1TCMA

Cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNADPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The raw starch binding domain of cyclodextrin glycosyltransferase from Bacillus circulans strain 251.
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 201
structure length 686
sequence length 686
chains with identical sequence B
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1996-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tcmA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1tcmA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1tcmA01
4N0YH 5D1XA 4H0HB 1FO0H 4JY6B 2JALA 3QUXC 3AUVA 2Y6SD 4DKDC 5IEHB 1QI5A 1TLKA 5DI8B 1JNHA 2NY4D 1VCAA 2XPGB 3HI1B 4O4YL 3WH7A 3VFSB 2VZTA 1QKZL 3BDYH 2P8MA 1KYOK 4ISVB 3BOVA 3K4DA 4L8DB 4IOIB 3EOTL 5EZJA 3PWPD 4CJ0A 4JKKA 1E4KC 1HQRB 2ED8A 1N8ZB 1XEDA 4HT1H 4E0RB 1P9MA 3AXLB 4O9HH 5TFSL 2CKBH 3NDZA 5C71A 4W5ZA 3BGMA 1AXSA 3BLPX 2XVNA 1S5IL 4U1IA 5ID0A 1XR9B 1IC5L 1KJVB 2J7DA 3R8QA 4Q7NA 4HHAB 3P9LA 1FQ9C 5EB9A 3AAZA 4WEBH 2VR4A 2DLEA 4PJ7F 3FRUB 4E8CA 3KWWB 5MERB 3L7FA 5FOOA 4L4VE 5HHPA 1C1EH 5J1AA 3RVTC 1CDHA 1AGDB 2WKLA 2DQHH 4OKDA 3BCDA 1XFPA 5ENWA 5BQ7B 3FN3A 4GW5B 1G84A 2R4SL 4PTUB 4JHOA 1WBZA 4KMQA 1KBGL 1JNNL 1YEJL 4W86A 3M17A 2HP4A 3WLWC 3L3KA 1J1PL 1F58H 1XGRB 1JWUA 1BEYL 4URIA 4ZPTA 3SDCC 2E8YA 1MCOL 1JUFB 2FDMA 3RPMA 3WO4B 4J3VA 1H3XA 4R4BB 4QY8B 5KZ6A 4NKQB 4NO0A 3CC5A 2FHCA 5EOCH 4PJCA 5KSAD 1FNFA 3GSQA 3EDFA 1DN0A 3HG1B 1NGPL 3VE0A 1OINA 5CJ5A 2BNQE 3S88L 1BFVH 5EU4A 1IGCH 3O6FB 2C3WA 3PL6B 3RKPA 3VFPA 4IIQC 4LCUB 2CERA 1Z9LA 4GPNA 3O41A 4JFFA 4LHUB 2PETA 4LQFH 4LAQL 3BLKA 1A0QH 4YDKH 2M8XA 2P24B 2RFXB 4Q97A 1DLHB 3CUPA 3E8UH 4BQ4A 4CL7A 2ZUQC 1VIWA 2OM5A 2X8RA 1CDUA 2IAMA 1QNOA 1SHMA 2P42B 5BQ7A 1UZ1A 5JW3L 3VI3F 5FM5M 3D4YA 5FHAL 5I0ZA 1WIUA 1T1YA 3HC0A 4BQ5A 5FYLH 2HFEB 1ZHLA 3L5WA 4K8RH 1X5KA 2HWZL 3IRZA 3OF6D 1EAPA 4YUEL 2EADA 4N8VB 1ZL1A 5AD0A 3RDKA 2OXHA 1JNEA 4OI7A 3O2DH 5FM4A 5BRZA 4UQ3B 5I1GL 4R8WH 3UBXA 1F4YH 3MS8A 1AE6H 3K7UA 4PLOB 4D9QD 3A4WA 3X11B 5IVXB 4YAQB 3SURA 5KS9A 1PY4A 2VXUL 2ZXAA 4WEBL 1MCEA 4JFVA 4E0RA 3GBDA 3UPCA 2VXTL 4U1GC 3WS3A 1QFWI 1MCFA 4JPKL 4EI6A 1T21B 4F7TA 4HK0B 1F4AA 4A6YL 3MR9B 4LCCA 4P99A 3BQUD 3DXAD 1N26A 2R2BB 2FJHA 4M02A 3ARVA 3RTQD 2NTFB 1OQOA 1ZLVH 2XA3A 3ZLQC 1G6RA 3ZTNL 1S8DA 2VIRB 2OQJB 1JZ7A 1MW1A 1JJUA 5MHSE 1QNPA 2UV3A 2UUDH 2EEXA 5E1AA 4MWFB 3M17B 3IGAA 3VRIA 1UM4L 3SO5A 3BSZL 4M8VA 5JUVA 3A24A 3WF4A 1JP5A 2A3BA 4P4RB 2OWCA 4LF3B 2YBUA 4JFDA 3U4EA 4OF7A 5D8ZA 1XGTA 1KFAH 1LHZA 3DYMA 1PZ2A 4ONOA 2EDOA 2EH8L 2A77H 2EXWD 2G75B 2Q76B 1NSNH 1GGCH 4EKXA 4ELMA 4NZCA 1IRAY 4Z7OE 4WO4B 1JYNA 2P8LA 4XBGB 4OI8A 2GITA 5I8CA 3UO1L 4X8XA 1JHLL 5DZNA 3ZTJH 3QOMA 1IE5A 3P0GB 4HUXB 3B6SB 4NP4L 4LKCB 4PBVC 5I74C 5ID0B 3VWKB 1A5FL 5LQBH 3RGHA 4R96A 1I8IA 1UA7A 3MRDB 3CDGB 5AYIA 2E9BA 5KVEH 3CSBA 1MH5B 1QO3B 1BPLB 3BGMB 5IT2H 4GMSH 4P8WA 3BVWA 3TO2A 3CD4A 1D5XA 1KJ2L 5IG7B 5HYJE 4HOZA 4XZBA 2Q3AA 2DYPA 3OAUL 5GSVB 2ITCA 5I8EB 4M6NL 2B0SH 3D85B 5E4EC 5BYWA 2DBLL 5I2UA 1KT2A 1JGEA 1BAGA 2BMKA 4G43A 4G6AD 3D2UB 4OJYA 1BLIA 1XAUA 4FRWA 5EU3B 2VLKA 3CFCL 1C8PA 5EUKA 1CGSH 3UTQA 1TVPA 4L5FH 4U6XB 1I7RA 3S5LB 4NQDA 1G0DA 1J0IA 1WEJH 3L9RB 2FX9H 4ODVL 1KLGA 4KDTA 2A2QT 3O6LL 1FYTB 3LMJL 5T3ZH 5CEZD 4PRPD 2EH7H 5SV3A 5A2JH 2OSYA 1QQDB 1GC1H 2V9QA 4P7LA 2YKLL 1AD0A 2VLMD 1IGML 3CVIL 3N50A 3CK0H 3GHBL 5GS2H 5E08H 3MLVL 4JZJA 1H0IA 4UV7H 5JW4M 3QJHA 3PZOA 3MMEB 4M1GH 5BV7H 4EDWL 1EXPA 5JHLH 4IM8A 2HTLD 1F2XK 5DFWH 4KGJA 3MGTB 4X5XB 3DBXA 3O8XC 4DN4H 2BXYA 2J47A 1JPGB 4HGWB 3L3JB 3FQXB 5E2VL 4M7KL 12E8L 4OD1L 4X0VA 1MCWW 3FZUC 4OCXL 1E4XL 1NCUA 3MV9B 4YH6A 5DD5L 2VCAA 4U1KB 1KGWA 1T2QH 5EU6A 4E2OA 2XZCL 5LXGL 3MCLL 3FO1A 2NZ9C 4D9LH 5IJKA 3NACL 1GOMA 3SDYH 2YBTA 3WL0A 4C83B 3MX0A 1HP5A 4XVJL 1MRCH 4W7VA 1BFTA 1H1NA 1PY9A 4G3YL 3VIPA 2ATPB 4QCFA 3JUYA 4JCMA 4UQ9A 4Z7QF 1NCCL 2J6EH 4DGYL 3W9DB 3WYRA 4XT1C 4G7YL 5CUSL 2V5SA 4M03A 3LN4A 3IXAA 5ISZA 4ZXBB 4D6JA 1IKNC 5HD8C 3S7GA 2XTJC 2JCCE 1AGBB 2HVJB 3QUKA 2PB1A 3G6JB 4Z7NF 1NLBL 1UD6A 3LY6A 1VFMA 4P3CH 2R1XA 2VN7A 2B2XL 5K9QI 2YL6A 3TFKD 5DJCB 3ORJA 1XF3A 2ZSWA 3X3GH 1Y6NR 4JM2C 3O11A 1H15A 2YSSB 1FLRL 4F79A 1R24A 1N4XH 3BN9C 3I75A 3MUZ1 4H20H 1U8LB 4NZJA 1AI1H 4KKAD 5D7JB 2E6QA 3DO3A 2ZOXA 3UR8A 3QXWA 2DWDA 3DUSA 4ODWB 3JV6A 3WUEA 3U83A 5SWQA 1I1AB 4V27A 3TYFA 3IAQA 2QQQA 4DOHE 1ZB5A 2R56L 3WBAA 2OLDA 5HHQB 1JDCA 2HFEA 3HPJA 2WNWA 3T0ED 1BWMA 4YQXL 4WIWA 2GTZB 2ZOKB 3IDXH 2BY3A 3L3DA 5KW9H 5F7EL 1VKXB 4MQSB 4X7EC 3C2AL 2DIEA 4JG1H 5JOPE 3W29A 3BQUA 2NY0C 1HE7A 4M93B 3RPIA 4H26A 2E8ZA 2JK5B 2W67A 4PR5B 5D6CA 1NCCH 3TESA 5FO8B 2B4CH 3VW3L 1QUNA 4APQD 1NUGA 4ZS6C 1A7RH 1VACA 3O6FA 3D69B 3PL6A 3GMLB 1MPAL 3IFLL 2H32A 3OKMA 3REWB 4BH7B 4P9HL 1DN0B 4ZXLA 3QHOA 2PTTA 3QWRD 4PJGE 1F42A 4NN6B 2G3NA 2OZ4L 4NO5B 2XZCH 4XVJH 3VFRA 1T0OA 4JL2A 2J7LA 2OCFD 2Z31D 3GBLA 5SWQB 3DRTA 1MF2H 4OGXL 2BSRB 2XVKA 4I3RH 5GZNC 1YDPA 3I2CH 4M43H 2DB8A 2WMFA 1UR2A 2DQGH 4JFQA 4JRYA 2EQDA 3HE6B 3MUY1 2PI6A 3ZDYF 3LB6C 3CVHH 3HFML 2F19L 1WISA 2YD3A 1K4CB 5HDBF 3O11B 4ONFL 4BYHA 4MXVE 1AGDA 2CK0H 1XF3B 2APTA 3EO0A 4BUHA 4IMLA 4DZBA 1MFVA 4X98A 1T80A 4B3KA 4OF8A 4M9OA 1GOHA 2ZSVB 3BJ91 4GBXD 1E0WA 3BWUC 1HXMA 4YFDB 4OLVH 5JW5B 5I6XC 3CSGA 1VGKB 2XTKA 4W88A 5GS1A 3SCRA 1ZHKB 4K3EH 4WW2A 2NT0A 4U6HB 2EDDA 3BUPA 4HGKC 2R0LH 5DGQA 5H35B 4O2FA 3RNQB 4QGTA 5DUPL 3OGCA 5GGUB 4HLZG 5C08E 1KR0A 3T09A 3UP1A 3CLWA 2B1AL 2DBLH 4B7IA 4OGXH 5KN5A 3S4SG 5LBSH 2YOCA 4Z5RB 5B8CB 1AQKH 5ALBH 1N3NB 2HMIC 4LASL 1OSPL 3CXHJ 4JR9L 3MV9A 3ULVF 3VRLE 3VDCA 3MOAL 1U93B 1VGEH 4UFKA 2OK0L 3O0RL 2EDXA 4G8IA 2XQYK 5EBLB 1I1YB 2BFVH 1TZHB 4DUVA 4EAMA 5GHWH 1IM9B 1BQHB 1OL0A 2J8UE 3A6BL 1ND0B 4HUNB 4UT6L 1U95A 5DJAA 1BQLL 3TO4A 5DR5H 5K9OA 4LNRB 3I9GL 2VTFA 1CQYA 3JV0A 1BYAA 2VCBA 2FD6H 3QXUA 5FCSH 3S35L 4P5TC 2ENYA 4ZPVB 1NBYB 4JFPB 2I25N 2VZ3A 4OIAA 5EN2B 2VABB 1YMMB 3B9DA 5KBNC 3K2UH 4POZD 1KLGB 4TSBL 3T3PE 3CMGA 1HHHA 4PCTA 5I1JH 3HG4A 1DBBH 5EWIH 4X80H 2WBJB 3QA3B 1BJ8A 5KSBB 2VXVL 3DX8A 2ADFL 5MEPA 4BK5A 3EYVA 4GJTB 1A8JH 1HDMB 3MLTA 3RPKA 4AIUA 1E4JA 3AIQA 4NQVA 3ZDZE 2VXSH 2ZUSA 1OSEA 3GSUA 4Y5XA 4OCSL 2DIJA 3I50H 3AICA 5IG7A 5FKPB 5DK0A 1W0VB 5T1LA 1WTLA 4PJHB 4DWSA 5ELIA 4FOMA 1O7DC 1W9VA 4U6YA 5F7UA 4PCSA 4H41A 2IANA 3QA3A 1IZJA 2VXUH 4JANA 3SCOA 4NUJB 4ATLA 3CV5A 1CQKA 4LLVB 4ZFOA 5BVJB 4W8LA 3HE6D 5ICXB 1ORQA 1JZ3A 1NKRA 1QYGH 2JB5L 4OKVB 4XAKD 3S4SA 4HMDA 3X12A 4K8RL 1IC7H 4XX6A 4TPRH 2ICWA 1G7IA 3QDAA 3QDGE 4FQHB 3BO8A 5FA3B 3RVUD 1FYTE 3S3JA 5KTEH 5I19L 5FL1A 4G8IB 4JVUA 3P4NA 1NMCB 4MJIE 3TBVA 3LQZB 4YR6B 3F5WA 4R7DB 1KR1A 5J9PB 3RNKB 5IB2A 3SY0B 2AJZB 3KHOA 5E1AB 1T1XB 3QPXL 1QLEH 3KPMB 4WWKC 4EUPG 2LU7A 1GHSA 1SR0A 2VDPH 5I79A 1WPCA 2YZ8A 3ET9F 2NTFA 4JFEE 1FH5H 3TYGL 4MNQA 5IW1B 3WIIH 5INCB 5C0JA 1AO7B 1CK0L 1UM5L 1ZGLP 1A4JB 4R27A 5JBDA 2WIMA 3QG6B 1AGCA 1D6VL 3EJZD 2GT9B 1UFUA 2IADB 3O6FD 3PL6D 3WENA 3KLAA 2VISA 5IM7A 1UWSA 2XPKA 1YEDB 3KXFA 4D6FA 5JIWA 4RMQA 2P43B 1HEZA 1OTUC 4K7PX 1JK8B 3P9MB 4V2XA 1P69B 4X4YA 1V3MA 2ZKHH 3I6KA 4LFHD 4KUZH 5FOBB 3MRRA 1DANT 3TNNA 1A6WH 1IGTB 3LIZL 3WN5B 1DR9A 1A7QH 1CFTB 1REIA 4R5EA 1CXHA 5KVDH 1D5ZB 1C12B 1EAPB 2VL5A 1RIVL 4Y2DD 3ZE2E 2H2SD 3W11C 4QRRA 5HGHB 2BK8A 4X99B 3BP7A 4L1HA 5ECUA 1YQVL 4PB9H 4RNRA 3U6RB 2MMXA 2J8UB 1CE6B 1U8JB 4U1MB 4ZUTB 1IARB 3L3GB 5J6GB 3RGVA 4BZYA 1I3RA 5IJVB 1B4RA 4PRAA 3SKJH 3DRTB 4YNYA 5DJ0A 3B5TA 3RMEA 1Q8MA 3RWFA 2GKIA 1H11A 1RUML 2D7TL 3BHBB 2Q6WB 2WAGA 1MFAH 3ULVC 1CR9H 3PDOB 5ADPH 1WK0A 1GAFH 1BZ9B 1RZIB 2ZOLA 5AC4A 2GJXA 3M8OL 3U30B 2OLHA 3QNZA 1U8OB 2W9DH 4JLRB 5C07D 3VXMD 3GSQB 4G8GE 1RZ7L 4F7PB 3EMCA 2GSGB 2W59A 4XHQA 3GMQA 4KUCD 1P84J 4L3AA 2VQUA 4PJ7E 1MJUL 1JUFA 3HNSH 3L6FA 1XCQB 3WHE1 1Q6GA 4XP4H 5A8QA 1E55A 3LKPA 5IVXE 3MV9D 2FX8L 4XI5C 5EWIL 1CE6A 3RIAF 3UTSB 1DQJB 4OZIE 5EZOH 4RQQA 1YUHA 4OUOA 1F2QA 3II1A 2W1NA 1SMDA 5HI3C 1EMTL 4OB5H 5C0RL 5IHRA 3O81A 4UT6H 1C3FA 3FQUB 4AMXA 3DGCR 5HI5D 1RU9L 1NGQL 3BZEB 2YJQA 4NHUB 2YSSA 1I7ZA 3C60A 4HUVB 3O9WC 4RMVA 3WO3B 2CHNA 5I1HL 4PG2C 4J3UA 5DK3A 1JN6B 3QFJE 1SEBA 5MEQB 5DJYB 3C9NA 1PSKL 1ISYA 1NFKA 3BAIA 3RJXA 5EOCJ 1WE5A 2DDQH 1JRHL 3EOBB 1IJ9A 4P5KB 3NIFF 2PR4H 1TQUA 1MCJA 3ZKND 3TA3B 4Q9RH 5JNYA 2F8OA 1RQ5A 1I7UA 4RFNC 1D6EA 4XBPA 1KXTA 1P7QA 1T5WA 3T0EE 4LCYA 4AL8L 2IH3A 1BAFH 2UWFA 2OTWA 1O7VA 2X2IA 3C87A 1KEGH 1I1RA 3A22A 3F7VB 2IAND 4WFHE 2NPLX 1HI6B 4WJ5A 4PYHA 3L2LA 1G9NL 5IW6A 1XH1A 4ZAKA 5I17A 3HA0A 1Q9WA 4X6DA 3VD7A 2J4GA 3WEMA 3KPQA 5E6IA 3RWIB 4TSBH 1J10A 1HHIB 3OWEA 3WFDH 5ILTH 3JWOH 3NPSC 4Y4FD 1KCUL 3W26A 4MAYD 5K59E 1C8YA 2NCMA 1JPGA 4RX4D 4GO8A 3GRWH 4PP1D 5IB1B 1OF2A 3U7VA 5IOPB 3BAEL 3EYPA 1LEIB 1NAKH 2OWXA 2FCBA 2Z93B 4NC2B 4WCYH 5SWSE 3VD3A 4F9PC 3SDDA 2CKBA 4F80A 1VPOH 1F58L 2ZUYA 1NCAH 2XSBA 4P8VA 3LN5A 3C8KA 1GJWA 3O3BA 1MW0A 4FQXC 4TRPL 3BP5A 4KU1A 4LP4A 1MCHA 1MHHA 3FT2A 5B3JE 1TTGA 3LRHA 5TDNB 2WZEA 5I16A 2Z1SA 5EUKB 3UTQB 3HUJF 3QRGL 4KQ3H 4V1DE 3RTQB 3GTNA 4L9LC 1M05B 2DLHA 1XH3A 5C6TL 1P6AB 4KZDL 2BMKB 5D1QC 5GGTA 1W1VA 2O61B 4FMFA 4IOFD 4LLWA 3DURB 5HVGB 3QIUB 4FQLH 2NNAA 4JFFD 5I1IH 3G04A 2BC4B 1F6AA 2EACA 4HZAA 4LVHB 5KZCB 3RWEA 2PNDA 3IJ8A 3NCFB 4L3CB 4MD4B 2CIKB 2AI0H 2W5FA 3RL2A 4DVBB 1ESWA 4ZFGH 5JNYB 2V17L 1HIZA 1F8TL 3DMMC 4KMTH 5GNXA 1XF1A 3GI8H 3VXSE 3OGRA 1ISWA 4MZ3A 4EIZC 2O5XL 4A6YA 1LWJA 5GGTL 3FW6A 5C0DB 2YZ1A 5C8BB 4PY7A 1YJDC 3VM7A 2Q86B 4R3SA 5BW7A 2UY3A 3W6LA 3HZMA 3CHFA 3DX7A 4DM2A 3FB8B 4GLRH 1MFBL 5DD3H 4Z7VE 2EDBA 4HXAH 1DE4B 1U93A 4XZUB 4C56B 5DO8A 1W3HA 4KZEH 1M4KA 3V4VL 3WFCL 4FLOA 3KYOB 4U1JB 3GYCA 5F8QC 5KOMC 1AXTL 1QOKA 3FB6B 4JFZH 3SCQA 3MV11 1FSKB 2XN1A 4K68A 4ZDHA 1Q9LA 3TZVA 1BFOB 2WINA 1E5JA 4GG6A 4MA1B 5DWUH 5L2KD 3OXSB 4K3EL 4PMXA 5E8NA 2D24A 4ODSH 2QSVA 3C60C 4PJ7B 1YNKL 3ZKXB 1QI2A 4MWFA 4X0KA 4Y4KB 1RUPL 5IVNA 3S5YA 3QDMB 2Q1EA 3OIHA 3VU2A 2Z8WC 1B6UA 1I1WA 4AEHH 1MHPL 5I1AA 4MHHG 1HF6A 2MPAL 4CBPA 2FSEB 2FJHB 2Y06H 2P45B 1RZKC 1K9FA 4ELME 2Y36H 3GNRA 3QNZB 4G3YH 4KUCF 4DKEL 1FGVL 1S9VA 4P2OD 4YHPB 1RZIA 4QNPF 3X14B 3IGUA 5GZOD 2JF6A 4HWZA 3RWDB 4MA3B 4JFQB 4GRWB 2KDGA 1R7OA 3IU3B 3OG4B 4P5TD 5E5RB 4DZ8A 3UBXB 2HFGH 3VPLA 4JFHE 4KV5E 3INUH 1U8JA 3CX5J 3FMGH 2YC1A 1EQCA 4L9LA 4OV5A 5D7IF 4ML4A 2XVLA 1HJXA 1H3GA 4X99A 2FB4L 4P57A 3T65B 4HWBH 4NDMB 3VH8B 3ROOB 1OTUD 3U6RA 3KPLA 3VXTB 4L8BA 1KTBA 4DKFH 2QR0B 3KPRA 3QUMH 4PJGB 5CP7A 4K3DL 5KEZA 1TCRA 3GB7A 4NOFA 2FSEA 4FF5A 4PJ8B 4P7QA 3VMOA 1IBGH 5HDRA 1TVHA 4QRUA 3SE3C 4EBQL 3FQRA 5T3XH 5T3ZE 2VC9A 2P24A 1V0MA 4CADB 3MJ8A 3PWPE 4H26B 3O8XA 1OIMA 4X6FB 1NCBH 2ICWJ 2R23B 3OBAA 2R69L 4ZFZB 3O0RH 1N82A 5BXSA 2ARWA 4RX4A 4E42A 5D7LB 2FE0A 5BCAA 1AY1H 3ARGD 4Q6IC 2ICWI 2WAHA 2WHKA 1R3LB 2F1BA 1MYRA 3KLDA 4PJEF 5IKCA 4P2RD 1Q9LB 3TZVB 1F11A 5LVEA 4ZDHB 4W4OC 4JHWL 3SE4C 4L4TE 4NQDD 4QXGL 1KPUA 2A1WL 6FABL 3UTTE 1R0AH 3MYZA 3GBNL 4FQXB 2B31A 2OW7A 4G42A 2J8GA 1MFEL 3BYYA 4XPAH 3T0WA 1ZGLB 3L3KB 1UOKA 4CDHA 5D8JH 1WC7B 1IQDB 3OKNB 2CEQA 2VH5L 3EGSA 5I1HH 1KJ3H 1DEEA 1T3FB 1RUPH 3QFJA 1INDH 3NCCB 3W24A 1TFVA 4MAUL 1Q6EA 3ECBB 1FHLA 1OARH 1QWNA 1MLBA 2FJFA 3QH3A 4NKDB 4OM0H 5CGTA 4J12A 3DLQR 5BXRA 3AAZB 2B4CC 4JFWA 1Q0YH 1KXHA 4G8FA 1WWBX 5CMAA 2VX5A 1AXTH 4PJFA 4PSPA 3BGAA 5T3ZL 3SHSA 2QMJA 5IB5B 1RZFL 5C0IB 1NGWB 4WO4D 3PE9A 3ZM8A 5BS0A 4PJGF 3VG0L 3DYPA 2EO7A 2NY3B 4D9LL 4P23B 5KVFH 4WHDA 3WUWG 3D5HA 4HF5L 1MJ8H 4GO9A 1ZKAA 3MLUH 2ZCHH 3CVHB 5D5MB 4JFSA 5TF1H 4B50A 2NY6D 1W0VA 5T1LB 3RKDC 4Y1AE 4DWSB 4OF6A 3U5YA 3F6LA 3NTCH 3P77A 1FNGB 1YEFH 1JI1A 3IETB 4JO3H 3HI1A 4NC1E 3MRJB 1IVLA 3TA3D 3KJ4C 2W0KA 1GIGH 1XYFA 3MV8A 4XNZC 1NLBH 3VIIA 1JGUL 3CVHA 3DSFH 4JZOB 2BNRD 3BXNB 5LCVL 5EOTA 4MADA 2HLFC 3K80A 3DI3B 5HYQA 1K2DB 3D18A 4MA8H 4F37F 1KACB 5EO9B 4E41B 4KI1A 4K7FA 3CFDA 2CCRA 4X5XA 3WMSA 5FL0A 3V0VB 3RX7A 1UVQB 4KKCD 4I3SH 5IB1A 3S35X 1DZBA 2WWDA 1A4KA 1FG9C 3GXMA 3KPOB 3O6LH 2F53A 3T2PA 5HGAA 1BBJA 1ONQB 3KL5A 4KTDH 1R3JB 3EAKA 4TUKL 2Y25A 1TCMA 4JVPA 4M61B 3UMTA 4FFYL 4LCCC 2PXYC 4FZEH 2N56A 2FYVA 1Q9WB 1B0GA 3EJYD 4K3HA 4X6DB 3WIHA 1GONA 5M95B 3WQ4A 2GW5A 3WFLA 4NQDB 1I1XA 4TTUA 1UJ3A 4D0BA 5I8OH 5EOQL 2VLKB 1S9XA 1UM6L 4ZO9A 1FZMB 2H26A 4P2OA 1GZJA 1C08A 1C5DB 1BYBA 3H42H 5EZLA 4YZFF 4MAYC 1EEQA 5A2BA 1J05A 4JRXD 2C7UB 3D85A 4NM4H 2JEQA 2ZKHL 4Y19E 4JDTH 4C59B 1OY3B 4GMSL 3MXWL 4NPYB 4WLCA 3UTZB 4O00A 5CJ8A 3GMNA 4KHTL 5B8CA 5IFAH 4HOWA 4U2ZA 1NEZB 1TA3B 1FCCA 1TJHL 4NRXB 1D6VH 1LD9A 5DJYA 1MH5A 1QO3A 2J8UF 4CW1A 2YD7A 3EJQA 2CRMA 1W2KT 2HLAB 3RIKA 1A6PA 3FN9A 4PRPB 4UQ2A 2VWEE 1CTOA 1EO8H 4LOUD 5GGRB 5ANME 1RK0B 2H3NA 5EZOL 4TTDC 3OGVA 1ADQL 1TQBB 3ARFD 4P8UA 2JF1A 5F3BA 1RVFL 3QP3A 5D71L 4HP5A 4X98B 3ZHDA 1M6OA 5TE7L 1OSZB 3S5ZA 4XHJC 4ODUA 1IKFH 4KK8C 5FB8B 3ZDZF 4Z78A 4Y8AA 4K3GA 2ERJB 4L9LB 4IRJA 3P4MA 3VINA 5GS1C 4UDUB 3AY4A 4YK4C 4LEXL 3TV3L 1ZVHA 2J78A 3GKZA 1MAML 1T20B 1UH4A 2A6KA 4NIKB 2APVA 4QAWA 1TQWA 2A6DA 5FUCC 1P4IH 4M3JA 1V7NH 3S36H 1W72H 3H8NA 5KVMC 3LKOA 2MTPA 4JJ5B 5A2AA 1SBSH 1TMQA 1BZ9A 3ULUC 3WDHA 1GC1L 2I60H 5F89B 3L4UA 5JQ6L 2V2TA 2H45A 5CSZB 3P0YL 1WCQA 1BWWA 5E9DE 1HXYB 3BIAX 3MANA 5EOCL 1A3LL 2DN7A 2BX5A 2D7PA 1F90H 5JORA 2V2WB 2CBJA 3OB0K 3RAJL 1BAFL 5CSGA 2F53E 5IB4A 1AD9B 1FNEA 1CGWA 4LL9A 4WKAA 4D6IA 3Q6GL 1UQSB 1V7MH 4GKZB 5C9JA 1JYXA 2J8UA 1RUAL 2KBGA 3HNVH 5SWZB 2PXYA 2XRAL 4S1QL 1DBAL 1HKKA 3OKEA 2R9HD 4OLWL 5JW3H 4Q6YA 4MLSA 2DGAA 5BO1H 4C56E 4M29A 2DDQL 2QQLL 1FVDB 3QQ9C 5IQ9A 4WSKA 1R5VA 4K9EC 3WNNA 4KTDL 2FGWL 1OWWA 3D9AH 2IAMB 4HIXL 5DA4A 3X3FH 2IGFH 3V52H 4XZUA 4KRUA 1HHKA 4K2UH 3QSKB 5FUZL 3RVTD 1GNXA 5AYUL 2COQA 1W72L 1GL4B 1MRDL 4PJ8C 3AIUA 2IADA 2X1QA 4PY7B 3E0GA 1Z3GH 4OFVA 2DQDH 1BVLB 1IL1B 1MAJA 3QIBC 4Z18A 2HG5A 3G6JA 5GJTH 3UG5A 3UC0L 4JFXA 4PJBB 3W39B 1GQLA 2Z8RA 1YEEL 2DSZA 3CUIA 2VZSA 2OTUB 2X4TB 32C2A 1TZ7A 1OGAB 4P9HC 1MIEL 3JBG7 4DCQB 1NANI 5J11C 1A1OB 4ZPTB 1NC2D 2CDFA 1YYLH 5F21B 3RWEB 3K8KA 1E6NA 4DVRL 3RAJH 1CFQA 1CBVH 4JKMA 3NCYP 5I73B 4WI6A 2XIDA 2DYPD 1JRHI 4U49A 4BFIA 1H0GA 1UWGL 1R3HA 1Q0YL 4OKVA 3X12B 4CUCA 4IDJH 1SYSB 1B0RB 1C5BL 3W2DH 2YXMA 5BWFA 1A6TB 2L7JA 1LO0H 2F53D 1B88A 2RJMA 2ADJA 4OM0L 1WFNA 1GYAA 3WUBA 1HQ4A 2AV7B 2DKUA 1B3JA 4HXBH 4HWEL 3WH8A 4MJ2A 5D2NB 3VFGH 5JZ7D 2LU3A 3BEVA 2VLKE 1X6LA 2AERT 2VLRA 1E27A 3WELA 5I71B 1P2CA 3EJZC 1YNLL 1EUTA 4QCIA 1FC2D 3QRFM 1F4XH 4YPJA 3IFNL 4ZOCA 2NZIA 4JFFE 1S9YA 1N0LA 1KGCE 3QEQB 5DEZA 2V3EA 5FIEA 4MNQE 4Y5XB 2D1ZA 2VERN 1ODAA 4XNQA 1LP9E 5I1KL 3MRCB 5FECB 5EO1B 3CFKA 1HI6A 1RVFH 5L8KB 3AMCA 3MLZH 4XCEB 3STLB 4P2RB 2CRIA 3O2DA 1QOXA 3PWVA 1P7QB 3KLSA 4EQ2A 1NOFA 3FHQA 2W0FB 2ZIDA 1TJGL 2B20A 2Y7QA 1S7WA 5DD0H 3ILQD 3UYRL 1D5XB 1TJHH 4MDIB 3ZJ6A 3OTTA 3WXWL 4PLKC 2CLZB 3JVGA 1DQDH 5BS0D 5A95A 4OZGB 4PJCF 2AJYH 3OMZA 3AS3A 4DK3A 1UA6L 4PMOA 2AEWA 4YHML 1T6VN 3QIUC 1FH5L 3W82A 3WIFA 4EDXB 3QT2A 2X7LB 5D9NA 3WS6C 5GSRA 1S5HB 3NIFE 1E4WL 5L8JB 3BAYA 1KCLA 2OYMA 1CDYA 3RJDA 1ES0B 5DHVA 1U8IB 1HJSA 3AMGA 4JN2A 4LSQH 2DJUA 1Q9KA 1W91A 1OAXL 3VCLA 1UKPA 5FCUL 2XQBL 3EKCA 1QSED 2YD8A 5AG8A 2R0LL 5BRPA 3QGVA 1U30A 3VXMB 1GJUA 2P5WB 1EIBA 3GSVA 4NKIL 4PV8B 4M3KB 3S98A 1J1OH 4LRNL 3WNPA 2EDJA 5DEFB 5F6HJ 3VGGA 2FHFA 4KRPD 3PABB 1D9KC 3OAYH 2V9RA 3LS5H 5HVFB 4QXWA 3BVVA 1VFUA 3N11A 1HXMB 3R4DA 2NW3B 3ARSA 2DWEB 5DD6A 3VIHA 4X8JB 5C6WH 5F6HI 1LQSR 2N1KA 4C4KT 4JFUA 1VBRA 4X9FA 1RAMA 1XCXA 4IMLB 1IQWL 1BJ1J 3QUXD 2AXHA 1OAZH 2R0WH 1JNLH 4L3ED 1L6ZA 2FIKA 1VADA 1DBJL 3GSNB 4LCCB 5H2BB 1G01A 1HJWA 1SJEA 5D7LE 3RWGB 4KKNA 4RA3A 1CZ8H 3O2VH 1PQZB 3PDOA 3MRHB 2XIIA 3FB5B 3EUUA 3UTPE 4X9IA 1U36A 2VQ1A 3RZCB 3G6JF 4TSCL 3HLAA 5B3JF 2H9GB 5MI0C 4KJQC 3MLUL 4PRAB 5FO9B 2AV7A 2F5BL 3BAKA 4GBXC 1FO0L 2HJLB 4YDJB 4HPOL 4NN5B 1RZJH 2CJUH 1BGXL 2B1HH 2DICA 2BV9A 3EYQD 1N4XL 3CLFL 4PRIE 5A94A 3MPCA 4X80L 4LU5L 3PJSA 3DMMA 1E4NA 4ACYA 5GGTH 4TVDA 1G0XA 4BH7A 1UB6A 1A1NB 1BYDA 4TOYH 4UR9A 1EEYA 5A40E 1KN2H 2JELL 5CIPB 3VGHA 1PG7L 2J8HA 5I78A 4UQEA 1U8HA 1SVCP 5CEYA 4W7WA 2WK2A 2X70B 1DQQB 1OTSD 1EEUA 4QHMB 1WNOA 3X13B 4JREB 5F7EH 1NUFA 2FJGA 1IZKA 1I4FB 2YFOA 1WEJL 5EUOA 5HI3D 4PRPE 2XVPA 4AYFA 4JKWA 4IRSB 1CGSL 1JPST 3B2UC 2CDEA 2VH5H 1YJDH 5IM7B 1MCKA 5KZCD 4O2EB 3EYOA 3VA2C 2GT9A 3BVXA 3QIUD 4JFFB 5B8CC 3D5OF 4OTXH 4TSCH 2HFGL 1OT1A 3LKSA 2P5ED 4ZUSB 2F5BH 4HJGB 2VRJA 5CPSA 2DM7A 2A1WH 3FZUD 4Y8DC 4KJQD 5KJRL 4EZMA 3UERA 1PEWA 5EBGA 2VZVA 4W8BA 5DJZA 1LK3L 4OM1L 3KPSA 3SCUA 4OCWH 2IUZA 3HR6A 3D0LA 3KYNA 5FEBA 1A9EB 3TBVB 4YXKH 1JZ5A 3ISWA 4O51B 3RQ3A 3BAEH 2YPKA 3ZJ8A 2Y06L 4QF1A 5J1AB 2VJXA 2E5EA 4DW2L 2D3NA 1ZA3A 3GRWL 2QLYA 1E9LA 5JUEH 4ELKB 4JZNB 1U3HC 3PTMA 3VGFA 3EYUH 4TUOB 2EPMX 1MNUH 2XKNB 1E40A 1AXIB 3U7WL 1T66C 1UQSA 1PFCA 4KRPC 3RVWD 1RK0A 3WY1A 5SV4A 1HINL 2AEQH 4HIHA 3V7AE 4D72A 4NQCA 5HTSA 1BSIA 1AQMA 4H04A 4GS7B 1OAKH 4MXWL 3QUZA 2P44B 5FKAB 4MCZB 1XCTB 3SBWC 4EUPA 1N8ZA 1U8NB 3QO0A 5GRUH 2QHRH 3MNZA 1HL8A 1TA3A 3NOIA 4P4KB 1V6XA 4X7CC 2XFXA 3VUPA 5DSCB 4PTTB 3U7AA 3VFSA 3CO4A 3DX9A 4KV5F 3SDCB 2Y5TB 3C5ZA 2KKQA 3MYJB 4KH2A 1KCRH 5CKAA 5D7IE 4YHZL 4XAKE 5DF0A 5JIHA 2IFFL 2VXQH 4DN3L 5GGSY 1AFVL 1DP0A 1FL3B 5MP6H 3K1KC 1EDTA 4L4JA 4CU7A 5E8EA 3BDXA 5FD0A 3QUXB 4H1LB 4Z8FH 1FFNA 2BOBB 5DJDA 5MEPB 2BRRL 1MNUL 3FFCA 3TIDA 3HG2A 1WICA 4XVSH 3MTRA 5JUEL 4UMGA 4Q9BA 3SE8L 3QCVL 4YWGH 4Q2ZA 3BX7C 5C8JB 4I4WB 1U8PA 3BW9A 2IBZX 2YUZA 5I71C 2R4RH 4I77H 4ODTL 4CN1A 4I1NB 5L2KB 1V0KA 2EPLX 3SGKC 3WD0A 3QDHA 3BPOB 2YPLB 3OAYK 4L8SB 2XRAH 1J8HD 5EC1B 5L2JA 5KJRH 1C7SA 2GJPA 3QUXA 3CSPA 1I1YA 3UJJL 1KIUA 2DQJL 4QTHA 2Q7YA 1QX1A 3DNKA 1L9MA 3JWDL 3B4NA 3VDHA 5IR1A 4N1CA 3HAEH 2NY1D 5DVMA 3MV8B 3VRLF 5HHOD 1WCGA 3BUYA 1NEZA 4YC2B 3VXRE 2ITCB 3LEVL 3WDQA 1E4MM 1ZT7B 3CUJA 1PG7X 4L8CA 4AZCA 2FLBT 3H3PH 4ZS7H 1K8IA 1NGXA 4PRBA 2PYEE 3BH9B 4PGJA 1KJ2B 1SBSL 3ARQA 1KUMA 2AJYL 1AO7D 3EFDL 4WKHA 1RZ8A 1B9ZA 2EEDA 2X1WL 4H8UA 3QUZB 1JWMA 4Z7WB 4HWUA 1YEKH 2Q8BL 1HVQA 5GJSL 4PJAB 2PO6C 4BSVB 4TOQA 3KEHA 3CFCH 3HAEB 1ETZA 5FYJE 4JAWA 5EG6C 1JCKA 3VH8G 3WD2A 4X6BB 1AJ7H 3GNML 1IM3B 5EU7C 5GS3A 3HB3D 3VNZA 3MZTA 5IMMB 1NBVH 3AHTA 3OAUH 3FQTA 1QRNB 3A4XA 3WQ5A 1AC6A 3WSUA 4OZ4A 3SE9H 4LLDA 1CXIA 2CXGA 5FCUH 5ICYA 3HMWH 2WUBH 1UVQA 2D9CA 4WU5B 2W07A 1M7XA 4GXUM 4U5KA 4X9HA 3ZYZA 1B0WA 4JRYB 5E8EB 4QOKD 3L5XL 3C08H 4IHOB 3RVXC 4NNPH 3GBEA 4KK5D 5DYOB 5EIIA 4B53A 2PBGA 1JTTA 3MFFA 2KH2B 5DHYA 3WCYA 3SDDC 2KL6A 1NAKL 3VTRA 2W60A 43C9B 1E56A 3LQAC 1HOCA 4PLJD 1XIWB 1RK1B 4D3CL 3WFEL 4F7TB 3DX3A 2JB6B 1FNSL 2MKLC 2EH7L 2IBGA 5DDHA 4X0NA 2YMXL 1K4DA 1IGMH 2FX9L 4ODVH 4EI5A 5E2JA 2VDPL 4UZSA 1CEOA 5HVHC 2BNJA 2E3ZA 3SGEH 1BX2B 2YA0A 3ZE0E 3H7BB 5DJ6A 3QQ9D 3QQ3A 1HKJA 3RY6A 3OKLB 5A8MA 3LS4H 4TYUA 1QBLH 3RPIB 4AISA 3TH3T 3RY4A 1J7VR 3WIHH 4BF7A 3HG3A 2XZQH 4GQQA 1V7ML 4NQCD 1R5WA 3DTXA 3MLZL 3O9WD 3TCLB 1A9BA 4NKDA 1WDPA 4XNXL 1X5HA 4PN2A 3KPLB 1U8QB 5C0AA 3KDMA 1KLFA 2KQMA 1WKYA 4WNQA 4NDMA 3UC0H 3REVA 3AFLA 35C8L 2YXFA 4NF7A 7CGTA 2HJFA 4RCAA 2OP4H 1T7WA 5I75B 3IFNH 1UACL 2VQ1B 4MNGB 2CMRL 4QTIH 4EIGB 3VXPA 1XCWA 2JIXA 3ULSB 2ZICA 1FNSH 2O9PA 3TYGH 1T2JA 2FEEI 3GMPB 3ILPA 4LVEA 1DBML 1JI2A 1ZT4B 3NN8A 4IOFC 4B7LA 1DVFD 4W68A 4UOJA 2XY1A 3WJLC 2Z4QA 4HT1L 4FFZL 4PP2B 1CT8A 3POCA 1MAMH 1W9DM 1X5LA 1CL7H 4CD6A 1S7TB 1BQHG 1GZQA 4PREB 5IFTA 5JA9A 4NNXB 1H0DA 3N18A 1E72M 1UR9A 4AXNA 5HHNA 2G9HA 4LEXH 4PBGA 5GIRB 3LN4B 5ISZB 2D3LA 8FABB 3W9DA 4S1QH 3FY1A 3ZE2F 2QQNH 5D1QA 1ADQA 1CBVL 2ATPA 4NN7B 5CEYB 5CEZH 1HNFA 3VXSD 2BVQB 1QYGL 2HT2D 4I0KA 1EEZB 5E00B 3FN0H 4XGZB 1OM3L 5JW4N 4M7LH 4JY4B 4F9DA 4WUUE 3DO7A 5DMJB 1H49A 2PWFA 4GBXB 1BQUA 3VXUE 4MX7B 5HHOA 4ONGH 3QEQE 5HPMA 4XNUH 3IT8D 5FO9A 1MCCA 4AY0A 2HFFA 1WFUA 2NW2B 5BW7C 3FAXA 5E4IA 1D5BB 3PP3H 1UR1A 1LO3L 2V2XB 1EFXD 3RWDA 1AXSB 5HYFA 3KHQA 3ZKSD 1UKQA 4A6YB 3F12B 3OG2A 2FECL 2IGFL 5FF6A 2LV4A 1LILA 1S9WB 5F9JB 3F4VA 4JPVL 2L0DA 2GSIB 2ESVD 3MODH 1UM6H 3HZKB 2YEZB 5DD6B 4DVRH 5IVXF 4AZIA 4PJ5D 1EHXA 3QHNA 1HHGB 2GAZA 1NFIB 4KKAC 4ZMAT 4UNVA 2X4QA 4HUUA 2UZIH 3D39D 5DEFA 4NQSA 1H3PL 1MIML 1V6UA 4XPBH 4KUZL 5FIPA 4MXQC 3LXCA 3AZRA 1RUKL 1FNAA 3IKKA 5E2WL 3MQIA 4UTFA 1CIDA 4XCEA 5BZDA 3AZSA 4TUKH 4M56A 4XB8A 4Z0XB 4X4ME 3OXSA 3SCPA 4NKMB 5AZEL 4TXEA 4G9FA 1RJYB 1RD6A 1PAMA 1XGQA 2D0HA 3BZFA 1UUQA 3SE8H 4GRLB 1SY6L 1X5AA 2CGRH 3HE7D 3QIWA 4JAMB 3V6OA 1P1ZB 5JMRA 3MLSH 4HIEB 4OIIH 5KSAC 3DSFL 5LCVH 3WIJA 5DT1H 1MFUA 2EIBA 1CK0H 1KXVC 3VDBA 1JZ6A 1P2CB 4GRWE 4Z77A 3IRPX 1UD8A 1CXFA 4HH9A 4U1LB 1BPVA 2VX7A 2MCPH 1J1PH 4LSRL 1SFSA 1GHFL 4XVUC 3UJJH 2VDRL 1CI5A 4KTEL 5EDXA 3ARBA 1CD1A 4YDVB 5KTEL 2X4NB 2MSPA 3CZFB 3NMEA 4KQ4L 1MW2A 4L3CA 2DRUA 3GM8A 4PLJC 3B9KA 1DUYB 1YN6B 4UB0L 3V0AC 2WCSA 4HS8L 5JQ6H 1MCNA 4XC1L 2CDFB 1KXTB 4KFZC 4GXUN 4ZNEE 5E9DD 4QXTA 3UG4A 1NMAH 3VFNA 4WI9A 4FQ1L 4JKPL 5E9DB 3SCVA 2GJJA 1J8HA 3BP5B 3UYPA 3VMPA 2W9EH 3SDAD 4OLUH 1YEFL 1UG9A 1JVKA 4FFWC 5HHVL 4AIOA 4YHIB 4HZLA 4QCIB 3O9NA 4XCNA 3O9WA 5GRVK 3Q5OA 2FH8A 4Y2DC 1K85A 2KZWA 4MD0B 4OM1H 2Z31B 3BUIA 1C16B 4U7SA 4HTYA 4HZ8A 4H1LG 4XPHL 1FV1B 1FVCA 4LPCA 4HFUL 1UG6A 1PPIA 1GOWA 5FHBL 2XT1B 1LP9F 4JL1A 1L6XA 5AY7A 2HRLA 1GORA 5EZIH 4GRLA 3AIWA 3CSYB 4U3CA 4HOXA 3CTTA 2AJ3A 1JPFB 3P73B 2MWCA 5EULV 2O5XH 3V0WL 3O4LA 3WLBB 4R9HA 4WI4A 3G5VB 4LHUD 3UAJD 4RQQB 1ZANL 2FZ3A 5J12B 3WN6A 3U7WH 4PJ9B 5C9JB 1BQLH 4PTMA 1PDKA 1A7OL 4PMVA 2PC8A 5TH2A 3I9GH 1PEZA 5I75C 1L7TH 3QEGL 4QRPA 3MLWH 1J0KA 4PJCE 2VOTA 2CK0L 1MVUB 3QFDB 5CSZA 1BG9A 1E4IA 4JDTL 3LH2L 3CMOH 4M1RA 3T2OA 4PGEB 1A3QA 1AI1L 2OYLA 4OQ1A 4Z7VF 4AH2A 1MW3A 1GQJA 1A1MA 4H20L 3TCXA 3SOBL 5EBWB 4NKOB 3V9FA 3AMLA 3GXTA 5EU5B 2OR8A 2V5DA 2VI0A 4U1GB 1JBJA 1ZSDA 2OTPA 2OZ4H 5D1ZD 1KGXA 3WD3A 4UV4H 2AJXH 5D96C 4CN4A 3ARFB 1SEQL 3EFFA 2VZOA 1UJTA 3LEXB 5B3NA 3WF0A 3IDYB 3N85H 4ODUB 1KTLB 4I9WE 2MQCA 1IM9D 3K46A 3PIQA 4QXUH 4EDWH 3IDMB 3PWNA 4ZSOB 4QT5A 1LGVA 2XZZA 2F15A 1D5ZA 2E40A 2Y1VA 4HZ7A 2D22A 2L4OA 1UCTA 1K9TA 4XP1H 4K71C 1FHDA 7A3HA 5JOEA 2C3VA 5HY9B 5FYJD 3UPAA 1T4KA 3Q5YA 1QSFB 5FO7A 1HKMA 2HTKC 2PW1B 3LQAH 3QQNA 2GHWB 3BEWB 3BISA 2W0LA 3VILA 1G7QB 2L7UA 3MCKB 5DRXA 4QNPE 4LSSL 5FUOL 1MCIA 4U6VH 1CE1H 3KXFD 2Z4QB 1NANH 3SKOB 1E4XH 2EDHA 1U8OA 1AGCB 2VDLH 4LLMA 3ZJ7A 4N0FB 4OD1H 4MS8C 4CD5A 5F8RC 4M24A 1BJ1H 3N13A 4AG4L 5TGBB 3MXVL 3VIJA 2OI9C 3VFOA 1QBMH 4JHWH 4PY8J 1WJ3A 4NQEA 4HEPG 4OZFH 4M8QB 4UTAH 3MC0A 4LDOB 4MDJB 5EFDA 3TO4D 4JPWH 4L4VD 2H26B 4P2OB 2WIIB 3T0EC 4IRJB 1S9XB 4RMTA 2XM2A 4F7EB 5IEHA 5HHVH 3U46B 3AM8A 4JKLA 4NZDA 4NXKA 4L3EE 2J7HA 4UOZA 1IKNA 2EE3A 2GK0A 1FYTD 1GGBL 3ME0A 2J7CA 2VL5B 3IDXL 2ZG2A 2FEEL 1M7DB 4S1DD 1JYWA 5IGXH 3NABL 3FO2A 4XWOC 2F53B 4JM2A 1SVZA 1EZVY 3D25A 3I6KB 3P2TA 3GIZL 4UQ2B 1U6AL 2NY7L 1MIMH 3P0VH 2HT4C 4PJEE 5FYKL 3SOBH 1OTTC 1DLFL 3ELAT 5I9QB 2HN7B 3OA5A 3ALFA 3A6OA 5ACMA 3Q5TA 2X4UA 2Y9RT 4FNPA 2AQ3A 3VXME 4XP4L 3QWOA 2XA8L 1KB9K 1A4JA 2F5AH 2OL3L 5IHLB 1NC2B 4HV8A 3AS2A 2ZUUA 4U1SB 3D6GA 3BPNB 5E6ZA 3DETD 2VAJA 4YHMH 4QYOB 3ZIZA 4MA1C 5KVGH 5B22A 5CEXA 4X7SL 2H41A 4HAGA 5C2BH 4NZUL 2YRLA 4MAVA 5F7FA 4AY1A 1HDMA 1C08B 3MLTB 5C0BA 1E6XM 1UH2A 1UKTA 3ZT7A 1W72A 4OIIL 5T5NF 4EXKA 4P2OC 3T0EB 3NSXA 2AI0L 4PJ9C 1BBDH 3RDTA 3JUZA 1XZ0A 4FLSA 4Q58C 2BVEA 4OCRL 1P84K 2EE9A 2JJTA 2XG4A 1G7MB 1X9QA 3QDJA 2FB4H 1T03L 1YNKH 3RM9A 4YHLH 4LPTA 4GKNA 4RISH 1E43A 3IU4H 5F93C 1ORQB 4JY5H 3SKMA 5DMYA 4QRQA 3VFWA 2VSDA 1KB5A 1CVSC 4CN6A 1KTKE 4PMUA 3BD5A 1E6ZA 4JQVA 4NHCH 4MQXD 4WTXA 3CFEA 4P2RE 3D0VB 1AGFA 4WDIA 4JHBA 3WFCH 4M9PA 2R0WL 5EOTB 4QWWD 1BIIB 1YNLH 1KJ2A 3ZKNC 3FRPA 4G42B 1EERB 4FFZH 1LWHA 1HILA 4DWSC 3LKNB 1U3HB 1T66D 2NY0D 1DFBH 2QEJA 4Z5RA 3RGVD 5T1KD 5E7FA 3H9SA 3OKYA 4NRZA 3VXNB 2JFEX 4OZIB 3CGTA 1AP2B 5D7IA 5DD1H 1TZGH 3B3IA 2YN5A 3ESVF 4K23L 4D94A 5BZDB 3ECQA 3VFTA 7TAAA 3U7BA 2X1IA 4X5WB 2BSTA 1FYHB 2R23A 4YIQB 4W81A 1MQRA 3GO1H 1UKOA 1KG0A 5E8DH 2W92A 1QPXA 3QIBD 4OQTH 3ZQ9A 1PZ5B 4Y4FA 2HWZH 4PJFB 2R15A 2D31A 5FGRA 4BS0A 3D1MC 2CH8A 3MREB 4TQEL 4X4XB 5FYLL 5C0GA 1H41A 2X4OA 2WZHA 3D25B 5K9JL 4G9DB 3BW9B 1LK2A 3DC0A 3TH4T 5FHAH 5I19H 1MWAB 1Q94A 1H3PH 2X2JA 3I3BA 2VR9A 3DIFA 3IJSA 1SYVA 1C5CH 1HYRC 3F12A 3IKCB 3FONB 4YZFE 3MRMB 1MJUH 3RZCD 2IQ9H 1F4WL 3QI9D 4HPYL 2YS4A 3EGSB 3OKNA 3HZVB 2YC1B 1TZIB 1GPOL 1OP5K 1F02I 4W6XB 2J12B 4UFLA 4HW6A 4P2QE 3HN3A 3ULUH 4JHAH 2Y2WA 4A6YH 2QKIB 1NLDL 5HYSB 5TPWH 1CR9L 2VXTH 4QEGA 4LCWA 4GXPA 5E0FA 4NP4H 3FQNA 1MFNA 2J3SA 3SUUA 4OB5L 3WEZA 4EI5C 4NBYB 5L9DH 3NAAL 5GGUA 2EO1A 3KJ6L 4HLZH 4NM8L 4NNPL 2WUBL 3HNTL 1LP9A 3GJFA 1KB9J 2QSCH 2XICA 1X44A 1E1EA 2EPNA 2CITA 1HH6B 4YK4B 3AISA 2DL2A 2FGLA 2NXZD 4AT6A 2PYFA 1I8KA 3H3BC 4RRPA 4MMXC 2ILLA 4C55A 1KPVA 3WFBL 2VLJB 2ZP0T 5ESQB 4KI5E 5D71H 4N8PA 1F97A 4Z7WF 3BRDA 3KPNB 2CKNA 4Q0XH 3PQYA 2OL3B 4J3SA 4DZBB 1ZA3B 3HPJB 4PB0H 4UIMB 1N2RB 1TQTA 1UQZA 1KTLA 4O02L 3LS4L 5IP4A 4WO4C 5MI0B 4MDPA 3LZFH 3UTSE 1UB5B 2CRYA 3SGKA 5DT1L 1VFBB 5DK2B 1Q6DA 3KYKL 1RJCA 3AHZA 4ZTPH 3VWJA 1QVBA 1FA2A 4M7LT 1NLDH 1LEKA 1I1CA 5EBWA 1BD2D 5C2BL 5D7JC 3HPLB 2DOCA 1LDSA 2HFTA 3U0PA 1A1MB 3MNWA 1XV8A 1J18A 1M7IA 3NPZB 1NGQH 2GY5A 1UGNA 2DM3A 4RA0C 4WNQB 2BHZA 3D9AL 4E41D 4B5EA 2X9XA 1WP6A 2VZUA 5J06A 5C0FA 1G7HB 2W66A 2YL8A 3CHCA 3RA7L 3PHOA 3SDXE 2BRQA 2WWMD 5HDQH 3SDDD 5SX5H 4KJPD 1LL6A 3G04B 5ABEA 2CD0A 3ALGA 3UBXI 3HNVL 1NGYB 5ERWA 4IS6B 3O4OB 3G08A 2XYLA 4OI9A 1HX0A 1WCBB 3CDFA 5ESAB 3W9EA 3WH6A 4LAQH 3TC9A 2D4DA 1S7XA 3UXFA 5HYJA 3F65A 3D3VD 5HHQA 4KPHH 5JA8B 4HMEA 4P23C 5IVZB 4ZAKC 4NC1C 3ZL4L 3TTSA 2NLJB 1KWKA 1MHCB 2F8XC 2BNRB 4FQQB 1DFBL 2HT3C 2DQIL 4CVXB 1XYZA 4JN1H 4PD4K 4OGZA 4PJEA 3UAJC 4F57H 5KSUB 1R6VA 3VD9A 3LX9A 1WBXB 4UBDD 1U8MA 3LAFA 4I18B 2Z31A 4W5UA 3NIYA 4YGVB 1URLA 3C08L 3FN0L 1BEYH 2IPUK 3FQTB 4LP5A 1MCRA 1JNJA 2DQUL 4LSDA 3FO9A 4HKJA 3VFMA 2X4SB 5TQ2H 3MO1B 3BCFA 2NXZC 2VXVH 1MQKH 1TQSA 1YQVH 5C0EA 3GZKA 2XG9A 1P9MC 3ARGA 3LPWA 3A21A 3VFNB 3BZ4A 4QO1A 5A8NA 5CJXC 2X4PB 2P49B 5A6MA 2NY6C 2D73A 4L29A 3D3VE 3NAAH 2H8PA 3WQVA 3WL9B 1D6EB 4H8WH 4KRPB 3WHE0 3GUTB 2C3GA 4JFDE 1EJOH 5TDNA 1GAFL 4Q7DA 1Q9KB 2HTKD 4JG1L 4PMRA 4Z76B 1RUMH 5F6IB 3JTSB 2A3AA 4AD3A 4U1KA 1JGDA 3WFHB 4WI2A 3TTOA 1L0XA 1LK3H 2UVFA 4I8DA 1GIGL 3QR2A 3C5ZC 1JN6A 2XG5A 4XP6H 4KI5D 3K74B 1CXLA 4O4YH 1QSEB 4CU6A 2AXGA 3RZCC 3LMYA 2EBNA 5DMKA 1QBML 4E41E 3NIDE 1US3A 3OR7B 1BLNA 2DI9A 2DLIA 4HK3N 3DXAE 3KYMA 3TZVD 3AI0A 1GZPA 2VWEC 1V8HA 5BJTA 4HPGA 3G5ZB 3VMNA 2W63A 1YJDL 4DGVH 3MLXH 3VG0H 3QISA 1NCWH 3HTLX 5CQ1A 4H8HA 4WO4A 1QA9A 5IVZA 4ORGA 5HDLA 4Y88A 4KHXL 4OZGE 1IGIL 2Z92A 4MNHA 3GO1L 4I77L 4ODTH 4PGDB 4FZEL 1YEHL 4LCWD 3HRZB 3ARPA 3S35H 3D3AA 2I5YH 2IF7A 2E7LA 1OARL 3BZDA 3D48R 2EKSB 1I75A 2X4QB 4PTXA 3SQOH 1U41A 3F8UB 3WV0A 3BP4B 1KQYA 3ZTJG 4UQDA 4JGUA 3L3IA 1G6RB 1YEGH 2RGSA 2SEBB 4LXFA 7FABL 5FUCE 4UT7H 2K7PA 3U1SL 4W84A 3PWJB 4F3FB 4H25B 1B3XA 1MQ8A 5I15L 4Y5VA 4EJ1C 3E2HC 3D4ZA 1T21A 3KXFE 3ULUE 1T0NA 1J0JA 1U8NA 3P0VL 2FLRT 3I2CL 1G7QA 1HJUA 1XR8A 1KC5H 1UEMA 3O2VL 3NFNA 1YPZF 1XGPB 1DBJH 2HFFB 3LDBB 5KG9A 3KAAA 5IWLA 3LQAL 3VO0A 2J7BA 3CUHA 5D7SL 1NBZA 1NFDF 2X0YA 3LRKA 1MPAH 3IFLH 1XIWC 5T1MA 2WMPA 4YEFA 5JHDB 4AZ6A 4Y2OA 3BPNC 2A3CA 3PIQB 3P4OA 3HC0B 3QEGH 3QB7C 1D5MA 2CO6B 2VLLB 5C08B 4NZRH 3IDNB 4QRTA 4AMWA 2WBWB 1I8MA 4LIQE 1A9EA 4NWTL 3D3VA 5DR5L 2ID5A 3KYNB 1EDQA 1OOAA 3TN0A 1TJIL 3P9MA 4WU7B 1OGAA 2BZDA 2JELH 3NACH 4RBPK 4BSWA 2R1YA 5DUBA 3ZO0A 2D4FA 2GSGA 1V08A 1KNOA 4UV4L 2XA8H 1MHEA 3AJ7A 4RAVA 5TDPA 1Z9SA 3TGXA 2ZUXA 3VE0B 4XP5L 3HC4H 1OSPH 3G6JE 2ZPKL 5DQDH 2V3DA 2CETA 4ATDA 1KNOB 3WS3B 1HSBB 2YD6A 4PJCB 1SJHA 4QXGH 4XCYB 5CPTA 3GSNH 3ULSA 2RIKA 5KSAA 1Y18A 3FKUS 1OQXA 2RCSH 5EUOB 3TJHD 5F97E 4MNQD 5D72H 1QZ1A 3THCA 1JAEA 4OOUA 3SDAB 4FK9A 2DAVA 4JFOB 3VXPB 2PUQT 2FBJH 4MNGA 5DA0B 4WF7A 2B39A 5HYIA 1V3LA 1QSZA 2XN0A 3TFKC 2WBGA 3BPLC 4N8VA 3KDMB 3C5ZD 2E0PA 4EBQH 1ZOXA 3DHPA 1GGBH 2A74B 4Z6AT 2IAMD 1E6OH 1QBAA 2BCKA 4OIBA 2Z91A 2C3XA 3DIFB 5INDA 4YHGA 5CCKH 4I0PD 3WE6A 3L4WA 3W0WD 4G9DA 5E2WH 3C6LD 4P7RA 2C4FT 4WTZG 3C8HA 4JZ5A 1TETH 4M6NH 2RAMA 3PBGA 2ZPKH 1INEL 4PTVA 5BXTA 3GSNL 1WQVT 3MXVH 4X5WA 5BRZD 4HZLB 1G1CA 1K4DB 5J56B 5DQDL 2EDLA 5CPQA 3S9DB 3O3AA 5HJ3A 4NYLA 1O7AA 5KVEL 2D3VA 2OZ4A 2W91A 2D03H 3RVVD 4IRSD 5E9DA 3NSMA 4FZ8L 5EO0A 4HKBA 1ZT1B 2YL5A 2ZZUT 2WSKA 2P48B 4N42A 3U36A 3LDBC 2DQIH 1Y6MR 3F5WB 4R7DA 1BIIA 1RI8A 2H2PD 1IGYA 1JWSA 1N6VA 1NAMB 1MQQA 1EXUA 3QJFB 4M1GL 5BV7L 2A6IA 3TP4A 1HHHB 2V6HA 1MCPL 3JWOL 3BO8B 5FA3A 4DAGH 5J89A 4LU5H 2Q20A 1UH3A 1KB5B 1IEAA 3VGDA 1NCTA 1BGXH 2B1HL 4FXKA 5T1DH 4I5BA 4KRTA 1OGSA 2Y4SA 2H3NB 1AGEB 4WUUA 5IESL 1S7SB 4KJYB 1DEDA 1T2QL 3CZGA 4AL8H 3HI6H 1MY7A 1D5IH 3ES6A 2D7OA 4HK3J 3MRLB 1KTDB 4PJAA 5FM5O 1TPXC 4UUJA 4TX8A 1S3KH 3I02B 3U7YH 3RILA 3MLRL 1X5FA 2W0PA 1E28A 3RX8A 4GSDL 3B5HA 3W0WE 3AREA 4YDKL 3U30C 4AD4A 3MLVH 3C60D 4WSJA 2GJ6A 4N0RA 4UBDC 3DX6B 1JNDA 2G5BB 4K94C 1D9KB 3HZYB 2PYEB 4DFIA 2H6PA 4G80B 3MLWL 3GIVA 2WB5A 2OWWA 1E28B 1ZGLM 1F8TH 3RIAK 2X4UB 4HSQA 4PRDB 4S1RH 1E70M 4O5LL 1LO0L 4XVUD 3BAXA 4IDLA 4RGND 3CFKB 4CNIA 4PB0L 1ORSA 4PJ5E 3MLXL 4KRNA 3V0WH 3OZ9H 4LLQB 2EDWA 1CLCA 2UYLB 4HFWA 5EORL 3QUMA 1BBJB 1ONQA 2GSIA 2VLRD 3QRGH 4DGVL 3MACH 1GH7A 1T7XA 1U3YA 4GOSA 3QPQD 1JDAA 2GTWB 4ZFFB 1EK3A 4R90H 1WBYA 1MCBA 1OD0A 1QWUA 1CLVA 2G4FA 3SBWA 5C09B 1E27B 2A6IB 1TZHA 1JXKA 1RSFA 2HKFH 4G8EA 3MLSL 2YRZA 3BKCL 4H1LA 4FQQA 2VB5A 4ZOEA 2VC2L 2B2XH 5C0CB 1B90A 2BNUA 4AZ8A 1HK6A 4HKBB 1DDHB 2ARJQ 4URTB 1MFAL 4HWEH 3OGSA 5A16B 4CVZB 3OKOA 4PRHB 5GS2D 1U2YA 2YPVH 4W8AA 2YN3A 3LV3B 3OL2A 5J6HA 3BUDA 2EYSA 1A3RH 4OFDA 1ZLUK 2R0ZH 5FGSA 1D7FA 4O2FB 3RNQA 2FO1A 1TQBC 4IS6A 3TVMD 3D51A 2NTSP 1QKZH 1F4YL 4MCZA 5HBFA 3MRBA 4LGXA 2VVSA 1DVFA 5C0NC 4RWYL 3BI9X 1C5CL 4GKSA 3N17A 1BZ7A 3CUFA 1NBVL 4JM2F 1UCBL 4WEMB 4PP2A 3IDJA 3H9YA 5DC4B 2OXGA 2VDRH 4LGSB 1I3UA 4L1DA 4QT5B 1ITCA 2F54D 3EYFA 4UOQA 2MCPL 3ZTNH 4P2QB 4NGHH 3AVEA 2VITB 5TDOB 1KJ2H 4ODWA 3VIFA 1Q38A 4XPGL 2ICEB 5E5MB 4F33B 1QR4A 4LLYA 5D93C 2CUMA 4JN1L 3MBED 2DSUA 1Q1JL 1W9PA 2P47B 5DK2A 5HI4C 3KPSE 1AC0A 4PMZA 4Y89A 2F74A 4IDJL 5IMLA 5C0CE 4I2XB 4PJXA 3KL3A 2MQ0A 1UWGH 4QTIL 3N9GL 3H0TB 3HCVA 1Z9MA 4ZS7L 2AAAA 4FQ2H 5C0AB 3IDJB 1R3LA 3OAZK 3ZE0F 1E3XA 5CEZL 1JHLH 3L4XA 3ARDD 3U48A 3N1PC 3OQ3B 4X6DF 1VHPA 1MCOH 1J1XH 2DD8L 4Y16B 4AT6B 1Z9OA 4FG6D 2IEPA 4XCFL 5KANI 5L7XH 1X5YA 4IRSA 2WLZA 2X42A 2VRQA 4HIJB 1QW9A 4K8RC 3L1OH 3IDNA 4QRTB 4Y16A 5C0BD 2VDOH 1C1EL 2DTMH 4IUGA 5HI5C 1H2JA 4J3WA 5FDWA 5JPMB 4LYPA 5J6HB 3AB0C 4GRMA 3RDTD 4RGNB 5H37G 1VB9A 4J27A 5AYUH 3N15A 1OIFA 5I2IB 2BNUB 3F5LA 5C1MB 3HCVB 3PP3K 2VSCA 4UI2A 2ESCA 1FL6B 4P49A 1JD9A 3NJ3A 1D3CA 5CZVH 5GGQL 4UDUA 1SBBA 1J0ZA 4O02H 3DBXB 1GRWA 3HLAB 3BVTA 5DJ2A 2G41A 3VA6A 4AD1A 1CFNB 1BYCA 1A6ZA 1FFPB 4W87A 1OSZA 4LEOA 4YO0A 3RBSA 1KB3A 3MMEA 1Q0XL 2VITA 4NCDA 5TDOA 1WVZA 1M6OB 2HKFL 2W65B 3FXYA 1YNTA 4YHIA 3ARZA 4ZFFA 4GZEA 4NM4L 1ZV5A 1V3IA 1RIUH 2UWEF 2AGJL 3H54A 1UCBH 1UWEH 1TVBB 5FYLD 1YYLL 1I3GH 1JYVA 4YDLB 5GGRA 1A3LH 4KI5F 4P9MH 1NQBA 3CZEA 4Z7WE 3PDDA 4LPXA 3PABA 4WI5A 2BSTB 4YIQA 3OKKB 2AP2A 2IGTA 3EO1A 3B3IB 1CLYL 1IT0A 2W9DL 2FO4A 1A3RL 1LDPH 1RZGB 3DYOA 4N8VG 3WD1A 4OV6F 3W25A 1TMCB 3CU1A 1M53A 4TVSa 4AEIL 2GJ6B 1P4IL 3MRIB 2Z92B 4PRBB 1A2YB 4AZ5A 3SGEI 5T3ZD 4NSKB 4OIFA 4PRHA 2IPKA 3BGFC 1CD1B 3GSXB 5C7XL 2YDRA 4LLUB 5E8PB 1Q9OB 4YHYB 2YKKA 3UX9B 1BMGA 2FL5A 1J05B 4TSAH 2BFVL 4OCLC 1FVEB 3W11D 4FXGA 4PRNB 5DT5A 4HC1L 4GG6F 4UTAL 3OR7A 4R4FL 3MA9H 3CFEB 4RMWA 1RP9A 3EIFA 3GBMH 3MGTA 1V3HA 3CH1B 1L7IH 3S6TA 2R2HB 2F7OA 1CICC 1QSEA 1NDGB 5FOJA 4FXGB 4KK8D 1DBAH 3GXIA 1CXKA 3ES6B 3SDXF 3TVMA 2FL5B 5L2KA 2CLZA 1UZ8B 1AGEA 3DVGB 3TVMC 5B38A 1XMWA 2NT1A 2GTWA 5CILL 4X6CF 3TBTA 5EU7E 1QBLL 3G6MA 4U6VL 5GRUL 1IAKB 4R26H 4ZO6A 1KCSL 1BFSA 1P4BH 5E6IC 1E5NA 3KPOA 1ZS2A 2R4RL 3QBTB 3ZYOA 1FOBA 4HZ6A 4BQ2A 1CS6A 3TBSB 2ICES 1I7RB 1ORSB 1IEAB 2YA1A 1PZ3A 3MV7A 4OQTL 3LPFA 4L29B 5CBAB 4G43B 1S7RB 3HG5A 1U2HA 5IHBA 3SGJA 4XB7A 2EEBA 1YEIH 5B39B 4I3SL 1CL7I 1H3WM 1PG7H 3MRKB 3RL1A 1G7PA 2OQJA 4J1UB 1J88A 5L88H 5KAQG 2IFGA 1N0XH 5JBEA 2Y5TA 3IJHA 1D9KA 3HZYA 4GRWF 4QFUA 1W3JA 5D2LE 5D7SH 4AM0B 4IJ3C 5DRZB 1H09A 4M43L 4N9GB 3QULB 2E7HA 4F37K 4NNYB 3S6CA 1R7AA 3CHEA 1S9WA 5F9JA 1WAWA 2FEDC 5HJ3B 2J88L 4LEOB 4YO0B 3MRQA 3W27A 1X6NA 4F7CA 3SCMD 3ARRA 3BH8B 4MNGE 5F88B 3VWKA 2G8ZA 1NGWA 4Z2KA 5KSUA 3NFSH 4LKCA 1ULVA 1CZ8L 3MGOA 1ZBCA 4OLZH 5T1LD 4DWSD 1LLOA 3QXAA 4MS8D 4CVXA 1QVOB 4JM2B 2CBVA 1L8NA 4OTXL 1M71A 4P5MA 3EMZA 3V5KB 4KJYA 3VIOA 3GNMH 3TT3L 1NBQA 4MQXC 4WJ5B 4HKZB 4R7NA 3O8XD 5AYQA 1H5VA 1CN4A 4N8CH 3HU7A 4TULH 1KELH 3ARGC 5JXAL 2GSJA 4F7EA 4ZE4A 3IXTB 1GOGA 4DW2H 4MB5A 3RJYA 4MDJA 1A1OA 4OLYH 5CS7A 2H32H 2XV6B 4ETQA 4WV1A 3WBDA 2MCG1 2OTUA 2OS7A 5KVGL 1HNGA 5DO2C 1Z0MA 4LCIL 3I6GB 5I76A 3QG7L 1WT5C 5GS0C 3DHUA 3MJ9L 4RAHA 4F9LC 4YHNA 3C9NB 4LASH 3V4VH 2OI9B 4BQCA 4O2EA 1OAKL 1S3KL 1BREA 4JRXA 4XXCA 3U7YL 5JOFB 1NGZA 5IHUH 3NIGF 4PS4L 5ITFB 3GKWL 2EDQA 2PW1A 1NWSA 4X6FA 5CCKL 1V3KA 3BKML 2ESVB 5A6LA 5LA1A 4P46A 3GI8L 5IQ7L 2VLME 4QRUB 4F33A 1FZKB 1FFRA 1MRFL 4ZFGL 5AYBA 1AHWC 5A6SA 1HYSC 3PN8A 4NJAL 5ANMA 5IFPA 4NX0A 5HHMD 4GT7A 5INDB 2F8VA 3REVB 2Z91B 3UYRH 3QXTA 3L3OA 4L4TA 3P30L 3DMMB 4TN9A 5GRJH 1E71M 1MHPH 5JIPA 1DL7L 2VDKL 1P7HL 4Y7MA 1AR2A 4Z8FL 4GKZA 1T2XA 2GFBB 3A67L 4P57B 4F58H 1A9BB 3VOCA 3FRUA 5T1MB 3CFBB 3T4YB 3CMJA 1J1OL 4FMKA 3ARFA 2X9WA 3KPPA 5IW3A 3STZA 4F2MA 1ZSDB 3A47A 1FNEB 4AG4H 3JWDC 2ZX9A 1GVYA 5I1KH 4KQ3L 4U2YA 3MGOB 3Q48A 3MJ7A 2V2WA 3B8SA 5F7LB 1ZLSL 5IFHL 2PW2B 1T0NB 2C9AA 4JLRA 4Z7UF 2WMIB 2GCYA 2NX5D 3LV3A 4YPGA 5ESVB 5F7MC 3T3ME 2XXCB 5F7KC 4F3FA 4F8TA 2VYRE 1RFDH 1XF4B 2DIAA 2WP3O 1F13A 3LKRB 4H25A 4PSRA 3PWJA 4F57L 5KAQF 1HHJA 5H94B 3NZ8B 2G2RB 4PJXF 5DI8A 2XN9E 1A7RL 1RPKA 4POUB 5ILTL 1N7ML 1JE6A 3V5DA 5E94A 4FFWD 2MPAH 4PJ7A 2B5IC 3TM6A 3POHA 3JWOC 2Y72A 4JPIB 4KJWC 4U4BA 4HU8A 5ALCH 4PGDA 4BQ6A 4NRSA 1T22A 1KBBA 5ICYB 5D9MA 3GMMB 3OR6A 4XBEL 5JR1H 3AZTA 1E6RA 1F3RB 2LU4A 1C12A 1MI5B 3BE1H 3GEWB 4AD5A 3C2AH 5FV1L 4L4OA 4LLQA 1JTOA 5IF0B 4MJID 1QA9B 1KEGL 4DGIH 1IM3A 1PZUB 3DHMA 4OGAD 4Y5YA 5DVKA 3V7AG 2VLRE 4HHAA 3B8YA 5BXFB 1UKSA 3GK8L 1C8XA 4HA3A 1J0HA 1NDGA 1QSVA 4GI9A 5A8PA 3O9WB 2Q86A 1RJZA 4UCFA 1NCNA 4NRXA 3KG5A 3MV7D 5E95B 4HC1A 4M7KH 2JJUA 5D7IB 2NY3D 2PR4L 2DH3A 2OMBA 5LGJB 5GPRA 5F6IC 4WJXA 1G9HA 4HA1A 2XY2A 2AK4E 3AREB 2EZ0C 1XF5A 1ZT7A 2CR3A 4Y4KD 5ITBL 2XWBA 1OP3H 5HYSG 2WYSA 1AH1A 5IEKA 1EGJA 4ATWA 1Q6FA 5CGYD 4EQ3A 4ZYKA 1AGFB 4WDIB 5DLMH 4OZHE 5FV2A 3TN0C 3EO1B 4MQ7B 1XH3B 1HWWA 1ZANH 1G7IB 5C09E 1UR0A 2YBRB 4I3GA 3HRZA 2LFGA 2X4NA 4OFYD 4L4VB 4O2CA 3BAJA 4RRPG 3F7YB 5C6TH 4LIQH 3FO9B 3SPVA 2PN5A 3BN9D 1VENA 2V7HB 4KZDH 4H0GA 1EQPA 2IMMA 5T3XE 3WNKA 4K8RD 1RZJL 2CJUL 5E03A 1U8PB 1H3UA 3BC9A 2OSLB 4UAOC 5JIKA 4W89A 3S37X 2LVCA 4XPHH 2DQFB 4HH9B 2HT2C 2NR6D 3HS0A 3JZ7A 2NY2D 5IOPA 3NFPA 1W72B 1IEBA 1A6UH 2GY7B 4CKQA 1GGUA 2BDNL 4XXDA 3VXUB 1MCQA 1K2DA 3U82B 4GMTL 4WGWB 2UY7A 4I0PC 3TNMA 1X1NA 3JV4A 1EUUA 4XV0A 1FNGA 3M8OH 3BWAB 4HXBL 2GUOA 5HYJB 3SJVD 4KJWD 1RV6X 4NT6A 3MRFA 1DQMH 4PTTA 1AHWB 4U5IA 3F7VA 1WZMA 3PGCB 4XAWL 1OP9A 3SKJL 3W9EB 3IJ7A 2K1MA 3SDXA 4BA8A 2QQKH 1E4XI 5CHNA 5DS8A 1RY7B 5I6XB 2IQ9L 5CMAB 3RIFF 3C5JB 3RUGB 4HS6A 4M81A 2EKJA 2AJSL 4N5UA 3ARGB 4OLWH 5JOPD 2G5RA 2VLJD 1ITBB 2E6PA 4LSQL 1HL9A 1T83A 4PGCB 2GK1A 2HH0H 3WIHL 3CZ8A 2WW5A 3IJYB 4JZNA 2X4SA 1T83C 4HX1B 4QRSA 3BAWA 1I9IH 3QDJE 5CJOL 4YHKL 5IMKA 3RX5A 2W65A 3GJEA 3HUJB 2NX5A 5K33A 3H0TA 4F9PA 5GS0H 3QHZL 3VXSA 4AWEA 1Q6CA 5GGQH 5E56A 5CZVL 2WC3A 1PS3A 1GOKA 4LYQA 1SY6H 2CGRL 3WXWH 3NA4A 2ENSA 1WDQA 4M8QA 5J3HD 3QO1A 4LLYB 3ILQC 1QI4A 1MHCA 5DVNA 3BJLA 4DTGH 3B83A 1WIOA 2EC9T 3O6MH 4NQXA 4GH7B 5IBTH 3FCTB 5IK3A 1F3JA 1FZJA 4XH2A 1QLEL 1N2RA 4HPHA 2PXYB 3SKOA 1DQJA 3LKQA 4ZFZA 4ERSL 2VVNA 1EFXA 5ETUB 1EZVX 3BFOA 1JFXA 4M93C 2EO9A 3FQRB 3QHTC 3VWJC 1IC7L 1TVHB 4PYGA 4JJHA 1GW1A 1HXYA 2CO7B 3TPUA 3VGEA 2O9OA 4QHMA 3E2HB 3GMQB 4PJ5A 4WIQA 2Z1KA 1MWAH 3G6LA 3QNXA 3BD3A 3QIBB 2EYSB 1OTTD 4TVPD 3LRSA 4MXQD 4CD8A 3D39A 3WLWD 3KS0J 4R0LA 4S11A 5A6BA 1QR1B 3W4RA 5DQ9B 3WY3A 2QKIA 4J6RH 4Y1AD 2GK2A 1OB1A 3BHBA 4LRIC 4JRYE 4KRLB 4DTGL 1JG9A 3L4VA 5IMLB 3EFFB 1U8KA 2HJFB 5MENE 3RWCA 4X7SH 5D2NE 5TPWL 4HWZB 2HRPL 4XNUL 3VD5A 4PMNA 3IU3A 4Q0XL 1TZIA 2OJEB 1OAQH 1AE6L 5LGHH 2QPUA 5IWLC 3MXWH 5IMKB 4UZUA 4JO1L 1VADB 3FONA 3AROA 2LTQC 3IJYA 3VGAC 3HG1E 3MLPA 4UIMA 4IJ3B 4QRPD 2R4SH 5DT7A 1SYVB 5CJOH 3MREA 4PR5A 5D6CB 3BH4A 5A2LH 1MVUA 3K2UL 4WWKD 4WI3A 4CMHC 2XFRA 2AQ2A 4CCEA 1DBBL 4N0YL 4G9FD 2V5RA 3RI5F 1I85C 1A6WL 5BS0E 5HSFA 4PGBB 4PG9A 4Y4KA 4JGJA 3GNPA 2H2SC 2R1WA 1WT5A 3R8BB 2WZIA 1LEGB 1KENH 1CLZL 3S96B 2AXFA 3BVNA 4ZUUA 5SX4H 2B7DT 2H1PL 1G94A 3G5VA 4FQ2L 4G80A 1FZJB 2HVMA 4ORGB 2A9MH 3FCTA 1P6WA 4LQFL 1HILB 3FT4A 4JFHD 5TFSH 4NPYA 4RL3A 1T04A 3MFFB 2IPTH 1DE4A 3I6LD 4MB1A 4U3AA 1UACH 3OJVC 4EVNA 4HIIA 4YR6A 2EYRB 1U42A 4TTDD 2A6JA 2WVUA 4GSDH 3AFBA 1DVFC 3DX7B 5LA2A 2R9HC 4JO3L 4OZ4B 3O2WL 1P7KB 1KIRB 4FQHA 1MJ7L 4AIEA 2XZQL 3VIKA 4HX1A 4OD3L 4QRSB 1JGDB 3CZLA 1NKOA 4GG8A 3WDJA 4AIZA 2GK1B 1G9EA 5HOSA 5K9JH 3DDGA 3IXAB 5HGAB 3F7YA 3SPVB 4AZ7A 2IH1A 3HNSL 2D0FA 1RZJC 1I7TA 5I1LB 1A7NH 2CIKA 2HJKA 5J1SC 3PGDA 2I60L 3ULUD 1JXJA 5LWYL 4KKBD 1EXUB 4LLWB 3NH7H 3PQYE 3VFTB 1HZHH 2D9QB 1ED3A 4KDWA 1IC5H 4NRRA 1IAII 3V2AR 4OSUL 4WEUD 1XF5B 5EBAA 1NWUA 4M5YL 2DQGL 4NT6B 3ZKMD 3QUZD 1S7VB 2F19H 3QWOB 3BWAA 3MRNA 5ADOH 3KGRA 3ULUL 3LKNA 4HG4K 3QEQA 1SYTA 1A6UL 2FWOA 2YD1A 1LEIA 3SUVA 4UFJA 3BUBA 5L2JB 2QF8A 1HH9A 3EDDA 2VNCA 3JTTB 3MV8D 1SQ2N 4EN3A 4LSTH 5I23A 4KMLB 3JV5A 3FO2B 4OCYH 3SIMA 1S7UB 2XI9A 1A7QL 4YX2H 1ZMYA 5IF0A 3SKMB 4L8SC 1A6TA 1U6AH 3TWCH 3AMDA 5MEND 3UROR 4QHUB 3UPRA 3WBEA 4ZTOH 5CSBA 5DJAB 3OR6B 3T1WA 2HKHH 5ABDE 1X7QA 5ESAA 3BE1L 3EYQC 4XC3L 3RKDD 1YY9C 4PMQA 2ALWA 1IGJB 3VRJA 2IH3B 2HVKA 4NZUH 1OD9A 1CGXA 4Y1AA 5GHWL 3MYJA 3L4ZA 1E6JH 5D8JL 4Y16C 3CLFH 1OP3K 5A6AA 4HWBL 3S97C 5CD5C 1ISVA 1UR4A 4QCEA 3JWDH 2OYPA 1F11B 1W0WB 1ODUA 3MLRH 4H2CA 3NIDF 3SGDI 3D2UD 1BGAA 2ORBL 5C0BE 4LSVH 1VEOA 2FYYB 3BT2L 3VG9B 3QOKA 2F58L 2YL9A 4GW1B 3WN5C 5JDSA 2FECI 2XTJB 2JTDA 4NHCL 1WB0A 3OX8B 4X9GA 2O5ZH 4NQCB 4BSWB 5FYJU 4ZG1A 3WH5A 2AVGA 4NHUA 1Q72H 4OZGF 3H7LA 4POZC 2VRAA 1L0PA 1W9XA 3GB7B 1UXSA 4KI5C 1FIGL 3KNBA 3VFVA 4XBEH 2GFBA 1HN1A 2Q76A 4JQIL 5DRNB 1PW3A 5HNNA 2XNAB 2FRGP 4U7MA 5CJXA 3BKJL 3GMMA 2CBIA 1T1WA 4UZGA 3KPNA 2J6EL 4DGYH 4LF3A 1YECL 1YZZA 1RMFH 1UXSB 2BVQA 1BOYA 3T0BA 4A4AA 3UTTA 1MFEH 4WV1C 3GHEH 4TVPL 3RDTC 4OF5A 1J9YA 4HA4A 3VI4F 1JGUH 4L4PA 4KVCL 2BVUA 2ED7A 3ULUF 3FMGL 1E6SM 2HT4D 1R3IL 3BKMH 1Y18B 1PX4A 3VFOB 1CE1L 3LKRA 4LDLB 3NTCL 4JM2D 4TNVF 4JRXB 4NQED 5JBFA 3MR9A 4KROD 1T5XA 4S3KA 3C6LA 3BT2H 3WY4A 1YPZE 2ADFH 2BHUA 4YPGB 5ESVA 1FCGA 4HXAL 2GCYB 4NBZB 1ZT4A 4GO6B 4XMPL 2P5EB 1HINH 2AEQL 4YAQA 1NFDE 4I0PB 5HD8D 4TVUA 5IJVA 4M7JH 3PV7A 5IROA 3RWFB 3TPUB 1ODZA 3VRJB 3VWKC 4LSUL 4ZUTA 2ERJC 3D3VB 3A67H 3P40A 5I1CH 2YPLE 3OJDA 3LMJH 3RGVB 2RHEA 2EXYD 4RWHA 5L2KE 4U1MA 1EDGA 2R2CA 5FB8A 4R7NB 1EHNA 5IB3A 2AJ3B 1T1YB 4G6KH 5HGGS 5LA0A 1NUDA 1YY9D 1FL5A 3IDMA 3PWNB 5CWSA 4ZSOA 3UR7A 1J01A 3V5KA 1IGIH 1LO4H 4TX6A 3QHMA 1KCSH 3VXRD 3ZSTA 1HYSD 3OKLA 1OLLA 3QO1B 3JTTA 1XGPA 3QQ3B 1A7BA 2B5IB 3KYMB 4XPAL 1U8LA 1BX2A 3QDJD 1I85A 3G5YB 1XC6A 1LG2A 2E3VA 4KKLD 5DMGD 1FGVH 5HGBB 5CBEB 3G9AB 4HFUH 1XR8B 4AMCA 4Q9RL 3K2MC 4HQQL 5SWZD 3LH2H 3HC4L 1NGZB 3NIGE 2K3TA 4G6JL 2HTLC 4YHEA 5CSUA 1MELA 4K7PL 5C0JB 1QSFD 1GUVA 4PMDA 5JTWA 3L3HB 2WWMC 3MA9L 3U1SH 1UR8A 2DEPA 1F4XL 2LAGB 4PGEA 1AY1L 4R6UA 1K6AA 1PYWA 2R69H 2O92A 4ACZB 1V6VA 4FXLA 1D9KD 3WUWB 3LQZA 4BFGA 2DI8A 1TITA 4TNVK 4C54A 4HS6B 3SY0A 2H8PB 4FQCL 1IGJA 5J9PA 3L7EA 2IG2H 5CUSH 1AR1C 3SUSA 1N5AA 2HVKB 3WFDL 3GHBH 4X9YA 1UJ3B 4D0BB 3V8OA 3VFWB 5HHPB 3I84A 5FHBH 1N59A 3R06A 5C0EB 2AKRA 5MERA 1YHTA 1CF8H 4P7OA 4LGRB 3QDGB 3WKNA 5A2IH 3C8KB 1CDIA 4NO2B 4RDQG 4FS0A 2J7FA 4M1DH 5J57B 5LXGH 3TNMB 3BSZH 3QXAB 2FDBP 3T3MF 4XXDB 1OW0C 2PBOA 1WWCA 5MEOA 2A6JB 4U1NB 2W38A 3BSGA 4S0TD 2J8FA 1BF2A 4OBSA 2Y07L 2FWOB 4ONHB 1MVYA 1EVUA 2K7QA 4M62L 3UESA 4PJXE 2DQDL 3T77A 1B2YA 3C2SA 2MKWA 4NSKA 4FTVE 3P11L 5ADPL 3KLHC 3ARYA 1WV7T 5I17B 5IW6B 3PZUA 4Z0XA 2X44D 3PWVB 4D1IA 1KPRA 2CR6A 4KPHL 2JLLA 4D0CB 3OKDB 4C58B 3D2UA 5FGBC 4BSJA 3MRCA 3DX8B 2XSAA 4HBCL 4YUEH 2X40A 1I7TB 5I1LA 4PEEA 1FRGH 1LNUA 2XQBH 2A77L 4U33A 3PHOB 2BSSB 5F7DA 3GFUA 1BQCA 4YFLF 2B0SL 4LQ1A 4XP9H 4RFOL 3E6FA 5J13C 4X7DC 1RIUL 2EXWC 1E4WH 2JJSC 1JRHH 4YGVA 1UA6H 4HUVA 4WY7H 5D9SA 3RM8A 1KIRA 1QFOA 5ECJE 4HCRL 2ZE0A 1IC4L 1U91B 3OPZH 2WMKA 3AHXA 5EBLA