 3C2AH 3CMOH 4D8PA 5BOZG 3A23A 5CWSB 1HHKA 3IDXL 3QISA 1FYTE 3NYDA 1OY3B 2HAZA 4D94A 4GIAA 4I0PB 3UTZA 3H3PL 1MCEA 3WNLA 4I5BB 4QHNA 4B16A 3VFOB 3SDAC 3NCBB 5H37H 4Y2DA 2C3HA 4OQTH 3SUSA 1UKSA 3NCMA 3LIZL 4O9HH 3SKOB 3Q6FB 3R4DA 3G5VB 1E27A 4YBQD 1HHGA 3UR8A 2ZXQA 4OLVH 1B88A 4BYHA 4KJWC 4DWHA 3RWHB 3NIGF 3EZ8A 3BC9A 4CVZB 3AYSA 1U8OB 1OAZH 3S36X 4GW1B 4LSVL 3OJMB 3DV6A 1YYLL 3X14B 3O2WL 5DRNB 2YK1H 5I16B 1WSST 3QUXC 5F7LB 3WNKA 1AI1L 4GAJL 4OCYL 5J1AB 4K3JH 1EOKA 4W7VA 4JDTL 1B4JH 1G7QB 1UCBH 4N8VA 5JOFA 5EU3B 4HWNA 5HBBA 5I1KH 4C59B 1MCFA 4HZLB 3CFBB 4JKKA 2WMPA 3SDDB 4TNWK 1MPAH 5DGRA 3P0GB 3MLYH 3CC5A 3PL6C 3ARTA 4H26A 2AJVH 3ZYOA 1ZTXL 1CF8H 1DBKH 2KZ1B 1VACA 2X4SA 3X3GH 1ES0B 3L3OB 5JIWA 4PV8A 1DBBL 4ELMF 3CU7A 2JKXA 3DRQA 2RAMA 1G9NH 3W81A 1TTGA 4FLOA 4QOKA 4JY6B 2J7HA 5EO0A 4GAYB 4BFGA 4UQBA 4PRAA 1L7IH 4OZHF 1U0QA 5AUMA 1T7XA 2X1WL 1QLEH 4KROD 3P73A 3M7SA 1SY6L 3MRFB 3OQ3B 4KJPC 3EYPA 1JGDB 4IDLA 3S35L 1FORH 4ZSOB 5AZ2L 1RP8A 1E6SM 2YA1A 4NN5C 1LO4L 1YMMB 2CEQA 1HH6B 4JANA 3ZKMD 3GUTA 4DM1A 1YPZE 4F7EA 4LSPL 4ZUUB 3WEZA 2A1WH 2WP3O 3QEHB 3U7VA 3D3VD 2PBGA 4G6FB 5JZ7C 4JFEE 3QQ4A 3TNNA 2ZOXA 5KVFH 2YPKA 4KK5C 3L1OH 2DTSA 4MNGE 1J8HA 3O3BB 3QSKB 4H0HB 3PWPE 2O61B 4APQA 2JIXA 1JYVA 3ZM8A 3PZMA 3OAUL 1CNVA 1H3WM 3O8XD 4GRWE 2X1PA 1QSFB 5E8NB 1S9XA 4H1LB 1JI1A 4KUCF 2GK1B 3REVA 2NCMA 4H04A 4GZIA 2HFFB 3OAZK 2X40A 1MRDH 1UM4H 3QJHB 1DLHB 1U3YA 2DLFH 1DLFL 2I5YH 2FEDC 4PJIA 4QHMB 4D9QE 3BKJL 2ZWYA 4I3RH 4PJ9D 5DK2B 3FRPG 3QIWD 4X5WB 1I9IL 4JFZH 4DZ8A 1TQVA 4FMVA 3QZWA 4S1RH 5TQ0H 1CXEA 3GNMH 3DMMA 5HGBB 5D9SB 4Z76B 3UTSB 3D5OF 1KPUA 5D9MA 5AYUH 5B3JF 1OAUL 4U4BA 2VURA 4ACZA 3SY0B 5IOPA 3EYOA 3EJUA 2XZQL 3R8BB 4RAVB 5D1XC 5C0JA 3RZCA 4JPWH 3T0ED 3VGGA 2BNUA 4UINL 2J7FA 4NN6B 3BUTA 4HULB 1OLLA 3VWJB 3IJHA 4K3EL 1D9KD 2YD5A 1HWHB 2VDKH 4FNSA 2BC4A 4Z7VF 1H3XA 1EQCA 3RJQB 5A8MA 1XC6A 5IW6B 4QLJA 4J23A 5FA4A 3B5GA 2PNDA 4NOBA 4P9ML 4RSVA 1DFBL 4LHUA 2F58H 1FGVL 2CDEA 1FCGA 2VDRH 1JD7A 4WVRA 1KULA 3OLEA 1TQCB 2VXTH 2WAHA 1KN4L 5KSUB 2H2PC 5C0NC 4RNRA 1YQVH 1U8KB 3JV4B 3MRMA 5HPMA 3CPLB 1NUFA 4NQEA 3RL1B 1B3WA 3PZVA 3QO1B 3D85B 4PJ7F 5EBWB 4HPYL 2BNQA 4L4JA 3VMOA 4J3OC 1UD8A 3LPOA 2Z8WC 3RNQA 3VRJA 1IQDB 1H3UA 2Z31D 3MNWA 4YHLL 2Q76A 1JNHA 4F37K 4RDQG 4OOUA 2H1PL 2WANA 2F19H 3QOKA 1JV5A 3QUZD 4XBPB 4M03A 1UT9A 3ZKND 5IIEB 1RZJH 4LSUL 2JJUA 1WUNT 5D1ZA 1K3ZA 3AHZA 1RFDL 5TE6L 2CRMA 3EDEA 3HC3H 4ONFL 4DEPB 1R3LA 4DGVL 1QSZA 2BCKB 1NCDL 2GJ6B 1N0LA 1F90H 8A3HA 3X11B 4NRRA 1RIHH 4ZUWB 2VQ1A 2B1HH 1LWJA 4L4VA 3P9WB 3KYOA 5F1OB 4P46D 3KLSA 3GH4A 4QFUA 1NH6A 5IR1A 2IEPA 2PTTA 3PQYB 4GUPB 2H9GA 4JQVC 4GMSH 1CR9L 3W0WE 4YFLF 3ULVE 3ARBA 4U1IB 3O6FC 1KTLA 1BJMA 3DSNA 4EI5A 3WUBA 4AL8L 3P2TA 2AKRB 3S5LA 5C8BB 4IIQB 4IJ3B 5BO1H 3C6LC 3DVGB 2ZOKB 3NIDF 4G9FD 3B9DA 1KTRL 2R0LH 4O2FA 4OM1L 2YWYA 4XAWL 2G3NA 1V6UA 3HG1D 2VX6A 1XGTA 2YMXL 4GZEA 3DHPA 4FFWC 5KVEH 5DHYB 1EHNA 2ZCKL 4F9PA 2Z8VC 3BWAA 4AWEA 1BLNB 3EDJA 4U1MA 1A7BA 4WEBH 5I17B 1QW9A 1I85C 1P7QD 1L0PA 3V0VA 3O11A 4KXZI 4P3WA 2QV4A 1B6DA 1PJ9A 1FH8A 1PYWA 2PF0A 2QADB 2W4XA 5FO9B 1LE9B 4FS0A 4HUXB 4HXBH 5C0GB 5M95B 1AHWC 3MROB 3RJYA 4LLQA 4ZOBA 1UQSA 1MHPL 1ZXQA 3QAZB 4EOWH 4AIXA 3F65A 5KAQG 3L4UA 4N0FA 5B38B 3SCWA 4JZNA 5FHAL 1LO0H 5JHLH 4ZD3L 2ZPKL 2AAAA 2RFXA 4MADA 5DEGB 3MNZA 3PTKA 1T7WA 1JWUA 4JJ5B 3GHEH 4TTDC 5ISZA 3GBMH 2R8SL 4LVOC 4KMTL 4D1IA 2VN7A 1JNNH 2HT4C 5FA3A 5J8OA 1FAKT 1OPGL 1EIBA 1KB5B 1QOKA 1BGAA 3HI6H 4PD4J 1AD9A 4H20H 1UWXK 2ENSA 4JRXD 4H25A 1N64L 1ZHKB 1IZKA 3VTRA 1CE1H 1EQPA 1VGEL 2I07A 4YHOH 4PJFE 4ZO7A 2WV3A 3O6MH 1HH9A 3GM0A 1J18A 1T0MB 4RMVA 1E6OH 1IAOA 2UWFA 1BOGA 2HKFH 4M62H 4YHZH 4HUWA 3R1GH 5SV4A 3LKPB 4LRNH 4KKLC 4XX1E 5GZNC 3PDOB 1QR1A 3DDGA 2PBOA 3AIRA 1GGBL 4HIJA 5T1KB 1FG2A 3MSGA 4I48B 3KPSA 1EHLH 4L3CA 2A3BA 3QQ9C 4LIQE 1DVFD 1MUJA 1MFCH 3UTQA 4LSQL 1J8KA 2DMCA 3VXSD 2D31B 4BFIA 1TE1A 2WW8A 4KKNA 4XVUC 5E1HB 4QWWD 4L4TE 5SWSE 2Y24A 3WLWD 1E4LA 4N1EA 5E1AB 2CRYA 2V5SA 4G8GB 4MJ6B 3BLKA 3DX6B 5C70A 4MJIE 4WW2F 2NZIA 2B0SH 4I0PA 3VUPA 3BHBB 4I5BA 1VBRA 5DMYA 4MDJA 3VFOA 3SKUD 4X80H 2YHGA 3CFDB 1QSVA 2JALA 3ZE2F 1FC1A 2NY4D 5DZNA 3SKOA 2E6JA 2X41A 4Y5XC 3FL7A 4QRPE 3G5VA 1YEGL 1WFUA 1OINA 3POCA 2IQAA 2XPGB 1C8QA 4U5KA 4MAYA 5IESL 3RWHA 2LABA 1P2CB 3HZKA 4XB8A 4CVZA 3B9KD 1GPFA 1F4XL 2Y07L 4GW1A 2X44D 2A9ML 1GGUA 5EB9A 4F8XA 3RDTB 3X14A 4PSRA 5CJXC 5I16A 1H0GA 4QHUB 3WFEH 4LARL 3PP4L 5J1AA 3WF2A 3O6LH 3GMQB 4LU5L 4XT1C 4GPNA 3AREB 2AV1B 1YNKH 4JDVA 4HZ6A 4GI9A 1V05A 5EU3A 1AO7B 1BZ7B 2E27H 4KKBC 1MYRA 4TNVF 5DLMH 4HZLA 4P2QA 3PZTA 2Q1EA 3CUHA 2APWA 3WFHB 3SDDA 4M7LH 1ZKAA 4PJDB 3KR3H 4U3XA 2IAMA 5T5NF 4Z18A 1CDYA 5IM7B 2Z4QB 1K6QH 1SQ2N 4EXKA 5IT2L 4HIXH 2J8HA 5EZJB 3V6FB 2EXYD 1GQLA 2A6DB 4NC1E 4PRNB 3W5NA 1ES0A 4M4RA 4O00A 2CYGA 3UG3A 1I9RL 2R56H 3ARDB 1EVUA 5CGYC 1KIUA 2A0LC 4D6FA 3GMMB 3OKEA 1OP9A 4XZBA 1JBJA 1FNGB 1JRHH 4FXKB 4IOFD 5D9NA 4ERSH 4GAYA 1IKFL 4M6ML 4M82A 1FZOB 4I3SL 3GSQB 2WBWB 2PW1B 4XC3L 4HT1H 2J7LA 2GJ6D 2Q3ZA 1IEAB 1ZVHA 1JGDA 5JW3L 3MOBH 4GRWH 1KFAL 4ZSOA 4KRPC 1I7UB 1UJ3C 4MAUL 4Y19B 1S7RB 1KGCD 4DUWA 2EABA 43CAB 1SM3L 3UEQA 2D23A 5CEYB 1HH6A 1Y6MR 5D96C 3JZ7A 4P8WA 4M1GL 4NM8H 4ZUUA 4LFHG 2OYKA 4IMKA 3K8MA 1XGUB 4UFHA 5IV2B 1BF2A 1JP5A 3QEHA 4KTEH 1J0ZA 4JFOA 3IFLL 3L9RB 5GNZA 5KJRL 4H88L 3WSUA 4MD0A 5FDYA 5D71L 1QNSA 2Q8XA 2DS4A 3A4WA 3QCUL 2A3EA 3VIKA 3DLQR 5I8EA 4S0SD 2PF6A 5AY7A 5IEHB 2CUIA 1EO8L 1L0YA 2AJSL 4ZTOL 3DHMA 1E4XH 1I3VA 3U5UA 3MBED 4BQBA 4U1JB 4W4OC 1QSFA 1RHFA 3X12B 4H1LA 3ZJ8A 4UU9B 5SWZD 2GK1A 4P8XA 1NGWB 3HNSL 5FIPA 3RIKA 1TVPA 3N1GC 1T20B 3FQUB 1ZEAH 2HFFA 2NZ9D 3QJHA 3EHBC 1DLHA 4NCC1 1CGTA 2V5YA 4QHMA 3W53A 4RGNB 1H0DA 4Y2OA 4X5WA 5DK2A 3ROLA 1VPOL 2XT1B 1YZZA 3GI8H 5F96H 3BP7A 3O45B 4KJQC 5TFSH 4CL7A 1JK8B 2OI9C 4Y5YB 3RGVA 1K8IB 1ZJBA 5HGBA 5D9SA 4Z76A 2OJZH 3WMCA 3BI9X 1HYRC 1XF2B 2Z35B 1EDGA 3S37H 1TETL 3AI0A 2GK0B 4UTBH 3SY0A 5DVLA 1KCUH 2VZVA 5D2LF 2AJXH 5F9WC 1W91A 3OKNB 4JPVL 5HHOE 1NANH 2J47A 2HT2D 3QNXA 4Q6YA 5D9OA 1TCRB 1TVHB 1CBVH 3BE1L 4I9WD 1CFTB 3QDGE 2X10A 4J3VA 4CU8A 1NWSA 5CJ8A 3QUYD 5EZLB 5GGRY 3FT2B 5JIKA 3VWJA 3Q3GB 4TRPL 3VM5A 1V7NH 1UFUA 3QHZH 2RJMA 2GUOB 1OD7A 3GO1H 3U9PL 2NY3C 3MLZH 1EJ6A 4HJJH 3RFZC 1QFUH 5IW6A 1F3DH 5D6CA 1I1CA 2WMKA 1U41A 1J12A 5ITBL 3EJRA 1HJVA 4UTAH 4UQEA 1HF6A 2IF7A 2VDML 1VHPA 3N11A 4JFDD 3H9ZA 5D4QA 2XN2A 2EDDA 3MLWH 5E99L 3TA3A 5IB2A 5CZVL 4S3JA 5KSUA 4C7DA 5IFJB 3JV4A 3D69B 5F7KC 4ZENA 3CPLA 1KN2H 4S1SL 3RL1A 1JHTB 2FBOJ 2XXCB 3QO1A 3D85A 4WV1B 5EBWA 3L3KB 2WLYA 4L29A 4N0UE 4Y5VB 3ZOAA 1N8ZB 4LGSB 2RCSH 1B6UA 5CUSH 2CUMA 4MNGA 4WI3A 4AZ8A 1IQDA 1SZNA 2GSJA 3HNVL 2QMKA 4JFQA 2ZUYA 4UBDD 4NQUA 1ROWA 2VDLL 1KXQA 4OD3L 4XMPH 3F4VA 5L6YL 3POHA 4K7PY 3ULVH 1ZGLB 1AD0B 3HPJB 4M5YH 2IALB 3DX3A 1F45A 4AYFA 1QKZH 3MRIB 4GI8A 5K59F 1HKFA 5I1JH 3S4SG 3RA7H 3VI3F 1J01A 4PJAE 5L2KE 5E94B 1S5IL 1TNNA 3H7BB 1ZLSH 1OIFA 4FLRA 1EEZB 1HEZA 5D2NE 2OSXA 3LEYL 1Q6FA 3FW6A 5FD0A 4EJ1C 2BCKA 4Y1AE 5I0ZA 1KXHA 5D7IA 2DRUA 3HC0B 3X11A 1WCBB 3T3PF 2OZ4A 2YA2A 4RE3A 1WAAE 1WF5A 4YC2B 4C7GA 1SEQL 4U0QB 1S7WB 3MLVH 3MUAA 3QGVA 2NR6C 3PQYA 4GUPA 4YWGH 5I6XB 3QXTA 1BGXL 4U1IA 1OHQA 2XN9D 2DWDA 5GGSA 5I1EL 4WWKD 5EG6C 1WNOA 2AKRA 3ARED 4IIQA 2WWKO 4KDVA 3VXRD 4YQXH 2ZOKA 2G9HB 3WDIA 4KRLB 5LGKA 1MQ8A 4XB3A 4MQTB 3WUEA 1V6YA 1K9DA 5FF6B 2D7TL 3LN5B 1GGTA 3IJYB 5DHYA 4AD0A 5I71B 1BLNA 2VC2H 4Y4KB 5I17A 2YPLB 4CKVX 2VIRB 4LMQI 4HC1H 4IRJC 4HX1B 4QEGA 2AJYH 1NCBL 3T4AB 4V27A 2Q7YB 5FO9A 1LE9A 2MSPA 4HUXA 3MROA 1QBBA 1ZVYA 1WE5A 3S36H 4L8SB 3GSRB 3MRKB 5IWLA 4UAOB 1WV7T 5CP3H 2DQGH 3HN3A 3HAEG 1MQQA 5B38A 4S1DD 2BOBA 3CSGA 3QDJE 1C1EH 3WF4A 3GIZH 4OLEA 4JB9L 5DMGC 5DEGA 4JJ5A 3GBNL 4OIFA 5KG9B 1DQMH 2PUQT 1GHFL 1PG7X 4LGPB 1FVDB 3DX0A 4MNLA 1CLVA 3VFSB 1MFDH 2FATH 2EH7H 2XWTB 3FFCD 1KB5A 4LIQH 4OM0L 5JR1H 2WXDM 4LLWA 3QCTL 4O58L 5F1SA 3VGAC 1ADQL 4MXWL 3N85L 3CZSA 2W61A 1ZANL 4LAQH 1BFOB 2PETA 4JFWA 2J74A 4YHML 4XP5L 4UT6L 1CVRA 4N5ED 3TWCL 2GY7B 4UT9H 4EN3B 1MIMH 2B20A 2J4GA 4DFHA 5M3WA 4NQCD 1UJTA 2OMNA 5E8DL 4P7NA 3UCRA 3O6KL 2A3HA 4PJGF 4YXHH 5DWUL 4DQOH 3LKPA 2JELL 2XPKA 3PDOA 2ATKB 1BX2B 1ZOXA 1KB9J 5DJCB 2AMGA 2WCAA 4XGZB 2NW3B 5DJDB 5J12C 4I48A 1HOCB 2EKSB 4HDIB 3ULUL 5KZCB 2DT0A 1K5NB 2VKWA 2OL3B 4PJ5E 2GUYA 3W0WA 5FGCB 4M1CC 3LHPL 2D31A 3V8CA 1V0LA 4QLRA 4JCLA 1R3IH 3HG2A 3FO0H 5H94A 4NOFA 2YRPA 3JVGA 1PPIA 1IAKB 2FD6H 4G8GA 4PN2A 4C56D 4L8BB 5CJQL 2EDRA 4OGZA 3MR9B 3WQ4A 5IVNA 2OJEA 3BHBA 4XPGH 4GXUN 5J4MA 4XP4H 5CSYA 5EUOF 4KMQA 4QRRE 1LEKB 4YDKL 4J7RA 5H8DA 1BJ8A 3HUJE 4WHYH 1BQLL 5TPWL 4ZS7L 1GOOA 5BW7C 4BSVB 4ZFOB 2DQDH 1WT5C 2XPGA 4P3CH 2NY6B 3MV8D 2AJUH 4DO4A 1P2CA 1QRND 5C2BH 1JRHI 2OP4H 1PS3A 1JHLH 2ID5A 5FHBL 1HDMA 3BDYH 3SDCB 4PJHE 3QULB 4FA8A 4ESKA 3RDTA 4PMVA 2FR4A 3SJVE 3A22A 2IPKB 3IXTA 5D93B 4GBXA 4QHUA 2VNCA 2HN7B 4FNQA 4LCWE 3RNKA 1OWQA 1LO3L 4HC1A 5FIEA 3GMQA 5J13C 2XZAH 3KXFE 3RP1A 1AO7A 3NFSH 5C8JB 1BZ7A 4L5FH 5J06A 2M8XA 2FGLA 5KS9B 1N7MH 4M7JL 4UOQA 1HNGA 1BWWA 1BFVH 3WFHA 1IT9L 3DX8B 4PPTA 4GMTH 4HWEL 4PJDA 3ALGA 1OCWH 1A8JH 5I73B 2Z4QA 2WC7A 1ND0B 1BVKB 2UZIH 1NFIB 3VMNA 4N42A 3JWOL 5LGJB 5B8CC 4A3HA 5EZJA 3V6FA 4RFEA 1LDPH 4ZFFA 2A6DA 8FABB 4PRNA 2FEEL 4DW2L 4JFXB 4D0CB 3S3PA 5JDJA 3SGEI 2DJSA 3FMGH 2YL6A 5F89B 3ARDA 2CRIA 3NA9L 1EO5A 3GBLA 5IFAL 4PB9H 3GXIA 2DICA 2Y23A 1E1EA 3MODL 3S9DB 4WWID 12E8L 3MV7E 1XV8A 5HVHC 2CDFB 3PWUB 4L4TA 4JM2B 5DHVH 5CHNB 1VEPA 3VXMB 3ARGD 5BVJB 4Z2HA 1FZOA 2BFGA 3QIUD 3RWJA 3GHBH 3GSQA 1A6AB 2PW1A 2WVVB 5ETUB 4U1HB 1CLZH 5J3HD 5HGDA 5HDBE 1IEAA 2R4SH 1H3PL 1CFNB 1IGML 2VZUA 5F1IB 1EJOL 1JGLL 4PJEE 3KJ6H 5I24A 4Y19A 1S7RA 3PUCA 2WMIA 1HN1A 2AQ2A 2XACC 2WBJD 3AM8C 4AD3A 4NNYB 5C6WH 1DSFL 4LLVB 3TT3L 1DUZB 2G3JA 1OB1B 4QRPA 1U6AL 4ZMAT 3T0XA 4ZS6D 1KNOB 1MVFA 5IV2A 5C86A 3QHFH 2DQHL 4WFHD 2VR5A 4BELD 1NANI 3FONB 3P0YL 2WZIA 15C8L 4KRNA 1AGCB 4XPTL 5J1TC 2EPLX 1W72B 4KK8D 1BEYL 5I5RA 5IEHA 1FA2A 3S35X 4P5TB 3IDJB 4J6RH 1G6RH 3MYZA 1I3RB 1ZLUH 4L9DA 4K71C 3M07A 4U1JA 4JR9L 1ZHNB 1PGRB 4UU9A 4S1QH 1NGWA 2CHNA 2YKLH 5K9QI 1RURH 2E9IA 3FQUA 2AGJH 2XV6B 1IL1A 3SGJC 3IU4L 1OARH 1QYGL 2P24B 3QJFB 5J89A 4W7UA 4AISA 2X2HA 1DWGM 4ONGL 2CPUA 1R24B 4UMGA 4IDJL 1JK8A 4XPAL 3CH1B 3AHYA 2VRQA 1JFQL 3KYNB 4GRMB 2GFBA 4Y4FD 3QT2A 5GZOD 3UC0H 5CGMA 1XF2A 2Z35A 3RWIB 1FZMB 2FX8H 2GK0A 3P3YA 4K55A 3FQNB 1CDBA 2P49B 2PXYD 1N4XH 4WSJA 1B1YA 2DD8L 2OCFD 2O9RA 2AW2A 2CK2A 1YYMH 4DKFL 2V7NA 4NBXB 1TCRA 1TVHA 2EDKA 2DKMA 4MNQE 1GL4B 4O02L 2V2WB 1CFTA 1CTOA 2V5MA 2XG4A 1MWAH 3CUJA 3FT2A 3GSVB 3ORJA 2NX5B 4HUNB 3C87A 1BBJB 3Q3GA 3TOPA 3AYRA 5EC2B 4HV8B 4RMSA 3QIBA 2GUOA 4HOZA 4GRLC 4HCRL 3NACH 5DJZB 3BP5B 5A2BA 4QDMA 4OCLC 5EB8A 5B4MC 2NNAA 4IRSA 5JO5A 3TN0C 2HRLA 3ULUC 4RMUA 1YEKL 4LL9A 4UIKH 3MLPA 5BCAA 1CU4H 1NC2A 1BFSA 1HIML 3WIHH 3U57A 1T80A 5CFHA 5E08H 4F15B 4MXQD 1Q6DA 4EUPB 5IFJA 1LEGA 3D69A 3EO1B 5HHMD 5DEZA 4H7VA 3SDAB 1D5XB 3V0WH 5E6ID 3EOBB 1X1NA 4ODUB 1JHTA 2W63A 1EMTH 3OL2A 1OAKH 1VB9A 3L3KA 2P47B 1YEHH 2P5WD 2VH5H 3G5ZA 3GEWB 4YE4L 1N8ZA 4GAGL 4KI1A 1F11B 2AK4D 4PG2A 5GGTH 1UWSA 5AG8A 4JHAL 3BQUD 3U4AA 4RISL 2XZZA 4TTGA 3O9WC 5CJOH 1NCNA 2ZX8A 3HPJA 1BYBA 2IALA 4RGOH 3AB0C 4TOYL 2ZSWA 2CERA 3V6ZA 3V6OA 1F2XK 4X6DE 2X1OA 5E94A 4HLZH 3NZ8B 4P23D 4ZO8A 4R90H 2XWDA 4FXGA 3GK8L 2NY6D 5A8QA 1XR9B 4OZFH 1AFVL 2BVDA 4HPOH 3T8XB 1WCBA 1ZB5A 1KPVA 5DD5L 4KI5D 4NZTL 4LX4A 1KJ2B 1S7WA 1XH1A 4NXSA 2CKNA 1IM9B 5C92A 1AP2B 5HI4D 1G6RA 4K8RL 6FABH 5BROA 4I77L 2X42A 2YIHA 5MEND 2FECI 3EJTA 5IHZB 4PMYA 4PJXB 1UWIA 1A1MB 4D6CA 2G9HA 3MMUA 4X4MA 2CIKA 5E5UB 1E0WA 2J2ZA 5FF6A 1IZJA 3LN5A 4DJMA 3WUFA 3IJYA 3T4YB 1MCKA 3QDGA 1E0VA 3MLRH 5EZOL 4Y4KA 3O4LE 3PP3H 3MJ9H 4QXUH 2YPLA 4X7SL 4I3GA 5E4IA 3T4AA 4HX1A 4MHHG 4EEEA 1Q6EA 2Q7YA 4ODVL 1AY1H 3OZ9L 4OLYH 1UH2A 5E2JA 3MRDA 4F8QA 4L8SA 4TN9A 3TV3L 3GSRA 3MRKA 3VGBA 4OF8A 1XYFA 1E6NA 3UDWC 3FB5B 3B2UC 5F7WC 1B0GB 3N0PB 1F4YH 3L3HB 1GZPB 1N6VA 4LDLB 1U8HB 2EICA 1FJ1B 3AY4A 1AGBB 4UDTB 5KG9A 3VXMD 5ABHA 4UV4H 3P11H 4JY5H 3S6CA 2Y7QB 1FVDA 1LMKA 3VFSA 3PXJA 1IQWH 2GQHA 5EU7C 2DQUH 2XWTA 1OCQA 1A2YB 2X4OB 3BXWA 3CVIL 4HHAB 1YDPB 1KGXA 1OAXL 4TSCH 2KPNA 1BFOA 3EO0B 1NCAH 3KPRB 5HYJD 5JW5B 1OTSC 4JRYD 2WUCH 4PLKC 3Q6GH 4EN3A 5HYSA 3VO0A 1D6VL 1D7FA 4XPFL 3TT1L 32C2B 3TEUA 4JFYB 4HH9B 3GBEA 3ZKXC 1AJ7L 5DO2C 4CU7A 5DK3A 4HS8L 5I1AB 2ATKA 2DTML 1BX2A 1WAAA 2XRAL 3QWRA 3QXWA 5DJCA 2FWOB 4XGZA 2YDSA 2XZCL 3RVUD 1A7OL 1MAKA 1U3JA 4XNMB 1XF3B 3BFOA 1HOCA 2EKSA 4HDIA 5GGTA 1GJWA 2VX7A 3KAAA 3U0WH 3GH7A 3BLBA 4UOW1 3I75A 2OL3A 2V3FA 4QP0A 3B6SB 4EDWH 5TE4L 1XRVA 4WO4B 1XMWA 4XPBH 1V3IA 1UWEL 4B3KA 4OT1H 3DETC 2DGAA 3LSOB 1IAKA 4R0LB 4L8BA 1R3JB 4BQ9A 4U6XA 5BVPH 3UTTB 2EXWD 3MR9A 2V7HB 5A2AA 4LNRB 4CD8A 4QTIH 1T03L 2J7DA 4YPJA 4U1NB 5T1DH 3FZUD 5ALBH 3BKML 4TYUA 1GVIA 4XVTH 4BSVA 1ORSB 4ZFOA 2G60L 4HKJB 5BS0E 3LQZB 1UVQB 1V0KA 1K8DB 4F80A 2R4RL 2AEPH 1XGRA 5I74B 3U6RA 3V4PL 5F7MC 3VI4E 3AZRA 1HINL 1TFHA 4NO0D 1RULH 2X89A 4KFZC 2DIJA 3DARA 4FQXA 1T2QH 3QULA 5TH2B 3CDYA 3ZDYE 3TESA 2IPKA 4Z2LA 3W29A 5TE7L 2HN7A 4RFOH 3PWLB 2JJWA 3MJ9A 3F62A 1NCCL 3MU7A 4JFFE 1H5BA 1VGKB 5EOQL 3GXTA 2YD4A 2EZ0C 2R2HB 1NGQH 1WICA 3WD4A 4GS7B 3I2CH 5C8JA 1RUQH 3X3FH 1EGJA 1A7QH 3DHJA 3WDHA 2VVSA 3RM9A 2LV4A 2P4AB 3NCYP 2FIRT 5DQ9B 3HU7A 1Q0YL 4KHTL 4KPHL 3D4ZA 2AEQL 5IROA 3N04A 1BVKA 4PJ8C 5I8KH 1NFIA 1RJLB 4LQFH 4IM8A 5LGJA 4YR6B 1BMGA 2BZDA 8FABA 5DVNA 4JFXA 4P2OC 4D0CA 4ELKB 2VRJA 2CJUL 1JGUL 4J4PD 5IFHL 5MHSD 5FYJU 2K3TA 1CFVH 1JNLL 5F89A 3C60B 2HJKB 4XC1L 1U36A 4I1NB 3H2WA 3CVHL 35C8H 3WHXB 4PJ5A 4Z8FL 4F7MB 4TVPL 1I1RA 2CDFA 3PWUA 4OI7A 4JM2A 2RGMA 5BVJA 5IJVB 3WSQH 3O4OB 3IRPX 4PJCB 3UX9B 3G6JB 5BOPA 2WVVA 3QDME 1HCVA 3B4NA 1E72M 4WFFD 3DUSB 4HIEA 1QI0A 2Y6SD 3K8KA 1CFNA 3HB3D 1GJUA 5F1IA 1RP9A 1TXKA 2NY0D 2EIBA 1MLCB 1WWWX 1A6UL 1OSPL 4K8RC 1DUZA 3PV6B 4CN6A 1OB1A 2DQIH 3VW3H 1T0OA 2J1KA 1KNOA 4DVRL 2VAAA 3DXAD 2UWEE 1FG9C 2QHRL 3FONA 4ZXBC 1XGYL 4ZDHB 4AY0A 4CD5A 1AGCA 5KSBB 1W72A 3TZVC 2D2OA 4NT6B 4OUUB 2G5RA 1OSZB 3EYUH 3BN9C 3PHQB 5J57B 4PRHB 4W8BA 4P5TA 3IDJA 4KV5F 1E4IA 1AXTH 4DK6A 9CGTA 3SJVA 1I3RA 3NIFF 1RPQA 2XSBA 1U3HC 2QBWA 1ZHNA 1I1YB 1IKNA 1T66D 2MKLC 3IDMA 1FRGL 2HVJB 2VSCA 4EAMA 1E4MM 5ACMA 3FOLB 4L4OA 3SBWA 4ZNCD 4ENEC 3BAYA 3D51A 1D5IH 4ZAKB 2H32H 4O4YL 3QEQE 3EBVA 2IG2H 4WHCA 4BSWA 4MMZC 5ACLA 4FNLL 4PLJD 2P24A 3QJFA 4MB5A 4X7EC 5E9DB 1OGGA 4ALAH 3WS3B 1OTTD 1VFOA 1GZQB 1R24A 4NQXB 4X5LA 1A6VH 3DOSA 3RIFK 2AK1L 3ISWA 5MEPB 2DL9A 2R0KH 3BP4B 4MXVE 2EPKX 4HBCH 3KYNA 4GRMA 4Z95L 3RAJL 1CICB 5FM5M 5L8LB 2MTPA 4R8WH 3RWIA 5HHXH 1DP0A 3RU8L 1OM3H 5AC5A 2J25A 3H54A 1OF2B 4JO2L 5AAMA 3Q5YA 4TXEA 3D39B 4BFBD 5D5MB 2HMID 4OGAD 2PYED 3OJDB 1JAKA 1KIRB 4MA7L 4KTDL 1YJDL 5HSFA 1FYHB 2FYVA 1EA9C 2WIIA 2CLZB 2V2WA 5IHLB 2I25N 4NQDA 1RD6A 4OF3A 2R1WB 3CMOL 5D7JB 1IGCL 3DI3B 2J8UE 5F3BB 4P2RE 4K9EL 4N68A 5JLZB 3I85A 4B0MM 3KLHC 2HVKB 1X6NA 4HV8A 4KVNH 1A4KB 3DWTA 4WKAA 4WFED 4MAYD 5DJZA 3BP5A 5K9OB 4WFGD 4P7LA 5ESVB 1B0RB 1IAIH 2H2SD 3TO4C 1FHDA 1KYOJ 3KLKA 5C09E 4OGXL 5HI5D 1WIPA 1R5WB 3V5KA 4UQ2B 4M9OA 3WF1A 1PG7H 3L5WA 4EUPA 4N0CD 2R29H 5JORB 1MSPA 1Q72H 3SDAA 1D5XA 3EOBA 1UADC 4ODUA 1NFDF 3PJSA 1NUDA 1XSKA 2CDGB 1E4WH 5T3ZL 4KY1H 2JF6A 5IKCA 1F11A 1V02E 3UYRH 1MRFL 2MHAB 3R06B 4OF7A 3QG6B 1EHAA 3CLEH 4OCMC 3VFWB 1HKMA 4JVUA 5DD1L 1KIQA 4P2QD 1MCHA 1QFOA 2IAMD 2X9WA 2ZG3A 5ENWA 1RV6X 4X9GA 3NAAH 1ZVSA 3TYFA 2YBUA 3HAEH 5LWYL 4M02A 2JB5L 3LKSB 5T1LA 1B9ZA 1MIEL 3CXDH 5GRVK 5H2BB 4Z7WE 4WI4A 3QUXA 1XR9A 2XQBL 4MQXC 3T8XA 1NCWH 1SVZA 2EEXA 1BREA 1CXIA 1R5IB 1VFFA 3S34H 1XGZA 3ZO0A 3LKNB 3LQAL 5A6JA 1CF8L 1IM9A 3FO9B 1AP2A 3RL2B 2VABB 5D70H 3EOTL 2P8LA 2HH0L 5IHZA 1E4JA 2BNJA 3FN9A 1A22B 3K2UH 3PL6A 4PJXA 3BAJA 4XVSH 5C9KA 5I75B 1OWRM 2OS7A 1V3MA 1FYTD 2E9WA 3HE6D 3K74B 1L7IL 4ZPTB 1D5ZB 2PC8A 3T4YA 1JPSL 3AIBA 3UO1H 3O3AB 3HI1B 4LPWA 1GAFH 2GSIA 2H32A 5DS8B 3S98A 4ZQKB 5D1QD 5JXED 2QPUA 2LVEA 4Y2DC 2IANE 5IF0B 4KI5F 4M81A 3IDXH 2IC2A 3H3PH 4IEFB 4UR9A 1Q9OB 3C60D 3TH2T 3OBAA 3FB5A 4WU5B 3RBSA 1B0GA 5DK0B 5C6PB 4CRPA 4HG4K 3LIZH 5L0QC 1GZPA 4CNIB 1NM9A 3F8UB 1JCKA 3GJFK 4LDOB 1JDAA 1U8HA 1FJ1A 4PP1C 1AGBA 4HKXA 1G7IA 3ZHDA 2XNAA 3L1OL 4BS0A 3D9AL 4PP2B 5KS9F 2Y7QA 2JK5B 3W6LA 1KUMA 1A2YA 2X4OA 4LSVH 3BISA 4HHAA 5FYKU 4LLAA 3STBA 1OD8A 4PLNC 2WZHA 3EO0A 3KPRA 3O2WH 1KFWA 2JB6A 3GKWL 1S78C 3MBXL 3BN3B 1ISXA 4X6DA 1C8PA 3VXQB 4GAJH 3GJEB 4AD5A 1UM4L 2CR3A 1J1XL 2XTJC 2HFEB 32C2A 4JDTH 5BRZE 5DHXB 1DQTA 1PX4A 1YEFL 4GKZB 2F53E 5HHQA 3W28A 4JFZL 5I1AA 2M2DA 5DD6B 4IMLB 2H45A 4XNMA 1BSIA 1XF3A 3QYCA 3OKYA 2CO6B 3DSFL 1YEJL 3MXVL 3BPLB 4YIQB 4OFVA 1JZ6A 1PIFA 3B6SA 4YGVB 1OLZA 1ZTXH 2GFTA 4WO4A 5GSRB 5E4EB 4XI5C 3LSOA 2Q6WB 2WBGA 1W9UA 4R0LA 2G3IA 1DBBH 3CSBA 1NOWA 4NC2B 4AIZB 3UTTA 2EQDA 4LNRA 3IJSB 1NBQA 1R75A 3O4LA 2VDKL 3UROR 3RJDA 3DO7B 4U1NA 1T1ZA 5AC4A 1B2YA 1TJGL 5D1XA 4FLSA 1FFNB 3SGDH 3SCMD 1XCTB 2XVLA 1FIGL 1ZWIB 4H41A 5A8OA 4CJ1A 3N17A 1ORSA 3VXUB 1SY6H 3WBEA 2EO9A 4WF7A 3CZJA 1UVQA 4JFED 3S88L 1Q94B 2FJFB 1K8DA 3EJPA 3S35H 5CQ1A 2OSWA 5AZ2H 5C0FA 1KLGB 5IVXB 1LO4H 3PWPD 3VH8B 1A6TB 1YJDC 4LSPH 3LRGA 5TH2A 1US3A 1MAML 4K9EC 5E9AA 3AIVA 3L7FB 1RZIA 3FT4B 5JHDB 4NN7B 5D9PA 2DIBA 5DJXB 4CMMB 1VGKA 4OLWL 1NUNB 3L5JA 2R2HA 2ZSVB 5D7SL 1B2WH 3HZVB 3QNZB 5LQBL 4D9QD 3OAUH 1S7XB 3L7EB 3TBTB 4JVPA 3ZT7A 5DQ9A 3BD3A 2F54E 2X8RA 2C5DC 5CZXD 5E2UL 1FH5L 3WD1A 3EJSA 1EUUA 1C5DB 3TTYA 4MJ5B 4Q9CA 4PRPB 1TVDA 2KBGA 4YR6A 3DMMC 3RX8A 1DLFH 3ZKQD 4LP4A 3BKJH 4S11A 3HR5B 1I9IH 1ZSDB 5F8QC 3M8OL 1O5DT 3BPOB 4LBEA 3BEWB 5ABFB 3WHXA 3MJGX 4F7MA 3RZCC 3QUKA 4JHZA 4NCDA 4XCEB 1NMAL 1E0XA 4JQVA 1RMFL 5IJVA 1OAUH 1NMCC 5I30L 3O2LA 4PJCA 3G6JA 2XZQH 5KVEL 3RUGB 5EIIA 1JXJA 3DUSA 3B43A 2OK0H 2UY3A 3FQWB 3LQAC 3P4OB 3C6LA 4MVBC 2JCCB 4LCUB 4HFWB 4UINH 1XH2A 1RQ5A 4JY4B 3LXBA 4HXBL 3FT3B 2HJLB 3NGBB 4K3EH 3T77A 2EDEA 1JG9A 5E09A 2OW7A 3I6GB 3E3QE 4ETQA 4ZUSA 4JFHE 4P9MH 4M9PA 4OKDA 4PTXA 5KSBA 1DFBH 1FGVH 2O26U 1AHWA 1C12A 2OR9L 4NT6A 1OSZA 5JW4M 1C93A 3GHEL 5ESQB 1OGTA 1WTGT 3S5YA 3BUYB 5C3TA 4M4PA 4Y16B 4HPYH 1I1YA 3NFNB 1IAII 2QHLA 2P5EE 5ANME 2EO7A 3CV5A 5D1ZC 1CZ1A 5D7KE 4PGCB 4OZIE 5DT1L 3D0LB 4YHLH 3FOLA 1FHLA 1RHHB 4YHKL 4KROC 3PXHA 3GIVA 1JPTL 1NJ9B 4ZAKA 2ESVE 1I1AD 2C1PA 5E9DA 1FGNL 3ZTNL 3I6LE 4LSUH 4RRPG 3WS3A 1BQHB 2WWMD 4QHLB 3TPUB 4NQXA 1RFDH 4MNJA 5TE6H 4YHZL 4ONFH 5MEPA 2CSPA 5CMAB 3BP4A 3ULVD 1UWUA 2BJMH 1GOHA 4DGVH 1CICA 1NCDH 1S9YA 5ERWB 1ED3B 3ARBC 1A1NB 1OF2A 1CDHA 4TTUA 2A6KB 1MFCL 3D39A 5ITFB 4CDHA 4PUDA 2H6PB 1AKJB 1CR9H 2CLZA 1KPRA 3D5HA 1OVZA 1LWRA 2DAVA 4F9PC 1KSRA 2R1WA 4DWSB 5D7JA 4AL8H 3BPNB 3W24A 1YEIL 5JLZA 3MMDA 2HVKA 1CXLA 5EUKB 2QKIB 4NZFA 4NGHL 3MV9E 3OMZA 3F12B 2CR6A 5CD3B 3MCLH 1G1CA 3G6DL 1X5YA 4OIBA 4HMDA 4OM1H 4XAWH 2JEPA 2YMXH 5ESVA 4TQEL 2J79A 4LCYB 2ZCKH 3E2HC 5EU4B 4PRIE 1JZ4A 1UB5B 2CIIB 3HFML 1T1XB 1R5WA 2ZWZA 4QLLA 2FL5B 3BZDA 4UQ2A 4OF6A 5IUSA 3LS5H 4Q6IC 2D7QA 3OZOA 5JORA 2LAAA 5CEZL 4LDEB 2CQVA 1MHPH 2XTKA 3HTLX 2CDGA 3C09C 3MYJB 5DD0L 1BZQK 1NUGA 2GAZB 1L0XA 3N1MC 5IBUB 3BUDA 4HMEA 1N82A 4P8UA 2MHAA 3R06A 4PGJA 4ZD3H 2QR0A 2ZPKH 2OLHA 1UQYA 1DHKA 2Q8AL 3VFWA 2ERJC 5EOCJ 2VXVL 3C5JA 1R3KB 4NRZB 1BYDA 2W5FA 2ZUQB 2R8SH 4KMTH 3O6LL 5A3IC 3RJXA 1NLDL 3TVMB 1OPGH 3VXUD 1G6VK 5CJXA 1LNUB 3OR7A 1U42A 5H2BA 5HYFA 3H53A 3MC0A 3F5KA 1N64H 4QF1B 3KR3L 5I8OL 1DN2A 3C5ZB 4ZNEA 4W85A 3HI5H 1MHEB 3RHWK 1A1OA 1VGEH 1R5IA 2AI0H 3ZLQC 3L4ZA 4HH8A 4X6CE 2UY2A 3LKNA 2XKUA 3U1SL 1QBML 5E2WL 3RX5A 4BJLA 4Z77A 1FL3B 2F9BT 3RL2A 1ZBKA 1BIIB 4L4TD 3WJLA 5SWSD 3IGUA 2APVA 3MLSL 3B9EA 5A2CA 2JE8A 4PJBB 2LU4A 1GGBH 4MJID 4MAVA 3CX5K 4OZGE 4ERSL 3D50A 1O7SA 2Z31C 1D5ZA 4FQCL 5KVMC 4B3LA 3O3AA 3HI1A 4GG6E 1OSEA 2WBKA 1I3GL 3CZLA 5DS8A 2J8UA 4ZQKA 4HT1L 1N5AB 3KZSA 2WIMA 4QRPD 1XD0A 3RDKA 2DYPA 3V7MA 1MY7A 5IF0A 1NGXB 3U9UB 1B0IA 3MA7B 4ZODA 3F7YB 4AH2B 3IDNB 4XHJD 2IBZX 1KCRL 1Q9OA 2NY1D 1QZ1A 4NM8L 4WU5A 1QLFB 3PGDA 5DK0A 2A6JB 1W3HA 2F8VA 2O92A 4CNIA 2OZ4L 5F9OL 1UJ3A 5GNYA 1YEGH 1TQWA 3ULUE 5CD5D 3DUUB 3MSDA 1WZMA 1JMZA 4K68A 4KHXL 3S6TA 2CXGA 5E95B 2JK5A 2GCYB 3VFTB 4OD1L 1V02A 3CUFA 2JFEX 1F4XH 2Y07H 5TDNB 2VB5A 3VFPB 2G41A 1DCLA 2A9MH 2RBLA 1QWNA 1CE6B 1TMQA 5KTEH 2W59A 4PY7B 3AMDA 3SDDC 1T0PB 4LARH 3T1FA 3GJEA 3PP4H 3SE3A 5DF0A 4LU5H 4DTGL 4K71B 1FCCA 5ID0B 1AR1D 1W1TA 3ARFB 4GKZA 5B39A 3TBYA 5DD6A 1U8MB 2DQTL 4GKOA 4IMLA 4IOIA 2XN0A 2C4FT 4PS4L 4HWBH 2D22A 4BM7A 3HE7B 5A2FA 5EIQA 3OSKA 5IT2H 5A8PA 4JGUA 4IRZL 1YC8A 1MEXL 5GSRA 5EO9A 5DTFB 2Q6WA 3QIBD 1EVTC 4D0DB 2W38A 5DO8A 3B2VH 3LKQB 1L7TL 2C1OB 4K7FB 1FZKB 4AIZA 3ABZA 3GZKA 4IRSD 5A2KH 4JHWL 3IJSA 4WHTB 4F7PA 3WFLA 2KL6A 1KB5L 5IMOB 3DO7A 2Y5EA 1UXWB 5EWIL 1IKFH 4M6MH 1QFUL 1ZWIA 5E7BA 4I3SH 4XC3H 4IMKC 3K46A 2OXGA 1H3VA 4HGKC 2FJFA 3U48A 3QH3A 2UY6A 5JW3H 2Z9TA 4MAUH 3SDXE 5IVXA 2HRPL 4FFYL 3VH8A 1SM3H 1AKJD 4M1GH 1JGEA 1GJIA 1ETZB 3GFUA 4LSDA 3QUMB 2X5PA 5JA9A 1B3JA 4QAWA 3IFLH 5KJRH 5JHDA 5D71H 4HK0A 3QI9D 3QCUH 5DJXA 4MA1B 1NAKL 1BP3B 4CMMA 3MFFA 3ARRA 4QWWC 4ODHH 2ZSVA 4V1DB 4U3AA 1JDCA 1YPZF 2XFRA 3PTMA 4HMCA 3RA7L 5IHRA 4ZTOH 3L2LA 3L7EA 2EDWA 3TBTA 3UTPE 5EU7E 2BSTB 4XXCC 5FCZA 1P4BH 1XF5B 4M6OL 4XCFL 3DUHA 4X6FB 3HNSH 5DVKA 5D5MF 5C0AE 1C5DA 2ZXBA 4MJ5A 2NY2D 3WDPP 1MI5B 4MD4A 4D3CL 1X9QA 4JFVA 3DHUA 3DIFA 1JUFB 3MX0A 3X13A 3TFKC 3HG5A 5GS0L 3WDQA 3HR5A 5FM4A 5HHOD 3T0VA 2O93L 4GRWF 1TNMA 1VPOH 1WTLA 4LOUD 3ZTJG 4FTVE 5ABFA 1G5AA 4XCEA 4POZD 1TETH 2YEZA 4NN6C 1EDQA 1J5OL 3VWJC 3HCVA 1X5HA 1UYQA 4JPVH 4L3EB 3RUGA 3F7QA 1HHHB 5GISH 4AEEA 2VC2L 4DFIA 4WGWB 2XVGA 1AXIB 3BE1H 3FQWA 2Z8RA 3P4OA 2AJYL 2NXYB 2X4NB 2JCCA 5EBGA 4LCUA 4JY4A 5J6GB 3IAPA 4U2YA 3FT3A 2HJLA 1HKLL 2BNRB 3O3DB 5J9PA 7TAAA 4UDUB 3T0BA 5A6BA 1TQCC 4HWBA 3U9PH 2EDNA 1G0DA 4E8DA 1NEZB 4P7OA 1SYVB 5EMYA 3I3EA 1FN4B 1V3KA 4WUUB 5GGQL 5ITBH 1WP6A 2VDMH 4HXAL 1OW0C 4OBRA 5DJ8B 4LP5A 1DQML 5ESQA 3BUBA 5E99H 5CZVH 4HS6B 5DJ2B 4HA1A 5CIPH 3VIPA 4LVNB 4S1SH 5L2KD 4Y16A 1UA6L 3ZYZA 4NBYB 2ZX6A 2R9HC 3UZEA 1D6EB 4IOFC 1WEJL 4BZ1L 3L3GA 3HNVH 4PGCA 4Y1AD 3KHOA 1JWMB 3D0LA 4HU8A 4DEPC 1TENA 2VDLH 3NIGE 4NC0B 2ZZUT 4OD3H 5L6YH 1RHHA 4K94L 1MJJB 1ACYH 1NJ9A 1Q0XL 4N0RA 2Y36L 3DX1A 1KGWA 1HSAB 3CFCL 5I9QB 1BQHA 2EEDA 1AC6A 5KSAB 3LEYH 4UZGA 2J7CA 5CMAA 4DQOL 5A6MA 4DKEL 1RJZB 1TQBB 5CAYB 4FZEL 2Y06L 1XHGA 2NW0A 4K3HA 4GKLA 1ED3A 3VJ6B 5CSUA 2HTLC 5HHPB 3DTXA 3RQ3A 4U1KB 3CHCA 3ARSA 1A1NA 4TUOA 2A6KA 3RWCA 1ISZA 5ITFA 4IIQC 1SEQH 1SBBA 1XIWD 4AMCA 4IJ3C 3FRPA 2DKUA 2H6PA 3CH8A 3WL9B 4UNTA 5C07B 5H37G 3FO0L 1BGXH 4JN2B 1Z5LB 5F7NC 5I1EH 2HLFC 1PBYA 4I2XE 3NFPA 3W11D 2AJZA 5JUVA 2W67A 5EUKA 2QKIA 2QADC 1HXMB 2AQ1A 3ARFD 3F12A 2GW5A 3WFZA 3VG9B 4E9LA 3CK0L 4XP4L 4M3KB 2D7TH 3D2UD 3MLXL 5E03A 3LEVL 3QDJD 4KJYB 1ITCA 5IWLC 1CQYA 5EU4A 3ULVF 3QAZC 3QZWG 4XCNB 4F7TB 3N13A 2CIIA 4FN0A 1N6QH 3DX4A 4QO1A 1T1XA 2IH3B 5I1DB 4FQXD 2OR7A 3HE7D 5HI3C 3LZFL 1NCBH 2FL5A 4DUVA 4NM4L 5FK9B 1BBDL 3T65B 1Y18A 2EDQA 4OZHE 1HIZA 4PBGA 1N0XH 3BUIA 3QPQD 3F5JA 2OP4L 4KDTA 4XTRD 1BD2B 1QFHA 3MYJA 4R2GD 1M03A 1E3XA 2GAZA 3P4NB 3TIDB 3QOMA 3SCOA 5EO1B 3IVKB 4JB9H 2MKWA 4N1CA 2JJVA 1TCMA 2HG5B 3GBNH 4J8RA 1R3KA 2HT2C 2AV7A 2HFTA 2CK0H 1MFEH 5EIVA 3TVMA 2P5EA 5ANMA 1G01A 3ESVF 1LNUA 4BF7A 4OM0H 1MREL 5DJ6A 1M7IB 4W4NA 3QCTH 1N7ML 3MACL 4XP1L 1BFVL 4MXWH 2YPVL 3N85H 1QP1A 1J86A 1OCWL 4GMTL 1ZANH 2SEBA 3C5ZA 3H55A 1ONQB 4YHMH 4UT6H 4UV7L 2HJFB 4N8PA 4CVWA 1Z9MA 1MH5B 5DRWB 3TWCH 1UUQA 4FQIL 2R15A 1FNAA 2Q7NA 4JEGB 4X4YB 1G9HA 1MW1A 1FL3A 4YLQT 5E8DH 1BIIA 1FBIH 1VKXB 4X7DC 3O6KH 3SO3B 2ZX5A 1VFAA 4IS6A 3PDDA 5LBSH 5DWUH 3K7UA 2JELH 3MRPB 1JYWA 4LLYB 4PJBA 4Y4HB 3UEZA 4PJFF 1UD3A 2ZCLL 2JEQA 2OTPA 1JGVH 4KGJA 2UY5A 3JVGC 5DR5L 5B8CA 4QYOB 2R23A 3ULUH 3IXAA 3RVVD 1SMDA 5F93C 1RZ7L 4OF5A 3NTCL 1E15A 3TJHD 4UBDC 5KANG 2ZE0A 1DQLL 4QRRD 4NUJB 2KQMA 4W89A 4M56A 3VX0A 4N9OB 1QOXA 1N5AA 1UWRA 2GITB 1LP9B 3OJ2C 2P7TB 5ADOL 5BQ7A 1K6AA 2ZUSA 5DSCA 4F66A 3KJ6L 1QTYT 1NGXA 5CJQH 3U9UA 4Z2JA 5GS0C 3LS4L 1X5XA 3MA7A 3WKML 1EFXD 4OBSA 3B3IB 3F7YA 3IDNA 4OLXL 5AWNL 3S96B 4ELMB 1H49A 2LVCA 2IGTA 3Q1SL 1S3KL 1YMHA 4LKCB 2A6JA 5FUCC 4YDKH 4ZFGL 1BQLH 5TPWH 4ZS7H 4NX0A 3S5LG 5FYLH 3GMLB 3RDTC 5C0BE 3DUUA 1FIEA 3RPKA 1F13A 4U1LB 3LRHA 4JM4L 4LCWD 5FAAA 3A21A 4M7LT 3NUKA 4J6RL 1G6RL 3VD3A 3CXHJ 3KXFD 4GQQA 1X7QB 5TDNA 1DANU 4PV9B 5FHBH 4B9ZA 1CE6A 1NAMB 4L3AA 1U2CA 3AREC 2QQNH 5MP6L 5F6HJ 1QNZL 4PY7A 4OCRL 1RURL 3E6FB 4NF7A 4MCZA 4M5ZL 4IPNB 1LO3H 5D6DA 5L7XL 2MQCA 4D2NA 5ID0A 1QSEA 4B50A 3QFDB 3PG2A 4U5IA 4XV0A 4MCYA 2Y25A 4M7JH 4Z5RB 3OXRB 1SJHA 4U6VL 3HZYB 1IT9H 1U8MA 4HWEH 4LCCB 1OT2A 3TLRA 4MX7B 5A94A 3MNVB 3OV6A 4LFHD 3WF0A 2MPAL 4WKHA 3MV7D 5HDRA 2NXZB 3RPMA 4DW2H 1FVCB 3SUUA 5DTFA 2ARJA 3FCTB 4D0DA 1VERA 4K94C 3NA9H 3LKQA 2C1OA 4FQ1H 2VMFA 4K7FA 1FZKA 1FFOB 4KTYA 5F7EL 3MODH 3VDAA 4WHTA 2VR9A 2G8ZA 12E8H 4FRWA 4TVSa 5IMOA 3PHAA 2VLJE 1UXWA 4M8QB 3BVWA 3BMWA 1VENA 1GQIA 1QNQA 3P30L 1IMHC 3FHAA 4MSWB 1GC1L 4P4KB 3VXOB 1W9PA 4BQ8A 4P7QA 1IGMH 4UIKL 5JQ6L 2BV9A 1EJOH 1JGLH 2Z92B 2MCPL 3WDJA 1CU4L 4C4KT 3NIDE 3DX9B 2PWDA 2EDBA 3PGFH 4KJWD 3TT3H 1CENA 5C07D 3BW9A 4E41B 1L4IA 4F57L 3WNNA 1ETZA 3DYMA 2E9LA 4HOWA 3QUMA 4HQQL 2DQHH 3VFMB 1MJ8L 4TNWF 3NABL 2BY3A 4TVPE 4Z7VB 3TCLB 15C8H 2OL3L 4WI7A 1BEYH 4HAFA 1ZK9A 3QUXD 4PBXA 4V1DA 3CLFL 5CJOL 4BH7A 3E8UL 5CILL 1W3JA 1MQKL 2P8MB 1EH9A 5JNYA 4RFNB 4R7DB 2EACA 2VLKB 3OIHA 3EYSH 2BSTA 4RMRA 4YDLB 4OFYD 4RGNC 2DSWA 2ADJA 1XF5A 4JR9H 3N18A 3O9WA 4HPOL 3VIMA 3D6GA 4PJ7B 4Y5YC 4QHKJ 1K4DB 5BS0B 2N56A 3W9DB 3SE8L 1JUFA 4N8CL 3IU4H 1I7RB 3PL6D 2OWXA 3D1MC 1QYGH 4ZFOL 4P99A 1T83C 4ONGH 2XFYA 6FABL 2E40A 4IDJH 4MNQD 3I84A 1J87A 3BVNA 1JFQH 4WI9A 1V5JA 2WQRA 3NCFB 3ES6B 4ZO6A 2D3NA 1DBML 1X5FA 4MB3A 5CSBA 5L8KB 4X83A 4X0KB 4L3EA 4HIHB 4AENB 1SYSB 4YXKL 1LK2B 4QOKE 4DKFH 4FK9A 2IADA 4AJ0A 1SYTA 2DLHA 3VD9A 4O02H 4KJPD 4G9DB 3LKRB 4HUMB 5J6GA 1OM0A 1KLUB 4OLYL 1EGJL 3AS3A 2BNRA 3O3DA 3BP6B 1R8LA 2LQRA 4UDUA 4XNQB 3KG5A 4HCRH 3QHNA 3VWKB 1NEZA 1KBBA 4P49A 2VC9A 1PKQB 2X05A 1FN4A 4WV1C 3RMEA 5I1LA 4WUUA 5FL0A 1YEKH 4Y5VC 4JREB 5A16B 5JZ7D 3GMPB 1HIMH 5DJ8A 2GDUA 4PG2C 3DECA 4M1DL 3RTQB 2BMKB 4HS6A 3WD5L 1F3JB 5DJ2A 3SE4A 4F3FB 3AXIA 1R85A 2XG5A 2C0HA 4WJXA 5GPRA 1MVUB 3ZE2E 2ADIB 2XHYA 4AD4A 1J8HE 3AISA 1MHCB 1D6EA 4YE4H 4D71A 4GAGH 3V6OC 1MCPL 2VI0A 5LG1A 3D4YA 1NC4B 4TUFA 1BECA 4RISH 2XYLA 3Q6GL 4E42B 1MJJA 3SKMB 1U2YA 5J3HC 4D72A 3PWJB 4TOYH 1HSAA 2E9JA 5I76B 5FB8B 1M4KA 4YC2C 4NBZB 2FJHB 5JBDA 5FYJH 2EE9A 1RZ8B 1MCJA 3IDGB 5KSAA 1INQB 2W1NA 1OQOA 4Z7UE 2VDPL 1WGOA 1RJZA 3GK8H 3GSWB 4I13B 4PJIE 5I6XC 1AFVH 1P6WA 2BVQA 5FUOH 3B83A 3CNKA 4WEMB 3VJ6A 5HHPA 4U1KA 2XTJB 1MY5A 5D7LB 4NZTH 3N1AA 3SUTA 5T3ZE 3ZE1E 4PJAF 1YQ2A 2IH1A 3CHDA 3WL9A 4H1LG 4AM0B 1F6FB 1R6VA 1W72L 3O4LD 4OT1L 3VM7A 4K8RH 1XGQB 4I77H 7FABH 3A6BH 1A47A 1Z5LA 4WTXA 5I71C 4Y4KC 5K9KB 4JLRB 4R4NC 2W9EL 2KH2B 1P6AB 3ZO9A 2VLRB 1HXMA 2AEIT 1EAPA 2H3NB 1M04A 4J1UB 3TNMA 3K0WA 5ALBL 4PMDA 4L8SC 3RWEB 1B3VA 3CMGA 5EZOH 4UAOC 3HZMA 4XCNA 3MRJB 3PHSA 4X7SH 1ORQB 4XMLH 5EBLB 2Y4SA 2D3LA 5KAQF 4ZOAA 4ODVH 1T1WB 4PR5A 2NY7H 4OZ4B 2D24A 3TV3H 1RULL 2YD2A 4W7WA 1BD2A 2H2PD 3IDIB 5C0ND 4WW2B 1O7AA 1FFRA 3P4NA 4Y8DC 1SEBB 1FAIL 5EO1A 3WY1A 3IVKA 2CIPA 4NQEE 4XZUB 1WBZB 4G80B 4NKMA 2Y8KA 5DJAB 4EDXB 1EK3A 5C0DB 4AYGA 2VDNL 3CFKB 2YUXA 4MQSB 1U58A 5TD4A 3VX1A 1GC1C 3TO2A 3U2SA 5BXFB 4EN3C 3ALPA 4P4KD 4UQ9A 2PB1A 3W2DL 4AW7A 1A7QL 1WBYB 1M7IA 4NO5B 3CVIH 4OCXL 1HQ4B 1OAXH 2WKLA 3AC0A 3WUWG 1ONQA 1P9MA 2HJFA 1JFHA 5C09B 1R33A 2PW2A 1T6WA 4FHBD 4PSPA 1MH5A 4P5MB 3JBG7 5DEFA 5DRWA 5I8KL 4E41D 2N7BA 1D6VH 4UCFA 1NBVL 1M01A 3OGCB 1UR8A 3PV7A 1AJ7H 1PLGH 4L4VE 1CFVL 1C7TA 3BZEA 1HQRB 2O5XL 3PF2A 3MRPA 4HS8H 2DTMH 2XRAH 5I1HL 4LLYA 4Y4HA 1HYSC 2E5EA 2E9BA 4ZG1A 5M7QA 35C8L 3O6FD 3I3BA 2XZCH 3WFBL 1A7OH 1VA9A 4QYOA 2N4IA 2PN5A 4W6XB 3PIQB 3AFLA 4P2OA 3MA9L 4DO6A 5J11B 2R0WH 3C6LD 5B22A 1IAIM 2GITA 3DRTB 4PRDB 2V5DA 1P5UA 5E2TH 4HF5H 3AHVA 3VKKA 5BS0D 4EIZC 4QCEA 1MLBB 3RRQA 2BERA 2X4QB 4P23C 3B3IA 4AEHL 1QFPA 3UAJC 3S96A 4ELMA 2NY6C 5MI0B 1T03H 4Z7QF 3VW3L 3QWQB 2E4TA 4LKCA 2IXUA 4X99B 4GO6B 1ZHBB 3SDCC 4OZHA 1KJ2L 2G60H 3WH5A 3LH2L 3DVNB 4X7FC 5IJKC 5D93C 4U1LA 4DKDC 2VR4A 4JFFD 1X5AA 5HI4C 2ZG2A 1KTDB 3V4PH 4TTDD 1HINH 2YR3A 3NSXA 4PV9A 2OW6A 2G3MA 4ZPVB 2HT4D 2W65B 1NAMA 1JL8A 3HUJF 3IDYB 4GJTB 1CQKA 4N0YL 2DI7A 1U8PB 5K9JL 1JF1B 5TE7H 3UETA 3BWUC 3E6FA 1NCCH 1ZLVH 2YN3A 3OTTA 4CDGC 4WJ5B 3DVFA 5EOQH 5BJTB 2DSKA 2XIBA 5IROC 5I73C 2EE6A 5B38G 4Q58C 3ZR5A 3WLBA 1U3HA 3Q0HA 5GQBA 4PJHF 3KHQA 4N9GA 1A7NL 4Z5RA 3OXRA 5HHNB 3HZYA 4LCCA 1Q0YH 4KHTH 4MX7A 4MPKA 4KPHH 1P84K 3AMLA 4KKLD 3MNVA 2AEQH 4KROB 4X9IA 1LO2L 5DUMH 4CVXA 3B8SA 1OAYL 5J6HB 1UD5A 4U6HB 4RMTA 4JKWA 3QQ9D 5F9AC 4CU6A 1FVCA 2CJUH 1JGUH 5IFHH 4JM2C 3KPSE 3QDMD 2FIKB 1O7VA 2I60L 3FCTA 1JNLH 1KCSL 5JOEA 4XVUD 4XC1H 1JYXA 3DO3A 1FFOA 4PUBL 4XRCB 3CVHH 1RIVL 3D3VB 1NGPL 4Z8FH 2WYSA 4TVPH 4W8LA 4YNYA 2XY2A 5KN5A 3QA3B 4KVNL 4NQVB 4M8QA 5ABDE 3KL0A 2R69L 1F97A 4MSWA 3ZTJH 3VXOA 5CBAA 1JD9A 4YZFE 2FSEB 2Z92A 5DYOB 5D2LB 2EDOA 3O8XB 2DQCL 5D7LD 2F7PA 3DX9A 5GJTL 3ILPB 2AERT 4WNQB 4G6JL 3WL0A 1A6UH 1OSPH 4P59L 3THML 1X5ZA 3V5HA 4P5TC 4U33A 4DVRH 4Z6AT 5FYKH 1QI3A 5HDBF 3VFMA 2QHRH 3L4YA 4PJEF 4Z7VA 4NZUL 2COQA 4PJ9B 3RVWD 3QIWB 3PNWB 4U2ZA 1PX8A 2DSZA 1CL7L 3L3JA 4NFDA 3QEQD 3SBWC 3AFBA 4R7DA 5EU6B 2VLKA 3PBGA 2OWWA 1W0WB 3FO1A 3VFUB 2IPTL 3CXDL 4KKBD 4WU7B 4MTVA 1IGJB 1FRGH 1HJSA 4FF5A 5ILTL 4PJ7A 1Q38A 1K4DA 1S7QB 4HEME 4W5ZA 4NNPL 2ZUUA 3T0EB 1G7MB 3LN9A 3S34L 2OMBA 4KRTA 2L0DA 3EJYC 1A64A 3GB7A 1I7RA 2PWHA 2HTKD 2VQTA 2AP2A 2C4FU 4FNLH 4R97B 5CJBA 1NOFA 1D9KB 3KJ4B 1ZL1A 2AK1H 5KEZA 3EJZC 1YNTB 1RU9L 3OB0H 3L95B 3HNTH 4Z95H 1WWAX 5CGYD 2XICA 4Z0XB 4M43L 2IUZA 5EBMB 4ZUVA 2XA8L 4P2RD 3ES6A 2JJTA 4A2MA 1VEMA 3G04B 3PGCA 5HGAB 1MJ7L 1T0NB 2C7FA 4JO2H 4KVCL 1UQZA 3MJ8B 4X0KA 2D3VA 4HIHA 3UO1L 1SYSA 1LK2A 4MA7H 1XSJA 4KTDH 5HOSA 4UZSA 5JW4R 4I4WB 1YJDH 1UXSA 5F7YC 5C09D 4YHPB 3EDKA 2VLJA 1NSNL 4G9DA 2VN4A 4L1HA 1IGCH 3C5SA 4K9EH 2Z31B 4KRPD 5HDLA 2LU3A 4XX1G 2ICWJ 3EYQC 4XNQA 3FAXA 4F15C 1UCTA 4ZSOE 5SV3A 4LMQE 2CLRA 4GH7B 1YMME 3QUZB 3PZOA 3AQUA 3NCJH 3CZ8A 1JHKL 2BVPA 4OGXH 5A16A 4U05A 5TGBA 3RIAK 4FQHA 1S9VB 3RTQA 3BAIA 4UZUA 4LPVA 1F3JA 3OKLB 3LN4B 4F3FA 1G7PA 1MVUA 3CVHA 4W86A 2ADIA 3OKKB 1B30A 2D73A 1MHCA 3BD4A 5T3ZH 5I0DA 1PAMA 4GT7A 4P46B 1NWUA 3EMCA 3ZJKA 1NDMB 2YD3A 1MRFH 1NC4A 1AQDB 2XWJB 3DX7B 5GGRB 4E42A 1KTCA 5DD1H 4XCYA 1QSFE 2L7UA 4EBQL 1ERNA 3L4WA 4KRMB 1E5JA 3O3EB 1KJMB 1T1YA 1D5BB 5I76A 1W9BM 5FB8A 2VSDA 3MCKB 2FJHA 3QR2A 1RZ8A 5LWYH 3IDGA 1INQA 2JB5H 4G9FB 1AQ0A 1CGSL 1MIEH 1T7YA 1ITBB 3HG1B 2YD6A 2XQBH 4KJQD 4PMUA 1I7TA 4F2MB 1B90A 1ZT7A 5CEZE 1NBZB 2G4FA 7A3HA 3KE0A 1V8HA 1U8LB 3CGTA 3F7RA 1P7QB 1J9CT 2R1YB 3OF6D 1LP9F 4GW5A 3L4VA 4PMRA 3LQAH 3RX7A 2FLBT 1EEYB 2XA3A 3UTSE 4AMXA 4AM0A 4PMOA 4OJFL 4LSSL 2YC1A 3T09A 3EOTH 4WHYG 1WWBX 3GSNB 2HH0H 1V3HA 4L4PA 1UR9A 5K9KA 4LPYA 2BVUA 4JLRA 3CZNA 2IAND 5BV7B 3H8NA 5GRXG 4PJGB 3H0TB 1G7LA 4C58B 2VLRA 4GI6A 1MQRA 1E56A 2H3NA 1Z6JT 2P46B 5C7XL 4J1UA 3CSYB 4RIRA 1JPSH 1YHTA 1NDGB 5GRWA 3RWEA 1TTFA 2NY3D 1DL7L 3MRCB 1KEMH 4M48L 3WELA 3MRJA 4W8AA 1ORQA 5EBLA 2OLDA 4PLJC 3ZKSD 4PGEB 2A73A 1FPTL 2QSCL 2UV3A 3U30B 1E0OB 2O5YL 4JRXB 1ODUA 1RK1B 4OZ4A 1H5VA 4J3SA 4QGYA 2J6EA 5FO7A 3VINA 4WW2A 3DYOA 3TBVB 1AMYA 1LL4A 1W32A 5EFIB 1WBZA 4G80A 3WE6B 5IFTA 5DJAA 2EADA 1C08A 4OSUL 5EUOB 5C0DA 4EDXA 2BSRB 3UJIL 4RA3A 1FZJB 5LGHH 5DFVD 4MMXC 3D9AH 3L5IA 5ALCL 1AQKH 1UEYA 1ZLUK 1RJCA 1B2WL 2BOCB 1KXQE 5BXFA 5BRZD 4HEPG 2BXZA 3INUL 3WF3A 3H42H 4NO5A 1DVFB 3U36A 2F53D 2V2TB 1HQ4A 1NARA 3BO8B 1F8TL 5KSVB 3VXSB 5HYQA 2XM2A 4LF3B 5L8JB 1B3XA 3GKWH 3MBXH 2H2SC 4JPKL 4P5MA 3N50A 3GXPA 4LYPA 1ZT4B 1MFBL 3NN8B 3MZGB 1J1XH 3OGCA 2GJ6E 5D7IE 2EYRB 4Z7UA 1QI4A 5HI5C 3MCG1 4ONHB 3H9SB 1X4XA 2NR6D 1YEFH 1HQRA 2PWEA 4WO4C 3MLTB 3P9LA 1MCOL 4FOMA 4X9YA 3PQYE 2WW5A 3R8QA 2NY4B 1OP3K 1ZS8B 1SJEB 4CD6A 4R0LC 2PTVA 1A6WL 4QTHB 5EU6D 5IB4A 3DSFH 1YEJH 3MXVH 4U3CA 1T5WB 2B31A 1EUTA 1N6UA 2CBIA 5T33H 2X1IA 2PO6B 1I1WA 2OK0L 4JFPB 4KQ4L 3B9KB 4J3UA 1WIUA 2X4RA 1LVEA 5EBAA 3TIEB 4XVJL 2AXFB 4Q22A 1C7SA 2ZP0T 4IRJD 1HP4A 2ALWA 1CDUA 4L9LB 4WY7L 1JXKA 5D72H 2G5BB 5I74C 3SPVB 2YDQA 1TJGH 4BQ5A 3V95A 1S5HB 4X99A 1H8OA 1FIGH 3WUGA 4WRLA 1CD1B 1ZHBA 1HHJB 4X98B 1RZFH 4WKFA 3KPNB 4NDMA 3AMCA 4RWYL 1U91B 4C83A 2R1XB 4YFEA 3DVNA 5DMGD 3UBXA 3S88H 2ARJQ 5C08B 3KYKH 1ODZA 3VU2A 1YY8B 4K2UL 4CKQA 1UWQA 4XBGB 3VIFA 1OGAB 1RAMA 1QO3B 3BESR 1P5VA 4ZPVA 4KK9C 1ZBVA 2W65A 1CECA 4OIAA 1CWYA 2J77A 1Q6GA 4I18B 4YO0A 1PY4A 2BK8A 5EPMB 3WIIL 1I8IB 4GS7C 1R86A 1G9EA 5C0EA 1I1FA 1MAMH 5E7FA 4P2CG 1U8PA 5IMLA 2F54D 1JF1A 4KZEL 1MNUL 4P9HL 1K2DA 4OF0A 4Q0XL 5FGBA 4WJ5A 4OLWH 4NO2B 3VI4F 5D7SH 4PMNA 4OAWA 4QT5A 1ZA3B 5LQBH 1INDH 1J0KA 3ECQA 2K7PA 3ZDYF 2IJ0C 3TBWB 3OXSA 2A2QT 3HHRB 2ZUTA 2BJML 4U0RB 5E2UH 3C60C 4NRYB 1FH5H 4U31A 3ECBB 5DXWA 1H0IA 3UPCA 2Y2WA 4U6HA 4G6AD 4ML4A 3CUIA 5CBEB 3MO4A 3BAEH 3BH8B 4H0GA 1OTUC 4RAHA 3O41A 3O4OC 3APGA 2XFXB 3M8OH 1WDRA 2J4WH 4NPYB 4LGXA 2GHWB 4AIUA 4XRCA 4DOHB 3OGSA 3BZFB 5HYSG 3WS6A 4A4AA 1MCQA 5F9JB 1XCQA 3D3VA 1I4FB 1F3RB 4HUKB 4MS8C 3WD0A 4PYHA 3S5ZA 3LMJL 4NQVA 4G8GE 1NMAH 3QHTC 1RMFH 1OD9A 1NP0A 1H4PA 3MCLL 5F71A 3PP3K 5I30H 1M1SA 1M53A 4XP6H 5F6IB 5MEOB 5T3XL 3VFVB 3MO1B 1FO0B 4UB0L 3DBXB 4JFHD 2FSEA 5DYOA 1E1FA 5D2LA 3O8XA 5A43C 4FNTA 1R0AL 5CS7A 3ILPA 3MBEB 3P77A 4AZCB 3GJFB 1HWGB 3IKCB 3LS5L 3CX2A 5SWZB 3RWDB 4QKXB 1A5FH 3KYAA 1KJ3L 5IGXL 2IGFL 3SQBA 4P4RB 1GPOL 4HLZG 5FUCE 4PTUA 2P5ED 4PJ9A 5D7KD 3PNWA 4Q6IA 5KVGL 4OZFG 2OR9H 4G5ZL 2GJZB 4R9HA 3DPBA 2ESVD 3QHMA 3LXAA 3GSNH 2UWEF 3I6LD 4AEIL 3A4XA 1WISA 4ZAKC 1W0WA 2R2EB 4K7PH 2VZTA 3IGAA 4AT6A 3EIFA 1IGJA 3MRNB 1AO7E 2JLLA 3LRLA 3RWFB 3SCUA 1WJ3A 5DT1H 1FLTX 3HI5L 5BXRA 1M6OB 2AI0L 3T0EA 5FCUL 1G7MA 4YHKH 1CICC 4PJDE 1JPTH 2HT3C 4FFZL 3BUQA 3QUYB 4X6EB 4YAQA 1FGNH 3FB8B 3ZTNH 1D9KA 1VEOA 4JG0L 3CZGA 4Y8AA 3GMNB 4L8DB 1YNTA 1X5IA 1S7UB 3L95A 4Z0XA 1U8JB 5EBMA 3IJ8A 4HJGB 1HKJA 4PCTA 3G04A 1D3CA 3VSUA 5D7JC 5HGAA 1P4LB 5DFAA 1T0NA 5FCSH 5KW9L 6TAAA 3MV9D 4JFDB 1MCNA 4R26L 1EXUA 4I4WA 3NDZA 4MXVF 4PRID 1MCDA 1E5NA 4JJHA 1MJUL 2R0ZH 1UA7A 1LEIB 1NLBL 4FFVC 3SN6N 5CWSA 5EA0L 2ATPB 1YEIH 2Z31A 2EYTB 1FHGA 3H9SD 4NGHH 3GSXB 4BUHA 4JZOB 2EO1A 4Y19E 3G6DH 1T21B 4H1LH 3QUZA 1EBAA 4TQEH 4YHIB 3ZSTA 1V6VA 3EDDA 3P40A 3UBXI 2ZG1A 3Q6FA 4LRIA 3HFMH 1GGCH 3FQXB 1S9VA 1MWOA 3CMJA 1Z3GL 3OKLA 4AZ5A 5CEZH 1C8XA 1W9DM 4TPRL 3OKKA 4HS3B 2PO6D 2EH8L 2APBA 1U8OA 4HKBB 1JPFB 5DD0H 4P46A 1M71B 1NDMA 1OIMA 4X4XB 5KTEL 3UG4A 2W9DL 3VFNB 2X70B 5JXAL 1RY7B 5DRNA 1ZLWK 3DX7A 5GGRA 2Q8AH 2VXVH 1I8KB 2XN9B 3VRIB 3O3EA 1KJMA 4WWKB 5I18H 4NJAL 3M46A 1NLDH 1G7QA 3VXRB 1KIPB 3W38A 4G9FA 5DUBB 2W92A 1J0HA 5C08D 4O51B 3HG1A 3CFBA 4RGNE 2WSPA 2NTSP 3WJLC 5I8OH 1NBZA 1OGAD 5CSGA 4GW4B 4HWBL 1JZ3A 1V7ML 1U8LA 4RAUB 1P7QA 2GKIA 3D18B 3EOYG 2R1YA 2AQ3A 1KCLA 3U1SH 2ZX9A 5I75C 1QBMH 2BY1A 4RX4D 5E2WH 1EEYA 3BZ4B 3CFJB 4P9HC 1CG9B 3LPGA 3L3OA 4Z7WF 3WD3A 3AS0A 1KEGH 3GSNA 2ORBL 1VAHA 3KL5A 3B2VL 3MLSH 1P1ZB 4M7ZB 2Q86B 4PJGA 3H0TA 2I9TB 1EX0A 5I1GL 3M6DA 4J3XA 4F33B 4JY6A 1TZGH 4GQ9L 5IVZB 3W9EB 1A4JB 4FQCH 4GRLD 2W0PA 1I3GH 3MRCA 5B4MD 1WZLA 3TN0D 1W1VA 3MRFA 4O2CB 1GGYA 3FFCB 3K3QA 3ZIZA 3PE9A 4PGEA 3ULUD 3VG0H 2FB4L 5HBFA 2WWMC 4JRXA 3GGWB 3MS8A 1YMMA 3AXLB 1HXKA 1E40A 2JIWA 1UB6B 5A6KA 4NIKB 3QNYB 1C92A 2VT0A 5I1CL 1KCRH 5FECB 3V5DB 3TBVA 3L4XA 1QHPA 3WH9A 4N90E 1W9XA 1RUKH 1ZU8A 2OZ4H 4NQCB 3WE6A 5F9OH 1U30A 3VXNB 1JI2A 2Z93B 4HGMA 5EUOA 3QG7L 2BSRA 2Q3AA 2DQJH 1FZJA 4QY8B 5AD0B 3O3BA 4G42B 3VD4A 4KHXH 2O61A 4ODHL 25C8L 4NZRL 1HI6B 2BOCA 4OD1H 5C0CB 3SGEH 1J88A 3SE3C 3U82B 1DVFA 4UOZA 2V2TA 4U3HA 3FN3A 1SMOA 1P4BL 2ED8A 3BO8A 4MA8L 4YBLB 5KSVA 2MCG1 1XSIA 3VXSA 1WCQA 5E8NA 3V6OE 3WKNA 4LF3A 1WC7B 2CLVB 2HFGL 1JN6B 4EUPG 4X9FA 4XCCL 5DURD 3SQOL 4DAGL 1ZT4A 3NN8A 3RI5F 2PR4H 4C56B 1HXJA 3F58L 3MRRB 4KKAC 4XXCA 4DTGH 4ONHA 3BPLC 3DJ9A 5IG7B 3KPQB 1JJUA 3MLTA 1HNYA 2ADFL 4OD2B 4FQLL 3UESA 3OKDB 5E4EC 2DQTH 3U7YH 1SJEA 1G9ML 1S9KC 5E1QA 4PS4H 3UTSA 1T5WA 2KQNA 4JFTA 5DMJB 1QVOB 3KLDA 3MV8B 4IRZH 1MEXH 1Q9KB 1QRNB 4X8JB 2TAAA 5GISL 4X4ME 4DK3A 4JFPA 3BPCB 3B9KA 3KS0J 4RAVA 3BGFC 4AYSA 3TIEA 4Z9KB 2AXFA 1L7TH 1UENA 3RO8A 2EC9T 3QFJB 4LPXA 2RQ8A 4JHWH 4FMFA 3EMQA 2YPLE 4LGRB 3U7WH 4XBEL 4L9LA 1I9JL 1KB5H 2Q8BH 3SPVA 4LSRL 3DGGB 3L5HA 4I0CC 5EWIH 1S5HA 2QLYA 1CD1A 3WO4C 1HHJA 3B2UD 4X98A 3BCDA 3KPNA 1U91A 1WB0A 2R1XA 4XX6A 3P0VL 4R4FL 4UOW0 1YY8A 2HWZL 1A3RL 3ZYJA 1FNHA 4NN7C 4XBGA 2HRPH 3VA2C 1NEUA 1CN4A 1IGTB 4FFYH 4BKLB 1QO3A 1U8KA 1OOAA 2AS5M 1IGIL 1FH7A 5DUPL 4R3SB 3UTPD 3IB4A 4I18A 5EPMA 1I8IA 4XWOD 3SUVA 2FZ3B 2VVNA 1OW0A 3CJJA 2CESA 2EDTA 4MJ4A 4P57B 4E5XB 5C0AD 1NAKH 2OSLB 2GTWB 3HR6A 4WCYL 3CD4A 3LRSB 1ACYL 2IBGA 4XBPA 2Z1KA 1ZA3A 3EYVB 5IIEA 2OR8A 1RUML 4O2EB 5DO2D 3ARUA 3TBWA 3ARGB 1I8LC 1RZKL 2F15A 3QIUB 4M6OH 4XCFH 2CBUA 4FTVD 4WTZA 2GJ6A 3BPOC 3QEGL 4ZUWA 3FO2B 1QD0A 3VXTB 1NWRA 2ENYA 5CBEA 4D3CH 1OGBA 2XWBB 3BAKA 1FOBA 1CZ8H 1KXVA 3BH8A 2F7OA 5GS0H 2WBJB 2P1YA 2J7GA 1JZ5A 3BVUA 2DM2A 1P4IL 2MOVA 4A6YB 5FGCE 1WZAA 3DETD 4NPYA 4DGIL 3A6CL 3BZFA 5F9JA 1I4FA 1R7AA 5JA8B 2XYCA 2DWEB 3DVGA 3IF1B 5B21A 3VIHA 2WP3T 1J5OH 5FDWB 4KQ3H 2XKSA 3NGBC 5MEOA 4J3WA 3N9GL 4UQAA 2MMXA 1W8OA 3VFVA 3MO1A 4P8VA 3WUZA 1FO0A 3P4MB 3DBXA 3V4VL 3OG4B 1N6QL 3MBEA 2YRZA 3WN5B 3L2MA 3GM8A 3IKCA 2WQ8A 5C0GA 3RWDA 3SE9L 2NY5L 2B39A 1N0XL 1HKLH 4OTXL 3CHEA 4P4RA 1IBGL 4KKCC 3WMSA 5DA0B 4EVNB 1UOKA 6CGTA 4NJ9L 4HKZB 4Y16C 1UZ8B 2VXSH 1BJ1H 3ARZA 5GGQH 2GJZA 4HXAH 4TSBL 2JJSA 1R34A 4GSDL 1CD0A 2CK0L 1M05B 1MFEL 4Y4FB 4QGTA 1AGFB 2R2EA 1UA6H 1ZV5A 3KEHA 1U93B 2PXYB 5CKGA 7CGTA 4YEFA 1EV2E 5J7CC 3HLAB 5F7FA 1WEJH 4BZ1H 3RWFA 1NFDB 3HG4A 3RCNA 5JPNB 1ZHKA 3ROOB 4M80A 3H3KA 1RIUL 2DI8A 5KS9E 1SFSA 1KLFA 1C3FA 2F7QA 2W0KA 4K94H 1T0MA 4PJ8D 1Q0XH 2X9XA 2CITA 4MZ3A 2Y36H 3CFCH 3WXVL 1N59B 4QNPF 3GMNA 5JMRA 1FBIL 1HHGB 4R7NB 1FLRL 4L8DA 1CLYL 5LBSL 4X7CC 4HBQA 3IJ9A 4IHOB 1S7UA 4OZIF 4DKEH 1U8JA 4MD5B 4FZEH 2Y06H 3RKDC 2XTLA 1JGVL 3JTSB 5T1KA 3P9MB 4DWSC 3FB6B 4S10A 5C0CD 2YLAA 1AXSB 1H3TA 3BPNC 4GKSB 1U8QB 3QUML 4JFDA 3VRLE 2GDVA 5GRUL 4X5XB 3Q2CA 1P6FA 2OTWB 1GVYA 4J12A 1CGWA 5HHMB 3FXYA 3VXME 1ITXA 3DYPA 5E6IB 4NZJA 3UZQA 2D7NA 5FL1A 5E1AA 1LEIA 2P5WB 4MJ6A 3SOBL 3O2DA 3DX6A 1NBYB 1YECL 5CG0A 2AK4B 2ATPA 1XF1A 2NSXA 3BQUB 4JZOA 3SCRA 4HFUL 1T21A 3CK0H 1P7KB 5E6ZA 3CFDA 1G9MC 3MLXH 3LEVH 4KDTC 3I50L 1VCAA 5T5FL 4M6AA 2ZX7A 4N5UA 4ZXBD 3JWDL 5FYLL 5IB1B 3CO4A 5A2LH 3FQXA 4P23B 2F5BL 4H5SB 3LZFH 4OQ1A 5GJSL 4NM4H 1BLIA 1BBDH 3TZVD 4F9LA 2XUCA 5BXPA 3BN9D 3ME0A 4HS3A 3Q5OA 4PREB 4HKBA 4WSKA 2ZUQC 3Q48A 3BH9B 1JPFA 1Z9SA 1L9MA 3RIFF 1M71A 2DEPA 3OLGA 3TVMC 3CZKA 3QFJD 1U3HD 4POZC 2QQNL 4X4XA 5I23A 3VFNA 3KL3A 2X70A 4Z0BL 5EO0B 4LYRA 3A47A 2RGSA 1I8KA 2XN9A 5MENB 2BP3A 3VRIA 3LRMA 3C5ZC 3G6LA 4WWKA 1NOUA 3WD2A 4ENED 3A5VA 3AREA 2AV1A 4V2BA 4YFDB 3VXRA 1KIPA 2FGZA 5DUBA 1UM5L 1MREH 4OLUL 3MACH 4O51A 4MDIB 4XP1H 1Z9OA 2YPVH 2X6MA 4FABL 4E0RB 4AD1A 4MZ2A 4R4BB 3GXNA 4JANB 4UV7H 1Z0MA 5IM7A 4RAUA 3GUTB 4O5LL 1FL6B 4LEOB 4FQIH 4JL2A 2ZNWA 3CFJA 1CD9B 3BZ4A 1CG9A 4M61B 4OCSH 1UWGH