1TD0A

Viral capsid protein shp at ph 5.5
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
b'EVRIFAGNDPAHTATGSSGISSPTPALTPLMLDEATGKLVVWDGQKAGSAVGILVLPLEGTETALTYYKSGTFATEAIHWPESVDEHKKANAFAGSALSHAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Head decoration protein
publication title Kinetic Stability and Crystal Structure of the Viral Capsid Protein SHP
pubmed doi rcsb
molecule tags Viral protein
total genus 18
structure length 102
sequence length 102
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02924 HDPD Bacteriophage lambda head decoration protein D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.300.10 Mainly Beta Beta Barrel Virus Head Decoration Protein; Chain: A, Head decoration protein D 1td0A00
1VD0A 3SUCA 1TD0A 1C5EA 3GQKA 1TCZA 3GQHA 1TD3A 1TD4A
chains in the Genus database with same CATH superfamily
1VD0A 3SUCA 1TD0A 1C5EA 3GQKA 1TCZA 3GQHA 1TD3A 1TD4A
chains in the Genus database with same CATH topology
1VD0A 3SUCA 1TD0A 1C5EA 3GQKA 1TCZA 3GQHA 1TD3A 1TD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD0 A;  3SUC A;  1TD0 A;  1C5E A;  3GQK A;  1TCZ A;  3GQH A;  1TD3 A;  1TD4 A; 
#chains in the Genus database with same CATH topology
 1VD0 A;  3SUC A;  1TD0 A;  1C5E A;  3GQK A;  1TCZ A;  3GQH A;  1TD3 A;  1TD4 A; 
#chains in the Genus database with same CATH homology
 1VD0 A;  3SUC A;  1TD0 A;  1C5E A;  3GQK A;  1TCZ A;  3GQH A;  1TD3 A;  1TD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...