1TCOA

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
352
structure length
352
Chain Sequence
VPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE B2
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
total genus 126
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1tcoA00
3AUZA 3PSNA 3C9FA 5C1VA 3C5WC 4NZVA 2Z72A 5IOHA 4LU9A 2O8AA 4LTYA 1QFCA 4HD0A 4O4KA 3GVEA 1NNWA 4H2FA 2QFPA 4MP0A 1OIDA 4H1YP 4DHLA 4JA7A 3IVDA 4TUIA 3IVEA 3H67A 1MF8A 2USHA 2WDEA 4ORAA 1T70A 1IT6A 2O8GA 1U32A 3JYFA 2IAEC 4FBQA 3RL5A 1G5BA 1S3NA 3IB8A 3H63A 5B8IA 2NPPC 2NYLC 2WDCA 1JK7A 2GJUA 4O24A 4V0XA 2BDXA 3H62B 1T71A 3P71C 2Q8UA 5F3WA 4M0VA 3DSCA 4UT2A 2A22A 3TGHA 1HPUA 1XZWA 1WAO1 4DT2A 2IE4C 4KKZA 5INBA 4H2GA 1S3LA 4H2IA 1M63A 2AHDA 3QFNA 3H69A 4IL1A 5EQVA 2ZBMA 1S3MA 3THOB 3QG5C 5GTUA 2NXFA 1AUIA 1HP1A 1SU1A 2BQ8X 1S95A 2BCDA 4ORCA 2P6BA 2YVTA 3LL8A 1TCOA 3QFMA 1V73A 4FBWA 5DNYA 2CV9A 4WWLA 1S8EA 2KKNA 1Z2WA 3PSOA 4FCXA 1OIEA 3K7VC 4O43A 4DSYA 1KBPA 3H66A 3ZTVA 2Z06A 1UTEA 1QHWA 1FJMA 1UF3A 3RL3A 2R17A 3E7AA 5HPEA 4TUGA 1WARA 3QFKA 4H1SA 2HYOA 4ORBA 4MOYA 4FBKA 3H61A 3T1IA 3IB7A 3RQZA 4YKEA 3KBPA 4V0WA 3FGAC 4JA9A 5JPEA 3V4YA 2IE3C 5J28A 4Q7FA 2HY1A 3N5UA 4OR9A 3THNA 4F0ZA 3DSDA 1USHA 4ZX2A 2Z1AA 3HVQA 4I5LC 3RL4A 4LACC 3AV0A 4KBPA 1OI8A 2QFRA 3H68A 2XMOA 4ZVZA 3K7WC 4V0VA 3DW8C 2HYPA 2DFJA 3EGHA 1II7A 3CK2A 4O5GA 3ZU0A 4B2OA 2QJCA 3H64A 2WDFA 1HO5A 4H2BA 2WDDA 3E7BA 4G9JA 4UWQA 1S70A 4I5NC 4IYPC 3EGGA 3H60A 2NYMC 4XPNA 4UT3A 4UT3B 4MOVA 3QFOA 5JPFA 1W24A 3ICFA 1XM7A 5JJTA 2JOGA 4J6OA 1Z2XA
chains in the Genus database with same CATH superfamily
3AUZA 3PSNA 3C9FA 5C1VA 3C5WC 4NZVA 2Z72A 5IOHA 4LU9A 2O8AA 4LTYA 1QFCA 3E0JA 4HD0A 4O4KA 3GVEA 1NNWA 4H2FA 2QFPA 4MP0A 1OIDA 4H1YP 4DHLA 4JA7A 3IVDA 4TUIA 3IVEA 2DXLA 3H67A 1MF8A 2USHA 2WDEA 4ORAA 1T70A 1IT6A 2O8GA 1U32A 3JYFA 2IAEC 3FLOA 4FBQA 3RL5A 1G5BA 1S3NA 3IB8A 3H63A 5B8IA 2NPPC 2NYLC 2WDCA 1JK7A 2GJUA 4O24A 4V0XA 2BDXA 3H62B 1T71A 3P71C 2Q8UA 5F3WA 4M0VA 3DSCA 4UT2A 2A22A 3TGHA 1HPUA 1XZWA 1WAO1 4DT2A 2IE4C 2DXNA 4KKZA 5INBA 4H2GA 1S3LA 4H2IA 1M63A 2AHDA 3QFNA 3H69A 4IL1A 5EQVA 2ZBMA 1S3MA 3THOB 3QG5C 5GTUA 2NXFA 1AUIA 1HP1A 1SU1A 2BQ8X 1S95A 2BCDA 4ORCA 2P6BA 2YVTA 3LL8A 1TCOA 3QFMA 1V73A 4FBWA 5DNYA 2CV9A 4WWLA 1S8EA 2KKNA 1Z2WA 3PSOA 4FCXA 1OIEA 3K7VC 4O43A 4DSYA 1KBPA 3H66A 3ZTVA 2Z06A 2ZO9B 1UTEA 1QHWA 1FJMA 1UF3A 3RL3A 2R17A 3E7AA 5HPEA 4TUGA 1WARA 3QFKA 4H1SA 2HYOA 4ORBA 4MOYA 4FBKA 3H61A 3T1IA 3IB7A 3RQZA 4YKEA 3KBPA 4V0WA 3FGAC 4JA9A 5JPEA 3V4YA 2IE3C 5J28A 4Q7FA 2HY1A 3N5UA 4OR9A 3THNA 4F0ZA 3DSDA 1USHA 4ZX2A 2Z1AA 3HVQA 4I5LC 3D03A 3RL4A 4LACC 3AV0A 4KBPA 1OI8A 2QFRA 3H68A 2XMOA 4ZVZA 3K7WC 4V0VA 3DW8C 2HYPA 2DFJA 3EGHA 1II7A 3CK2A 4O5GA 3ZU0A 4B2OA 2QJCA 3H64A 2WDFA 1HO5A 2YEQA 2WDDA 4H2BA 3E7BA 4G9JA 4UWQA 1S70A 4I5NC 4IYPC 3EGGA 3H60A 2NYMC 4XPNA 4UT3A 4UT3B 4MOVA 3QFOA 5JPFA 1W24A 3ICFA 2ZOAA 1XM7A 5JJTA 2JOGA 4J6OA 1Z2XA
chains in the Genus database with same CATH topology
3AUZA 3PSNA 3C9FA 5C1VA 3C5WC 4NZVA 2Z72A 5IOHA 4LU9A 2O8AA 4LTYA 1QFCA 3E0JA 4HD0A 4O4KA 3GVEA 1NNWA 4H2FA 2QFPA 4MP0A 1OIDA 4H1YP 4DHLA 4JA7A 3IVDA 4TUIA 3IVEA 2DXLA 3H67A 1MF8A 2USHA 2WDEA 4ORAA 1T70A 1IT6A 2O8GA 1U32A 3JYFA 2IAEC 3FLOA 4FBQA 3RL5A 1G5BA 1S3NA 3IB8A 3H63A 5B8IA 2NPPC 2NYLC 2WDCA 1JK7A 2GJUA 4O24A 4V0XA 2BDXA 3H62B 1T71A 3P71C 2Q8UA 5F3WA 4M0VA 3DSCA 4UT2A 2A22A 3TGHA 1HPUA 1XZWA 1WAO1 4DT2A 2IE4C 2DXNA 4KKZA 5INBA 4H2GA 1S3LA 4H2IA 1M63A 2AHDA 3QFNA 3H69A 4IL1A 5EQVA 2ZBMA 1S3MA 3THOB 3QG5C 5GTUA 2NXFA 1AUIA 1HP1A 1SU1A 2BQ8X 1S95A 2BCDA 4ORCA 2P6BA 2YVTA 3LL8A 1TCOA 3QFMA 1V73A 4FBWA 5DNYA 2CV9A 4WWLA 1S8EA 2KKNA 1Z2WA 3PSOA 4FCXA 1OIEA 3K7VC 4O43A 4DSYA 1KBPA 3H66A 3ZTVA 2Z06A 2ZO9B 1UTEA 1QHWA 1FJMA 1UF3A 3RL3A 2R17A 3E7AA 5HPEA 4TUGA 1WARA 3QFKA 4H1SA 2HYOA 4ORBA 4MOYA 4FBKA 3H61A 3T1IA 3IB7A 3RQZA 4YKEA 3KBPA 4V0WA 3FGAC 4JA9A 5JPEA 3V4YA 2IE3C 5J28A 4Q7FA 2HY1A 3N5UA 4OR9A 3THNA 4F0ZA 3DSDA 1USHA 4ZX2A 2Z1AA 3HVQA 4I5LC 3D03A 3RL4A 4LACC 3AV0A 4KBPA 1OI8A 2QFRA 3H68A 2XMOA 4ZVZA 3K7WC 4V0VA 3DW8C 2HYPA 2DFJA 3EGHA 1II7A 3CK2A 4O5GA 3ZU0A 4B2OA 2QJCA 3H64A 2WDFA 1HO5A 2YEQA 2WDDA 4H2BA 3E7BA 4G9JA 4UWQA 1S70A 4I5NC 4IYPC 3EGGA 3H60A 2NYMC 4XPNA 4UT3A 4UT3B 4MOVA 3QFOA 5JPFA 1W24A 3ICFA 2ZOAA 1XM7A 5JJTA 2JOGA 4J6OA 1Z2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AUZ A;  3PSN A;  3C9F A;  5C1V A;  3C5W C;  4NZV A;  2Z72 A;  5IOH A;  4LU9 A;  2O8A A;  4LTY A;  1QFC A;  4HD0 A;  4O4K A;  3GVE A;  1NNW A;  4H2F A;  2QFP A;  4MP0 A;  1OID A;  4H1Y P;  4DHL A;  4JA7 A;  3IVD A;  4TUI A;  3IVE A;  3H67 A;  1MF8 A;  2USH A;  2WDE A;  4ORA A;  1T70 A;  1IT6 A;  2O8G A;  1U32 A;  3JYF A;  2IAE C;  4FBQ A;  3RL5 A;  1G5B A;  1S3N A;  3IB8 A;  3H63 A;  5B8I A;  2NPP C;  2NYL C;  2WDC A;  1JK7 A;  2GJU A;  4O24 A;  4V0X A;  2BDX A;  3H62 B;  1T71 A;  3P71 C;  2Q8U A;  5F3W A;  4M0V A;  3DSC A;  4UT2 A;  2A22 A;  3TGH A;  1HPU A;  1XZW A;  1WAO 1;  4DT2 A;  2IE4 C;  4KKZ A;  5INB A;  4H2G A;  1S3L A;  4H2I A;  1M63 A;  2AHD A;  3QFN A;  3H69 A;  4IL1 A;  5EQV A;  2ZBM A;  1S3M A;  3THO B;  3QG5 C;  5GTU A;  2NXF A;  1AUI A;  1HP1 A;  1SU1 A;  2BQ8 X;  1S95 A;  2BCD A;  4ORC A;  2P6B A;  2YVT A;  3LL8 A;  1TCO A;  3QFM A;  1V73 A;  4FBW A;  5DNY A;  2CV9 A;  4WWL A;  1S8E A;  2KKN A;  1Z2W A;  3PSO A;  4FCX A;  1OIE A;  3K7V C;  4O43 A;  4DSY A;  1KBP A;  3H66 A;  3ZTV A;  2Z06 A;  1UTE A;  1QHW A;  1FJM A;  1UF3 A;  3RL3 A;  2R17 A;  3E7A A;  5HPE A;  4TUG A;  1WAR A;  3QFK A;  4H1S A;  2HYO A;  4ORB A;  4MOY A;  4FBK A;  3H61 A;  3T1I A;  3IB7 A;  3RQZ A;  4YKE A;  3KBP A;  4V0W A;  3FGA C;  4JA9 A;  5JPE A;  3V4Y A;  2IE3 C;  5J28 A;  4Q7F A;  2HY1 A;  3N5U A;  4OR9 A;  3THN A;  4F0Z A;  3DSD A;  1USH A;  4ZX2 A;  2Z1A A;  3HVQ A;  4I5L C;  3RL4 A;  4LAC C;  3AV0 A;  4KBP A;  1OI8 A;  2QFR A;  3H68 A;  2XMO A;  4ZVZ A;  3K7W C;  4V0V A;  3DW8 C;  2HYP A;  2DFJ A;  3EGH A;  1II7 A;  3CK2 A;  4O5G A;  3ZU0 A;  4B2O A;  2QJC A;  3H64 A;  2WDF A;  1HO5 A;  4H2B A;  2WDD A;  3E7B A;  4G9J A;  4UWQ A;  1S70 A;  4I5N C;  4IYP C;  3EGG A;  3H60 A;  2NYM C;  4XPN A;  4UT3 A;  4UT3 B;  4MOV A;  3QFO A;  5JPF A;  1W24 A;  3ICF A;  1XM7 A;  5JJT A;  2JOG A;  4J6O A;  1Z2X A; 
#chains in the Genus database with same CATH topology
 3AUZ A;  3PSN A;  3C9F A;  5C1V A;  3C5W C;  4NZV A;  2Z72 A;  5IOH A;  4LU9 A;  2O8A A;  4LTY A;  1QFC A;  3E0J A;  4HD0 A;  4O4K A;  3GVE A;  1NNW A;  4H2F A;  2QFP A;  4MP0 A;  1OID A;  4H1Y P;  4DHL A;  4JA7 A;  3IVD A;  4TUI A;  3IVE A;  2DXL A;  3H67 A;  1MF8 A;  2USH A;  2WDE A;  4ORA A;  1T70 A;  1IT6 A;  2O8G A;  1U32 A;  3JYF A;  2IAE C;  3FLO A;  4FBQ A;  3RL5 A;  1G5B A;  1S3N A;  3IB8 A;  3H63 A;  5B8I A;  2NPP C;  2NYL C;  2WDC A;  1JK7 A;  2GJU A;  4O24 A;  4V0X A;  2BDX A;  3H62 B;  1T71 A;  3P71 C;  2Q8U A;  5F3W A;  4M0V A;  3DSC A;  4UT2 A;  2A22 A;  3TGH A;  1HPU A;  1XZW A;  1WAO 1;  4DT2 A;  2IE4 C;  2DXN A;  4KKZ A;  5INB A;  4H2G A;  1S3L A;  4H2I A;  1M63 A;  2AHD A;  3QFN A;  3H69 A;  4IL1 A;  5EQV A;  2ZBM A;  1S3M A;  3THO B;  3QG5 C;  5GTU A;  2NXF A;  1AUI A;  1HP1 A;  1SU1 A;  2BQ8 X;  1S95 A;  2BCD A;  4ORC A;  2P6B A;  2YVT A;  3LL8 A;  1TCO A;  3QFM A;  1V73 A;  4FBW A;  5DNY A;  2CV9 A;  4WWL A;  1S8E A;  2KKN A;  1Z2W A;  3PSO A;  4FCX A;  1OIE A;  3K7V C;  4O43 A;  4DSY A;  1KBP A;  3H66 A;  3ZTV A;  2Z06 A;  2ZO9 B;  1UTE A;  1QHW A;  1FJM A;  1UF3 A;  3RL3 A;  2R17 A;  3E7A A;  5HPE A;  4TUG A;  1WAR A;  3QFK A;  4H1S A;  2HYO A;  4ORB A;  4MOY A;  4FBK A;  3H61 A;  3T1I A;  3IB7 A;  3RQZ A;  4YKE A;  3KBP A;  4V0W A;  3FGA C;  4JA9 A;  5JPE A;  3V4Y A;  2IE3 C;  5J28 A;  4Q7F A;  2HY1 A;  3N5U A;  4OR9 A;  3THN A;  4F0Z A;  3DSD A;  1USH A;  4ZX2 A;  2Z1A A;  3HVQ A;  4I5L C;  3D03 A;  3RL4 A;  4LAC C;  3AV0 A;  4KBP A;  1OI8 A;  2QFR A;  3H68 A;  2XMO A;  4ZVZ A;  3K7W C;  4V0V A;  3DW8 C;  2HYP A;  2DFJ A;  3EGH A;  1II7 A;  3CK2 A;  4O5G A;  3ZU0 A;  4B2O A;  2QJC A;  3H64 A;  2WDF A;  1HO5 A;  2YEQ A;  2WDD A;  4H2B A;  3E7B A;  4G9J A;  4UWQ A;  1S70 A;  4I5N C;  4IYP C;  3EGG A;  3H60 A;  2NYM C;  4XPN A;  4UT3 A;  4UT3 B;  4MOV A;  3QFO A;  5JPF A;  1W24 A;  3ICF A;  2ZOA A;  1XM7 A;  5JJT A;  2JOG A;  4J6O A;  1Z2X A; 
#chains in the Genus database with same CATH homology
 3AUZ A;  3PSN A;  3C9F A;  5C1V A;  3C5W C;  4NZV A;  2Z72 A;  5IOH A;  4LU9 A;  2O8A A;  4LTY A;  1QFC A;  3E0J A;  4HD0 A;  4O4K A;  3GVE A;  1NNW A;  4H2F A;  2QFP A;  4MP0 A;  1OID A;  4H1Y P;  4DHL A;  4JA7 A;  3IVD A;  4TUI A;  3IVE A;  2DXL A;  3H67 A;  1MF8 A;  2USH A;  2WDE A;  4ORA A;  1T70 A;  1IT6 A;  2O8G A;  1U32 A;  3JYF A;  2IAE C;  3FLO A;  4FBQ A;  3RL5 A;  1G5B A;  1S3N A;  3IB8 A;  3H63 A;  5B8I A;  2NPP C;  2NYL C;  2WDC A;  1JK7 A;  2GJU A;  4O24 A;  4V0X A;  2BDX A;  3H62 B;  1T71 A;  3P71 C;  2Q8U A;  5F3W A;  4M0V A;  3DSC A;  4UT2 A;  2A22 A;  3TGH A;  1HPU A;  1XZW A;  1WAO 1;  4DT2 A;  2IE4 C;  2DXN A;  4KKZ A;  5INB A;  4H2G A;  1S3L A;  4H2I A;  1M63 A;  2AHD A;  3QFN A;  3H69 A;  4IL1 A;  5EQV A;  2ZBM A;  1S3M A;  3THO B;  3QG5 C;  5GTU A;  2NXF A;  1AUI A;  1HP1 A;  1SU1 A;  2BQ8 X;  1S95 A;  2BCD A;  4ORC A;  2P6B A;  2YVT A;  3LL8 A;  1TCO A;  3QFM A;  1V73 A;  4FBW A;  5DNY A;  2CV9 A;  4WWL A;  1S8E A;  2KKN A;  1Z2W A;  3PSO A;  4FCX A;  1OIE A;  3K7V C;  4O43 A;  4DSY A;  1KBP A;  3H66 A;  3ZTV A;  2Z06 A;  2ZO9 B;  1UTE A;  1QHW A;  1FJM A;  1UF3 A;  3RL3 A;  2R17 A;  3E7A A;  5HPE A;  4TUG A;  1WAR A;  3QFK A;  4H1S A;  2HYO A;  4ORB A;  4MOY A;  4FBK A;  3H61 A;  3T1I A;  3IB7 A;  3RQZ A;  4YKE A;  3KBP A;  4V0W A;  3FGA C;  4JA9 A;  5JPE A;  3V4Y A;  2IE3 C;  5J28 A;  4Q7F A;  2HY1 A;  3N5U A;  4OR9 A;  3THN A;  4F0Z A;  3DSD A;  1USH A;  4ZX2 A;  2Z1A A;  3HVQ A;  4I5L C;  3D03 A;  3RL4 A;  4LAC C;  3AV0 A;  4KBP A;  1OI8 A;  2QFR A;  3H68 A;  2XMO A;  4ZVZ A;  3K7W C;  4V0V A;  3DW8 C;  2HYP A;  2DFJ A;  3EGH A;  1II7 A;  3CK2 A;  4O5G A;  3ZU0 A;  4B2O A;  2QJC A;  3H64 A;  2WDF A;  1HO5 A;  2YEQ A;  2WDD A;  4H2B A;  3E7B A;  4G9J A;  4UWQ A;  1S70 A;  4I5N C;  4IYP C;  3EGG A;  3H60 A;  2NYM C;  4XPN A;  4UT3 A;  4UT3 B;  4MOV A;  3QFO A;  5JPF A;  1W24 A;  3ICF A;  2ZOA A;  1XM7 A;  5JJT A;  2JOG A;  4J6O A;  1Z2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...