1TCOA

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
352
structure length
352
Chain Sequence
VPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEETVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNIC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
molecule keywords SERINE/THREONINE PHOSPHATASE B2
total genus 126
structure length 352
sequence length 352
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1tcoA00
1QFCA 2QFPA 4G9JA 3E7AA 4DSYA 3DSCA 2NXFA 1XZWA 3QFNA 4ORAA 3ICFA 2BCDA 3KBPA 4LACC 2HYOA 3PSOA 4I5LC 1II7A 4M0VA 2O8AA 5INBA 2BQ8X 4LTYA 2DFJA 4ORBA 1WARA 4O24A 2IE4C 2Z06A 1S3NA 4WWLA 1MF8A 4H1SA 1FJMA 4JA9A 3EGHA 3LL8A 4MOVA 2NYMC 3IVDA 4O5GA 4MOYA 3H68A 1Z2WA 1G5BA 1NNWA 3K7WC 3HVQA 3TGHA 2R17A 4I5NC 3GVEA 2IAEC 2JOGA 4UWQA 4J6OA 3K7VC 4OR9A 1Z2XA 3H67A 3H63A 5B8IA 3THNA 4H2FA 2NPPC 3THOB 4FCXA 2AHDA 2WDFA 3FGAC 1IT6A 3ZTVA 1TCOA 4NZVA 3H69A 4KKZA 2CV9A 3H61A 4LU9A 1W24A 3RQZA 1KBPA 5JPEA 2P6BA 3H62B 4ORCA 5C1VA 2Z72A 1QHWA 4ZX2A 4XPNA 4O4KA 3AV0A 2O8GA 1M63A 2KKNA 3E7BA 3JYFA 4H2GA 3T1IA 2YVTA 3C9FA 4H1YP 4UT3A 1V73A 3P71C 3DW8C 2HY1A 3EGGA 5IOHA 2NYLC 5EQVA 1S95A 1WAO1 4O43A 4DT2A 4TUGA 4ZVZA 2HYPA 3C5WC 5JJTA 4YKEA 2Z1AA 3IVEA 1HPUA 5GTUA 4B2OA 3N5UA 4F0ZA 3H64A 1HO5A 2A22A 3AUZA 1S3MA 4FBQA 1HP1A 3IB8A 3QFKA 4V0WA 4DHLA 1OIEA 2WDDA 3RL5A 4IYPC 4H2IA 4V0XA 1T71A 3V4YA 2WDCA 3H60A 5HPEA 4V0VA 1JK7A 1XM7A 2QFRA 5J28A 4FBKA 1UF3A 1SU1A 4TUIA 3QG5C 1OI8A 3IB7A 3RL3A 2BDXA 1U32A 4JA7A 2QJCA 4FBWA 3RL4A 4HD0A 3DSDA 3CK2A 3QFOA 2USHA 5JPFA 3PSNA 4Q7FA 4H2BA 1S3LA 3ZU0A 2WDEA 1AUIA 2IE3C 4UT2A 3H66A 1USHA 1S70A 3QFMA 4KBPA 5F3WA 2ZBMA 1S8EA 1T70A 2Q8UA 2GJUA 4IL1A 4MP0A 5DNYA 1OIDA 4UT3B 2XMOA 1UTEA
chains in the Genus database with same CATH superfamily
1QFCA 2QFPA 2DXLA 4G9JA 3FLOA 3E7AA 4DSYA 3DSCA 2NXFA 1XZWA 3QFNA 4ORAA 3ICFA 2BCDA 3KBPA 4LACC 2HYOA 3PSOA 4I5LC 1II7A 4M0VA 2O8AA 5INBA 2BQ8X 4LTYA 2DFJA 4ORBA 1WARA 4O24A 2IE4C 2Z06A 1S3NA 4WWLA 1MF8A 4H1SA 1FJMA 4JA9A 3EGHA 2ZO9B 3LL8A 4MOVA 2NYMC 3IVDA 4O5GA 3D03A 4MOYA 3H68A 1Z2WA 1G5BA 1NNWA 3K7WC 3HVQA 3TGHA 2R17A 4I5NC 3GVEA 2IAEC 2JOGA 4UWQA 4J6OA 3K7VC 4OR9A 1Z2XA 3H67A 3H63A 5B8IA 3THNA 4H2FA 2NPPC 3THOB 4FCXA 2AHDA 2WDFA 3FGAC 1IT6A 3ZTVA 1TCOA 4NZVA 2ZOAA 3H69A 4KKZA 2CV9A 3H61A 4LU9A 1W24A 3RQZA 1KBPA 5JPEA 2P6BA 3H62B 4ORCA 5C1VA 2Z72A 1QHWA 4ZX2A 4XPNA 4O4KA 3AV0A 2O8GA 1M63A 2KKNA 3E7BA 3JYFA 4H2GA 3T1IA 2YVTA 3C9FA 4H1YP 4UT3A 1V73A 3P71C 3DW8C 2HY1A 3EGGA 5IOHA 2NYLC 5EQVA 1S95A 1WAO1 4O43A 4DT2A 4TUGA 4ZVZA 2HYPA 3C5WC 5JJTA 4YKEA 2Z1AA 3IVEA 1HPUA 5GTUA 4B2OA 3N5UA 4F0ZA 3H64A 1HO5A 2A22A 3E0JA 3AUZA 1S3MA 4FBQA 1HP1A 3IB8A 3QFKA 4V0WA 4DHLA 1OIEA 2WDDA 3RL5A 4IYPC 4H2IA 4V0XA 1T71A 3V4YA 2WDCA 3H60A 5HPEA 4V0VA 1JK7A 1XM7A 2QFRA 5J28A 4FBKA 1UF3A 1SU1A 4TUIA 3QG5C 2YEQA 1OI8A 3IB7A 3RL3A 2BDXA 1U32A 4JA7A 2QJCA 4FBWA 3RL4A 4HD0A 3DSDA 3CK2A 3QFOA 2DXNA 2USHA 5JPFA 3PSNA 4Q7FA 4H2BA 1S3LA 3ZU0A 2WDEA 1AUIA 2IE3C 4UT2A 3H66A 1USHA 1S70A 3QFMA 4KBPA 5F3WA 2ZBMA 1S8EA 1T70A 2Q8UA 2GJUA 4IL1A 4MP0A 5DNYA 1OIDA 4UT3B 2XMOA 1UTEA
chains in the Genus database with same CATH topology
1QFCA 2QFPA 2DXLA 4G9JA 3FLOA 3E7AA 4DSYA 3DSCA 2NXFA 1XZWA 3QFNA 4ORAA 3ICFA 2BCDA 3KBPA 4LACC 2HYOA 3PSOA 4I5LC 1II7A 4M0VA 2O8AA 5INBA 2BQ8X 4LTYA 2DFJA 4ORBA 1WARA 4O24A 2IE4C 2Z06A 1S3NA 4WWLA 1MF8A 4H1SA 1FJMA 4JA9A 3EGHA 2ZO9B 3LL8A 4MOVA 2NYMC 3IVDA 4O5GA 3D03A 4MOYA 3H68A 1Z2WA 1G5BA 1NNWA 3K7WC 3HVQA 3TGHA 2R17A 4I5NC 3GVEA 2IAEC 2JOGA 4UWQA 4J6OA 3K7VC 4OR9A 1Z2XA 3H67A 3H63A 5B8IA 3THNA 4H2FA 2NPPC 3THOB 4FCXA 2AHDA 2WDFA 3FGAC 1IT6A 3ZTVA 1TCOA 4NZVA 2ZOAA 3H69A 4KKZA 2CV9A 3H61A 4LU9A 1W24A 3RQZA 1KBPA 5JPEA 2P6BA 3H62B 4ORCA 5C1VA 2Z72A 1QHWA 4ZX2A 4XPNA 4O4KA 3AV0A 2O8GA 1M63A 2KKNA 3E7BA 3JYFA 4H2GA 3T1IA 2YVTA 3C9FA 4H1YP 4UT3A 1V73A 3P71C 3DW8C 2HY1A 3EGGA 5IOHA 2NYLC 5EQVA 1S95A 1WAO1 4O43A 4DT2A 4TUGA 4ZVZA 2HYPA 3C5WC 5JJTA 4YKEA 2Z1AA 3IVEA 1HPUA 5GTUA 4B2OA 3N5UA 4F0ZA 3H64A 1HO5A 2A22A 3E0JA 3AUZA 1S3MA 4FBQA 1HP1A 3IB8A 3QFKA 4V0WA 4DHLA 1OIEA 2WDDA 3RL5A 4IYPC 4H2IA 4V0XA 1T71A 3V4YA 2WDCA 3H60A 5HPEA 4V0VA 1JK7A 1XM7A 2QFRA 5J28A 4FBKA 1UF3A 1SU1A 4TUIA 3QG5C 2YEQA 1OI8A 3IB7A 3RL3A 2BDXA 1U32A 4JA7A 2QJCA 4FBWA 3RL4A 4HD0A 3DSDA 3CK2A 3QFOA 2DXNA 2USHA 5JPFA 3PSNA 4Q7FA 4H2BA 1S3LA 3ZU0A 2WDEA 1AUIA 2IE3C 4UT2A 3H66A 1USHA 1S70A 3QFMA 4KBPA 5F3WA 2ZBMA 1S8EA 1T70A 2Q8UA 2GJUA 4IL1A 4MP0A 5DNYA 1OIDA 4UT3B 2XMOA 1UTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFC A;  2QFP A;  4G9J A;  3E7A A;  4DSY A;  3DSC A;  2NXF A;  1XZW A;  3QFN A;  4ORA A;  3ICF A;  2BCD A;  3KBP A;  4LAC C;  2HYO A;  3PSO A;  4I5L C;  1II7 A;  4M0V A;  2O8A A;  5INB A;  2BQ8 X;  4LTY A;  2DFJ A;  4ORB A;  1WAR A;  4O24 A;  2IE4 C;  2Z06 A;  1S3N A;  4WWL A;  1MF8 A;  4H1S A;  1FJM A;  4JA9 A;  3EGH A;  3LL8 A;  4MOV A;  2NYM C;  3IVD A;  4O5G A;  4MOY A;  3H68 A;  1Z2W A;  1G5B A;  1NNW A;  3K7W C;  3HVQ A;  3TGH A;  2R17 A;  4I5N C;  3GVE A;  2IAE C;  2JOG A;  4UWQ A;  4J6O A;  3K7V C;  4OR9 A;  1Z2X A;  3H67 A;  3H63 A;  5B8I A;  3THN A;  4H2F A;  2NPP C;  3THO B;  4FCX A;  2AHD A;  2WDF A;  3FGA C;  1IT6 A;  3ZTV A;  1TCO A;  4NZV A;  3H69 A;  4KKZ A;  2CV9 A;  3H61 A;  4LU9 A;  1W24 A;  3RQZ A;  1KBP A;  5JPE A;  2P6B A;  3H62 B;  4ORC A;  5C1V A;  2Z72 A;  1QHW A;  4ZX2 A;  4XPN A;  4O4K A;  3AV0 A;  2O8G A;  1M63 A;  2KKN A;  3E7B A;  3JYF A;  4H2G A;  3T1I A;  2YVT A;  3C9F A;  4H1Y P;  4UT3 A;  1V73 A;  3P71 C;  3DW8 C;  2HY1 A;  3EGG A;  5IOH A;  2NYL C;  5EQV A;  1S95 A;  1WAO 1;  4O43 A;  4DT2 A;  4TUG A;  4ZVZ A;  2HYP A;  3C5W C;  5JJT A;  4YKE A;  2Z1A A;  3IVE A;  1HPU A;  5GTU A;  4B2O A;  3N5U A;  4F0Z A;  3H64 A;  1HO5 A;  2A22 A;  3AUZ A;  1S3M A;  4FBQ A;  1HP1 A;  3IB8 A;  3QFK A;  4V0W A;  4DHL A;  1OIE A;  2WDD A;  3RL5 A;  4IYP C;  4H2I A;  4V0X A;  1T71 A;  3V4Y A;  2WDC A;  3H60 A;  5HPE A;  4V0V A;  1JK7 A;  1XM7 A;  2QFR A;  5J28 A;  4FBK A;  1UF3 A;  1SU1 A;  4TUI A;  3QG5 C;  1OI8 A;  3IB7 A;  3RL3 A;  2BDX A;  1U32 A;  4JA7 A;  2QJC A;  4FBW A;  3RL4 A;  4HD0 A;  3DSD A;  3CK2 A;  3QFO A;  2USH A;  5JPF A;  3PSN A;  4Q7F A;  4H2B A;  1S3L A;  3ZU0 A;  2WDE A;  1AUI A;  2IE3 C;  4UT2 A;  3H66 A;  1USH A;  1S70 A;  3QFM A;  4KBP A;  5F3W A;  2ZBM A;  1S8E A;  1T70 A;  2Q8U A;  2GJU A;  4IL1 A;  4MP0 A;  5DNY A;  1OID A;  4UT3 B;  2XMO A;  1UTE A; 
#chains in the Genus database with same CATH topology
 1QFC A;  2QFP A;  2DXL A;  4G9J A;  3FLO A;  3E7A A;  4DSY A;  3DSC A;  2NXF A;  1XZW A;  3QFN A;  4ORA A;  3ICF A;  2BCD A;  3KBP A;  4LAC C;  2HYO A;  3PSO A;  4I5L C;  1II7 A;  4M0V A;  2O8A A;  5INB A;  2BQ8 X;  4LTY A;  2DFJ A;  4ORB A;  1WAR A;  4O24 A;  2IE4 C;  2Z06 A;  1S3N A;  4WWL A;  1MF8 A;  4H1S A;  1FJM A;  4JA9 A;  3EGH A;  2ZO9 B;  3LL8 A;  4MOV A;  2NYM C;  3IVD A;  4O5G A;  3D03 A;  4MOY A;  3H68 A;  1Z2W A;  1G5B A;  1NNW A;  3K7W C;  3HVQ A;  3TGH A;  2R17 A;  4I5N C;  3GVE A;  2IAE C;  2JOG A;  4UWQ A;  4J6O A;  3K7V C;  4OR9 A;  1Z2X A;  3H67 A;  3H63 A;  5B8I A;  3THN A;  4H2F A;  2NPP C;  3THO B;  4FCX A;  2AHD A;  2WDF A;  3FGA C;  1IT6 A;  3ZTV A;  1TCO A;  4NZV A;  2ZOA A;  3H69 A;  4KKZ A;  2CV9 A;  3H61 A;  4LU9 A;  1W24 A;  3RQZ A;  1KBP A;  5JPE A;  2P6B A;  3H62 B;  4ORC A;  5C1V A;  2Z72 A;  1QHW A;  4ZX2 A;  4XPN A;  4O4K A;  3AV0 A;  2O8G A;  1M63 A;  2KKN A;  3E7B A;  3JYF A;  4H2G A;  3T1I A;  2YVT A;  3C9F A;  4H1Y P;  4UT3 A;  1V73 A;  3P71 C;  3DW8 C;  2HY1 A;  3EGG A;  5IOH A;  2NYL C;  5EQV A;  1S95 A;  1WAO 1;  4O43 A;  4DT2 A;  4TUG A;  4ZVZ A;  2HYP A;  3C5W C;  5JJT A;  4YKE A;  2Z1A A;  3IVE A;  1HPU A;  5GTU A;  4B2O A;  3N5U A;  4F0Z A;  3H64 A;  1HO5 A;  2A22 A;  3E0J A;  3AUZ A;  1S3M A;  4FBQ A;  1HP1 A;  3IB8 A;  3QFK A;  4V0W A;  4DHL A;  1OIE A;  2WDD A;  3RL5 A;  4IYP C;  4H2I A;  4V0X A;  1T71 A;  3V4Y A;  2WDC A;  3H60 A;  5HPE A;  4V0V A;  1JK7 A;  1XM7 A;  2QFR A;  5J28 A;  4FBK A;  1UF3 A;  1SU1 A;  4TUI A;  3QG5 C;  2YEQ A;  1OI8 A;  3IB7 A;  3RL3 A;  2BDX A;  1U32 A;  4JA7 A;  2QJC A;  4FBW A;  3RL4 A;  4HD0 A;  3DSD A;  3CK2 A;  3QFO A;  2DXN A;  2USH A;  5JPF A;  3PSN A;  4Q7F A;  4H2B A;  1S3L A;  3ZU0 A;  2WDE A;  1AUI A;  2IE3 C;  4UT2 A;  3H66 A;  1USH A;  1S70 A;  3QFM A;  4KBP A;  5F3W A;  2ZBM A;  1S8E A;  1T70 A;  2Q8U A;  2GJU A;  4IL1 A;  4MP0 A;  5DNY A;  1OID A;  4UT3 B;  2XMO A;  1UTE A; 
#chains in the Genus database with same CATH homology
 1QFC A;  2QFP A;  2DXL A;  4G9J A;  3FLO A;  3E7A A;  4DSY A;  3DSC A;  2NXF A;  1XZW A;  3QFN A;  4ORA A;  3ICF A;  2BCD A;  3KBP A;  4LAC C;  2HYO A;  3PSO A;  4I5L C;  1II7 A;  4M0V A;  2O8A A;  5INB A;  2BQ8 X;  4LTY A;  2DFJ A;  4ORB A;  1WAR A;  4O24 A;  2IE4 C;  2Z06 A;  1S3N A;  4WWL A;  1MF8 A;  4H1S A;  1FJM A;  4JA9 A;  3EGH A;  2ZO9 B;  3LL8 A;  4MOV A;  2NYM C;  3IVD A;  4O5G A;  3D03 A;  4MOY A;  3H68 A;  1Z2W A;  1G5B A;  1NNW A;  3K7W C;  3HVQ A;  3TGH A;  2R17 A;  4I5N C;  3GVE A;  2IAE C;  2JOG A;  4UWQ A;  4J6O A;  3K7V C;  4OR9 A;  1Z2X A;  3H67 A;  3H63 A;  5B8I A;  3THN A;  4H2F A;  2NPP C;  3THO B;  4FCX A;  2AHD A;  2WDF A;  3FGA C;  1IT6 A;  3ZTV A;  1TCO A;  4NZV A;  2ZOA A;  3H69 A;  4KKZ A;  2CV9 A;  3H61 A;  4LU9 A;  1W24 A;  3RQZ A;  1KBP A;  5JPE A;  2P6B A;  3H62 B;  4ORC A;  5C1V A;  2Z72 A;  1QHW A;  4ZX2 A;  4XPN A;  4O4K A;  3AV0 A;  2O8G A;  1M63 A;  2KKN A;  3E7B A;  3JYF A;  4H2G A;  3T1I A;  2YVT A;  3C9F A;  4H1Y P;  4UT3 A;  1V73 A;  3P71 C;  3DW8 C;  2HY1 A;  3EGG A;  5IOH A;  2NYL C;  5EQV A;  1S95 A;  1WAO 1;  4O43 A;  4DT2 A;  4TUG A;  4ZVZ A;  2HYP A;  3C5W C;  5JJT A;  4YKE A;  2Z1A A;  3IVE A;  1HPU A;  5GTU A;  4B2O A;  3N5U A;  4F0Z A;  3H64 A;  1HO5 A;  2A22 A;  3E0J A;  3AUZ A;  1S3M A;  4FBQ A;  1HP1 A;  3IB8 A;  3QFK A;  4V0W A;  4DHL A;  1OIE A;  2WDD A;  3RL5 A;  4IYP C;  4H2I A;  4V0X A;  1T71 A;  3V4Y A;  2WDC A;  3H60 A;  5HPE A;  4V0V A;  1JK7 A;  1XM7 A;  2QFR A;  5J28 A;  4FBK A;  1UF3 A;  1SU1 A;  4TUI A;  3QG5 C;  2YEQ A;  1OI8 A;  3IB7 A;  3RL3 A;  2BDX A;  1U32 A;  4JA7 A;  2QJC A;  4FBW A;  3RL4 A;  4HD0 A;  3DSD A;  3CK2 A;  3QFO A;  2DXN A;  2USH A;  5JPF A;  3PSN A;  4Q7F A;  4H2B A;  1S3L A;  3ZU0 A;  2WDE A;  1AUI A;  2IE3 C;  4UT2 A;  3H66 A;  1USH A;  1S70 A;  3QFM A;  4KBP A;  5F3W A;  2ZBM A;  1S8E A;  1T70 A;  2Q8U A;  2GJU A;  4IL1 A;  4MP0 A;  5DNY A;  1OID A;  4UT3 B;  2XMO A;  1UTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...