1TCOC

Ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKAGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PHOSPHATASE B2
publication title X-ray structure of calcineurin inhibited by the immunophilin-immunosuppressant FKBP12-FK506 complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Complex (hydrolase/isomerase)
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1tcoC00
3NI6A 3FAPA 3KADA 4DRMA 1FKBA 2KI3A 3JYMA 4DRKA 4ODMA 5HW6A 2XP6A 4QIBA 1FAPA 2DG4A 3KZ7A 3UI5A 3KAGA 2MF9A 3I6CA 1BL4A 1JVWA 2ZR5A 1J4RA 4DZ2A 2M08A 2MPHA 3IKDA 2JZVA 3O5EA 4LAWA 2OFNA 1Q6IA 4ODNA 1D7JA 1D7IA 1ZK6A 2RUDA 3CGNA 3PRDA 4JFJA 1U79A 4DROA 4NNRA 4J4OA 4TNSA 3UI4A 5HUAA 3KAHA 1PBKA 1JNSA 1D7HA 2MLZA 2AWGA 2L2SA 3O5OA 3PA7A 1Q1CA 1NSGA 4DRQA 5HKGA 4ODQA 2PPOA 1FKFA 3CGMA 2PV2A 3TDBA 1QPLA 4G2PA 5HWBA 2XP3A 3KAIA 4ODRA 1NMWA 2RURA 3UF8A 4R0XA 1Q6UA 1J6YA 3TC5A 1YATA 1FKSA 4QT2A 1C9HA 2PPNA 2KGJA 2DG9A 1FKIA 2ZQTA 4LAXA 2Y78A 4DIPA 5HW8A 4DRPA 1F40A 4TW6A 2RUQA 4IQ2A 3PRBA 4C02B 1D6OA 5B8IC 4J4NA 3O5LA 1KT0A 1N1AA 3O5MA 5DIUA 2ZQUA 4MSPA 1TCOC 4JFLA 4ITZA 2VCDA 4LAYA 3JYJA 2XP8A 3LUOA 4IPXA 3RGCA 4QT3A 3UQAA 2K8IA 3KACA 3O5RA 2VN1A 1FKKA 1FD9A 1W26A 3RFWA 3O5GA 1FKTA 4JYSA 3WH0A 1J4IA 1QPFA 2KR7A 4ODOA 3UI6A 2LKNA 3ODKA 2M2AA 4W9PA 4DRNA 2ZR6A 4DT4A 3KAFA 2FAPA 2XP4A 5GPGA 5HTGA 3O5KA 2FKEA 2PV1A 3IKGA 4JFMA 1ROTA 1FKRA 2PPPA 3IHZA 3NTPA 1FKDA 3O5FA 4GIVA 1EYMA 1M5YA 2LGOA 2PBCA 2RQSA 1BKFA 1FKGA 2F2DA 2XP7A 3JXVA 4DRJA 4TW8A 4FAPA 5D75A 1P5QA 4IQCA 3OOBA 4BF8A 4U84A 4GGQA 1B6CA 2XPBA 4JFIA 3H9RB 4N19A 3O5JA 2Q5AA 4W9OA 1A7XA 5J6EA 4MGVA 3GPKA 3EY6A 1FJDA 3KCEA 4O2TA 4ODPA 4DRHA 2F21A 3O5IA 4W9QA 5HW7A 1EQ3A 2IF4A 2F4EA 1FKJA 1FKHA 1F8AB 2MLXA 3NRKA 2RUCA 3TCZA 3UQIA 4ODLA 4FN2A 5DITA 4JFKA 2RSEA 2PV3A 4U85A 1YW5A 1JNTA 2ZR4A 5HWCA 3O5DA 2XPAA 3MDYB 2XP9A 4TX0A 1ZCNA 1J4HA 2KO7A 5BXJA 1L1PA 1R9HA 1T11A 2ZQSA 1QZ2A 1Q6HA 2D9FA 2N87A 3O5QA 1FKLA 4G50A 2KE0A 2XP5A 4U86A 5HT1A 4DRIA 1PINA 3KABA 2DG3A 2ITKA 2LPVA 1Y0OA 5I98A 2KFWA 2MLYA 2LJ4A 2ZQVA 1NMVA 1ROUA 2UZ5A 4TYOA 3VAWA 3UQBA 1HXVA 4TW7A 3O5PA 1KT1A 4DH0A 2M1IA 4LAVA 4ODKA 2MNTA 3IK8A 4DZ3A 3B7XA 5DIVA
chains in the Genus database with same CATH superfamily
3KADA 4Z2IA 4ODMA 3FXYA 3KAGA 2IUZA 1BL4A 1HKJA 1H0IA 2MPHA 4AY1A 3O5EA 4R5EA 2RUDA 4TNSA 4ZPWR 4Z2HA 5HUAA 3KAHA 1X6NA 2MLZA 1ZBWA 1NSGA 4PTMA 3RMEA 2DSWA 3CGMA 3ARVA 3TDBA 3KAIA 2RURA 2DPEA 2DT2A 1FKSA 1C9HA 2DG9A 1FKIA 5HW8A 3ALFA 4DRPA 3W4RA 4J4NA 2A3AA 1N1AA 2ZQUA 4LAYA 2A3BA 2VCDA 3AQUA 1E6NA 3B9AA 3ARPA 2K8IA 3KACA 2WM0A 1FKKA 1ZBCA 1SYTA 3RFWA 4HBOA 4JYSA 1WAWA 2LKNA 3B9DA 3ODKA 2QF8A 4DT4A 2FAPA 2XP4A 3IKGA 4JFMA 3ALGA 3WD0A 3IHZA 3O5FA 1X6LA 1L1PA 4ZS6A 2RQSA 1FJDA 1BKFA 1FKGA 4TW8A 5D75A 3OOBA 3ARQA 1FFRA 4DWSA 2G8ZA 4N19A 2XPBA 3ARSA 3H9RB 2P4VA 3ARYA 3BXWA 3KCEA 4O2TA 4Z2KA 4W9QA 1FKJA 4FN2A 1EHNA 1WB0A 5HWCA 4MTVA 1NH6A 3MDYB 2XP9A 2KO7A 5BXJA 1JNDA 1QZ2A 2N87A 4XAKA 3CHFA 2KE0A 4U86A 3RM9A 4DRIA 3KABA 2DG3A 1E6PA 2DT3A 2LPVA 1LJYA 2ZQVA 4P8VA 1NMVA 4MAVA 4TW7A 3AS0A 1KT1A 3O5PA 4URIA 4P8XA 1FKBA 2KI3A 4KR0B 5HW6A 2XP6A 1HKKA 4QIBA 3KZ7A 3UI5A 3CHCA 4HBEA 1JVWA 1E9LA 1E44A 1Q6IA 3G6LA 3ARXA 1D7JA 1ZK6A 3CGNA 1U79A 5DF0A 1O6IA 1JNSA 3WD3A 2AWGA 2O9OA 4DRQA 1IX5A 2PV2A 3WD4A 5HWBA 4HARA 1LL4A 1NMWA 3UF8A 1D2KA 1Q6UA 4QT2A 1W1TA 2WLZA 4LAXA 3ARUA 2ESCA 4DIPA 2Y78A 4WJXA 1F40A 5B8IC 4WIWA 2EULA 4MSPA 1TCOC 3WIJA 4ITZA 3RGCA 1ITXA 3LUOA 1LL7A 2DSUA 3UQAA 1LQ0A 3O5RA 2VN1A 4ZPVR 1W9PA 2KR7A 4ODOA 4Z2GA 3FY1A 2B31A 2M2AA 3WD2A 4S3JA 2ZR6A 3EIPA 4ZPTR 3WL1A 2PV1A 1EYMA 2PBCA 2F2DA 2F23A 1JCHB 4BF8A 1B6CA 4JFIA 1A7XA 2B5UB 4P8WA 1OGGA 2F21A 3O5IA 1EQ3A 1UR9A 2IF4A 1W9VA 3GTYX 4WKAA 1F8AB 3CZ8A 3UQIA 1K9TA 1ZBKA 2G41A 3BMBA 1FFQA 4MPKA 1ZCNA 2ZQSA 4G50A 5I98A 1HJXA 1Y0OA 1ZL1A 3G6MA 1ROUA 2UZ5A 3UQBA 4Z2JA 4ODKA 4DZ3A 3ARZA 5DIVA 3CH9A 3JYMA 2O92A 2MF9A 3I6CA 4UDMA 3IKDA 1LL6A 2OFNA 2ETNA 2OLHA 4P8UA 2DT1A 4NNRA 3B8SA 2WLYA 3UI4A 3PA7A 1Q1CA 3RM4A 2A3CA 5HKGA 4ODQA 1W1YA 4G2PA 2FDMA 1UR8A 1ZBVA 4ML4A 1J6YA 3TC5A 1YATA 2PPNA 2ZQTA 4Q7NA 4C02B 4IT6A 5DIUA 3O5MA 2XP8A 2DSVA 3WD1A 3ARRA 4QT3A 3GU0A 4Z2LA 1FD9A 3O5GA 3WH0A 1J4IA 1QPFA 3UI6A 3QOKA 4DRNA 3KAFA 3AS2A 5GPGA 1W1PA 1FKRA 1H0GA 1HJWA 1FKDA 1ZB5A 2PN0A 3ARWA 2LGOA 3JXVA 2XP7A 4FAPA 1GOIA 2AOSA 4IQCA 4U84A 4GGQA 4MNMA 4DWSB 4DWSD 1OWQA 4MGVA 1WNOA 3EY6A 4ODPA 1LG2A 1E6ZA 1LG1A 2RUCA 3CHEA 4L3NA 2PV3A 4U85A 3O5DA 2XPAA 5DO2A 3WQVA 4TX0A 1J4HA 3OA5A 1R9HA 5GQBA 4S3KA 5HT1A 1PINA 3AS1A 1EDQA 3PRAA 2KFWA 5GPRA 2MLYA 1W1VA 2LJ4A 3CHDA 4TYOA 3VAWA 1HXVA 4Q22A 4DH0A 5HBFA 2M1IA 1XRVA 2PI6A 3PR9A 2MNTA 1OGBA 3B7XA 5JH8A 3NI6A 3FAPA 4DRMA 4DRKA 1FAPA 2DG4A 3RM8A 1E15A 1GUVA 2DT0A 2ZR5A 1J4RA 4DZ2A 1HKIA 2M08A 4LGXA 2JZVA 4LAWA 4WKHA 1TFVA 4ODNA 4W5UA 1D7IA 3PRDA 4JFJA 1EIBA 4DROA 3WKZA 4J4OA 2YBUA 1NWSA 1PBKA 1D7HA 3WL0A 3O5OA 2L2SA 3WQWA 2PPOA 1FKFA 1QPLA 1GRJA 4L72B 2XP3A 4ODRA 4R0XA 2DSZA 4IT4A 1E6RA 2KGJA 3AS3A 1CTNA 4TW6A 2RUQA 4IQ2A 3PRBA 1D6OA 3O5LA 1KT0A 1NWTA 4JFLA 3JYJA 4IPXA 4WKFA 3B9EA 4KQZA 3ARTA 1XHGA 1W26A 1RD6A 1FKTA 1JNEA 1W9UA 1NWUA 1HKMA 1KFWA 1HJVA 4W9PA 5HTGA 3O5KA 2WK2A 2FKEA 1ROTA 4MNJA 2PPPA 3NTPA 4GIVA 1M5YA 4DRJA 3AROA 1P5QA 1GPFA 3O5JA 2Q5AA 4W9OA 2A3EA 5J6EA 3GPKA 4DRHA 1ZU8A 5HW7A 5DEZA 2F4EA 2MLXA 1FKHA 3NRKA 1VF8A 3TCZA 4ODLA 5DITA 4JFKA 2RSEA 4DWSC 1YW5A 1JNTA 2ZR4A 4MNKA 4NZCA 2YBTA 1T11A 4MNLA 2D9FA 1Q6HA 3O5QA 1FKLA 2XP5A 1SR0A 4NSBA 2ITKA 4QZVB 4WK9A 4LAVA 3IK8A 1NWRA
chains in the Genus database with same CATH topology
3KADA 4Z2IA 4ODMA 3FXYA 3KAGA 2IUZA 1BL4A 1HKJA 1H0IA 2MPHA 4AY1A 3O5EA 4R5EA 2RUDA 4TNSA 4ZPWR 4Z2HA 5HUAA 3KAHA 1X6NA 2MLZA 1ZBWA 1NSGA 4PTMA 3RMEA 2DSWA 3CGMA 3ARVA 3TDBA 3KAIA 2RURA 2DPEA 2DT2A 1FKSA 1C9HA 2DG9A 1FKIA 5HW8A 3ALFA 4DRPA 3W4RA 4J4NA 2A3AA 1N1AA 2ZQUA 4LAYA 2A3BA 2VCDA 3AQUA 1E6NA 3B9AA 3ARPA 2K8IA 3KACA 2WM0A 1FKKA 1ZBCA 1SYTA 3RFWA 4HBOA 4JYSA 1WAWA 2LKNA 3B9DA 3ODKA 2QF8A 4DT4A 2FAPA 2XP4A 3IKGA 4JFMA 3ALGA 3WD0A 3IHZA 3O5FA 1X6LA 1L1PA 4ZS6A 2RQSA 1FJDA 1BKFA 1FKGA 4TW8A 5D75A 3OOBA 3ARQA 1FFRA 4DWSA 2G8ZA 4N19A 2XPBA 3ARSA 3H9RB 3ARYA 3BXWA 3KCEA 4O2TA 4Z2KA 4W9QA 1FKJA 4FN2A 1EHNA 1WB0A 5HWCA 4MTVA 1NH6A 3MDYB 2XP9A 2KO7A 5BXJA 1JNDA 1QZ2A 2N87A 4XAKA 3CHFA 2KE0A 4U86A 3RM9A 4DRIA 3KABA 2DG3A 1E6PA 2DT3A 2LPVA 1LJYA 2ZQVA 4P8VA 1NMVA 4MAVA 4TW7A 3AS0A 1KT1A 3O5PA 4URIA 4P8XA 1FKBA 2KI3A 4KR0B 5HW6A 2XP6A 1HKKA 4QIBA 3KZ7A 3UI5A 3CHCA 4HBEA 1JVWA 1E9LA 1Q6IA 3G6LA 3ARXA 1D7JA 1ZK6A 3CGNA 1U79A 5DF0A 1O6IA 1JNSA 3WD3A 2AWGA 2O9OA 4DRQA 1IX5A 2PV2A 3WD4A 5HWBA 4HARA 1LL4A 1NMWA 3UF8A 1D2KA 1Q6UA 4QT2A 1W1TA 2WLZA 4LAXA 3ARUA 2ESCA 4DIPA 2Y78A 4WJXA 1F40A 5B8IC 4WIWA 4MSPA 1TCOC 3WIJA 4ITZA 3RGCA 1ITXA 3LUOA 1LL7A 2DSUA 3UQAA 1LQ0A 3O5RA 2VN1A 4ZPVR 1W9PA 2KR7A 4ODOA 4Z2GA 3FY1A 2B31A 2M2AA 3WD2A 4S3JA 2ZR6A 4ZPTR 3WL1A 2PV1A 1EYMA 2PBCA 2F2DA 4BF8A 1B6CA 4JFIA 1A7XA 4P8WA 1OGGA 2F21A 3O5IA 1EQ3A 1UR9A 2IF4A 1W9VA 4WKAA 1F8AB 3CZ8A 3UQIA 1K9TA 1ZBKA 2G41A 1FFQA 4MPKA 1ZCNA 2ZQSA 4G50A 5I98A 1HJXA 1Y0OA 1ZL1A 3G6MA 1ROUA 2UZ5A 3UQBA 4Z2JA 4ODKA 4DZ3A 3ARZA 5DIVA 3CH9A 3JYMA 2O92A 2MF9A 3I6CA 3IKDA 1LL6A 2OFNA 2OLHA 4P8UA 2DT1A 4NNRA 3B8SA 2WLYA 3UI4A 3PA7A 1Q1CA 3RM4A 2A3CA 5HKGA 4ODQA 1W1YA 4G2PA 2FDMA 1UR8A 1ZBVA 4ML4A 1J6YA 3TC5A 1YATA 2PPNA 2ZQTA 4Q7NA 4C02B 4IT6A 5DIUA 3O5MA 2XP8A 2DSVA 3WD1A 3ARRA 4QT3A 4Z2LA 1FD9A 3O5GA 3WH0A 1J4IA 1QPFA 3UI6A 3QOKA 4DRNA 3KAFA 3AS2A 5GPGA 1W1PA 1FKRA 1H0GA 1HJWA 1FKDA 1ZB5A 3ARWA 2LGOA 3JXVA 2XP7A 4FAPA 1GOIA 2AOSA 4IQCA 4U84A 4GGQA 4MNMA 4DWSB 4DWSD 1OWQA 4MGVA 1WNOA 3EY6A 4ODPA 1LG2A 1E6ZA 1LG1A 2RUCA 3CHEA 4L3NA 2PV3A 4U85A 3O5DA 2XPAA 5DO2A 3WQVA 4TX0A 1J4HA 3OA5A 1R9HA 5GQBA 4S3KA 5HT1A 1PINA 3AS1A 1EDQA 3PRAA 2KFWA 5GPRA 2MLYA 1W1VA 2LJ4A 3CHDA 4TYOA 3VAWA 1HXVA 4Q22A 4DH0A 5HBFA 2M1IA 1XRVA 2PI6A 3PR9A 2MNTA 1OGBA 3B7XA 5JH8A 3NI6A 3FAPA 4DRMA 4DRKA 1FAPA 2DG4A 3RM8A 1E15A 1GUVA 2DT0A 2ZR5A 1J4RA 4DZ2A 1HKIA 2M08A 4LGXA 2JZVA 4LAWA 4WKHA 1TFVA 4ODNA 4W5UA 1D7IA 3PRDA 4JFJA 1EIBA 4DROA 3WKZA 4J4OA 2YBUA 1NWSA 1PBKA 1D7HA 3WL0A 3O5OA 2L2SA 3WQWA 2PPOA 1FKFA 1QPLA 4L72B 2XP3A 4ODRA 4R0XA 2DSZA 4IT4A 1E6RA 2KGJA 3AS3A 1CTNA 4TW6A 2RUQA 4IQ2A 3PRBA 1D6OA 3O5LA 1KT0A 1NWTA 4JFLA 3JYJA 4IPXA 4WKFA 3B9EA 4KQZA 3ARTA 1XHGA 1W26A 1RD6A 1FKTA 1JNEA 1W9UA 1NWUA 1HKMA 1KFWA 1HJVA 4W9PA 5HTGA 3O5KA 2WK2A 2FKEA 1ROTA 4MNJA 2PPPA 3NTPA 4GIVA 1M5YA 4DRJA 3AROA 1P5QA 1GPFA 3O5JA 2Q5AA 4W9OA 2A3EA 5J6EA 3GPKA 4DRHA 1ZU8A 5HW7A 5DEZA 2F4EA 2MLXA 3NRKA 1FKHA 1VF8A 3TCZA 4ODLA 5DITA 4JFKA 2RSEA 4DWSC 1YW5A 1JNTA 2ZR4A 4MNKA 4NZCA 2YBTA 1T11A 4MNLA 2D9FA 1Q6HA 3O5QA 1FKLA 2XP5A 1SR0A 4NSBA 2ITKA 4QZVB 4WK9A 4LAVA 3IK8A 1NWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NI6 A;  3FAP A;  3KAD A;  4DRM A;  1FKB A;  2KI3 A;  3JYM A;  4DRK A;  4ODM A;  5HW6 A;  2XP6 A;  4QIB A;  1FAP A;  2DG4 A;  3KZ7 A;  3UI5 A;  3KAG A;  2MF9 A;  3I6C A;  1BL4 A;  1JVW A;  2ZR5 A;  1J4R A;  4DZ2 A;  2M08 A;  2MPH A;  3IKD A;  2JZV A;  3O5E A;  4LAW A;  2OFN A;  1Q6I A;  4ODN A;  1D7J A;  1D7I A;  1ZK6 A;  2RUD A;  3CGN A;  3PRD A;  4JFJ A;  1U79 A;  4DRO A;  4NNR A;  4J4O A;  4TNS A;  3UI4 A;  5HUA A;  3KAH A;  1PBK A;  1JNS A;  1D7H A;  2MLZ A;  2AWG A;  2L2S A;  3O5O A;  3PA7 A;  1Q1C A;  1NSG A;  4DRQ A;  5HKG A;  4ODQ A;  2PPO A;  1FKF A;  3CGM A;  2PV2 A;  3TDB A;  1QPL A;  4G2P A;  5HWB A;  2XP3 A;  3KAI A;  4ODR A;  1NMW A;  2RUR A;  3UF8 A;  4R0X A;  1Q6U A;  1J6Y A;  3TC5 A;  1YAT A;  1FKS A;  4QT2 A;  1C9H A;  2PPN A;  2KGJ A;  2DG9 A;  1FKI A;  2ZQT A;  4LAX A;  2Y78 A;  4DIP A;  5HW8 A;  4DRP A;  1F40 A;  4TW6 A;  2RUQ A;  4IQ2 A;  3PRB A;  4C02 B;  1D6O A;  5B8I C;  4J4N A;  3O5L A;  1KT0 A;  1N1A A;  3O5M A;  5DIU A;  2ZQU A;  4MSP A;  1TCO C;  4JFL A;  4ITZ A;  2VCD A;  4LAY A;  3JYJ A;  2XP8 A;  3LUO A;  4IPX A;  3RGC A;  4QT3 A;  3UQA A;  2K8I A;  3KAC A;  3O5R A;  2VN1 A;  1FKK A;  1FD9 A;  1W26 A;  3RFW A;  3O5G A;  1FKT A;  4JYS A;  3WH0 A;  1J4I A;  1QPF A;  2KR7 A;  4ODO A;  3UI6 A;  2LKN A;  3ODK A;  2M2A A;  4W9P A;  4DRN A;  2ZR6 A;  4DT4 A;  3KAF A;  2FAP A;  2XP4 A;  5GPG A;  5HTG A;  3O5K A;  2FKE A;  2PV1 A;  3IKG A;  4JFM A;  1ROT A;  1FKR A;  2PPP A;  3IHZ A;  3NTP A;  1FKD A;  3O5F A;  4GIV A;  1EYM A;  1M5Y A;  2LGO A;  2PBC A;  2RQS A;  1BKF A;  1FKG A;  2F2D A;  2XP7 A;  3JXV A;  4DRJ A;  4TW8 A;  4FAP A;  5D75 A;  1P5Q A;  4IQC A;  3OOB A;  4BF8 A;  4U84 A;  4GGQ A;  1B6C A;  2XPB A;  4JFI A;  3H9R B;  4N19 A;  3O5J A;  2Q5A A;  4W9O A;  1A7X A;  5J6E A;  4MGV A;  3GPK A;  3EY6 A;  1FJD A;  3KCE A;  4O2T A;  4ODP A;  4DRH A;  2F21 A;  3O5I A;  4W9Q A;  5HW7 A;  1EQ3 A;  2IF4 A;  2F4E A;  1FKJ A;  1FKH A;  1F8A B;  2MLX A;  3NRK A;  2RUC A;  3TCZ A;  3UQI A;  4ODL A;  4FN2 A;  5DIT A;  4JFK A;  2RSE A;  2PV3 A;  4U85 A;  1YW5 A;  1JNT A;  2ZR4 A;  5HWC A;  3O5D A;  2XPA A;  3MDY B;  2XP9 A;  4TX0 A;  1ZCN A;  1J4H A;  2KO7 A;  5BXJ A;  1L1P A;  1R9H A;  1T11 A;  2ZQS A;  1QZ2 A;  1Q6H A;  2D9F A;  2N87 A;  3O5Q A;  1FKL A;  4G50 A;  2KE0 A;  2XP5 A;  4U86 A;  5HT1 A;  4DRI A;  1PIN A;  3KAB A;  2DG3 A;  2ITK A;  2LPV A;  1Y0O A;  5I98 A;  2KFW A;  2MLY A;  2LJ4 A;  2ZQV A;  1NMV A;  1ROU A;  2UZ5 A;  4TYO A;  3VAW A;  3UQB A;  1HXV A;  4TW7 A;  3O5P A;  1KT1 A;  4DH0 A;  2M1I A;  4LAV A;  4ODK A;  2MNT A;  3IK8 A;  4DZ3 A;  3B7X A;  5DIV A; 
#chains in the Genus database with same CATH topology
 3KAD A;  4Z2I A;  4ODM A;  3FXY A;  3KAG A;  2IUZ A;  1BL4 A;  1HKJ A;  1H0I A;  2MPH A;  4AY1 A;  3O5E A;  4R5E A;  2RUD A;  4TNS A;  4ZPW R;  4Z2H A;  5HUA A;  3KAH A;  1X6N A;  2MLZ A;  1ZBW A;  1NSG A;  4PTM A;  3RME A;  2DSW A;  3CGM A;  3ARV A;  3TDB A;  3KAI A;  2RUR A;  2DPE A;  2DT2 A;  1FKS A;  1C9H A;  2DG9 A;  1FKI A;  5HW8 A;  3ALF A;  4DRP A;  3W4R A;  4J4N A;  2A3A A;  1N1A A;  2ZQU A;  4LAY A;  2A3B A;  2VCD A;  3AQU A;  1E6N A;  3B9A A;  3ARP A;  2K8I A;  3KAC A;  2WM0 A;  1FKK A;  1ZBC A;  1SYT A;  3RFW A;  4HBO A;  4JYS A;  1WAW A;  2LKN A;  3B9D A;  3ODK A;  2QF8 A;  4DT4 A;  2FAP A;  2XP4 A;  3IKG A;  4JFM A;  3ALG A;  3WD0 A;  3IHZ A;  3O5F A;  1X6L A;  1L1P A;  4ZS6 A;  2RQS A;  1FJD A;  1BKF A;  1FKG A;  4TW8 A;  5D75 A;  3OOB A;  3ARQ A;  1FFR A;  4DWS A;  2G8Z A;  4N19 A;  2XPB A;  3ARS A;  3H9R B;  2P4V A;  3ARY A;  3BXW A;  3KCE A;  4O2T A;  4Z2K A;  4W9Q A;  1FKJ A;  4FN2 A;  1EHN A;  1WB0 A;  5HWC A;  4MTV A;  1NH6 A;  3MDY B;  2XP9 A;  2KO7 A;  5BXJ A;  1JND A;  1QZ2 A;  2N87 A;  4XAK A;  3CHF A;  2KE0 A;  4U86 A;  3RM9 A;  4DRI A;  3KAB A;  2DG3 A;  1E6P A;  2DT3 A;  2LPV A;  1LJY A;  2ZQV A;  4P8V A;  1NMV A;  4MAV A;  4TW7 A;  3AS0 A;  1KT1 A;  3O5P A;  4URI A;  4P8X A;  1FKB A;  2KI3 A;  4KR0 B;  5HW6 A;  2XP6 A;  1HKK A;  4QIB A;  3KZ7 A;  3UI5 A;  3CHC A;  4HBE A;  1JVW A;  1E9L A;  1E44 A;  1Q6I A;  3G6L A;  3ARX A;  1D7J A;  1ZK6 A;  3CGN A;  1U79 A;  5DF0 A;  1O6I A;  1JNS A;  3WD3 A;  2AWG A;  2O9O A;  4DRQ A;  1IX5 A;  2PV2 A;  3WD4 A;  5HWB A;  4HAR A;  1LL4 A;  1NMW A;  3UF8 A;  1D2K A;  1Q6U A;  4QT2 A;  1W1T A;  2WLZ A;  4LAX A;  3ARU A;  2ESC A;  4DIP A;  2Y78 A;  4WJX A;  1F40 A;  5B8I C;  4WIW A;  2EUL A;  4MSP A;  1TCO C;  3WIJ A;  4ITZ A;  3RGC A;  1ITX A;  3LUO A;  1LL7 A;  2DSU A;  3UQA A;  1LQ0 A;  3O5R A;  2VN1 A;  4ZPV R;  1W9P A;  2KR7 A;  4ODO A;  4Z2G A;  3FY1 A;  2B31 A;  2M2A A;  3WD2 A;  4S3J A;  2ZR6 A;  3EIP A;  4ZPT R;  3WL1 A;  2PV1 A;  1EYM A;  2PBC A;  2F2D A;  2F23 A;  1JCH B;  4BF8 A;  1B6C A;  4JFI A;  1A7X A;  2B5U B;  4P8W A;  1OGG A;  2F21 A;  3O5I A;  1EQ3 A;  1UR9 A;  2IF4 A;  1W9V A;  3GTY X;  4WKA A;  1F8A B;  3CZ8 A;  3UQI A;  1K9T A;  1ZBK A;  2G41 A;  3BMB A;  1FFQ A;  4MPK A;  1ZCN A;  2ZQS A;  4G50 A;  5I98 A;  1HJX A;  1Y0O A;  1ZL1 A;  3G6M A;  1ROU A;  2UZ5 A;  3UQB A;  4Z2J A;  4ODK A;  4DZ3 A;  3ARZ A;  5DIV A;  3CH9 A;  3JYM A;  2O92 A;  2MF9 A;  3I6C A;  4UDM A;  3IKD A;  1LL6 A;  2OFN A;  2ETN A;  2OLH A;  4P8U A;  2DT1 A;  4NNR A;  3B8S A;  2WLY A;  3UI4 A;  3PA7 A;  1Q1C A;  3RM4 A;  2A3C A;  5HKG A;  4ODQ A;  1W1Y A;  4G2P A;  2FDM A;  1UR8 A;  1ZBV A;  4ML4 A;  1J6Y A;  3TC5 A;  1YAT A;  2PPN A;  2ZQT A;  4Q7N A;  4C02 B;  4IT6 A;  5DIU A;  3O5M A;  2XP8 A;  2DSV A;  3WD1 A;  3ARR A;  4QT3 A;  3GU0 A;  4Z2L A;  1FD9 A;  3O5G A;  3WH0 A;  1J4I A;  1QPF A;  3UI6 A;  3QOK A;  4DRN A;  3KAF A;  3AS2 A;  5GPG A;  1W1P A;  1FKR A;  1H0G A;  1HJW A;  1FKD A;  1ZB5 A;  2PN0 A;  3ARW A;  2LGO A;  3JXV A;  2XP7 A;  4FAP A;  1GOI A;  2AOS A;  4IQC A;  4U84 A;  4GGQ A;  4MNM A;  4DWS B;  4DWS D;  1OWQ A;  4MGV A;  1WNO A;  3EY6 A;  4ODP A;  1LG2 A;  1E6Z A;  1LG1 A;  2RUC A;  3CHE A;  4L3N A;  2PV3 A;  4U85 A;  3O5D A;  2XPA A;  5DO2 A;  3WQV A;  4TX0 A;  1J4H A;  3OA5 A;  1R9H A;  5GQB A;  4S3K A;  5HT1 A;  1PIN A;  3AS1 A;  1EDQ A;  3PRA A;  2KFW A;  5GPR A;  2MLY A;  1W1V A;  2LJ4 A;  3CHD A;  4TYO A;  3VAW A;  1HXV A;  4Q22 A;  4DH0 A;  5HBF A;  2M1I A;  1XRV A;  2PI6 A;  3PR9 A;  2MNT A;  1OGB A;  3B7X A;  5JH8 A;  3NI6 A;  3FAP A;  4DRM A;  4DRK A;  1FAP A;  2DG4 A;  3RM8 A;  1E15 A;  1GUV A;  2DT0 A;  2ZR5 A;  1J4R A;  4DZ2 A;  1HKI A;  2M08 A;  4LGX A;  2JZV A;  4LAW A;  4WKH A;  1TFV A;  4ODN A;  4W5U A;  1D7I A;  3PRD A;  4JFJ A;  1EIB A;  4DRO A;  3WKZ A;  4J4O A;  2YBU A;  1NWS A;  1PBK A;  1D7H A;  3WL0 A;  3O5O A;  2L2S A;  3WQW A;  2PPO A;  1FKF A;  1QPL A;  1GRJ A;  4L72 B;  2XP3 A;  4ODR A;  4R0X A;  2DSZ A;  4IT4 A;  1E6R A;  2KGJ A;  3AS3 A;  1CTN A;  4TW6 A;  2RUQ A;  4IQ2 A;  3PRB A;  1D6O A;  3O5L A;  1KT0 A;  1NWT A;  4JFL A;  3JYJ A;  4IPX A;  4WKF A;  3B9E A;  4KQZ A;  3ART A;  1XHG A;  1W26 A;  1RD6 A;  1FKT A;  1JNE A;  1W9U A;  1NWU A;  1HKM A;  1KFW A;  1HJV A;  4W9P A;  5HTG A;  3O5K A;  2WK2 A;  2FKE A;  1ROT A;  4MNJ A;  2PPP A;  3NTP A;  4GIV A;  1M5Y A;  4DRJ A;  3ARO A;  1P5Q A;  1GPF A;  3O5J A;  2Q5A A;  4W9O A;  2A3E A;  5J6E A;  3GPK A;  4DRH A;  1ZU8 A;  5HW7 A;  5DEZ A;  2F4E A;  2MLX A;  1FKH A;  3NRK A;  1VF8 A;  3TCZ A;  4ODL A;  5DIT A;  4JFK A;  2RSE A;  4DWS C;  1YW5 A;  1JNT A;  2ZR4 A;  4MNK A;  4NZC A;  2YBT A;  1T11 A;  4MNL A;  2D9F A;  1Q6H A;  3O5Q A;  1FKL A;  2XP5 A;  1SR0 A;  4NSB A;  2ITK A;  4QZV B;  4WK9 A;  4LAV A;  3IK8 A;  1NWR A; 
#chains in the Genus database with same CATH homology
 3KAD A;  4Z2I A;  4ODM A;  3FXY A;  3KAG A;  2IUZ A;  1BL4 A;  1HKJ A;  1H0I A;  2MPH A;  4AY1 A;  3O5E A;  4R5E A;  2RUD A;  4TNS A;  4ZPW R;  4Z2H A;  5HUA A;  3KAH A;  1X6N A;  2MLZ A;  1ZBW A;  1NSG A;  4PTM A;  3RME A;  2DSW A;  3CGM A;  3ARV A;  3TDB A;  3KAI A;  2RUR A;  2DPE A;  2DT2 A;  1FKS A;  1C9H A;  2DG9 A;  1FKI A;  5HW8 A;  3ALF A;  4DRP A;  3W4R A;  4J4N A;  2A3A A;  1N1A A;  2ZQU A;  4LAY A;  2A3B A;  2VCD A;  3AQU A;  1E6N A;  3B9A A;  3ARP A;  2K8I A;  3KAC A;  2WM0 A;  1FKK A;  1ZBC A;  1SYT A;  3RFW A;  4HBO A;  4JYS A;  1WAW A;  2LKN A;  3B9D A;  3ODK A;  2QF8 A;  4DT4 A;  2FAP A;  2XP4 A;  3IKG A;  4JFM A;  3ALG A;  3WD0 A;  3IHZ A;  3O5F A;  1X6L A;  1L1P A;  4ZS6 A;  2RQS A;  1FJD A;  1BKF A;  1FKG A;  4TW8 A;  5D75 A;  3OOB A;  3ARQ A;  1FFR A;  4DWS A;  2G8Z A;  4N19 A;  2XPB A;  3ARS A;  3H9R B;  3ARY A;  3BXW A;  3KCE A;  4O2T A;  4Z2K A;  4W9Q A;  1FKJ A;  4FN2 A;  1EHN A;  1WB0 A;  5HWC A;  4MTV A;  1NH6 A;  3MDY B;  2XP9 A;  2KO7 A;  5BXJ A;  1JND A;  1QZ2 A;  2N87 A;  4XAK A;  3CHF A;  2KE0 A;  4U86 A;  3RM9 A;  4DRI A;  3KAB A;  2DG3 A;  1E6P A;  2DT3 A;  2LPV A;  1LJY A;  2ZQV A;  4P8V A;  1NMV A;  4MAV A;  4TW7 A;  3AS0 A;  1KT1 A;  3O5P A;  4URI A;  4P8X A;  1FKB A;  2KI3 A;  4KR0 B;  5HW6 A;  2XP6 A;  1HKK A;  4QIB A;  3KZ7 A;  3UI5 A;  3CHC A;  4HBE A;  1JVW A;  1E9L A;  1Q6I A;  3G6L A;  3ARX A;  1D7J A;  1ZK6 A;  3CGN A;  1U79 A;  5DF0 A;  1O6I A;  1JNS A;  3WD3 A;  2AWG A;  2O9O A;  4DRQ A;  1IX5 A;  2PV2 A;  3WD4 A;  5HWB A;  4HAR A;  1LL4 A;  1NMW A;  3UF8 A;  1D2K A;  1Q6U A;  4QT2 A;  1W1T A;  2WLZ A;  4LAX A;  3ARU A;  2ESC A;  4DIP A;  2Y78 A;  4WJX A;  1F40 A;  5B8I C;  4WIW A;  4MSP A;  1TCO C;  3WIJ A;  4ITZ A;  3RGC A;  1ITX A;  3LUO A;  1LL7 A;  2DSU A;  3UQA A;  1LQ0 A;  3O5R A;  2VN1 A;  4ZPV R;  1W9P A;  2KR7 A;  4ODO A;  4Z2G A;  3FY1 A;  2B31 A;  2M2A A;  3WD2 A;  4S3J A;  2ZR6 A;  4ZPT R;  3WL1 A;  2PV1 A;  1EYM A;  2PBC A;  2F2D A;  4BF8 A;  1B6C A;  4JFI A;  1A7X A;  4P8W A;  1OGG A;  2F21 A;  3O5I A;  1EQ3 A;  1UR9 A;  2IF4 A;  1W9V A;  4WKA A;  1F8A B;  3CZ8 A;  3UQI A;  1K9T A;  1ZBK A;  2G41 A;  1FFQ A;  4MPK A;  1ZCN A;  2ZQS A;  4G50 A;  5I98 A;  1HJX A;  1Y0O A;  1ZL1 A;  3G6M A;  1ROU A;  2UZ5 A;  3UQB A;  4Z2J A;  4ODK A;  4DZ3 A;  3ARZ A;  5DIV A;  3CH9 A;  3JYM A;  2O92 A;  2MF9 A;  3I6C A;  3IKD A;  1LL6 A;  2OFN A;  2OLH A;  4P8U A;  2DT1 A;  4NNR A;  3B8S A;  2WLY A;  3UI4 A;  3PA7 A;  1Q1C A;  3RM4 A;  2A3C A;  5HKG A;  4ODQ A;  1W1Y A;  4G2P A;  2FDM A;  1UR8 A;  1ZBV A;  4ML4 A;  1J6Y A;  3TC5 A;  1YAT A;  2PPN A;  2ZQT A;  4Q7N A;  4C02 B;  4IT6 A;  5DIU A;  3O5M A;  2XP8 A;  2DSV A;  3WD1 A;  3ARR A;  4QT3 A;  4Z2L A;  1FD9 A;  3O5G A;  3WH0 A;  1J4I A;  1QPF A;  3UI6 A;  3QOK A;  4DRN A;  3KAF A;  3AS2 A;  5GPG A;  1W1P A;  1FKR A;  1H0G A;  1HJW A;  1FKD A;  1ZB5 A;  3ARW A;  2LGO A;  3JXV A;  2XP7 A;  4FAP A;  1GOI A;  2AOS A;  4IQC A;  4U84 A;  4GGQ A;  4MNM A;  4DWS B;  4DWS D;  1OWQ A;  4MGV A;  1WNO A;  3EY6 A;  4ODP A;  1LG2 A;  1E6Z A;  1LG1 A;  2RUC A;  3CHE A;  4L3N A;  2PV3 A;  4U85 A;  3O5D A;  2XPA A;  5DO2 A;  3WQV A;  4TX0 A;  1J4H A;  3OA5 A;  1R9H A;  5GQB A;  4S3K A;  5HT1 A;  1PIN A;  3AS1 A;  1EDQ A;  3PRA A;  2KFW A;  5GPR A;  2MLY A;  1W1V A;  2LJ4 A;  3CHD A;  4TYO A;  3VAW A;  1HXV A;  4Q22 A;  4DH0 A;  5HBF A;  2M1I A;  1XRV A;  2PI6 A;  3PR9 A;  2MNT A;  1OGB A;  3B7X A;  5JH8 A;  3NI6 A;  3FAP A;  4DRM A;  4DRK A;  1FAP A;  2DG4 A;  3RM8 A;  1E15 A;  1GUV A;  2DT0 A;  2ZR5 A;  1J4R A;  4DZ2 A;  1HKI A;  2M08 A;  4LGX A;  2JZV A;  4LAW A;  4WKH A;  1TFV A;  4ODN A;  4W5U A;  1D7I A;  3PRD A;  4JFJ A;  1EIB A;  4DRO A;  3WKZ A;  4J4O A;  2YBU A;  1NWS A;  1PBK A;  1D7H A;  3WL0 A;  3O5O A;  2L2S A;  3WQW A;  2PPO A;  1FKF A;  1QPL A;  4L72 B;  2XP3 A;  4ODR A;  4R0X A;  2DSZ A;  4IT4 A;  1E6R A;  2KGJ A;  3AS3 A;  1CTN A;  4TW6 A;  2RUQ A;  4IQ2 A;  3PRB A;  1D6O A;  3O5L A;  1KT0 A;  1NWT A;  4JFL A;  3JYJ A;  4IPX A;  4WKF A;  3B9E A;  4KQZ A;  3ART A;  1XHG A;  1W26 A;  1RD6 A;  1FKT A;  1JNE A;  1W9U A;  1NWU A;  1HKM A;  1KFW A;  1HJV A;  4W9P A;  5HTG A;  3O5K A;  2WK2 A;  2FKE A;  1ROT A;  4MNJ A;  2PPP A;  3NTP A;  4GIV A;  1M5Y A;  4DRJ A;  3ARO A;  1P5Q A;  1GPF A;  3O5J A;  2Q5A A;  4W9O A;  2A3E A;  5J6E A;  3GPK A;  4DRH A;  1ZU8 A;  5HW7 A;  5DEZ A;  2F4E A;  2MLX A;  3NRK A;  1FKH A;  1VF8 A;  3TCZ A;  4ODL A;  5DIT A;  4JFK A;  2RSE A;  4DWS C;  1YW5 A;  1JNT A;  2ZR4 A;  4MNK A;  4NZC A;  2YBT A;  1T11 A;  4MNL A;  2D9F A;  1Q6H A;  3O5Q A;  1FKL A;  2XP5 A;  1SR0 A;  4NSB A;  2ITK A;  4QZV B;  4WK9 A;  4LAV A;  3IK8 A;  1NWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...