1TCOC

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKAGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
molecule keywords SERINE/THREONINE PHOSPHATASE B2
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tcoC00
1FJDA 3NRKA 1C9HA 2PV2A 4ODOA 3UQBA 2XP9A 1D7JA 2ZR4A 4ODPA 2KFWA 1TCOC 4TW7A 2XP4A 1M5YA 4FN2A 2LJ4A 3RGCA 4DRQA 4JFJA 3VAWA 4ODQA 2XP8A 4O2TA 3CGNA 1BL4A 5HTGA 2AWGA 2PBCA 2ZR6A 3UI4A 1FKSA 1KT0A 1ZK6A 2PPOA 4ODRA 5HWCA 4DROA 4DZ2A 1U79A 3O5JA 4TW8A 2KO7A 1QZ2A 1D7IA 4U86A 1FKHA 1Q1CA 3IK8A 2VN1A 3IKGA 2M1IA 3KAHA 2XPBA 4DRPA 2Y78A 4U85A 2ZQTA 4ITZA 4W9PA 1Q6IA 1J4IA 3MDYB 1ROUA 4IQCA 3RFWA 3O5RA 2XP7A 2K8IA 3UF8A 2RUDA 2F21A 1F8AB 2FKEA 1N1AA 2IF4A 4TX0A 4TW6A 4JYSA 4ODMA 5DIUA 4QT3A 1FKIA 4MSPA 4DRNA 4DRIA 1NSGA 2L2SA 5BXJA 3O5PA 4QT2A 1NMWA 1A7XA 3O5EA 1ROTA 4DH0A 1JNSA 3TDBA 2D9FA 2ZQVA 3O5FA 4LAYA 3O5GA 2DG3A 3KABA 3TC5A 1FD9A 4JFLA 1KT1A 2RQSA 4IQ2A 1Q6HA 3IHZA 4QIBA 1FKKA 3ODKA 1EQ3A 4C02B 2XP6A 3B7XA 1J6YA 1FKTA 4N19A 1T11A 2XP3A 3IKDA 5HW7A 4BF8A 3JXVA 3LUOA 4LAVA 4GIVA 4DRJA 3KAIA 5HUAA 2Q5AA 5B8IC 1EYMA 1PBKA 2LGOA 1D7HA 4DIPA 5HW8A 3I6CA 1J4RA 1FKBA 4J4NA 4W9QA 2PPNA 1FKLA 4FAPA 3O5IA 2KR7A 3UI5A 2JZVA 2MF9A 2DG9A 1L1PA 2MLXA 2F4EA 3O5DA 1YATA 4LAWA 3NI6A 1FKFA 1FKJA 4JFMA 2OFNA 1QPFA 5D75A 2ZQUA 4DRKA 1JNTA 2DG4A 5HKGA 3UQAA 3FAPA 2XP5A 3GPKA 4TNSA 3CGMA 1D6OA 3EY6A 3PRBA 4GGQA 2PPPA 2KI3A 1B6CA 2MPHA 2PV1A 3JYMA 5J6EA 3TCZA 1R9HA 2RUQA 3JYJA 1PINA 5GPGA 5HT1A 5HW6A 1QPLA 4G2PA 2PV3A 2XPAA 5DIVA 2M08A 4DRMA 3KAFA 1ZCNA 3KAGA 3O5OA 4IPXA 1Y0OA 3KADA 5DITA 3UI6A 4ODNA 1P5QA 2KGJA 1YW5A 2ZQSA 3UQIA 3WH0A 1BKFA 3PA7A 1FKRA 1FKDA 2LPVA 2MNTA 1Q6UA 4NNRA 4R0XA 1W26A 3O5KA 2RSEA 1J4HA 3NTPA 3PRDA 4J4OA 4TYOA 3KZ7A 1NMVA 2N87A 4JFKA 1F40A 4MGVA 4W9OA 5I98A 4LAXA 5HWBA 4DRHA 2ITKA 2UZ5A 3KCEA 4U84A 2M2AA 4G50A 4DT4A 3KACA 3OOBA 3O5LA 2FAPA 1JVWA 1HXVA 4JFIA 2RUCA 2ZR5A 1FKGA 3H9RB 2MLZA 2F2DA 2RURA 2KE0A 2MLYA 4ODKA 4ODLA 3O5QA 1FAPA 2VCDA 4DZ3A 2LKNA 3O5MA
chains in the Genus database with same CATH superfamily
2PV2A 3CH9A 2LJ4A 4IT6A 4Q7NA 4JFJA 3VAWA 4ODQA 2AWGA 1GPFA 1IX5A 2PPOA 1HJWA 3O5JA 1QZ2A 1ZBVA 1HJXA 3OA5A 1FKHA 2M1IA 2ZQTA 1J4IA 3MDYB 1ROUA 4IQCA 3CHEA 3RFWA 3UF8A 1E6PA 1F8AB 2IF4A 4TW6A 4ODMA 1FKIA 4DRIA 5BXJA 4KR0B 2DG3A 4ZPWR 2RQSA 4IQ2A 2AOSA 3IHZA 4P8WA 1EQ3A 4C02B 3B7XA 4Z2IA 3IKDA 5HW7A 4GIVA 1LG2A 3CHDA 3AQUA 1EYMA 2ESCA 4DIPA 1D7HA 2WM0A 1GOIA 3WD2A 4WIWA 1E15A 4J4NA 4W9QA 2A3BA 5DEZA 4UDMA 2MLXA 3O5DA 2WK2A 1JNTA 1WB0A 1X6LA 4WJXA 1JNEA 5HKGA 2XP5A 4LGXA 3CGMA 1D6OA 4S3JA 2PV1A 3B9AA 3B9EA 1HKIA 1R9HA 3JYJA 5HT1A 4XAKA 2XPAA 2YBTA 1ZCNA 3O5OA 4IPXA 3UI6A 5DITA 4Z2HA 4ODNA 1P5QA 3UQIA 2MNTA 1Q6UA 4R0XA 3PRDA 1W26A 1J4HA 4MAVA 1NMVA 4JFKA 4LAXA 5HWBA 2UZ5A 1VF8A 1JCHB 2M2AA 4G50A 4DT4A 3KACA 2FAPA 2ZR5A 1FKGA 5GQBA 2MLZA 1SYTA 4ODLA 1FAPA 2VCDA 3CHFA 2LKNA 3NRKA 1C9HA 2XP9A 1HKMA 2KFWA 1TCOC 1M5YA 1XHGA 1W1VA 1FFQA 2B5UB 1BL4A 4WK9A 5HTGA 1OWQA 2PBCA 1ZK6A 2DT3A 3CZ8A 3ALFA 1ZBWA 1D7IA 1UR8A 4MNKA 1NWUA 1Q1CA 3IK8A 3RM8A 2VN1A 4W9PA 1HJVA 2FKEA 1N1AA 4TX0A 2IUZA 5GPRA 3WQWA 2L2SA 4QT2A 1JNSA 1NMWA 1A7XA 1WNOA 3TDBA 3TC5A 3O5GA 2O92A 1HKJA 1KT1A 1Q6HA 3BXWA 3ODKA 4Z2LA 2XP6A 1H0GA 1NWTA 1JNDA 4BF8A 4HBEA 2QF8A 3JXVA 4ML4A 3ALGA 3KAIA 5HUAA 3GU0A 3RMEA 1PBKA 3I6CA 4P8UA 5DO2A 3WD0A 1FKLA 3O5IA 3UI5A 3BMBA 1L1PA 1W1TA 2DPEA 1TFVA 3ARTA 4DRKA 4MPKA 3GPKA 1K9TA 4JFIA 3EY6A 3PRBA 3JYMA 1B6CA 2MPHA 3TCZA 2F23A 5HW6A 1QPLA 2PV3A 2DSWA 4L3NA 4WKAA 1YW5A 2PI6A 2G8ZA 1X6NA 4S3KA 1FKRA 2YBUA 2RSEA 4J4OA 2N87A 4DWSA 3WL1A 4W9OA 3WD1A 5I98A 4DRHA 4U84A 4MNLA 3O5LA 2B31A 1E6ZA 1GUVA 2RUCA 3H9RB 1OGGA 3ARSA 1ZBCA 2A3EA 4DZ3A 3O5MA 1FJDA 3UQBA 3AROA 3PRAA 1D7JA 4TW7A 4ODPA 2P4VA 1W9PA 4FN2A 1ZU8A 2XP8A 4O2TA 3CGNA 1EHNA 1E9LA 3UI4A 1FKSA 1EDQA 2OLHA 5HWCA 3WD3A 1U79A 3EIPA 1D2KA 4Q22A 4U86A 3KAHA 4DRPA 4AY1A 2Y78A 1SR0A 1Q6IA 2K8IA 1E6RA 2F21A 2RUDA 1ZBKA 3ARWA 1NH6A 1UR9A 4QT3A 4MSPA 4P8XA 4DRNA 1NSGA 4DH0A 3O5FA 4LAYA 2WLZA 1FD9A 4JFLA 4QIBA 3RM9A 1E6NA 1E44A 1NWRA 1FKTA 3G6MA 1T11A 2DSZA 4LAVA 4WKFA 1W1PA 1LL7A 2Q5AA 1ITXA 4MTVA 3ARVA 1KFWA 1EIBA 1LL4A 1J4RA 4HARA 1GRJA 2PPNA 5JH8A 4FAPA 3GTYX 2MF9A 4W5UA 2F4EA 3NI6A 1ZB5A 1FKJA 2OFNA 4MNMA 2EULA 3ARUA 2DG4A 4IT4A 5HBFA 3WQVA 4HBOA 1NWSA 5DIVA 3KAFA 3KAGA 4ZPTR 1RD6A 3WH0A 3PA7A 1LG1A 1FKDA 2LPVA 3O5KA 3G6LA 3AS3A 3NTPA 1F40A 4MGVA 4MNJA 1OGBA 3KCEA 3ARZA 3OOBA 1LJYA 2F2DA 2RURA 1LL6A 2KE0A 3ARYA 4ODKA 4Z2KA 3B9DA 1W1YA 4ODOA 2ZR4A 2XP4A 3B8SA 2DT0A 4DRQA 3RGCA 3FXYA 3RM4A 4KQZA 2ZR6A 4ZPVR 2FDMA 1KT0A 1W9VA 4P8VA 4ODRA 2WLYA 2A3AA 4DROA 4DZ2A 4TW8A 5DF0A 2KO7A 4NZCA 4DWSB 3IKGA 2XPBA 1XRVA 2PN0A 4U85A 4ITZA 4URIA 3O5RA 2XP7A 2A3CA 1ZL1A 1FFRA 4JYSA 5DIUA 3ARQA 2DT1A 3O5PA 3O5EA 1ROTA 4QZVB 2O9OA 2D9FA 2ZQVA 3KABA 3WIJA 4DWSC 1FKKA 1WAWA 1J6YA 3WKZA 4N19A 2XP3A 3LUOA 4DRJA 4ZS6A 3CHCA 3ARPA 5B8IC 5HW8A 2LGOA 3PR9A 1CTNA 2DSVA 1H0IA 1FKBA 2ETNA 3WD4A 3QOKA 2KR7A 2JZVA 2DG9A 4NSBA 1YATA 4R5EA 2G41A 4LAWA 4WKHA 1FKFA 4JFMA 2DT2A 1QPFA 5D75A 2ZQUA 3UQAA 3FAPA 4PTMA 3WL0A 4TNSA 4GGQA 2PPPA 2KI3A 3ARXA 5J6EA 2RUQA 5GPGA 1PINA 4G2PA 4DRMA 2M08A 3FY1A 1Y0OA 3KADA 2KGJA 2ZQSA 1HKKA 1BKFA 4NNRA 4TYOA 1O6IA 2DSUA 3KZ7A 3AS2A 1W9UA 2ITKA 4Z2JA 3AS0A 1JVWA 4Z2GA 4DWSD 1HXVA 3W4RA 3ARRA 2MLYA 3O5QA 3AS1A 1LQ0A 4L72B
chains in the Genus database with same CATH topology
2PV2A 3CH9A 2LJ4A 4IT6A 4Q7NA 4JFJA 3VAWA 4ODQA 2AWGA 1GPFA 1IX5A 2PPOA 1HJWA 3O5JA 1QZ2A 1ZBVA 1HJXA 3OA5A 1FKHA 2M1IA 2ZQTA 1J4IA 3MDYB 1ROUA 4IQCA 3CHEA 3RFWA 3UF8A 1E6PA 1F8AB 2IF4A 4TW6A 4ODMA 1FKIA 4DRIA 5BXJA 4KR0B 2DG3A 4ZPWR 2RQSA 4IQ2A 2AOSA 3IHZA 4P8WA 1EQ3A 4C02B 3B7XA 4Z2IA 3IKDA 5HW7A 4GIVA 1LG2A 3CHDA 3AQUA 1EYMA 2ESCA 4DIPA 1D7HA 2WM0A 1GOIA 3WD2A 4WIWA 1E15A 4J4NA 4W9QA 2A3BA 5DEZA 2MLXA 3O5DA 2WK2A 1JNTA 1WB0A 1X6LA 4WJXA 1JNEA 5HKGA 2XP5A 4LGXA 3CGMA 1D6OA 4S3JA 2PV1A 3B9AA 3B9EA 1HKIA 1R9HA 3JYJA 5HT1A 4XAKA 2XPAA 2YBTA 1ZCNA 3O5OA 4IPXA 3UI6A 5DITA 4Z2HA 4ODNA 1P5QA 3UQIA 2MNTA 1Q6UA 4R0XA 3PRDA 1W26A 1J4HA 4MAVA 1NMVA 4JFKA 4LAXA 5HWBA 2UZ5A 1VF8A 4DT4A 2M2AA 4G50A 3KACA 2FAPA 2ZR5A 1FKGA 5GQBA 2MLZA 1SYTA 4ODLA 1FAPA 2VCDA 3CHFA 2LKNA 3NRKA 1C9HA 2XP9A 1HKMA 2KFWA 1TCOC 1M5YA 1XHGA 1W1VA 1FFQA 1BL4A 4WK9A 5HTGA 1OWQA 2PBCA 1ZK6A 2DT3A 3CZ8A 3ALFA 1ZBWA 1D7IA 1UR8A 4MNKA 1NWUA 1Q1CA 3IK8A 3RM8A 2VN1A 4W9PA 1HJVA 2FKEA 1N1AA 4TX0A 2IUZA 5GPRA 3WQWA 2L2SA 4QT2A 1JNSA 1NMWA 1A7XA 1WNOA 3TDBA 3TC5A 3O5GA 2O92A 1HKJA 1KT1A 1Q6HA 3BXWA 3ODKA 4Z2LA 2XP6A 1H0GA 1NWTA 1JNDA 4BF8A 4HBEA 2QF8A 3JXVA 4ML4A 3ALGA 3KAIA 5HUAA 3RMEA 1PBKA 3I6CA 4P8UA 5DO2A 3WD0A 1FKLA 3O5IA 3UI5A 1L1PA 1W1TA 2DPEA 1TFVA 3ARTA 4DRKA 4MPKA 3GPKA 1K9TA 4JFIA 3EY6A 3PRBA 3JYMA 1B6CA 2MPHA 3TCZA 5HW6A 1QPLA 2PV3A 2DSWA 4L3NA 4WKAA 1YW5A 2PI6A 2G8ZA 1X6NA 4S3KA 1FKRA 2YBUA 2RSEA 4J4OA 2N87A 4DWSA 3WL1A 4W9OA 3WD1A 5I98A 4DRHA 4U84A 4MNLA 3O5LA 2B31A 1E6ZA 1GUVA 2RUCA 3H9RB 1OGGA 3ARSA 1ZBCA 2A3EA 4DZ3A 3O5MA 1FJDA 3UQBA 3AROA 3PRAA 1D7JA 4TW7A 4ODPA 1W9PA 4FN2A 1ZU8A 2XP8A 4O2TA 3CGNA 1EHNA 1E9LA 3UI4A 1FKSA 1EDQA 2OLHA 5HWCA 3WD3A 1U79A 1D2KA 4Q22A 4U86A 3KAHA 4DRPA 4AY1A 2Y78A 1SR0A 1Q6IA 2K8IA 1E6RA 2F21A 2RUDA 1ZBKA 3ARWA 1NH6A 1UR9A 4QT3A 4MSPA 4P8XA 4DRNA 1NSGA 4DH0A 3O5FA 4LAYA 2WLZA 1FD9A 4JFLA 4QIBA 3RM9A 1E6NA 1NWRA 1FKTA 3G6MA 1T11A 2DSZA 4LAVA 4WKFA 1W1PA 1LL7A 2Q5AA 1ITXA 4MTVA 3ARVA 1KFWA 1EIBA 1LL4A 1J4RA 4HARA 2PPNA 5JH8A 4FAPA 2MF9A 4W5UA 2F4EA 3NI6A 1ZB5A 1FKJA 2OFNA 4MNMA 3ARUA 2DG4A 4IT4A 5HBFA 3WQVA 4HBOA 1NWSA 5DIVA 3KAFA 3KAGA 4ZPTR 1RD6A 3WH0A 3PA7A 1LG1A 1FKDA 2LPVA 3O5KA 3G6LA 3AS3A 3NTPA 1F40A 4MGVA 4MNJA 1OGBA 3KCEA 3ARZA 3OOBA 1LJYA 2F2DA 2RURA 1LL6A 2KE0A 3ARYA 4ODKA 4Z2KA 3B9DA 1W1YA 4ODOA 2ZR4A 2XP4A 3B8SA 2DT0A 4DRQA 3RGCA 3FXYA 3RM4A 4KQZA 2ZR6A 4ZPVR 2FDMA 1KT0A 1W9VA 4P8VA 4ODRA 2WLYA 2A3AA 4DROA 4DZ2A 4TW8A 5DF0A 2KO7A 4NZCA 4DWSB 3IKGA 2XPBA 1XRVA 4U85A 4ITZA 4URIA 3O5RA 2XP7A 2A3CA 1ZL1A 1FFRA 4JYSA 5DIUA 3ARQA 2DT1A 3O5PA 3O5EA 1ROTA 4QZVB 2O9OA 2D9FA 2ZQVA 3KABA 3WIJA 4DWSC 1FKKA 1WAWA 1J6YA 3WKZA 4N19A 2XP3A 3LUOA 4DRJA 4ZS6A 3CHCA 3ARPA 5B8IC 5HW8A 2LGOA 3PR9A 1CTNA 2DSVA 1H0IA 1FKBA 3WD4A 3QOKA 2KR7A 2JZVA 2DG9A 4NSBA 1YATA 4R5EA 2G41A 4LAWA 4WKHA 1FKFA 4JFMA 2DT2A 1QPFA 5D75A 2ZQUA 3UQAA 3FAPA 4PTMA 3WL0A 4TNSA 4GGQA 2PPPA 2KI3A 3ARXA 5J6EA 2RUQA 5GPGA 1PINA 4G2PA 4DRMA 2M08A 3FY1A 1Y0OA 3KADA 2KGJA 2ZQSA 1HKKA 1BKFA 4NNRA 4TYOA 1O6IA 2DSUA 3KZ7A 3AS2A 1W9UA 2ITKA 4Z2JA 3AS0A 1JVWA 4Z2GA 4DWSD 1HXVA 3W4RA 3ARRA 2MLYA 3O5QA 3AS1A 1LQ0A 4L72B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJD A;  3NRK A;  1C9H A;  2PV2 A;  4ODO A;  3UQB A;  2XP9 A;  1D7J A;  2ZR4 A;  4ODP A;  2KFW A;  1TCO C;  4TW7 A;  2XP4 A;  1M5Y A;  4FN2 A;  2LJ4 A;  3RGC A;  4DRQ A;  4JFJ A;  3VAW A;  4ODQ A;  2XP8 A;  4O2T A;  3CGN A;  1BL4 A;  5HTG A;  2AWG A;  2PBC A;  2ZR6 A;  3UI4 A;  1FKS A;  1KT0 A;  1ZK6 A;  2PPO A;  4ODR A;  5HWC A;  4DRO A;  4DZ2 A;  1U79 A;  3O5J A;  4TW8 A;  2KO7 A;  1QZ2 A;  1D7I A;  4U86 A;  1FKH A;  1Q1C A;  3IK8 A;  2VN1 A;  3IKG A;  2M1I A;  3KAH A;  2XPB A;  4DRP A;  2Y78 A;  4U85 A;  2ZQT A;  4ITZ A;  4W9P A;  1Q6I A;  1J4I A;  3MDY B;  1ROU A;  4IQC A;  3RFW A;  3O5R A;  2XP7 A;  2K8I A;  3UF8 A;  2RUD A;  2F21 A;  1F8A B;  2FKE A;  1N1A A;  2IF4 A;  4TX0 A;  4TW6 A;  4JYS A;  4ODM A;  5DIU A;  4QT3 A;  1FKI A;  4MSP A;  4DRN A;  4DRI A;  1NSG A;  2L2S A;  5BXJ A;  3O5P A;  4QT2 A;  1NMW A;  1A7X A;  3O5E A;  1ROT A;  4DH0 A;  1JNS A;  3TDB A;  2D9F A;  2ZQV A;  3O5F A;  4LAY A;  3O5G A;  2DG3 A;  3KAB A;  3TC5 A;  1FD9 A;  4JFL A;  1KT1 A;  2RQS A;  4IQ2 A;  1Q6H A;  3IHZ A;  4QIB A;  1FKK A;  3ODK A;  1EQ3 A;  4C02 B;  2XP6 A;  3B7X A;  1J6Y A;  1FKT A;  4N19 A;  1T11 A;  2XP3 A;  3IKD A;  5HW7 A;  4BF8 A;  3JXV A;  3LUO A;  4LAV A;  4GIV A;  4DRJ A;  3KAI A;  5HUA A;  2Q5A A;  5B8I C;  1EYM A;  1PBK A;  2LGO A;  1D7H A;  4DIP A;  5HW8 A;  3I6C A;  1J4R A;  1FKB A;  4J4N A;  4W9Q A;  2PPN A;  1FKL A;  4FAP A;  3O5I A;  2KR7 A;  3UI5 A;  2JZV A;  2MF9 A;  2DG9 A;  1L1P A;  2MLX A;  2F4E A;  3O5D A;  1YAT A;  4LAW A;  3NI6 A;  1FKF A;  1FKJ A;  4JFM A;  2OFN A;  1QPF A;  5D75 A;  2ZQU A;  4DRK A;  1JNT A;  2DG4 A;  5HKG A;  3UQA A;  3FAP A;  2XP5 A;  3GPK A;  4TNS A;  3CGM A;  1D6O A;  3EY6 A;  3PRB A;  4GGQ A;  2PPP A;  2KI3 A;  1B6C A;  2MPH A;  2PV1 A;  3JYM A;  5J6E A;  3TCZ A;  1R9H A;  2RUQ A;  3JYJ A;  1PIN A;  5GPG A;  5HT1 A;  5HW6 A;  1QPL A;  4G2P A;  2PV3 A;  2XPA A;  5DIV A;  2M08 A;  4DRM A;  3KAF A;  1ZCN A;  3KAG A;  3O5O A;  4IPX A;  1Y0O A;  3KAD A;  5DIT A;  3UI6 A;  4ODN A;  1P5Q A;  2KGJ A;  1YW5 A;  2ZQS A;  3UQI A;  3WH0 A;  1BKF A;  3PA7 A;  1FKR A;  1FKD A;  2LPV A;  2MNT A;  1Q6U A;  4NNR A;  4R0X A;  1W26 A;  3O5K A;  2RSE A;  1J4H A;  3NTP A;  3PRD A;  4J4O A;  4TYO A;  3KZ7 A;  1NMV A;  2N87 A;  4JFK A;  1F40 A;  4MGV A;  4W9O A;  5I98 A;  4LAX A;  5HWB A;  4DRH A;  2ITK A;  2UZ5 A;  3KCE A;  4U84 A;  2M2A A;  4G50 A;  4DT4 A;  3KAC A;  3OOB A;  3O5L A;  2FAP A;  1JVW A;  1HXV A;  4JFI A;  2RUC A;  2ZR5 A;  1FKG A;  3H9R B;  2MLZ A;  2F2D A;  2RUR A;  2KE0 A;  2MLY A;  4ODK A;  4ODL A;  3O5Q A;  1FAP A;  2VCD A;  4DZ3 A;  2LKN A;  3O5M A; 
#chains in the Genus database with same CATH topology
 2PV2 A;  3CH9 A;  2LJ4 A;  4IT6 A;  4Q7N A;  4JFJ A;  3VAW A;  4ODQ A;  2AWG A;  1GPF A;  1IX5 A;  2PPO A;  1HJW A;  3O5J A;  1QZ2 A;  1ZBV A;  1HJX A;  3OA5 A;  1FKH A;  2M1I A;  2ZQT A;  1J4I A;  3MDY B;  1ROU A;  4IQC A;  3CHE A;  3RFW A;  3UF8 A;  1E6P A;  1F8A B;  2IF4 A;  4TW6 A;  4ODM A;  1FKI A;  4DRI A;  5BXJ A;  4KR0 B;  2DG3 A;  4ZPW R;  2RQS A;  4IQ2 A;  2AOS A;  3IHZ A;  4P8W A;  1EQ3 A;  4C02 B;  3B7X A;  4Z2I A;  3IKD A;  5HW7 A;  4GIV A;  1LG2 A;  3CHD A;  3AQU A;  1EYM A;  2ESC A;  4DIP A;  1D7H A;  2WM0 A;  1GOI A;  3WD2 A;  4WIW A;  1E15 A;  4J4N A;  4W9Q A;  2A3B A;  5DEZ A;  4UDM A;  2MLX A;  3O5D A;  2WK2 A;  1JNT A;  1WB0 A;  1X6L A;  4WJX A;  1JNE A;  5HKG A;  2XP5 A;  4LGX A;  3CGM A;  1D6O A;  4S3J A;  2PV1 A;  3B9A A;  3B9E A;  1HKI A;  1R9H A;  3JYJ A;  5HT1 A;  4XAK A;  2XPA A;  2YBT A;  1ZCN A;  3O5O A;  4IPX A;  3UI6 A;  5DIT A;  4Z2H A;  4ODN A;  1P5Q A;  3UQI A;  2MNT A;  1Q6U A;  4R0X A;  3PRD A;  1W26 A;  1J4H A;  4MAV A;  1NMV A;  4JFK A;  4LAX A;  5HWB A;  2UZ5 A;  1VF8 A;  1JCH B;  2M2A A;  4G50 A;  4DT4 A;  3KAC A;  2FAP A;  2ZR5 A;  1FKG A;  5GQB A;  2MLZ A;  1SYT A;  4ODL A;  1FAP A;  2VCD A;  3CHF A;  2LKN A;  3NRK A;  1C9H A;  2XP9 A;  1HKM A;  2KFW A;  1TCO C;  1M5Y A;  1XHG A;  1W1V A;  1FFQ A;  2B5U B;  1BL4 A;  4WK9 A;  5HTG A;  1OWQ A;  2PBC A;  1ZK6 A;  2DT3 A;  3CZ8 A;  3ALF A;  1ZBW A;  1D7I A;  1UR8 A;  4MNK A;  1NWU A;  1Q1C A;  3IK8 A;  3RM8 A;  2VN1 A;  4W9P A;  1HJV A;  2FKE A;  1N1A A;  4TX0 A;  2IUZ A;  5GPR A;  3WQW A;  2L2S A;  4QT2 A;  1JNS A;  1NMW A;  1A7X A;  1WNO A;  3TDB A;  3TC5 A;  3O5G A;  2O92 A;  1HKJ A;  1KT1 A;  1Q6H A;  3BXW A;  3ODK A;  4Z2L A;  2XP6 A;  1H0G A;  1NWT A;  1JND A;  4BF8 A;  4HBE A;  2QF8 A;  3JXV A;  4ML4 A;  3ALG A;  3KAI A;  5HUA A;  3GU0 A;  3RME A;  1PBK A;  3I6C A;  4P8U A;  5DO2 A;  3WD0 A;  1FKL A;  3O5I A;  3UI5 A;  3BMB A;  1L1P A;  1W1T A;  2DPE A;  1TFV A;  3ART A;  4DRK A;  4MPK A;  3GPK A;  1K9T A;  4JFI A;  3EY6 A;  3PRB A;  3JYM A;  1B6C A;  2MPH A;  3TCZ A;  2F23 A;  5HW6 A;  1QPL A;  2PV3 A;  2DSW A;  4L3N A;  4WKA A;  1YW5 A;  2PI6 A;  2G8Z A;  1X6N A;  4S3K A;  1FKR A;  2YBU A;  2RSE A;  4J4O A;  2N87 A;  4DWS A;  3WL1 A;  4W9O A;  3WD1 A;  5I98 A;  4DRH A;  4U84 A;  4MNL A;  3O5L A;  2B31 A;  1E6Z A;  1GUV A;  2RUC A;  3H9R B;  1OGG A;  3ARS A;  1ZBC A;  2A3E A;  4DZ3 A;  3O5M A;  1FJD A;  3UQB A;  3ARO A;  3PRA A;  1D7J A;  4TW7 A;  4ODP A;  2P4V A;  1W9P A;  4FN2 A;  1ZU8 A;  2XP8 A;  4O2T A;  3CGN A;  1EHN A;  1E9L A;  3UI4 A;  1FKS A;  1EDQ A;  2OLH A;  5HWC A;  3WD3 A;  1U79 A;  3EIP A;  1D2K A;  4Q22 A;  4U86 A;  3KAH A;  4DRP A;  4AY1 A;  2Y78 A;  1SR0 A;  1Q6I A;  2K8I A;  1E6R A;  2F21 A;  2RUD A;  1ZBK A;  3ARW A;  1NH6 A;  1UR9 A;  4QT3 A;  4MSP A;  4P8X A;  4DRN A;  1NSG A;  4DH0 A;  3O5F A;  4LAY A;  2WLZ A;  1FD9 A;  4JFL A;  4QIB A;  3RM9 A;  1E6N A;  1E44 A;  1NWR A;  1FKT A;  3G6M A;  1T11 A;  2DSZ A;  4LAV A;  4WKF A;  1W1P A;  1LL7 A;  2Q5A A;  1ITX A;  4MTV A;  3ARV A;  1KFW A;  1EIB A;  1LL4 A;  1J4R A;  4HAR A;  1GRJ A;  2PPN A;  5JH8 A;  4FAP A;  3GTY X;  2MF9 A;  4W5U A;  2F4E A;  3NI6 A;  1ZB5 A;  1FKJ A;  2OFN A;  4MNM A;  2EUL A;  3ARU A;  2DG4 A;  4IT4 A;  5HBF A;  3WQV A;  4HBO A;  1NWS A;  5DIV A;  3KAF A;  3KAG A;  4ZPT R;  1RD6 A;  3WH0 A;  3PA7 A;  1LG1 A;  1FKD A;  2LPV A;  3O5K A;  3G6L A;  3AS3 A;  3NTP A;  1F40 A;  4MGV A;  4MNJ A;  1OGB A;  3KCE A;  3ARZ A;  3OOB A;  1LJY A;  2F2D A;  2RUR A;  1LL6 A;  2KE0 A;  3ARY A;  4ODK A;  4Z2K A;  3B9D A;  1W1Y A;  4ODO A;  2ZR4 A;  2XP4 A;  3B8S A;  2DT0 A;  4DRQ A;  3RGC A;  3FXY A;  3RM4 A;  4KQZ A;  2ZR6 A;  4ZPV R;  2FDM A;  1KT0 A;  1W9V A;  4P8V A;  4ODR A;  2WLY A;  2A3A A;  4DRO A;  4DZ2 A;  4TW8 A;  5DF0 A;  2KO7 A;  4NZC A;  4DWS B;  3IKG A;  2XPB A;  1XRV A;  2PN0 A;  4U85 A;  4ITZ A;  4URI A;  3O5R A;  2XP7 A;  2A3C A;  1ZL1 A;  1FFR A;  4JYS A;  5DIU A;  3ARQ A;  2DT1 A;  3O5P A;  3O5E A;  1ROT A;  4QZV B;  2O9O A;  2D9F A;  2ZQV A;  3KAB A;  3WIJ A;  4DWS C;  1FKK A;  1WAW A;  1J6Y A;  3WKZ A;  4N19 A;  2XP3 A;  3LUO A;  4DRJ A;  4ZS6 A;  3CHC A;  3ARP A;  5B8I C;  5HW8 A;  2LGO A;  3PR9 A;  1CTN A;  2DSV A;  1H0I A;  1FKB A;  2ETN A;  3WD4 A;  3QOK A;  2KR7 A;  2JZV A;  2DG9 A;  4NSB A;  1YAT A;  4R5E A;  2G41 A;  4LAW A;  4WKH A;  1FKF A;  4JFM A;  2DT2 A;  1QPF A;  5D75 A;  2ZQU A;  3UQA A;  3FAP A;  4PTM A;  3WL0 A;  4TNS A;  4GGQ A;  2PPP A;  2KI3 A;  3ARX A;  5J6E A;  2RUQ A;  5GPG A;  1PIN A;  4G2P A;  4DRM A;  2M08 A;  3FY1 A;  1Y0O A;  3KAD A;  2KGJ A;  2ZQS A;  1HKK A;  1BKF A;  4NNR A;  4TYO A;  1O6I A;  2DSU A;  3KZ7 A;  3AS2 A;  1W9U A;  2ITK A;  4Z2J A;  3AS0 A;  1JVW A;  4Z2G A;  4DWS D;  1HXV A;  3W4R A;  3ARR A;  2MLY A;  3O5Q A;  3AS1 A;  1LQ0 A;  4L72 B; 
#chains in the Genus database with same CATH homology
 2PV2 A;  3CH9 A;  2LJ4 A;  4IT6 A;  4Q7N A;  4JFJ A;  3VAW A;  4ODQ A;  2AWG A;  1GPF A;  1IX5 A;  2PPO A;  1HJW A;  3O5J A;  1QZ2 A;  1ZBV A;  1HJX A;  3OA5 A;  1FKH A;  2M1I A;  2ZQT A;  1J4I A;  3MDY B;  1ROU A;  4IQC A;  3CHE A;  3RFW A;  3UF8 A;  1E6P A;  1F8A B;  2IF4 A;  4TW6 A;  4ODM A;  1FKI A;  4DRI A;  5BXJ A;  4KR0 B;  2DG3 A;  4ZPW R;  2RQS A;  4IQ2 A;  2AOS A;  3IHZ A;  4P8W A;  1EQ3 A;  4C02 B;  3B7X A;  4Z2I A;  3IKD A;  5HW7 A;  4GIV A;  1LG2 A;  3CHD A;  3AQU A;  1EYM A;  2ESC A;  4DIP A;  1D7H A;  2WM0 A;  1GOI A;  3WD2 A;  4WIW A;  1E15 A;  4J4N A;  4W9Q A;  2A3B A;  5DEZ A;  2MLX A;  3O5D A;  2WK2 A;  1JNT A;  1WB0 A;  1X6L A;  4WJX A;  1JNE A;  5HKG A;  2XP5 A;  4LGX A;  3CGM A;  1D6O A;  4S3J A;  2PV1 A;  3B9A A;  3B9E A;  1HKI A;  1R9H A;  3JYJ A;  5HT1 A;  4XAK A;  2XPA A;  2YBT A;  1ZCN A;  3O5O A;  4IPX A;  3UI6 A;  5DIT A;  4Z2H A;  4ODN A;  1P5Q A;  3UQI A;  2MNT A;  1Q6U A;  4R0X A;  3PRD A;  1W26 A;  1J4H A;  4MAV A;  1NMV A;  4JFK A;  4LAX A;  5HWB A;  2UZ5 A;  1VF8 A;  4DT4 A;  2M2A A;  4G50 A;  3KAC A;  2FAP A;  2ZR5 A;  1FKG A;  5GQB A;  2MLZ A;  1SYT A;  4ODL A;  1FAP A;  2VCD A;  3CHF A;  2LKN A;  3NRK A;  1C9H A;  2XP9 A;  1HKM A;  2KFW A;  1TCO C;  1M5Y A;  1XHG A;  1W1V A;  1FFQ A;  1BL4 A;  4WK9 A;  5HTG A;  1OWQ A;  2PBC A;  1ZK6 A;  2DT3 A;  3CZ8 A;  3ALF A;  1ZBW A;  1D7I A;  1UR8 A;  4MNK A;  1NWU A;  1Q1C A;  3IK8 A;  3RM8 A;  2VN1 A;  4W9P A;  1HJV A;  2FKE A;  1N1A A;  4TX0 A;  2IUZ A;  5GPR A;  3WQW A;  2L2S A;  4QT2 A;  1JNS A;  1NMW A;  1A7X A;  1WNO A;  3TDB A;  3TC5 A;  3O5G A;  2O92 A;  1HKJ A;  1KT1 A;  1Q6H A;  3BXW A;  3ODK A;  4Z2L A;  2XP6 A;  1H0G A;  1NWT A;  1JND A;  4BF8 A;  4HBE A;  2QF8 A;  3JXV A;  4ML4 A;  3ALG A;  3KAI A;  5HUA A;  3RME A;  1PBK A;  3I6C A;  4P8U A;  5DO2 A;  3WD0 A;  1FKL A;  3O5I A;  3UI5 A;  1L1P A;  1W1T A;  2DPE A;  1TFV A;  3ART A;  4DRK A;  4MPK A;  3GPK A;  1K9T A;  4JFI A;  3EY6 A;  3PRB A;  3JYM A;  1B6C A;  2MPH A;  3TCZ A;  5HW6 A;  1QPL A;  2PV3 A;  2DSW A;  4L3N A;  4WKA A;  1YW5 A;  2PI6 A;  2G8Z A;  1X6N A;  4S3K A;  1FKR A;  2YBU A;  2RSE A;  4J4O A;  2N87 A;  4DWS A;  3WL1 A;  4W9O A;  3WD1 A;  5I98 A;  4DRH A;  4U84 A;  4MNL A;  3O5L A;  2B31 A;  1E6Z A;  1GUV A;  2RUC A;  3H9R B;  1OGG A;  3ARS A;  1ZBC A;  2A3E A;  4DZ3 A;  3O5M A;  1FJD A;  3UQB A;  3ARO A;  3PRA A;  1D7J A;  4TW7 A;  4ODP A;  1W9P A;  4FN2 A;  1ZU8 A;  2XP8 A;  4O2T A;  3CGN A;  1EHN A;  1E9L A;  3UI4 A;  1FKS A;  1EDQ A;  2OLH A;  5HWC A;  3WD3 A;  1U79 A;  1D2K A;  4Q22 A;  4U86 A;  3KAH A;  4DRP A;  4AY1 A;  2Y78 A;  1SR0 A;  1Q6I A;  2K8I A;  1E6R A;  2F21 A;  2RUD A;  1ZBK A;  3ARW A;  1NH6 A;  1UR9 A;  4QT3 A;  4MSP A;  4P8X A;  4DRN A;  1NSG A;  4DH0 A;  3O5F A;  4LAY A;  2WLZ A;  1FD9 A;  4JFL A;  4QIB A;  3RM9 A;  1E6N A;  1NWR A;  1FKT A;  3G6M A;  1T11 A;  2DSZ A;  4LAV A;  4WKF A;  1W1P A;  1LL7 A;  2Q5A A;  1ITX A;  4MTV A;  3ARV A;  1KFW A;  1EIB A;  1LL4 A;  1J4R A;  4HAR A;  2PPN A;  5JH8 A;  4FAP A;  2MF9 A;  4W5U A;  2F4E A;  3NI6 A;  1ZB5 A;  1FKJ A;  2OFN A;  4MNM A;  3ARU A;  2DG4 A;  4IT4 A;  5HBF A;  3WQV A;  4HBO A;  1NWS A;  5DIV A;  3KAF A;  3KAG A;  4ZPT R;  1RD6 A;  3WH0 A;  3PA7 A;  1LG1 A;  1FKD A;  2LPV A;  3O5K A;  3G6L A;  3AS3 A;  3NTP A;  1F40 A;  4MGV A;  4MNJ A;  1OGB A;  3KCE A;  3ARZ A;  3OOB A;  1LJY A;  2F2D A;  2RUR A;  1LL6 A;  2KE0 A;  3ARY A;  4ODK A;  4Z2K A;  3B9D A;  1W1Y A;  4ODO A;  2ZR4 A;  2XP4 A;  3B8S A;  2DT0 A;  4DRQ A;  3RGC A;  3FXY A;  3RM4 A;  4KQZ A;  2ZR6 A;  4ZPV R;  2FDM A;  1KT0 A;  1W9V A;  4P8V A;  4ODR A;  2WLY A;  2A3A A;  4DRO A;  4DZ2 A;  4TW8 A;  5DF0 A;  2KO7 A;  4NZC A;  4DWS B;  3IKG A;  2XPB A;  1XRV A;  4U85 A;  4ITZ A;  4URI A;  3O5R A;  2XP7 A;  2A3C A;  1ZL1 A;  1FFR A;  4JYS A;  5DIU A;  3ARQ A;  2DT1 A;  3O5P A;  3O5E A;  1ROT A;  4QZV B;  2O9O A;  2D9F A;  2ZQV A;  3KAB A;  3WIJ A;  4DWS C;  1FKK A;  1WAW A;  1J6Y A;  3WKZ A;  4N19 A;  2XP3 A;  3LUO A;  4DRJ A;  4ZS6 A;  3CHC A;  3ARP A;  5B8I C;  5HW8 A;  2LGO A;  3PR9 A;  1CTN A;  2DSV A;  1H0I A;  1FKB A;  3WD4 A;  3QOK A;  2KR7 A;  2JZV A;  2DG9 A;  4NSB A;  1YAT A;  4R5E A;  2G41 A;  4LAW A;  4WKH A;  1FKF A;  4JFM A;  2DT2 A;  1QPF A;  5D75 A;  2ZQU A;  3UQA A;  3FAP A;  4PTM A;  3WL0 A;  4TNS A;  4GGQ A;  2PPP A;  2KI3 A;  3ARX A;  5J6E A;  2RUQ A;  5GPG A;  1PIN A;  4G2P A;  4DRM A;  2M08 A;  3FY1 A;  1Y0O A;  3KAD A;  2KGJ A;  2ZQS A;  1HKK A;  1BKF A;  4NNR A;  4TYO A;  1O6I A;  2DSU A;  3KZ7 A;  3AS2 A;  1W9U A;  2ITK A;  4Z2J A;  3AS0 A;  1JVW A;  4Z2G A;  4DWS D;  1HXV A;  3W4R A;  3ARR A;  2MLY A;  3O5Q A;  3AS1 A;  1LQ0 A;  4L72 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...