1TCOA

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
352
structure length
352
Chain Sequence
VPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
molecule keywords SERINE/THREONINE PHOSPHATASE B2
total genus 126
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1tcoA00
3H66A 2WDCA 2P6BA 4FBWA 5INBA 4F0ZA 3C9FA 4HD0A 4H2BA 2QFPA 4FBKA 4V0XA 4UWQA 3H64A 4ZVZA 2KKNA 2HYOA 2R17A 1M63A 5JPFA 2Q8UA 5JJTA 4ZX2A 4TUIA 3RL3A 3GVEA 5F3WA 5J28A 1S3MA 3T1IA 2NPPC 1Z2XA 3PSOA 5HPEA 3IB8A 4O4KA 2XMOA 1Z2WA 1QHWA 4J6OA 3DSCA 1S3LA 3QFMA 2JOGA 1QFCA 3H62B 1TCOA 2IE4C 2WDFA 1KBPA 1XM7A 1WAO1 4MP0A 4JA9A 5B8IA 4JA7A 1T70A 3EGHA 4IL1A 3LL8A 3P71C 3E7BA 1OI8A 4DSYA 3E7AA 1AUIA 3QFOA 2USHA 4DHLA 4H1SA 4H2IA 4KBPA 3ICFA 3V4YA 2NXFA 4O24A 3EGGA 1T71A 1XZWA 2O8GA 4FBQA 4O43A 4UT3B 1G5BA 4H1YP 3N5UA 1U32A 1S3NA 4UT2A 2IAEC 1IT6A 1USHA 2Z72A 1JK7A 1W24A 2QJCA 4LTYA 4M0VA 4IYPC 3QFKA 4H2FA 3HVQA 2AHDA 2CV9A 1HO5A 2BDXA 1FJMA 1HPUA 2A22A 3CK2A 4ORBA 4V0WA 3KBPA 2GJUA 4B2OA 2Z06A 4ORAA 3H60A 1SU1A 3JYFA 4XPNA 2NYLC 2HYPA 4MOYA 4MOVA 3IB7A 1S8EA 2O8AA 3IVEA 5C1VA 1S70A 5DNYA 4DT2A 3C5WC 2HY1A 1WARA 2WDDA 3ZTVA 3THNA 2NYMC 3H69A 2WDEA 1OIEA 3H63A 5JPEA 1NNWA 1V73A 2YVTA 1MF8A 1HP1A 3THOB 1UTEA 3DW8C 2BCDA 3TGHA 3DSDA 3H61A 4ORCA 2Z1AA 4TUGA 4LACC 3K7VC 3QG5C 4YKEA 4H2GA 4NZVA 3IVDA 3RQZA 3H67A 3K7WC 4OR9A 3RL5A 3PSNA 1OIDA 1S95A 1UF3A 4O5GA 4LU9A 3AV0A 4G9JA 3FGAC 2DFJA 3QFNA 3RL4A 3ZU0A 2IE3C 2QFRA 4Q7FA 4V0VA 4WWLA 4KKZA 5IOHA 2ZBMA 4FCXA 1II7A 3H68A 4UT3A 2BQ8X 4I5LC 5EQVA 3AUZA 4I5NC 5GTUA
chains in the Genus database with same CATH superfamily
3H66A 2WDCA 2P6BA 4FBWA 5INBA 4F0ZA 3C9FA 4HD0A 4H2BA 2QFPA 4FBKA 4V0XA 4UWQA 3H64A 4ZVZA 2KKNA 2HYOA 2DXLA 2R17A 1M63A 5JPFA 2Q8UA 5JJTA 4ZX2A 4TUIA 3RL3A 3GVEA 5F3WA 5J28A 1S3MA 3T1IA 2NPPC 1Z2XA 3PSOA 5HPEA 3IB8A 4O4KA 2XMOA 1Z2WA 2ZOAA 1QHWA 4J6OA 3DSCA 1S3LA 3QFMA 2JOGA 1QFCA 3H62B 1TCOA 2IE4C 2WDFA 1KBPA 1XM7A 1WAO1 4MP0A 2YEQA 4JA9A 5B8IA 4JA7A 1T70A 3EGHA 4IL1A 3LL8A 3P71C 3E7BA 1OI8A 4DSYA 3E7AA 1AUIA 3QFOA 2USHA 4DHLA 4H1SA 4H2IA 4KBPA 3ICFA 3V4YA 2NXFA 4O24A 3EGGA 1T71A 1XZWA 2O8GA 4FBQA 4O43A 4UT3B 1G5BA 4H1YP 3N5UA 1U32A 1S3NA 4UT2A 2IAEC 1IT6A 1USHA 2Z72A 1JK7A 1W24A 2ZO9B 2QJCA 4LTYA 4M0VA 4IYPC 3QFKA 4H2FA 3HVQA 2AHDA 2CV9A 1HO5A 2BDXA 1FJMA 1HPUA 2A22A 3CK2A 3FLOA 4ORBA 4V0WA 3KBPA 2GJUA 4B2OA 2Z06A 2DXNA 4ORAA 3H60A 1SU1A 3JYFA 4XPNA 2NYLC 2HYPA 4MOYA 4MOVA 3IB7A 1S8EA 2O8AA 3D03A 3IVEA 5C1VA 1S70A 5DNYA 4DT2A 3C5WC 2HY1A 1WARA 2WDDA 3ZTVA 3THNA 2NYMC 3H69A 2WDEA 1OIEA 3H63A 5JPEA 1NNWA 1V73A 2YVTA 1MF8A 1HP1A 3E0JA 3THOB 1UTEA 3DW8C 2BCDA 3TGHA 3DSDA 3H61A 4ORCA 2Z1AA 4TUGA 4LACC 3K7VC 3QG5C 4YKEA 4H2GA 4NZVA 3IVDA 3RQZA 3H67A 3K7WC 4OR9A 3RL5A 3PSNA 1OIDA 1S95A 1UF3A 4O5GA 4LU9A 3AV0A 4G9JA 3FGAC 2DFJA 3QFNA 3RL4A 3ZU0A 2IE3C 2QFRA 4Q7FA 4V0VA 4WWLA 4KKZA 5IOHA 2ZBMA 4FCXA 1II7A 3H68A 4UT3A 2BQ8X 4I5LC 5EQVA 3AUZA 4I5NC 5GTUA
chains in the Genus database with same CATH topology
3H66A 2WDCA 2P6BA 4FBWA 5INBA 4F0ZA 3C9FA 4HD0A 4H2BA 2QFPA 4FBKA 4V0XA 4UWQA 3H64A 4ZVZA 2KKNA 2HYOA 2DXLA 2R17A 1M63A 5JPFA 2Q8UA 5JJTA 4ZX2A 4TUIA 3RL3A 3GVEA 5F3WA 5J28A 1S3MA 3T1IA 2NPPC 1Z2XA 3PSOA 5HPEA 3IB8A 4O4KA 2XMOA 1Z2WA 2ZOAA 1QHWA 4J6OA 3DSCA 1S3LA 3QFMA 2JOGA 1QFCA 3H62B 1TCOA 2IE4C 2WDFA 1KBPA 1XM7A 1WAO1 4MP0A 2YEQA 4JA9A 5B8IA 4JA7A 1T70A 3EGHA 4IL1A 3LL8A 3P71C 3E7BA 1OI8A 4DSYA 3E7AA 1AUIA 3QFOA 2USHA 4DHLA 4H1SA 4H2IA 4KBPA 3ICFA 3V4YA 2NXFA 4O24A 3EGGA 1T71A 1XZWA 2O8GA 4FBQA 4O43A 4UT3B 1G5BA 4H1YP 3N5UA 1U32A 1S3NA 4UT2A 2IAEC 1IT6A 1USHA 2Z72A 1JK7A 1W24A 2ZO9B 2QJCA 4LTYA 4M0VA 4IYPC 3QFKA 4H2FA 3HVQA 2AHDA 2CV9A 1HO5A 2BDXA 1FJMA 1HPUA 2A22A 3CK2A 3FLOA 4ORBA 4V0WA 3KBPA 2GJUA 4B2OA 2Z06A 2DXNA 4ORAA 3H60A 1SU1A 3JYFA 4XPNA 2NYLC 2HYPA 4MOYA 4MOVA 3IB7A 1S8EA 2O8AA 3D03A 3IVEA 5C1VA 1S70A 5DNYA 4DT2A 3C5WC 2HY1A 1WARA 2WDDA 3ZTVA 3THNA 2NYMC 3H69A 2WDEA 1OIEA 3H63A 5JPEA 1NNWA 1V73A 2YVTA 1MF8A 1HP1A 3E0JA 3THOB 1UTEA 3DW8C 2BCDA 3TGHA 3DSDA 3H61A 4ORCA 2Z1AA 4TUGA 4LACC 3K7VC 3QG5C 4YKEA 4H2GA 4NZVA 3IVDA 3RQZA 3H67A 3K7WC 4OR9A 3RL5A 3PSNA 1OIDA 1S95A 1UF3A 4O5GA 4LU9A 3AV0A 4G9JA 3FGAC 2DFJA 3QFNA 3RL4A 3ZU0A 2IE3C 2QFRA 4Q7FA 4V0VA 4WWLA 4KKZA 5IOHA 2ZBMA 4FCXA 1II7A 3H68A 4UT3A 2BQ8X 4I5LC 5EQVA 3AUZA 4I5NC 5GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H66 A;  2WDC A;  2P6B A;  4FBW A;  5INB A;  4F0Z A;  3C9F A;  4HD0 A;  4H2B A;  2QFP A;  4FBK A;  4V0X A;  4UWQ A;  3H64 A;  4ZVZ A;  2KKN A;  2HYO A;  2R17 A;  1M63 A;  5JPF A;  2Q8U A;  5JJT A;  4ZX2 A;  4TUI A;  3RL3 A;  3GVE A;  5F3W A;  5J28 A;  1S3M A;  3T1I A;  2NPP C;  1Z2X A;  3PSO A;  5HPE A;  3IB8 A;  4O4K A;  2XMO A;  1Z2W A;  1QHW A;  4J6O A;  3DSC A;  1S3L A;  3QFM A;  2JOG A;  1QFC A;  3H62 B;  1TCO A;  2IE4 C;  2WDF A;  1KBP A;  1XM7 A;  1WAO 1;  4MP0 A;  4JA9 A;  5B8I A;  4JA7 A;  1T70 A;  3EGH A;  4IL1 A;  3LL8 A;  3P71 C;  3E7B A;  1OI8 A;  4DSY A;  3E7A A;  1AUI A;  3QFO A;  2USH A;  4DHL A;  4H1S A;  4H2I A;  4KBP A;  3ICF A;  3V4Y A;  2NXF A;  4O24 A;  3EGG A;  1T71 A;  1XZW A;  2O8G A;  4FBQ A;  4O43 A;  4UT3 B;  1G5B A;  4H1Y P;  3N5U A;  1U32 A;  1S3N A;  4UT2 A;  2IAE C;  1IT6 A;  1USH A;  2Z72 A;  1JK7 A;  1W24 A;  2QJC A;  4LTY A;  4M0V A;  4IYP C;  3QFK A;  4H2F A;  3HVQ A;  2AHD A;  2CV9 A;  1HO5 A;  2BDX A;  1FJM A;  1HPU A;  2A22 A;  3CK2 A;  4ORB A;  4V0W A;  3KBP A;  2GJU A;  4B2O A;  2Z06 A;  4ORA A;  3H60 A;  1SU1 A;  3JYF A;  4XPN A;  2NYL C;  2HYP A;  4MOY A;  4MOV A;  3IB7 A;  1S8E A;  2O8A A;  3IVE A;  5C1V A;  1S70 A;  5DNY A;  4DT2 A;  3C5W C;  2HY1 A;  1WAR A;  2WDD A;  3ZTV A;  3THN A;  2NYM C;  3H69 A;  2WDE A;  1OIE A;  3H63 A;  5JPE A;  1NNW A;  1V73 A;  2YVT A;  1MF8 A;  1HP1 A;  3THO B;  1UTE A;  3DW8 C;  2BCD A;  3TGH A;  3DSD A;  3H61 A;  4ORC A;  2Z1A A;  4TUG A;  4LAC C;  3K7V C;  3QG5 C;  4YKE A;  4H2G A;  4NZV A;  3IVD A;  3RQZ A;  3H67 A;  3K7W C;  4OR9 A;  3RL5 A;  3PSN A;  1OID A;  1S95 A;  1UF3 A;  4O5G A;  4LU9 A;  3AV0 A;  4G9J A;  3FGA C;  2DFJ A;  3QFN A;  3RL4 A;  3ZU0 A;  2IE3 C;  2QFR A;  4Q7F A;  4V0V A;  4WWL A;  4KKZ A;  5IOH A;  2ZBM A;  4FCX A;  1II7 A;  3H68 A;  4UT3 A;  2BQ8 X;  4I5L C;  5EQV A;  3AUZ A;  4I5N C;  5GTU A; 
#chains in the Genus database with same CATH topology
 3H66 A;  2WDC A;  2P6B A;  4FBW A;  5INB A;  4F0Z A;  3C9F A;  4HD0 A;  4H2B A;  2QFP A;  4FBK A;  4V0X A;  4UWQ A;  3H64 A;  4ZVZ A;  2KKN A;  2HYO A;  2DXL A;  2R17 A;  1M63 A;  5JPF A;  2Q8U A;  5JJT A;  4ZX2 A;  4TUI A;  3RL3 A;  3GVE A;  5F3W A;  5J28 A;  1S3M A;  3T1I A;  2NPP C;  1Z2X A;  3PSO A;  5HPE A;  3IB8 A;  4O4K A;  2XMO A;  1Z2W A;  2ZOA A;  1QHW A;  4J6O A;  3DSC A;  1S3L A;  3QFM A;  2JOG A;  1QFC A;  3H62 B;  1TCO A;  2IE4 C;  2WDF A;  1KBP A;  1XM7 A;  1WAO 1;  4MP0 A;  2YEQ A;  4JA9 A;  5B8I A;  4JA7 A;  1T70 A;  3EGH A;  4IL1 A;  3LL8 A;  3P71 C;  3E7B A;  1OI8 A;  4DSY A;  3E7A A;  1AUI A;  3QFO A;  2USH A;  4DHL A;  4H1S A;  4H2I A;  4KBP A;  3ICF A;  3V4Y A;  2NXF A;  4O24 A;  3EGG A;  1T71 A;  1XZW A;  2O8G A;  4FBQ A;  4O43 A;  4UT3 B;  1G5B A;  4H1Y P;  3N5U A;  1U32 A;  1S3N A;  4UT2 A;  2IAE C;  1IT6 A;  1USH A;  2Z72 A;  1JK7 A;  1W24 A;  2ZO9 B;  2QJC A;  4LTY A;  4M0V A;  4IYP C;  3QFK A;  4H2F A;  3HVQ A;  2AHD A;  2CV9 A;  1HO5 A;  2BDX A;  1FJM A;  1HPU A;  2A22 A;  3CK2 A;  3FLO A;  4ORB A;  4V0W A;  3KBP A;  2GJU A;  4B2O A;  2Z06 A;  2DXN A;  4ORA A;  3H60 A;  1SU1 A;  3JYF A;  4XPN A;  2NYL C;  2HYP A;  4MOY A;  4MOV A;  3IB7 A;  1S8E A;  2O8A A;  3D03 A;  3IVE A;  5C1V A;  1S70 A;  5DNY A;  4DT2 A;  3C5W C;  2HY1 A;  1WAR A;  2WDD A;  3ZTV A;  3THN A;  2NYM C;  3H69 A;  2WDE A;  1OIE A;  3H63 A;  5JPE A;  1NNW A;  1V73 A;  2YVT A;  1MF8 A;  1HP1 A;  3E0J A;  3THO B;  1UTE A;  3DW8 C;  2BCD A;  3TGH A;  3DSD A;  3H61 A;  4ORC A;  2Z1A A;  4TUG A;  4LAC C;  3K7V C;  3QG5 C;  4YKE A;  4H2G A;  4NZV A;  3IVD A;  3RQZ A;  3H67 A;  3K7W C;  4OR9 A;  3RL5 A;  3PSN A;  1OID A;  1S95 A;  1UF3 A;  4O5G A;  4LU9 A;  3AV0 A;  4G9J A;  3FGA C;  2DFJ A;  3QFN A;  3RL4 A;  3ZU0 A;  2IE3 C;  2QFR A;  4Q7F A;  4V0V A;  4WWL A;  4KKZ A;  5IOH A;  2ZBM A;  4FCX A;  1II7 A;  3H68 A;  4UT3 A;  2BQ8 X;  4I5L C;  5EQV A;  3AUZ A;  4I5N C;  5GTU A; 
#chains in the Genus database with same CATH homology
 3H66 A;  2WDC A;  2P6B A;  4FBW A;  5INB A;  4F0Z A;  3C9F A;  4HD0 A;  4H2B A;  2QFP A;  4FBK A;  4V0X A;  4UWQ A;  3H64 A;  4ZVZ A;  2KKN A;  2HYO A;  2DXL A;  2R17 A;  1M63 A;  5JPF A;  2Q8U A;  5JJT A;  4ZX2 A;  4TUI A;  3RL3 A;  3GVE A;  5F3W A;  5J28 A;  1S3M A;  3T1I A;  2NPP C;  1Z2X A;  3PSO A;  5HPE A;  3IB8 A;  4O4K A;  2XMO A;  1Z2W A;  2ZOA A;  1QHW A;  4J6O A;  3DSC A;  1S3L A;  3QFM A;  2JOG A;  1QFC A;  3H62 B;  1TCO A;  2IE4 C;  2WDF A;  1KBP A;  1XM7 A;  1WAO 1;  4MP0 A;  2YEQ A;  4JA9 A;  5B8I A;  4JA7 A;  1T70 A;  3EGH A;  4IL1 A;  3LL8 A;  3P71 C;  3E7B A;  1OI8 A;  4DSY A;  3E7A A;  1AUI A;  3QFO A;  2USH A;  4DHL A;  4H1S A;  4H2I A;  4KBP A;  3ICF A;  3V4Y A;  2NXF A;  4O24 A;  3EGG A;  1T71 A;  1XZW A;  2O8G A;  4FBQ A;  4O43 A;  4UT3 B;  1G5B A;  4H1Y P;  3N5U A;  1U32 A;  1S3N A;  4UT2 A;  2IAE C;  1IT6 A;  1USH A;  2Z72 A;  1JK7 A;  1W24 A;  2ZO9 B;  2QJC A;  4LTY A;  4M0V A;  4IYP C;  3QFK A;  4H2F A;  3HVQ A;  2AHD A;  2CV9 A;  1HO5 A;  2BDX A;  1FJM A;  1HPU A;  2A22 A;  3CK2 A;  3FLO A;  4ORB A;  4V0W A;  3KBP A;  2GJU A;  4B2O A;  2Z06 A;  2DXN A;  4ORA A;  3H60 A;  1SU1 A;  3JYF A;  4XPN A;  2NYL C;  2HYP A;  4MOY A;  4MOV A;  3IB7 A;  1S8E A;  2O8A A;  3D03 A;  3IVE A;  5C1V A;  1S70 A;  5DNY A;  4DT2 A;  3C5W C;  2HY1 A;  1WAR A;  2WDD A;  3ZTV A;  3THN A;  2NYM C;  3H69 A;  2WDE A;  1OIE A;  3H63 A;  5JPE A;  1NNW A;  1V73 A;  2YVT A;  1MF8 A;  1HP1 A;  3E0J A;  3THO B;  1UTE A;  3DW8 C;  2BCD A;  3TGH A;  3DSD A;  3H61 A;  4ORC A;  2Z1A A;  4TUG A;  4LAC C;  3K7V C;  3QG5 C;  4YKE A;  4H2G A;  4NZV A;  3IVD A;  3RQZ A;  3H67 A;  3K7W C;  4OR9 A;  3RL5 A;  3PSN A;  1OID A;  1S95 A;  1UF3 A;  4O5G A;  4LU9 A;  3AV0 A;  4G9J A;  3FGA C;  2DFJ A;  3QFN A;  3RL4 A;  3ZU0 A;  2IE3 C;  2QFR A;  4Q7F A;  4V0V A;  4WWL A;  4KKZ A;  5IOH A;  2ZBM A;  4FCX A;  1II7 A;  3H68 A;  4UT3 A;  2BQ8 X;  4I5L C;  5EQV A;  3AUZ A;  4I5N C;  5GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...