1TD1A

Crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with acetate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
282
Chain Sequence
ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures for the Potential Drug Target Purine Nucleoside Phosphorylase from Schistosoma mansoni Causal Agent of Schistosomiasis.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords purine-nucleoside phosphorylase
total genus 90
structure length 282
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1td1A00
1U1FA 3PHBE 4JOSA 3FUCA 1JDUA 1JDVA 4QATA 4DARA 1ULAA 1M73E 4TXMA 1PF7E 3U40A 5CXQA 2QDKA 1PR2A 4LZWA 4F1WA 3OPVA 1I80A 4QASA 3NM6B 1PWYE 1JDTA 1Z5NA 1OTYA 3GB9A 1T8RA 3OCCA 4K6OA 1C3XA 1RXCA 4QEZA 4DANA 1PBNA 4F2PA 4YNBA 4MARA 1Z5OA 4RJ2A 1OU4A 1U1GA 4TTIA 1V3QE 3OOEA 1FXUA 1SD1A 1NC1A 2OC9A 3DF9A 3FWPA 4F3KA 3EMVA 1SD2A 5F7ZA 4G8JA 3KUKA 4GKAA 3BL6A 3QPBA 1OV6A 2OC4A 4D8VA 4GLFA 4OGKA 3LA8A 3KHSA 4R31A 2QSUA 5F78A 3KU4A 2AI1A 3D1VA 4R2XA 4L0MA 4YMLA 4BMXA 3P0EA 1Z39A 3FAZA 1VFNA 4KN5A 1QE5A 2QPLA 1T8YA 3DP9A 1A69A 4G41A 4TS9A 4OEHA 1YQUA 1PR5A 4WKNA 1Z38A 1A9SA 4LNAA 1K3FA 4UC0A 2GUWA 2AI3A 4DAEA 4I2VA 4TS3A 5EUBA 5EPUA 1V45E 3UAXA 3IEXA 3OZCA 1Z37A 4EB8A 1ULBA 4E1VA 1Z34A 1LVUA 3DJFA 4GMHA 1T0UA 4LKRA 1PW7A 3F8WA 4DABA 2A0XA 1RYZA 4MCIA 2AI2A 3OZBA 2AC7A 1YBFA 3FOWA 2XRFA 3UAVA 1PR0A 5CXSA 4EARA 1RCTE 2A8YA 1ODIA 1Z5PA 1PKEA 4PNPA 3E9ZA 3C74A 5CCDA 1TCVA 1TGYA 1A9PA 4DAOA 1OUMA 1CB0A 4U2KA 5FAKA 2P4SA 1Y1QA 4TYMA 1LX7A 1PK7A 4QFBA 5F7JA 5F77A 1VMKA 1N3IA 3OZDA 3UT6A 5I3CA 3K8OE 4DA6A 1A9OA 1V48A 4YJKA 5B7NA 3ONVA 4TXHA 4NY1A 2BSXA 1LV8A 1ODLA 2ON6A 5B7PA 3INYA 4DA7A 4ECEA 5DK6A 4BMZA 3NM5A 1JE0A 3OF3A 1VHWA 1K27A 2IQ5A 2HRDA 4DA8A 3ODGA 2OECA 4WKBA 4D8YA 2QTTA 4YO8A 4L5YA 1RFGE 4L5CA 4TTJA 2H8GA 2HWUA 3OOHA 3DPSA 1V2HE 1JE1A 5B7QA 1Z33A 3KVRA 1Y6RA 1Y1RA 3E0QA 3UAYA 4DA0A 3TL6A 4L6IA 2QTGA 4TTAA 1A9RA 5CYFA 1RSZA 4BMYA 3MMSA 3P0FA 4M1EA 4F2WA 5CCEA 1NW4A 3GGSA 4NS1A 3KVVA 1JP7A 1Z36A 4H1TA 1V4NA 1YR3A 1TCUA 3NM4A 5C80A 1XE3A 5ETJA 3SCZA 3OZEA 4BN0A 3BJEA 2OXFA 3EEIA 1JPVA 1SJ9A 3K8QA 3PNSA 1ECPA 1U1DA 1RR6A 2A0YA 5KB3A 4D8XA 1T8SA 1K9SA 2I4TA 1RXYA 4D98A 3EUFA 4WKOA 4QAQA 1ODJA 4IP0A 3T94A 2HN9A 4TXNA 2A0WA 4L5AA 5JPCA 1ODKA 2ISCA 5IU6A 1V41E 3O4VA 1RXSA 1Z35A 4JWTA 2RJ3A 1Y6QA 5F76A 1JDSA 1WTAA 4TXLA 4LNHA 1JYSA 3KVYA 4OGLA 4QARA 2HSWA 4JP5A 1PR6A 1U1EA 3MB8A 4M3NA 3EUEA 1ZL2A 1Q1GA 5B7GA 4F3CA 1TD1A 4GLJA 5F73A 4OY3A 1B8OA 4OF4A 2Q7OE 3FB1A 2PGAA 4TXJA 1OTXA 4MCHA 3DDOA 5K1ZA 4G89A 4X24A 1YQQA 1YRYE 2B94A 3LBAA 1G2OA 3NBQA 1PK9A 3BSFA 1U1CA 1T8WA 3PNPA 1SQ6A 5F7XA 3UAWA 4PR3A 1PR1A 3IOMA 4LDNA 1A9QA 1Y1TA 4FFSA 4NSNA 3UAZA 1A9TA 3ENZA 3O6VA 4D9HA 5EFOA 3PHCA 1ZOSA 1CG6A 4M7WA 4P54A 3BGSA 4OJTA 1JDZA 4WKCA 1OVGA 1NC3A 5CYGA 4R2WA 1B8NA 5F7OA 1RT9A 4WKPA 2I8AA 3LGSA 1RXUA 5IFKA 1VHJA 1PR4A 1Y1SA 3FNQA 3E9RA 1TGVA
chains in the Genus database with same CATH superfamily
1O96B 4CF4A 1E1LA 1EP2B 3AF4A 3R75A 4FYPA 1P6QA 1Z15A 5AKKA 1Z82A 4JOSA 2RGYA 4TLBA 1R6VA 2Z5GA 5E4TA 5K3CA 3NYQA 1JHPA 2FZKA 4BVHA 1YONA 4JLPA 1VKJA 3GT0A 1TEVA 3BRWD 4UD6A 2OAP1 2WE8A 1CRZA 1P1BA 8LDHA 2BRUC 2FFQA 2CT8A 2Q5QA 3DJYA 2ZDQA 3T38A 4F1KA 3FR8A 2HY7A 1RAAA 2NAFA 4QKQA 2F59A 4LGYA 1H4TA 2C4TA 5B3LA 2H5IA 2V8BA 1G21B 3M4ZA 2KHZA 3PE4A 4YUAA 4JV5B 4BLQA 3PFIA 3NC1C 4MW7A 5E8JA 3GA7A 2WIKA 1C8VB 3IPCA 3TLAA 2EJCA 2Z9DA 3KG2A 4QASA 1XRPA 3K3PA 1P91A 4D4KA 1ZIPA 4ITRC 3BOSA 3HCBA 1Z5NA 4UFOA 4NBRA 3FTEA 1RWWA 1V96A 1Z29A 2TECE 5JWRA 4CN8A 4L7QA 3M5PA 5EUCA 3THXB 1C1XB 1C30B 1NU8A 2QX6A 2HIMA 2ZSUA 3GYGA 3O4GA 4ZDKA 4Q7JB 5L3SB 4DV3B 2B30A 4J2TA 1K8RA 3N0TA 4AZTA 3KWMA 1IBCA 4S2EA 5BSTA 3OEHA 1DXQA 1K6JA 4MARA 5D5HA 4P5EA 4DJJA 1J8MF 3PQFA 4WADA 4TYNA 3TI9A 1ECLA 2PYZA 4ZQGA 4V0OA 1BW9B 2HRBA 3CC8A 2H0QA 2W93A 5T57A 2H2GA 2FN4A 3B3AA 1CYDA 2OC9A 2XRZA 2VDKB 1NVEA 3LLSA 4TKZA 4YJGB 5K4HA 1F7UA 2AKEA 2LUOA 2OCDA 3U7QB 3GHYA 1M2HA 3GRYA 3R0VA 4IZIA 4AIIA 4RTLA 2IY9A 1RE0A 2F6RA 5E1BA 4WBNA 2FSHA 3ITEA 4ZAWA 1ZHHA 3AHGA 1HUQA 1NQVA 1RXEA 1TEXA 2R5NA 3IUQA 4KBFA 4MS1A 5EHIA 4HDOB 4D4JA 2B25A 2FG6C 1G5TA 3DV9A 1JRLA 3BK2A 4R5MA 2PD3A 5H8WA 5JNUA 1MO3A 1PTKA 2HLDD 2ORED 2TSYB 2DT5A 4QO7A 4XM2A 1PZNA 1JEJA 2C99A 2I6UA 2CE7A 2XUPA 4IMIB 5F78A 4HVCA 1VPVA 5B1YA 4DM3A 1I7QB 2X13A 1QP4A 3PD1A 2D1QA 2X76A 3G1WA 5G53C 5PNTA 3L7JA 2ZIAA 4DUYB 1NW3A 1Q0RA 1QRUA 1NN5A 2P3LA 1RCUA 1AC5A 3WL8A 3QFFA 2PGJA 1VFNA 1Y7LA 5B57C 1T4MA 2C82A 4YGXB 4Q9DA 1O77A 3LF2A 2OESA 2HSZA 1FQWA 4M83A 5ALQA 3AV0B 4G1EB 3T1OA 4ZI5A 3PEUA 4PHTA 1KC3A 1JHDA 1E9SA 3BC1A 5BOVA 4LDRA 5JHHB 2ST1A 3SJZA 2PDAA 3DP9A 4G5QA 4PAQA 1EBFA 4G41A 1E1KA 1BDIA 3CG4A 2ZUSA 5HKKD 5IVKA 3GR6A 2ZBPA 4B71A 2AH5A 5JROA 4EENA 3C16C 4ENTA 3TDKA 2PANA 1T9ZA 2DUMA 2VH1A 3NW9A 2X8JB 4P7GA 5T3YA 4CKXA 2VHZA 3AOEC 4RXTA 1WZIA 4BQOA 2X3YA 2DHRA 4LNAA 4LQCA 2CJWB 4OHZA 4NLLA 1QNLA 3F6SA 2Y92A 3FCOA 2QI9C 3TRDA 4ARZB 2V96A 3U4QB 2H00A 4LRUA 1WUJS 3WZ2A 4Q47A 4FNMA 3W5CA 1GKYA 2NU8B 3BB3A 2IKSA 4D82A 4YRTA 4DRZA 3R5XA 1J8YF 1KK2A 2JNWA 2XRYA 3H4MA 2HUPA 3SF8A 2CB9A 2EX4A 4JLKA 5JFOA 1QBGA 1BMDA 1WJGA 4V0MA 2CXHA 1GARA 221PA 1VBFA 2FP3A 2FKNA 2HA2A 3EMBA 5EJ4A 4PQGA 5JH7B 2HHJA 2PVCA 1G64A 3EVZA 4UHCA 2IIVA 4OMDA 1NLMA 4V3CA 3BTVA 3KPWA 4LJLA 4H3HB 4L02A 2ATVA 2OSVA 2NXJA 3FHCB 2EW1A 3Q8MA 2B7LA 1P0QA 3R5SA 1RBYA 4P93A 1YBFA 3T3NA 3KZNA 1UOEA 2Z6UA 3HMQA 4H17A 4ZOLA 2WUDA 1ES9A 2OL4A 1LDEA 1RZVA 4MV8A 4M1ZA 2W42A 1ZNXA 5CLFA 3USCS 1HTBA 3C4JA 1CB7A 5J9FA 1VLHA 1KYWA 4G81A 3KT6A 3QBTA 3RSSA 4N76A 2R7NA 2IF0A 1VG0B 1A4XA 1X13A 1B0AA 2NZVG 4OV6B 5J4YA 1MEOA 3AUFA 2PWAA 3I04A 1ZWKA 4QE3A 1EBBA 1CJSA 1V3TA 3A1NA 2E21A 1H2WA 2XCOA 2CVFA 3IUYA 4P81A 4R8KA 1Z3CA 4S0ZA 4XYBA 2MR5A 4FNAA 3OPYA 5KSPA 3WA7A 3SKVA 1UOQA 1SZPA 1YUBA 4PAOA 1MX9A 4S1PA 1BU5A 4PTLA 3TD6A 3EAQA 3ZC3A 3H19A 4UHKA 3F3KA 4R8SA 4BV2A 2XD9A 4A26A 4M36A 3R3JA 2B1RA 4V1CA 1QGUB 3ISJA 1A9PA 2X8LA 5B1DA 5DT9A 3Q10A 4B3CA 1MAUA 5CIQA 5CH8A 5M3BA 1AX9A 1FP4A 2GO1A 2GPTA 5DOZA 4RKRA 4QQFA 5GJVC 3JQ9A 4II2A 2PL1A 3OO0A 4RCVA 5H59A 4AL4A 4YREA 1PIWA 4DJFC 4H59A 5C3MA 3CZ4A 3MG9A 1PWXA 4LF9B 2GOYA 4C7OA 4EI7A 2Q45A 2FWBA 3CMMA 4KN9S 1JJBA 4PV7A 1WHTB 4BS9A 5JLJA 4V0SA 4UNRA 4KLRA 5AI9A 5KAPA 2BMJA 4AFNA 4B0OA 2FPPB 3LUJA 4KMRA 4R1UA 4F11A 1K3UB 2C54A 3AJ8A 4RIFA 1L5NA 1Z7YA 3R5KA 3RVSA 1HA3A 3UATA 4W5OA 2AA3A 3T12A 3QSYA 4W5WA 1EDEA 3BCSA 4QBKA 3WY9A 4CLRA 2I2BA 1XP5A 4XIYA 3SMQA 1M2FA 5ALLA 4RQTA 2HU7A 4CKEA 2YKGA 3KYDB 2XT0A 2QX4A 1MTZA 4MI9A 1H0HA 1GKKA 2B34A 3AKEA 4K28A 4IDHA 4ZGGA 2JB9A 5FTLA 3KSMA 2CBZA 1OSNA 2JIRA 2J0SA 3N53A 4WXRA 3UB2A 2O23A 4FHDA 4AZVA 3WADA 2FJPA 5KVSA 2ONKA 4HZUB 1RMQA 1Y4UA 3RSLA 1ICEA 2PLAA 3NRCA 3PJFA 3DZCA 2FN3A 5AHOA 1MGOA 1ZFNA 3ILVA 5D3MB 1P8AA 4CRWB 4DCVA 3M49A 3RRZA 1QQ7A 4FGUA 5AXDA 3AF6A 4MUAA 1WNTA 1IXYA 3OF5A 5HBRA 2QW0X 2Q62A 3JPYA 5JXWA 1HFWA 1SHZA 3EZ6A 3TBHA 2Z95A 3DOHA 3IAEA 1UC5B 1MU0A 4PX9A 2JIMA 2XB9A 1AV7A 2CN1A 4L5YA 5J4LA 2BFBB 2H54A 1S3SA 2LWIA 2WSSD 3R0QA 3RVNA 3S4YA 4R5HA 5CITA 2W6ID 2VYNA 3RT7A 4TTJA 5E3HA 3LKDA 1L4GA 2XE8A 2DWPA 3N39C 3O1IC 5JRZA 3T3PB 3C3PA 3VTFA 1J22A 2QR2A 3TZLA 4Q9NA 1KAGA 4EMUA 2C8VA 3JASB 2QY9A 1E3EA 4S1WA 1XMSA 2AJTA 3IMFA 3GIWA 4W7HA 1LEHA 4TQGA 1G20B 2I8LA 5KNDA 3WICA 4NFLA 3KYCB 2P1DA 4R9RA 3SI7A 2VK8A 3JQ7B 4LK2A 1OPXA 3GCWA 4P33A 3I1FA 3ZNPA 3U4IA 2HZ7A 1JHVA 1ZPDA 2YOGA 3KPYA 3O90A 4RZ3A 1A97A 3QYPA 1N78A 4JGBA 2G08A 1UEJA 2HGZA 4S05A 1MB9A 2IOFA 3MWYW 2CW5A 4DLVA 1EU1A 2XLBA 3RCBA 1YZNA 3ZY5A 2UZ3A 4OSPA 1DZ3A 2WWGA 1GA1A 1KDRA 3DZDA 1J49A 1JFFB 1HMYA 4Y0AA 1XCGB 3DWGA 3KXLA 1NMEA 1U2DC 4CF5A 4TMXA 3OE4A 1QCZA 4NCIA 1RSZA 3FCYA 3IOYA 2OXRA 3BF7A 5JFTA 1JGTA 3PFCA 4OHVA 2OCAA 4V0QA 1VCNA 1EK2A 4MW4A 3WHKA 1JQDA 1NW4A 4LVCA 5JXIA 3F73A 3ANYB 1YIAA 3W9SA 5K8VA 1Q1EA 1Q7EA 3F8SA 3FPJA 1N6NA 3PQEA 4AY4A 3PQ8A 2FRVA 4C5AA 2VP9A 1QLJA 3HI4A 4ZCTA 4Q7KA 1IOWA 4QUKA 1F2VA 2PEZA 3R3HA 5FBRB 2EQBA 1BVHA 3PT9A 3RRBA 4WLUA 1P2SA 2Z1DA 2ZUTA 4EBBA 5KCMA 2X86A 5JNLA 1RU3A 3QGMA 5EJ8A 4RMJA 1WPGA 3I9KA 3OTHA 1GU0A 2ISSD 1P1IA 4LWQA 4BNFA 2EKQA 3B1KA 3OFJA 4B31A 4W8GA 5AW9A 2IPOA 3EEIA 3G5MA 4O2LA 1EM8B 1GL9B 1Q5PA 1SHJA 3DQPA 4OQ4A 4RPKA 3OWOA 2GPYA 4X93A 1BXZA 1E0SA 3O3OB 4Y7DA 2PK3A 3VC3A 1UM9B 2IWRA 4B33A 1T91A 4OYRA 2GF9A 1PZHA 4G2NA 5DBOA 1T4CA 1GG8A 1Z5GA 2WWTA 5MFPA 2H2IA 4M0UA 1Z0AA 2FUG6 2V7PA 1CV2A 4Q3KA 2L0XA 1PS0A 2BONA 2LCFA 5IYZA 1CF4A 4MUYA 1Y5LA 1JXMA 1M1ZA 5DGCA 1T24A 1XJWA 2HA7A 2XY4A 1EVQA 3F5SA 3VSEA 5A3JA 4K9LA 4B3MB 2I3ZA 5K8IA 4KO1S 4MHOA 3FYTA 2YV5A 1ODJA 1VJ5A 3IPRA 4I1PA 4EH1A 2OD7A 3T94A 3TIFA 4QLOA 3BHMA 5DN6A 1X3SA 1QYIA 1PBTA 2B5OA 1JU3A 2FTKE 4M46A 4AMBA 2AXEA 1PFWA 1IQ0A 1ZD2P 2P0EA 1XNGA 2A6PA 4K6HA 3EPKA 1Z6AA 4HUJA 4ZO8A 1FXWF 1TUBA 3TSAA 5CDTA 4IS3A 3HXQA 4E30A 2OZLB 2WNHA 2BEUA 4V0NA 2D5AA 4DSZA 2ZR8A 4LXUA 4V0RA 5HW0A 3M5WA 4J7CA 4PU0A 4ASUA 5BVHA 5IBCA 5LD2C 4UCQA 2Y2UA 2CL6X 3RVLA 4RMHA 2Q07A 4ATNA 5AUOB 5GIOE 1HWYA 1V26A 1Z5UA 5B3AA 3T9FA 3GYBA 5LMCA 1LDMA 3OIYA 1G6KA 1T9BA 4LJ6A 4E1AA 3NHAA 2VHTA 3IXMA 2OSBA 2RGNC 3K0SA 1F2TB 1FLDA 3VBCA 3RUPA 2XXBA 4MO2A 3LC7O 1Q91A 1PD1A 3JQ8B 1FQOA 4EHAA 2EX0A 3UGQA 3RI3A 2PUDA 4BATA 3SM3A 1N6OA 4B73A 1KEEA 4J3NA 2QTHA 3C7AA 3LKZA 1D2EA 1GAQA 1TMOA 2E48A 2F1KA 3IIIA 3QWAA 4XPZA 2G1AA 2NAPA 3DC2A 3GFPA 3NWBA 1PS8A 3QYFA 4FI3C 5EP4A 2DLDA 3KFXA 4KGZA 2C31A 3UWPA 3ZHYA 2J4DA 4D92A 1P3DA 5CLIA 4FCTA 5LBIA 4KQEA 1FU7A 1T0HB 4EJ6A 3K6RA 4CF7A 4FWTA 3ND8A 2O2SA 1RP1A 2R2AA 1BVUA 2I6SA 1JEEA 3C1TA 3AUAA 3CRQA 5IJWA 1VLJA 4KMSA 2QRKA 5G4KB 3VHXB 1Y63A 1BQEA 2XUKA 4U63A 3SXJA 2CWWA 2JI9A 1DKNA 3G2OA 1OWLA 4E6PA 3HXTA 1JSZA 2CVZA 3N2EA 1UJ6A 3VR5H 4U2GA 1Q0PA 2XMSA 2VZEA 2FX2A 1ZUNA 1JHQA 1K6XA 1OX4A 2ZJFA 3R8FA 3P9XA 1TZKA 3RYFB 1X0VA 4G26A 4HK4A 3HP4A 4OHCA 4W8HA 3COJA 2Y99A 4G67A 1TU4A 1M2WA 2D59A 4LJSA 1EUDA 3HDQA 3LPCA 2D5CA 2BGMA 4QPCA 3FMIA 2P30A 5CB8A 3RBZA 4ZKDA 3QEBZ 1W1IA 1HKHA 3GFTA 1J56A 1K4YA 1ONBA 2ODPA 2B8JA 2XDAA 1I7NA 1R8JA 2ZYHA 4LHEA 3B6EA 1K6EA 5H9VA 9LDBA 5KC9A 3NDIA 4ZPJA 3W5DA 1YO6A 3G02A 3H0CA 1IG0A 8GPBA 3T9BA 1JA1A 1UMDB 4AS1A 2Y93A 3AH8A 5DLDA 3GVCA 5DNVA 1DJOA 5CFPA 1QHFA 2ISQA 3A7EA 3ESAA 2YZNA 3DOCA 4QDKA 4B40A 3ABOB 4OXIA 1VM6A 4K9PA 4R2IA 5FV7A 2HHCA 4TTTS 3EGIA 2GZRA 1K5HA 3M4YA 2XXAB 2ECQA 2R6AA 3V4FA 5KSOA 1JIUA 1MPTA 4QX6A 4OP2A 5TR9A 1ZCJA 1F38A 2DWUA 4G86A 1LBSA 1E9EA 3EC2A 1OW3B 4U4AA 4BKOA 2O8DB 4RM2A 1FMCA 1W4BA 3C5VA 3SP1A 3TZQA 2WWVD 2AD5A 3I9MA 4MV3A 1X1CA 4Y6QA 4YBRA 4ZAGA 4KFSA 2W6JD 4IIVA 3RABA 2IYNA 1HH4A 2ACVA 2J5XA 3DNPA 5IS2A 3ZS9A 3W4JA 2WDPA 1F17A 3A4TA 3AJRA 1A95A 1ZMRA 2OA0A 3JPWA 3GRAA 4MLPA 1HNXB 2LKCA 1PLLA 3FY4A 1P4SA 5LQCA 4BQRA 1GTMA 4HRAA 3C41J 1Z47A 3C0KA 2G63A 3NXKA 2CWDA 2IYSA 2EQ5A 2CHQA 4INJA 4M6WB 4Q34A 2FMUA 3E8XA 3GD5A 3ET4A 1OWPA 1Z4OA 3PQDA 4JYCA 1XQWA 3B20A 4RK5A 5DHPA 4YAIA 1TM5E 3IDFA 4MULA 1U0RA 2GEVA 2Z08A 3PHBE 3HN6A 3QOWA 3OT5A 4PO9A 2O2CA 2GTPA 1ZHFA 1QYXA 3FNGA 1IG3A 5EAIA 1BDHA 2GM4A 2X1MA 4ZJZA 1CEQA 2C5HA 3WQBA 4R7GA 4IJMA 2OGSA 1ZMOA 4NJMB 4TZ0A 3I1IA 4EA8A 3HUTA 2HF2A 5TLSA 2VI5A 3EBPA 5HQTA 4I0WB 5AK0A 4RTJA 3D7LA 1KAOA 2FFAA 2YMMA 3FMFA 3U13A 1NIPA 4WCFB 2UUPA 4DKXA 3GUYA 3BWYA 1UQUA 5LN1A 3V8RA 5IKPA 3ZKAA 4ENQA 2VXOA 2DQKA 3KB6A 4CR8A 1JEQB 2YN2A 3NYRA 4HP8A 3LUHA 3F97A 1JDTA 3WLOA 3OF2A 2FCAA 5JANA 3ONWA 2NUTA 3A6EA 2JFVA 4WFKA 5DI3B 1WZEA 3TAXA 4DFDA 2ZI5A 2H17A 3QU9A 3IERA 2NZXA 2PMEA 4EQZA 4Q1CA 4HYTA 3BX1A 3IULA 4X8HA 1Z25A 1PBNA 4U7TB 2W6OA 3KQKA 3V7NA 4XSGA 4K9KA 2F9FA 5JARA 1FPQA 3CZRA 1RJ9A 1XPJA 4AN0A 2C0QA 4B44A 4G4JA 1Z5OA 5EKSA 3E22B 1R27A 2HF7A 3GRKA 3NUZA 2OG1A 5KPDA 2YS6A 4QTZA 2WWHA 1WY7A 2OD9A 2ZGVA 3I01A 4MMYB 1EFAA 3KYCA 3S2GA 1NV9A 1SPXA 1ZL0A 3JAKA 2C4NA 1SD1A 4A6XA 4CCYB 4W7IA 1XK6A 2OCLA 4M1MA 3FWPA 1NNLA 1POXA 4ZK2A 3UH1A 2VYVA 2NT4A 4CFYA 1LD3A 2BMEA 3GUCA 2IUSA 3IAFA 5FBHA 1YSCA 3PFFA 4BNYA 3L07A 3LVBA 3UMRA 4P92A 4C5BA 4PBTA 3DAOA 3EGOA 4JUBA 1K5DA 4ODIA 5J1SB 4DR5B 2WMYA 4HQRA 1YU6A 5JZBA 2JLVA 1CZUA 3BWVA 1Q7TA 1DBRA 4Q18A 1SEVA 1E9DA 1HSOA 1SC6A 3VAAA 1XROA 5LL6P 3OETA 3LA8A 3D3JA 3DO8A 3NHBA 4ENPA 2DZDA 3AR2A 4Y2VA 3UCXA 4MMZB 1FNDA 4A1FA 1I5RA 3PRYA 5M34A 5FD8A 5JBIA 3MWLA 3P0EA 3HBAA 1DX6A 3GAMA 3ZD9A 5I5GA 3SBEA 4Z4EA 2OOKA 3QJ5A 1M1YE 1QHYA 3LQYA 3OECA 1ISHA 1WL8A 4GOJA 3FOCA 4ARIA 1MPXA 3H4TA 1P7CA 1JW9B 5ARDA 1P72A 3DULA 3WIVA 5DCYA 3TGWA 1JEDA 3GC6A 1Q7BA 3HRKA 2P35A 3HU5A 5K8UA 1SQSA 2Q9UA 3O91A 3LC0A 4E94A 4PO1A 4KPFC 1EX1A 2JK0A 1ZJ4A 3SBXA 3Q3GE 3VU8A 1QWSA 4HT3B 1S3IA 3G23A 1II8A 4X63A 4DLPA 2XXJA 1JF8A 5EIHA 1IBLB 4I9GA 4UUBA 1VHLA 3UKDA 3ILXA 1NBAA 2A84A 4EY4A 4I2NA 5IZCA 5HP4A 1T5TA 1IJFA 2C3YA 5A3SA 5IYZB 2I65A 5BUZA 1SZCA 1F20A 5TDHA 1YA6A 4P8RA 2Q50A 3JQPA 4ICIA 2R79A 4P38A 4K7JA 2MINA 5FBZA 1D07A 3WBKA 3WL5A 2YDXA 2OWDA 3G0BA 3ROMA 4WAUA 4XB6B 1CF2O 2A3RA 2L18A 1Y34E 3I05A 2Q6OA 1PFVA 4FB5A 2C2HA 3PPIA 2ZG6A 4CEJB 1Z37A 3D02A 1FSPA 2K6GA 3MJHA 2P6RA 1E0DA 3HPRA 4AICA 3EYAA 5DH9A 2DUWA 3NASA 4PSAA 4IKOA 2WSIA 3D4PA 2C7VA 1VKRA 3UBMA 1C3OA 1OXKB 1JJFA 2NSDA 4MCJA 1L8LA 3NKFA 2PQ0A 1NAIA 2R87A 2Y77A 5BN5A 3L0OA 1TFRA 9LDTA 3ER8A 1KL7A 3OU6A 4AJOA 4Z1OA 1W8IA 2IGBA 1CDZA 2PBFA 2XRFA 3DT6A 4JJZA 2OCKA 3GBVA 3ESZA 1IULA 3ZXIA 5LUAA 3SFZA 1HYGA 1TO2E 1V8OA 2HA6A 3GJ0A 4MVJI 4XD7A 3NJ8A 3BFXA 5GM2A 1J0DA 2IHBA 1MBZA 3JYQA 4FS8A 2CDNA 4CNQA 5F3RA 1OFGA 2D1SA 3EVBA 5GOZA 2QVLA 3PIIA 1AQ6A 4ENWA 1HFJA 5A71A 4P7FA 2BN4A 4GOOD 3R2JA 3MJEA 1NYRA 4J1QA 2Z4SA 4NJEA 1CIJA 2J5QA 5IJ0A 1HDEA 4LRTB 5BYKA 1R18A 5KZMB 2O59A 1S1MA 4LWPA 4X6UA 2X2FA 1N6HA 1AY0A 1EFTA 4DC9A 3C3WA 2NNWB 3ZGVA 1ZUWA 1KO1A 3FGNA 4IXDA 4MAMA 1XRLA 2J4CA 1WMFA 1VBMA 1ZNQO 2PQ6A 1IMOA 4DMCA 5BNZA 3SR4A 4FNGA 4YMUA 4TYMA 3OM9A 4HDCA 1QG4A 1QFJA 3OJFA 1I0ZA 1OD6A 2WFZA 3DKKA 3IMGA 4G4GA 4QFBA 4J1NA 4HJRA 3UN1A 4D7AA 1K7EB 2UZIR 4K2HA 4E32A 3LY9A 4XGRA 4IMRA 3OQIB 3TAHA 1XTJA 3ZVLA 1T43A 3CWCA 5IVHA 5JD5A 4HSGA 2C2BA 4N6GA 4MI6A 1G5RA 3RLFA 2UYCA 2QJFA 5CNMA 4I19A 4EA7A 4CLXA 1GTRA 2W5UA 4JJGA 1DAFA 2W2OA 3W04A 1U04A 4NVRA 4Q4HA 3KJQA 3BHIA 1Y81A 1U8TA 2AR9A 5BW5A 1ULHA 1DG9A 3LPNA 5D86A 1MO5A 5A62A 3RS9A 3VRHA 1VKZA 2BM8A 4BE9A 2G06A 5LC1A 4C4YA 3W3AH 5EMNA 2C84A 3NH9A 2ODWA 3W77A 1EFLA 4GI7A 4PO3X 4JI1B 4BX9A 2A59A 2BFOA 2IYLD 3PC8C 2YQZA 4Y9RA 4EA9A 1YZFA 1JE0A 1Z07A 5AW8A 4GKJB 3FB4A 2N1BA 3CTMA 3OIFA 1GLNA 6CHYA 3D8SA 2C1EA 1QO7A 5KWIA 4WKBA 5FL3A 4WN3A 1G5IA 5HCNA 2QTTA 4C14A 4X3PA 5LWQA 1VDZA 3ZJYA 3AR5A 4TLLB 5HEKA 4CUJA 1E3MA 2VDWA 1ZG3A 4JWKA 1O1YA 3LBYA 3V8PA 1RP7A 2REQB 4GOKA 3Q5GA 4MB6A 4UU8A 4C0SA 2GVDC 3FCSB 4QJIA 3NJ4A 2NZYA 3OOHA 4PS1A 2UDPA 4KV7A 1UJ2A 1Z2CA 1V1MA 1KGSA 4PLWA 3NHUA 4BFVA 3LCVB 1WWKA 4ZAZA 2YW2A 1NY5A 1A2OA 4GBMA 1LK0A 3CINA 2ZRAA 4MUIA 2G04A 4GMKA 3KR1A 1QXSA 2QTVA 1NYQA 4RAQA 4UTXA 2OXIA 4FVTA 3IAUA 1FZQA 1JXOA 1ADGA 3Q7IA 1IN4A 4LDPA 3WJ7A 3O7MA 2BGIA 2APJA 5K45A 4DILA 2F8MA 2KBEA 4DA0A 4GGOA 3KZCA 4A8JB 1E4EB 1GRRA 2R0QC 1U0SY 3JS5A 4L2IB 3HCFA 4F6LA 1MV8A 1YE3A 4EX6A 2X0IA 3K0HA 4LGCA 3STUA 3RSCA 3S55A 5EKDA 1GUZA 5FWDA 4IYRA 2P2ZA 4KGXA 3TR0A 4RL6A 3DTNA 1GL7A 3C6QA 5K5EA 2Z8XA 3VR0A 3ZN2A 3SG0A 4LY3A 3EIXA 1PAUA 5EKXA 1T1SA 5L7TA 2HJHA 2CFTA 4ARVA 5DP1A 1L4BA 2ZE7A 5I7EA 4YY3B 1NN1A 1UK6A 4JFRA 4E4RA 4RSGA 4HLDA 4JJEA 1Z36A 3DFUA 3OZGA 4MROA 3GN1A 1QMPA 2HCBA 3OE1A 5BWCA 1PT6A 1YJ8A 1YR3A 4GVXA 3FPKA 2Q3CA 3NIGB 1MO2A 5CFZA 4ND2A 2Z2IA 4ND4A 3W8EA 2GRUA 1XD2A 3L9WA 3LU1A 3T5AA 5IRCD 2ZB8A 4B8ZA 3VKGA 2PXAA 1ZUD1 2VF7A 4IX9A 1L8OA 3IIJA 2W2LD 4JYMA 3K4PA 5FFMA 2BY4A 2CDAA 2GXQA 3BJEA 3DDSA 3LX6A 3A4NA 4GRAA 1ZLYA 4FONA 5BWLA 3DLTA 3ITKA 3PL1A 1KTVA 2NU7B 1VXRA 2GD2A 1USGA 4P4LA 3J81k 3EDRA 4YLYA 3B6MA 1IIRA 3SJUA 2WYWA 3GMSA 3HM9A 4LUCA 2DSTA 2AJBA 5DTEA 2GLTA 3UPDA 4G0YA 2YFHA 4KOAA 4ME6A 1RXYA 5K03A 1CUZA 1Z5VA 2J33A 2R1VA 3D8HA 4OOEA 1JH9A 3EIEA 3GRUA 1EHYA 1OTHA 2VLBA 4IH9A 4IINA 4BPRA 2JI8A 1V9LA 1EWVA 3MUEA 4C6TA 3OQJA 1Z7BA 1ZNZA 4II3A 4BQPA 4NR0A 3CEAA 3QKRA 3A6LA 2WI8A 4BU0A 4BLRA 4GI1A 3GD7A 2A5DA 3USZA 4JLNA 4URUR 3OURA 1NUSA 4YJ2F 4E0BA 1NXPA 4PC1A 2WV7A 5HNKA 3O5AA 4FQ7A 3TQQA 2ZSAA 2VJOA 5BUSA 3ENWA 1NI5A 1D2HA 2POCA 1QQ6A 5C51B 1E59A 3PG5A 1GL6A 2HFJA 4E1BA 4EPWA 3L46A 3HVRA 2QLLA 1E3LA 2O07A 3D2AA 4KQFA 4GPEA 4Q1BA 5IHXA 1UMCA 4NHOA 4C3ZA 1X9HA 2R60A 3FMPB 2QL5A 2JIQA 4I6JA 5ANRB 3PTAA 1MV5A 2YFKA 3GEBA 4FXPA 2YY7A 2VWGA 5AVRA 3IQWA 1SBIA 4MPJA 2YL2A 1ZD3A 4LHWA 3W3AD 4KK4A 2VP5A 4EGAA 4F3CA 1RZ3A 2HCJB 3ES9A 2W90A 4Y2SA 4C7JA 5JZVA 3QKSA 3AHHA 1AGPA 5IKXA 3CGWA 2W71A 3O95A 4Q1DA 1JHZA 1MNQA 1JDBC 1SVKA 2GXSA 4EI9A 2L69A 5J40A 4QG3A 3KT3A 3MTAA 2NO4A 2MSKA 4PWZA 1YI8A 3L1HA 5T3UA 2HQSA 3UNXA 1QH1A 3DVSX 3OIDA 3QVKA 3U7IA 1Z28A 4R54A 4TYQA 3U7EB 1JHOA 3DZFA 3NX4A 4PR0A 4D9BA 4O5OA 5BR8B 3K2BA 2C97A 1Z7GA 1TMGE 2R47A 2QJTA 2WUVA 3CE6A 2OE2A 3VYVA 1SULA 4IS2A 2B7BA 3FIUA 2AUTA 1NWHA 2H52A 2Y8EA 1PQPA 1T1IA 2Q3FA 1M8PA 3RKUA 3KUUA 1R8YA 1EXMA 1U8FO 1NGSA 1UADA 3CRMA 4RMNA 5LQAA 1LTKA 3AESB 4UBJA 2Q8NA 1KI6B 4JDPA 4Q9IA 3WLRA 1R12A 3B9RA 3I9V1 4CEJA 2QX8A 3E6AA 3GMTA 4KQCA 3HTXA 2AZMA 4BZZA 3H5RA 3F9IA 4AMUA 3PDIB 4N7MA 4YR9A 4B75A 2WJYA 4TZ6A 5IBRA 3CVJA 1YASA 2EIHA 1FDTA 1FX0A 5E1MA 1CDDA 3Q2OA 3KQUA 1H65A 4CQMB 2DOKA 4UOZA 4UMFA 2Y0PA 2D4HA 1K63A 4RHUA 2IY7A 4UEWA 3VZDA 5BN5B 4F97A 4B6FA 1GRNA 3DE2X 3WYGA 4FFMA 3CLSC 4JBIA 5DI9A 4P98A 5L7WA 4MWGA 1B6SA 4MYDA 3GLGB 1NATA 4X60A 2B2NA 5E4FA 1R88A 1XEFA 5EJ7A 3W78A 5JE8A 2WWRA 3VPAA 1D2MA 2N47A 3EVGA 3FRIA 4MW2A 3ADOA 5FBWB 1QTIA 5H4GA 4PN7A 4OBWA 3V8EA 1UKBA 4XDZA 3UUWA 3MS4A 1Q0QA 1JIQA 3QVUA 1IHDA 3I53A 2JA1A 5T41A 1B4DA 5CNIA 4MV4A 4TOIA 3TCXB 4B6QA 4HAYA 4D41A 4DRXB 2PAAA 1KO5A 2ZWOA 3EIOA 4C4OA 4CQJA 2WSMA 4P54A 3AOEA 3H42B 5FI5A 5G1NA 5EHXA 5A0FA 2GAJA 1CUUA 3UOAB 3H84A 2BFFA 3KL4A 1CT9A 1EDOA 4P86A 3AR4A 4MGIR 2HEIA 1ABFA 5F2OA 3U31A 2LIPA 5AKJA 1SCDA 3LHKA 1EFRD 3V8VA 1N5RA 2VNIA 4LSMA 3VU0A 1EA5A 4P2GA 3OEED 3FLBA 4YCNA 1X1DA 1R1DA 5FJIA 5TVGA 1XJ5A 4AWBA 5KNCA 3W9YA 2DCMA 4PYKA 1SBNE 3NG1A 4Y2JA 4JOBA 4QDXA 3JRNA 3TRIA 1XO1A 2NV0A 1YVEI 3G2PA 2NYRA 3EFBA 3OPQA 2QXUA 4OMFG 3DDNA 4PSUA 1M2VB 4WBXC 4P5PA 1R15A 2JJ2A 5FF9A 3F1LA 4EG5A 2YASA 3I1YA 1XOIA 2FMIA 2QU7A 2ZR7A 3HRHA 1Y5RA 4EHNA 4K6FA 1F4VA 4H6XA 2EZ4A 1KO8A 2H3HA 5DTQA 2P9JA 3LO5A 5KTSA 4C0WA 3DLCA 5KOYA 1BNCA 4L9WA 3WGHA 1U8XX 3IA7A 2GNOA 2WA2A 3W7VA 4A0RA 2AYZA 2GZ3A 1J9ZA 1KRHA 3OUZA 4PTZA 3AVWA 1K7XB 2ORYA 1DOAA 2FEWB 3NH6A 1XDBA 3B1WA 4ZTZB 1G4AE 1I2AA 1I7PA 1JR4A 5EINA 4ZICA 3T1VA 1SA0A 1G19A 1T6ZA 3W2HA 1NX6A 2QD3A 4KVFA 2J9ZB 3O8LA 1FDVA 3M1YA 1H94A 1YT5A 3B60A 2ZBFA 3EOZA 3SZRA 2CMKA 3AY0A 3RS3A 3HVKA 3SU8A 2Y67A 5BVGA 1D4AA 1E96A 1GRQA 3GNSA 3ZJ5A 1BKSB 3LAWA 1HTTA 4N7RA 4B8YA 4K9QA 4LX0A 5D1NA 2A0FA 2GFQA 2O20A 4R16A 5I7FA 1WXIA 3U1VA 4OQFA 1M72A 2BR3A 4KO4S 3VNVA 2FUCA 3HJFA 4JP8A 3AERA 4IIHA 1EUZA 1F1BA 3LOUA 4HDNA 1UDBA 5EOVA 1ZJ6A 4FD2A 2YTZA 2VTBB 2AR7A 1Q0HA 2EGUA 2JIDA 2RHBA 4RJ2A 1T36A 1M6VB 3TE6A 3UMBA 1GPNA 2NADA 1G21A 3GT3A 5K0CA 5G0TA 1XB2A 1FXUA 2YN0A 2Z5VA 5DOVA 1FFEA 2FYTA 4AJNA 4Z2AA 4I66A 4PPGA 3AHCA 1RZUA 2J9RA 1ZY2A 4BFSA 1PJQA 1U0BB 3GROA 5CLLA 2BM1A 5DNUA 4DQVA 4O4LB 1GAWA 2A9PA 1VSQA 2PT5A 4IXNA 4REQB 5CX1A 5J5VA 3MJVA 4I9UA 3T0IA 4H2DA 4QA9A 1T29A 5L3SA 1SUSA 4BXOB 2E37A 1OV6A 2OC4A 3WLKX 1TRHA 1W36B 4PAMA 1DFIA 4PG6A 1WE2A 3NETA 4X94A 1LKZA 5FOQA 3NHWA 1UOOA 3PEVA 1P1CA 3ZX4A 1GZVA 1BHO1 5IPFA 2I29A 1L3BA 3AHIA 1XU7A 3CH5A 1P4AA 1ORDA 5KYGA 4MI1A 3MHPA 2RB4A 4GZMA 3W5JA 2HCTA 1SBTA 2RK3A 1C0LA 4JC8A 3VQTA 4HEQA 4QGBA 1CR0A 3RIGA 4MUNA 2ZSFA 4BMNA 1LXCA 2BP7B 1BC5A 1KQPA 3N5CA 1Z0UA 2BKAA 1Y6ZA 3IQXA 2BELA 5IBQA 1XVIA 3PD7A 3SX0A 4CL8A 3D0OA 4WDRA 4EF5A 1Y5NA 2ZFUA 1W49A 3A4IA 2R5WA 1FCJA 1D2CA 3W3AA 4IVNA 2IYXA 4MUMA 3RJMA 1X7ZA 3ZLBA 4YT4A 1JLMA 3VSAA 1XK7A 5EQFA 4JJKA 4NJOA 4UBMA 4GZLA 5CB4F 4MWOA 4AECA 2I6QA 1YB6A 2GZDA 3UY4A 3N2NA 2WW8A 1MIOB 2HOQA 3R24A 5ESXA 4DV4B 4B35A 3DOOA 2WICA 1FP6A 1HTWA 3AVVA 1PI3A 2XZTA 3PIRA 1ZN9A 4HKTA 2WVGA 5C8YB 1MAAA 1S8OA 3WMFA 3BREA 1NFRA 1ZO8A 2NVUA 5EE9A 4AM8A 2XB4A 5F1KA 3NMUF 4JFAA 3M0EA 2PFGA 4OU4A 3FHTA 2JAOA 5FQNA 5TGZA 4A8PA 3X1KA 1DTSA 3FSRA 2RCNA 1JG6A 3UEOA 2VT2A 4RJTA 3GT4A 2I55A 1VIYA 3X44A 4IKEA 5KNDD 4EB8A 3AU8A 3E7PA 5DULA 2FJUA 3UQYS 2C9DA 3BMCB 3MTEA 4YAGA 3CYFA 4TMKA 4UPEA 1IVNA 1VKOA 5ED0A 1SKUA 1NJSA 2NZ8A 2VTEA 4C6SA 2EYUA 3LT1A 3VR6A 1WU7A 4LC0A 2GFHA 3H2BA 1CUHA 4CIXA 3WWEA 3NS7A 3SEAA 3GIDA 1H5QA 3ZEAA 5DM2A 1WB5A 4RGYA 4M54A 5KHLB 1HOTA 2KLBA 1MRNA 2AKYA 3PPWA 4JD5A 1Z4LA 2HC9A 4FOOA 2ZUVA 2BCGY 4FZVA 1VE1A 3V80A 4DNPA 2QN6A 5B2FA 2X23A 3DUFA 4D4IA 2BI4A 1X7HA 1ZU4A 2LR0A 4DCGA 4IZOA 2PUBA 3T1TA 2XNDD 3UK1A 4L3VA 1YCDA 3LXXA 1DAMA 1KE2A 4A82A 3JVIA 4AG6A 2DFNA 1FJHA 3HY6A 2RAFA 2O3JA 1QIDA 1YCHA 4AVYA 1IHOA 4H6WA 3ONEA 3UF0A 3HR7A 5F35A 4K46A 1COZA 1UIRA 4LDQA 1BD4A 3OZRA 4HGOA 2WAXA 2J0EA 5LIPA 5EUQB 2C0PA 1GOTA 5CD1A 4DZTA 1DBQA 3CXUA 3QEMB 2Q27A 4GD3Q 4O4HA 5D3ZA 5JRJA 2PZBA 1K0UA 1RJDA 2QV7A 1LX7A 5ALXA 2JBWA 4EUNA 5ILQA 2D1YA 2AMFA 4P4NA 4YAFA 1TC2A 2VQ3A 4M49A 2JEZA 4C4RA 3EVEA 3JYHA 4QDUA 4UDNA 3O8CA 1UDRA 1ZCBA 4IIFA 4QLBA 5LP6C 5LMUB 4H77A 2GZHA 1ZIOA 2WIGA 3ZCQA 5KI6A 1T0BA 2XZPA 3BF8A 3LLUA 3LYUA 5CJPA 2GCPA 3PLAE 1IOZA 4BX8A 2ZBRA 1WU8A 3V33A 1NRJB 3GHHA 1NG9A 3QW4B 3BYZA 4KDRA 4TV9A 3C3JA 4G07A 1S2LA 3UENA 4DV0B 2OHJA 2QXTA 1NM5A 3IS3A 4IG9A 4PXAA 1OY1A 4OHXA 1NTOA 1L4YA 2H5LA 3ZOZA 1FU4A 1OI7A 1CVRA 2IEZA 2LKDA 1V11B 4H7HA 1T2EA 2RC6A 1T9GS 1MT0A 4DA7A 1U2GA 3GWZA 2IHTA 5DE3A 3VZRA 5EHZA 4KE8A 2FI1A 3QHQA 1JFLA 3IHWA 3SC2A 4YRSA 4I6GA 4UE2A 2JANA 3C48A 3IHLA 3QX7A 4N5HX 4LSGA 4QC2A 5BSVA 3TL2A 1A8SA 1SUPA 3DOJA 4UNPA 5HTKA 5BN4B 4ALMA 4AS2A 4BAZA 4YMTA 2I3GA 3QVLA 4X95A 2PGDA 2QRLA 4BO9A 3DE7X 2ECOA 3AM4A 2X2EA 1NXWA 3L77A 4L5CA 5A2GA 1CKEA 4GBED 4F60A 1OB5A 5FR1A 2AFVA 3RBVA 4BO1A 3KYDA 2JLZA 2VXYA 1XVTA 2M6SA 2X0FA 3VVLA 3EGCA 1XIVA 3N75A 4B8WA 4D57A 2BZSA 2X9GA 1GZ6A 2AS0A 2LIVA 4KIJA 5H9WA 5J4KA 1G7TA 3IAS1 5KYWB 1NQWA 3ICEA 3T34A 3ZVRA 5BOSA 2WMDA 4WFQA 4J2HA 4LOKA 1TW2A 5DWVA 1J70A 3E15A 3KWJA 2PZFA 3V1LA 4CMAA 2V9PA 3IT2A 1XEWX 2GO7A 3LXUX 4RK6A 4EVSA 1IM5A 1B3RA 2Y1WA 2P9TA 1N34B 3WIEA 1DEAA 4M2LA 2W6JA 1WZCA 1VZ2A 5K0NA 4C0BA 5ALSA 4JXZA 2HGSA 4ZO6A 1ZH2A 4BLWA 3FNHA 4W8OA 4ZZ0A 5MGBA 2YWJA 1JQAA 2C4MA 1HQKA 2AW3A 3KM0A 2R85A 3Q7QA 1THGA 1Y3HA 4FFVA 3BWCA 4LGMA 4TTAA 1RWBA 4DN6A 4PGHA 3P0FA 5C3UA 1FFGA 1FMTA 1PTJC 1G8JA 1JU4A 3TF5A 3FPCA 3IT0A 4UNIA 1HEYA 3GGSA 3U4MA 1XDWA 4HVAA 4MRMB 2JKZA 4GQIA 4EKDA 1Y0BA 5DJ5A 2AZTA 4E5YA 1JP7A 1MKYA 1N33B 3HJTA 3M5DA 1I36A 4WNIA 5G40A 1QYCA 2IELA 1QB7A 3NM4A 5BVGB 3A9SA 1RKUA 2QJRA 3OKPA 5AJYA 5ETJA 1VSUA 4R1QA 1BOOA 2M32A 1E7YA 5HKAA 1EEXB 2XNCA 1A72A 1L7RA 5L51A 2A94A 2XGSA 1QGDA 1JLRA 4IHJB 3GPLA 1YUMA 4BFLA 1T2DA 3C7TA 3TW8A 5CB4B 3DLHA 2V6FA 3G2NA 1SQ5A 3HO8A 3THYA 1ECPA 2OBMA 2JD0A 5EPEA 5ERXA 4D8XA 1YMQA 1L7QA 2E3JA 3MWEA 4ZOAA 3E53A 3ZE7A 3AJDA 1OFVA 4PBSA 3OJOA 5JHGB 3NYIA 1E64A 2HSGA 1E3WB 2C4VA 4X1YB 2PUHA 5I6DA 3WKCA 3ZY2A 3O9ZA 4RHEA 5J2UA 1PLKA 1RD4A 1L7NA 1IZ8A 1YR2A 1EZ1A 1YL5A 4WIAA 3R7FA 1E9VA 4BFWA 2E4YA 2Z1MA 3FNFA 3B1FA 3VDMA 1CY8A 2UYYA 3B1XA 2WIJA 3F5MA 2VDVE 2Z2XA 1H4VB 3P52A 1U9YA 2FWAA 2EJTA 4IP0A 5BUCA 1POWA 1PN3A 5J5AA 5BWMA 1KIFA 1H0SA 3DDWA 4M1TA 1XXHB 5TNXA 2MMCA 3I9LA 4U7FA 1NX9A 1Y1PA 5K09A 3ENNA 1XFDA 3LFHA 4HS9A 1FRFS 4ZOQI 2ISCA 4O2BB 5IABA 1Q0ZA 3HKBB 5D00A 3IKLA 1V41E 2ORVA 4ND6A 1CUWA 2JS7A 2QUHA 5DTMA 1UM9A 3TMKA 4ERNA 4QBHA 2V97A 3ONNA 1KDVA 1TYBE 3TTTA 2WTNA 3JQRA 4WZZA 4F93B 1OI2A 1KY3A 1C7JA 2B8NA 3BE4A 4JQSA 4O4LF 4BVLA 1JYSA 3ZD7A 1E7RA 4IILA 3U60B 3DFFA 5FBLB 1BU8A 1IH8A 2O2YA 4KIGA 5EWLA 1PQWA 2HSWA 5LIRA 3N2GB 3WA6A 3MOIA 4Q1AA 1AU9A 4R1SA 4IVPA 1SKBA 1ZL2A 1KVUA 4JYBA 1W48A 3QLEA 4M7OA 4EP1A 4EG6A 1JYEA 4FGJA 2H57A 5FA6A 1YRQA 4YWJA 4KX3A 2X8JA 4U6SA 3SHTA 3FPFA 1KI8A 4D56A 4AYXA 3IUMA 3L8EA 1L9KA 1K7SN 2DSNA 4U2DA 1CNEA 1K66A 2JGNA 4YEDA 5T6BA 1F6DA 5ILOA 2HFKA 3IMCA 3KT8A 3PF9A 1PUJA 4I1RA 3UV3A 5B3KA 2ZZMA 4HWRA 4A27A 3ZZUA 5JFGA 5DVZA 3F71A 4B84A 1KMQA 4LVNA 3K20A 1TJNA 4L15A 4XPIB 5I7OA 2XSZD 3CY6A 4R84A 1Z0SA 4GGMX 1VA5A 4MQ6A 3QUSA 2WJJA 5CEFA 4WLEA 5GQSA 5K3SA 3WXMA 1VIDA 2WKRA 3P1JA 5FKJA 3KKMA 4J90A 4D8UA 3LVRE 2QSYA 3C5CA 3OJEA 3WXBA 4DMFA 1U5BB 2D2EA 2IQIA 4EGFA 1GY8A 1YJAA 2PKRA 2ZWAA 1KMMA 4EQ6A 3KSZO 3LBAA 3MINB 3ZNQA 1TLTA 1BKYA 1NKVA 5IM5A 2ASEA 1X14A 4QTUB 4RMIA 5CHYA 1Z8DA 3CN7A 4PCLA 4EHJA 1NQ5A 5JEDA 1PWHA 4DCUA 1FFDA 4WLVA 4EY3A 1Q0UA 1T8WA 2GAIA 1O0SA 4QYMA 5FTKA 2ZKIA 4NCJA 4UREA 4ZOLB 4B3SB 1GPUA 2Q3LA 3EZGA 1S2IA 5BQXA 2VYVD 1SK8A 2YWBA 1GPKA 1MC8A 1L5ZA 2WOOA 3AIKA 3D59A 4H6PA 4OP1A 4ZHQB 2QD1A 1KJJA 1BN6A 3IHTA 5FLEX 3RVJA 4G5SA 1L4KA 4LRXA 3UAZA 4N0MA 1A9TA 3P20A 5KDLA 5DISB 2IHZA 2PWPA 1RLTA 3VUEA 1R5JA 2PE5A 4BX0A 3JVUA 4XE5A 3RNLA 2DTEA 3E84A 2G8NA 3U26A 2VQDA 3PBKA 4NBLA 3V9PA 2VNAA 4WNAB 4MVJM 1FU8A 1BOFA 3GN2A 1EH5A 4P53A 3F2VA 1LB1B 3DFIA 3E1KA 1YQTA 1J7JA 2KE5A 4JENA 1A8PA 3TIXB 5GAJA 3WK7A 3KB8A 2V54A 5JT1A 3CF6R 1UBTS 3HU2A 2QB5A 1ZAKA 4D1YA 1EB8A 3CNHA 1XAJA 3RYHB 1SIWA 2R8RA 3ZDCA 2QYOA 4RTQA 4GIBA 1UBMS 3H2YA 4NYMQ 4G4SO 1QFSA 1NBME 2WVHA 1GYRA 1UWCA 4LTDA 1PDWA 3K16A 4YRAA 3QSGA 3RUHA 2WG0A 4FE3A 1FMLA 2F43A 2QA5A 4IHAA 1CVIA 5H4HA 5K6AC 2YXEA 3W7BA 4J0JA 3ZE0B 4DWWA 1L5RA 4PYMA 1N2EA 4F0JA 5KINB 2WF6A 4MIKA 4QLAA 4NENB 3WWDA 4ZDIA 3AVUA 2IZ7A 1D4ZA 1IN5A 2BISA 3DFZA 1MQSA 3V7UA 1GT91 3ECSA 1P39A 1NT4A 1DAGA 3LYLA 4HFRA 1VPLA 5AKGA 1A5TA 4A8HA 3L41A 4CLRB 3N2YA 1TO1E 4XWOA 1X1EA 5DNYB 3D6NB 4H7PA 5DCLA 4BYMA 5IAOA 2ZSJA 3AF3A 1FJ2A 3Q7PA 4QICA 1T15A 1TJPB 5J2TB 2O8DA 4ZV7A 4RHXA 5HRCA 3MJCA 5LKAA 3KKZA 2Z4RA 4NE7A 2W2MA 2AFHB 4P32A 2W43A 4XWAA 1DARA 2IIQA 4QNNA 1SVLA 3UJBA 3ZPXA 4DARA 1ZMXA 3RKSA 2PXHA 1SFRA 1OXXK 4PAGA 4DIKA 1UK7A 3K4HA 3DBRB 3QQPA 4A23A 1CULC 3MK31 2X19A 1JG7A 1CD5A 2QZPA 1T5SA 1WXWA 1JZQA 2DERA 2JZOA 1YAHA 4NC9A 1L8XA 3ESDA 4OXRA 2R44A 1UINA 3A31A 3T1NA 2ZSEA 3FBTA 3SJ7A 2P6PA 1QIKA 1EGHA 2KPOA 1JIKA 1NVDA 3LFUA 4YAWA 3W6UA 3M89A 3CBQA 4KLNA 1FW8A 2P69A 3SS9X 5KTOA 3QLVA 1WY5A 3GUUA 4LYYA 3GA5A 1CU1A 5DLQC 3SK0A 1P9WA 4ETIA 4B17A 5JW6A 1E1QA 2BDTA 3KR0A 4J0FA 4Q93A 2QXYA 5CVUA 1U7HA 3BXGA 2NT3A 5HK9A 4Z7JA 4JX9A 3BFKA 5TJHA 1KS2A 2ZB3A 2O3RA 3BTOA 3L6BA 2QU8A 2B21A 2JGMA 1B1AA 3OOWA 1YDHA 4W6QA 1U3TA 4C4PA 4B32A 2OQIA 1DT3A 4Z8YA 2AZ4A 3ODPA 4ZV9A 1CJVC 1W73A 2LPMA 4NJMA 2HUNA 3BIXA 3ED5A 3ICOA 3ME5A 4JZYA 1UPXA 1ELOA 1YB5A 4LOLA 4BP9A 4F4CA 1ZDMA 4Q39A 2R8EA 3BBLA 1N0IA 3C97A 3DP7A 2AOVA 4IFIA 2PCJA 4XR9A 4GMXA 5EMJA 2W2TA 1YBHA 5G3YA 5LP6B 1VB5A 1YZUA 1QDLB 4FHZA 2QX7A 1WAMA 3TSOA 1SOWA 1YZQA 3JZIA 4M1KA 2WHPB 4I4IA 2HV9A 3CLTC 4GI3A 2CFOA 3EMVA 3ISVA 1T9KA 1PEYA 1JMYA 1PV1A 1DJMA 1CQIA 3L7LA 4RAOA 1JXAA 2BBOA 4PZYA 4EITA 3JATA 2NUTB 4CV2A 3ROTA 1C7RA 1XVLA 4B4DA 1ZH0A 2ZSHA 3MBOA 3D2BA 4MKRA 5DGIA 2HNAA 2BPOA 1KSGA 1U7UA 3WLTA 3CLRD 3HYLA 1O89A 2EOAA 3CCCA 4W5NA 3P94A 2HO4A 3M7IA 3QYJA 2DBZA 4NMMA 1IY8A 5K0JA 2C2ZA 4RZIA 4MQFB 3K70C 3EISA 1IJBA 2FWRA 1B76A 3DS8A 4A0FA 3KLMX 1FC0A 2PH3A 1EVJA 3K5PA 4LI0A 3JAKB 7YASA 2I1QA 1NLZA 3TTWA 1HNZB 3U1BA 3B2QA 1L3IA 2DY0A 2PPLA 3E7DA 1BEZA 3TUZC 3KHKA 1BCSA 1OVMA 3IEIA 5CVJA 4A5OA 4L8YA 2BFNA 2CD9A 1HV8A 4JQCA 1OYYA 4U5XA 3LY8A 3SMVA 5L53A 3SX2A 3DLAA 2RGGA 2ZRCA 3F47A 3H1TA 4MI3A 4NXMB 4TKUA 4J4BA 1E2KA 1HEUA 3FI0A 1XMIA 1FLVA 4LJAA 2WAMA 4LS3A 4ND5A 5COBA 1YL7A 2IX9A 3VR4A 2IIBA 3VUFA 2W6CX 1EVKA 3SBOA 5EJ2A 1R6DA 5JADA 4C7MA 1ID8A 2YJ6A 3MCVA 3T7AA 1E0AA 3MWEB 3AXSA 1S9DA 1A71A 3HLTA 4IXTA 4OU5A 1UBFA 2AGVA 4WLOA 3KHTA 2BEJA 1E3WA 2OHXA 2R68A 1R4ZA 4JS0A 4X1YA 2GFIA 2GUWA 1P8JA 1XRQA 1P7WA 2V6BA 5A04A 4C0KA 4BMOB 1IXSB 1YULA 3IUSA 4LOIA 4YRCA 3GEPA 4IWXA 1KC1A 5T4FA 1NYLA 1UWVA 1YK0A 3DE4X 3UAXA 4BUCA 1C9JA 3QPVA 2NV6A 2IXDA 3PFKA 4OTZA 4QUEA 2VHWA 1LPNA 3VV2A 2VZ8A 3I23A 1ZGHA 2P62A 3OSUA 3EEYA 4PCVA 1SC4A 2DJ5A 2MU1A 4IDCA 4CF3A 5HSGA 2K7FA 2QTZA 3IO5A 4HWPA 4LMPA 3OO1A 4QQRA 4JR2A 1G291 2P65A 2VUUA 3DJFA 4UZEA 1Y37A 4AD8A 4ZI7F 2UU9B 1HR0B 2FQ1A 2QG6A 2JFYA 1MX1A 2QTFA 2FSGA 3L79A 4UVDA 3VZSA 4BCDA 3HM2A 4RENA 2XOKD 2GSWA 4UAVA 3NHSA 2NX2A 3EYWA 1LJUA 2PVSA 2DULA 4MYRA 4FW8A 3DWFA 3EXAA 4INZA 4I4LA 4EFDA 3H9JA 3JXEA 4DIMA 2D4AA 4XIFA 4DZZA 5K4GA 4JBHA 1ODIA 2IP2A 3PGVA 4J8PA 4QQ8A 1DSSG 2ADMA 4XASA 3SOZA 5KQLA 2QF7A 2XUZA 3L0BA 4OATA 1UFOA 3CCFA 5TS3A 2FW0A 2O57A 3EAFA 2G9RA 1SXGA 3N6RA 1EINA 2H1RA 3BGVA 3KWLA 4JBWA 4D80A 4P34A 2O2IA 5HDQA 3D7KA 1NBMD 4F71A 4M8IA 1XTBA 2AQ8A 3Q4GA 1GAXA 4OHRA 5TS2A 1CDOA 1EFPA 3CM0A 3FYUA 4LV8B 2FSVC 1JEYA 4BKUA 4R7ZA 4ZYVA 5K99A 2DGDA 2XX3A 4RA9B 2ZQ5A 4NPHA 3W06A 5B4VA 5B6PA 1PDOA 1P4GA 3O94A 3QJGA 1THTA 2HMYB 1T6BY 4DVGA 2BZ1A 1R0YA 4B3IA 2JHPA 3NDJA 1HDOA 4KOEC 3LBIA 1L3CA 3MS7A 4XPIA 3ZGOA 5FUVA 1N5IA 1SAYA 1O4VA 3T3IA 1IN7A 1AXRA 1U0GA 2YHBA 2CLKB 4I9HA 4RD3A 5DWDA 5AOVA 4MVJP 4Z53A 4PQRA 4C1BA 1YVUA 3HWWA 2GCEA 1BXRB 3DO5A 1RYBA 3HFGA 3MMXA 2FEAA 3QW2A 4F8EA 5BN1A 4EQ6B 3FDXA 4LJ4A 3PXGA 4CTJA 4ZOLF 2QUKA 1J9EA 3JWIA 4BO6A 3DL4A 3QFCA 1PVOA 3RYIA 1DMRA 2A5JA 2RKBA 3TBFA 2IYEA 3UTDA 3ZTYA 3IAHA 4KODA 5E0KB 2GERA 5AW6A 4XRGA 2A33A 5I8WA 1QH8B 3KB2A 5G02A 4DS3A 2PA3A 3B1JA 3K2QA 1H42A 4QPZA 3TOZA 3PC8A 3U4CA 5KYKA 1VE6A 3VKVA 3WRVA 5TARA 4R1LA 1Z0JA 1KI3A 3ABQB 3QMWA 4YMVA 5B36A 1N5KA 2HT1A 4XJVA 1ZJWA 3T8YA 3UJHA 3ZV3A 1HDCA 3WYCA 2YHUA 2QD5A 2IXBA 2ZJ4A 2ETVA 2VKTA 4WOPA 1JEAA 2ACKA 1J2YA 4JT8A 3TUJC 2IU4A 3ZHQA 2G0AA 1OWOA 3HCEA 2Q4TA 5REQB 3R1IA 2GBLC 1R2QA 3OQOA 4GC9A 4DIBA 1JG3A 4UBIA 5EIAA 4OQLA 3EFEA 4R2JA 4Z4GA 2HWKA 2ZYDA 2KI5A 1TJ5A 2AG1A 3MUFA 2VK2A 2FPKA 3TTVA 4N40A 1E3TA 5DHUA 1PL0A 2YV2A 3M6AA 5IJ9B 2B3TA 3HA2A 1F48A 1QVRA 2PNJA 4GPBA 1V4VA 5CXXA 1L8QA 3ICPA 3L8YA 2XUFA 1IXKA 2V6IA 2VSQA 2I78A 3FUWA 3NFYA 3EW7A 1M5UA 4MRPA 4RV4A 1BE6A 1CZKA 4PM4A 3H18A 3TQIA 3IDSA 4NYJQ 4HMPA 2NSHA 4BQNA 1C81A 2QP4A 1FDIA 1QUEA 3FZNA 1BSVA 4OM7A 2BFWA 4QYSA 3KUDA 3HUFA 4PONA 5FHRA 2CHUA 3IXQA 5JPIA 1C0IA 1JB1A 3CRNA 4NQRA 4L4ZA 4ZU1X 3CNNA 1XJ0A 1JJIA 2O8BB 5DT2A 5J2TA 1D09A 3LI2A 4XGNA 5MHTA 4JBGA 5J2TF 3B3JA 3D6TB 4QUHA 4C08A 1HK7A 4OI2A 4Z3KA 2C58A 2I22A 4KR2A 2B61A 4OB8A 3VTZA 3WQSB 1L4NA 2CUZA 5EJ6A 4BU1A 2XWPA 2FMFA 3SHQA 4UVHA 4X1KA 4RZHA 1I4DD 4DV2B 3CR3C 3UPUA 4R1TA 3UFBA 4JCOA 2Z9BA 1JEQA 1RQXA 4JP2A 3R9KA 4BFZA 1PNQA 1Y8QB 2JAQA 5LQNA 1LJ8A 4A3SA 4FMCB 2JLSA 2CZQA 4M21A 5BNFA 1ODFA 2BTEA 1F12A 3UFXB 4CR7A 1WETA 1W1UA 5DN6D 5MN6A 4GXQA 1D3AA 1U8YA 2ZCVA 4JKIA 1Z8NA 3JYOA 4MW6A 3KTAA 5FT9A 3TKLA 3TRFA 2IBSA 3S27A 4KPGA 4N5IX 2JJQA 3ZQUA 1DMSA 3WGJA 2FPXA 4GM1A 2QBYA 4TMWA 5ALIA 4LYAA 4GBGA 4V0ME 1Z3IX 3L6RA 2W70A 1GDTA 3C7KA 3N6XA 4MA4A 4S12A 4RPJA 5J5CA 3OKAA 2AOWA 1YDFA 1KFBB 2E4XA 1I32A 3HB7A 4D6YA 3R0JA 3AFOA 3OESA 3QY0A 3RVMA 5BRAA 3KR9A 5JXJA 3NHZA 1A0OA 1XAIA 1ZA1A 2ZVQX 2E0IA 4W6ZA 4CODB 2WJZB 3BZUA 4HDSA 3ZWNA 3PC6A 1M74A 1D7AA 1ZVMA 5BSKA 1M2GA 2O6LA 2WJGA 3BGOS 3ZY6A 1AZLA 3RSHA 3CUSA 3UT5B 1RYNA 3OX3A 2YXBA 2GZAA 3ZI0A 4PX5A 1U65A 4LV6A 3H9UA 3LYAA 4G3XA 4MQ4A 4HH4A 5A6SA 2AW5A 3TZBA 2GB4A 2JARA 2FV8A 4ZCMA 5IG2A 1PCXA 4GM0A 1XZNA 3PRKE 4TXNA 1C7QA 1HFKA 2BFCA 4JSYA 4XYGA 4CM9D 1N2XA 3I2HA 5LXTA 1ENZA 3E82A 1QKIA 2BEKA 2ID4A 3MMZA 1IHUA 1AG9A 2BJHA 3UQZA 1FYWA 3OQ1A 3UJ6A 4A2CA 3SFTA 2NSYA 4B4VA 3MCZA 3CH4B 4NH4A 2PSDA 2ZUUA 5HM8A 1QOQB 2E4VA 3H1BA 2X58A 3UA4A 4CLDA 1JDSA 1TJ4A 4ZTBA 1UBEA 2XZDA 4E22A 4ETMA 2QL7A 2OPHA 3BH0A 4ED9A 2Q7XA 3K09A 2F8LA 2QD2A 3PPXA 3A28A 2NPFA 4KKVA 1IQUA 1KAHA 1VPEA 2XV1A 4TYYA 2XQJA 5CNJA 3X1YA 5AK5A 4F8YA 4J1TC 4EHIA 4K3UA 4ASUD 3S2ZA 3AEKB 1X70A 3M2PA 4BWGA 3H11A 3ZK7A 2EDCA 2AJDA 3EVCA 3R5HA 4J0CA 3LSTA 1DUIA 2XKAA 1HYEA 2RGWA 3DAFA 1O8CA 5HF8A 1TD1A 2UYOA 5TPZA 1YKSA 1HC7A 5IASA 1LQ2A 5A02A 5AVSA 4CMGA 4OY3A 4DADA 2QLFA 3T5BA 3O7WA 3TNJA 3RK0A 2R8YA 3DBLA 2CJXA 2BHNA 3O4FA 1BJKA 2ZANA 1ZBDA 3U61B 3PNKA 1GV1A 1CRLA 2JCSA 5KYUB 1SXQA 4IAOA 2DFPA 4BASA 5AJHA 1SXJD 3WV4A 4ARCA 3SS8A 4CDNA 3R5TA 1TADA 4RGQA 1OREA 3PC4A 4FKBA 1Q0SA 1YZHA 1E2QA 3EGXA 2G7MC 4B81A 4QHSA 3AKDA 4G09A 1ORHA 4N0EA 1GQ2A 1CNMA 2VWPA 2G25A 2JGAA 4ZZ1A 1X74A 3SICE 3WLMA 4G8CA 2OXTA 4Z86A 3RU2A 2ZTSA 5DW3A 3SXUB 5BSGA 1B15A 1J8DA 5AH0A 1K7YA 1RJFA 2H7CA 2ZE8A 4HDKB 1JLLA 1TUEA 3OM1A 3QE0A 3I8OA 4MWDA 5EP3A 1XMOB 4RF5A 1QFXA 5DEIA 1H6CA 1EG7A 3LECA 1RS0A 4IQ8A 3U17A 4MJ7A 3IE1A 5AI6A 1HL3A 2V9CA 5F21A 4QBFA 1XN4A 2IXEA 3F6CA 1PR1A 3UUEA 1U6JA 4GX5A 1ONSA 2I2WA 2Q49A 4WWHA 3FI9A 2GN4A 3QTTA 5E4YA 4OHUA 4UMVA 2ZXUA 4L08A 7MHTA 2BI7A 1U2EA 4FGWA 1NLUA 3PKIA 1RAGA 1EQAA 1PJLA 2DECA 3PDWA 4IDPA 1G6OA 4P7BA 5LZ5A 3T3DA 5TQ0B 2HPAA 2E5LB 3QA3E 1V8BA 4EB6A 2BBWA 2VTVA 4OLAA 3PJDA 1Y33E 4Y6GB 3G8AA 3H7AA 4G84A 4EG3A 4LF6B 3CB4A 1ONPA 3KNZA 1VGQA 4DEVA 1TO6A 1L5LA 2BI8A 4OUKX 4B09A 4QOEA 3GJQA 3H05A 4KE7A 2GESA 3HLKA 2YVUA 4OSOA 4PRZA 2O8NA 1U9IA 2G9NA 4AROA 4CEIB 2RMKA 3RASA 2XVMA 4NDZA 1CJBA 2AB0A 3UO8B 4D5EA 3EWNA 1Q0TA 3KZXA 1L4FA 3FYUB 3R3WA 5BR7A 2ZAIA 3TSWA 1SOMA 1AK2A 1EKXA 4MP3A 3I76A 3WDLA 3AFIA 3QMVA 5CTAA 2GT1A 3STWA 1C1DB 1L5YA 4LK3A 1XT6A 3OFNA 4WKCA 4YUVA 1NC3A 3BD6A 3NTOA 4I1OA 3T3OA 4C0XA 4CMKA 2VAMA 4RTOA 3GLGA 2VSXA 4DJDC 1RT9A 3MXOA 1W6UA 2MSEB 5C52B 4GZ5A 3ETJA 1JHMA 4F2HA 2P4UA 1XGKA 4JVLA 2Q6IA 3WHLA 1DL5A 1N7HA 4ARUA 4KXNA 4XJXA 5IDYA 5M7EA 2W8ZA 3LDFA 1NVFA 3I28A 1E5DA 1GAEO 1N25A 1I5OA 2DC1A 2WIBA 3EGEA 1U11A 3I5UA 3PCXA 2IH5A 4EYEA 4FC6A 1T26A 4K9OA 4RMGA 3GEHA 4IX1A 4QQNA 3I6ZA 5B1EA 5JBNA 5KOJB 2JJYA 4CM4A 4UAGA 4F3NA 1FP2A 1IWBB 1AB6A 1YJQA 3TZ6A 1J2UA 1II9A 2EJVA 2R84A 3KAPA 4Z1MA 4F4IA 4G0VA 1I0IA 3GARA 1DTWA 5DTIA 3GUZA 5L3ZA 2WTMA 1VCHA 1NONA 2INGX 4OHFA 2WWIA 2B36A 4AKTA 2YC4C 3A27A 4DY6A 5FDFA 3JD4A 3DKVA 3AL2A 4Y8VA 4HGQA 1UBGA 3EF1A 4HSEA 2AJCA 1OX6A 3X1ZA 3FNIA 5ADWA 2HPZA 5GJBA 3BL8A 2VRNA 3EXHA 5A7FA 1Y42X 1Y4AE 2XIQA 1DC3A 2NYVA 3DYBA 421PA 3JU3A 1D2RA 5A5DA 1Z88A 3HCWA 1HF3A 3FA2A 1R00A 4YFVA 4DMRA 3NGXA 1ZD8A 3KJNA 1UT8A 3V4VB 3OLZA 3SS7X 1TUIA 5AK4A 3GMDA 2HPVA 1TAHA 2B98A 3LDUA 1C3XA 2P9CA 2FQQA 4C4TA 2WIDA 1QH9A 4X97A 2VDJA 3U5ZB 1GUBA 4G9GA 2WYOA 4LYEA 5JZ9A 4C2TA 2YWRA 3R3VA 3GDHA 4HAOA 1VYHA 1IBMB 5FUBA 5EWJB 2OQRA 3W5AA 1UEIA 3EBLA 5AO9A 3EVNA 1FMJA 2OCYC 2ZT5A 5JJLA 2XTMA 3I64A 5ESRA 3VX4A 1DC5A 1CLEA 1OIWA 4OJKA 1ZGZA 2A86A 4R2LA 4R41A 1PQUA 1O6CA 1V3QE 2HKIA 2IOYA 4M1QA 1N9ZA 1NC1A 4OJYA 2YOFA 3OIGA 3SSOA 1WF6A 1RBMA 1T8TA 2IUYA 3KLNA 1Z75A 2CVPA 1J8VA 2Q5CA 1AS0A 4L2IA 4LQLA 2AV6A 5LQDA 3K5WA 2BSQA 2KJQA 2FW7A 4YJ3A 5IC4A 4J9VA 1GPWB 1W85B 1TYAE 4TUYA 4ZC8A 4GX2A 3SF0A 2P0AA 4YV7A 3AG5A 3KOYA 3PUZA 4JB0A 4R9UC 2ZAGA 4GKAA 1AKMA 4S0XA 1QJ4A 1Z5WA 2FHPA 2Q4RA 1Z4KA 3ENKA 1GDHA 1W0KA 4CM1A 2R5FA 4EATA 5FUQA 2FN7A 5KSWB 1FA9A 5U1PA 3G2LA 3K73O 4ZCRA 2JW5A 4JL8A 3IP7A 4P6VF 1W44A 5ICCA 1HG0A 1EQUA 4AKEA 2ZRLA 3GVPA 3IAM6 4HDNB 1RPJA 4YJGA 4DMKA 2JGDA 3FTFA 3AZPA 4B3JA 5HMLA 1H4QA 4UQLA 1DADA 1TM3E 3ILSA 1TNDA 2EFCB 1CHNA 2DQ4A 3KAJA 3SJCA 2HJRA 3KXPA 3ZWBA 5JYDA 2BGWA 3ED1A 3LF1A 4QNRA 2XWBF 3SHFA 4ZT4A 1DAPA 1IZYA 1ORIA 3LTNC 3THRA 3BN3A 4Q9HA 3MJ4A 3OZIA 3QA9A 3V2HA 3OKFA 2QPLA 4LDJA 4XGIA 1K3TA 2P4QA 3PQ5A 4IO1A 5H3HA 3B70A 1A04A 2EZ9A 4EVQA 1E4VA 1WXXA 3Q85A 3DLPX 1YS1X 3HV0A 4TS9A 2PU5A 3I45A 4OEHA 3JAWB 2VO1A 8MHTA 3RU3A 1YQUA 1M2NA 2FZEA 4D3XA 3A1TA 4TRMA 3IH5A 3R40A 3U7JA 3FSGA 3UXYA 1SN7A 2CBXA 5LLDA 2Q2WA 2NG1A 2QN8A 1K5GA 3CLRC 3DAHA 3NP9A 3Q98A 3WFZA 3JWHA 1K8ZB 2J9FA 3B2EA 1TEHA 4FR0A 2D1FA 1GTZA 1KGDA 5BWBA 2Q2VA 3DL0A 2VZ9A 3NVAA 1NP3A 5GZ1A 4M7RA 2ODTX 1H2HA 2OAEA 4MUBA 2OCGA 4IZHA 5HILA 5A6SB 1OKKA 2ROQA 2HT6A 4FX5A 1QNFA 4Q16A 1T6XA 3QUAA 2H2DA 4RTKA 4IQGA 4CQNA 2YW9A 1W5FA 1YRLA 3OTGA 4F92B 2QGFA 4U1RA 2GXUA 4MAAA 5C46F 2RHDA 1N6LA 2GILA 1M2OB 1YJBA 4W7SA 1RPZA 4ZA2A 3A8TA 3HKDB 3L40A 3I6BA 1FNNA 5U4QA 1XZMA 5C7IO 2E9SA 3WB9A 3EW9A 1ZM2A 1I2MA 3HJRA 4GR4A 4M1WA 3R7LA 1I1HA 1V7PC 5JXHA 3LP8A 5JSHA 1V3UA 4BRUA 5I7HA 5AICA 2WTXA 2G5CA 3IYLW 1AUPA 2RBEA 2AC7A 3LS2A 4KFUA 3UTCA 4B6SA 3GU3A 5LNK1 4EPVA 3JV7A 1E32A 5FA5A 4E5NA 1YMVA 2M2IA 4RPHA 2LCIA 4TT3A 4OQZA 5CXSA 1RCTE 3AEKA 3LPAA 5DP2A 5ENVA 1AO3A 1V16A 1E94E 2C9CA 5JCJD 2WQ7A 3FPGA 2CVHA 3ACBA 1IONA 3BXZA 2W6ZA 1CQZA 3I72A 3NTQA 4L51A 4BNVA 4B6OA 4GE0A 3GK3A 3AK4A 2PFKA 2QAGC 4L27A 4KR7A 4J1TA 4JNKA 1XMVA 2QRQA 4RLQA 1H2RS 4DWJA 4FHGA 1XR3A 1QV9A 2X1VA 4RA6B 2BAGA 2CKDA 2ILVA 3ABRB 2QQGA 1EVLA 1ZCAA 2DHQA 1HKUA 2ET6A 5IU6A 4IIJF 2PKEA 1A7JA 3FCCA 3WJAA 3MGGA 4P0PB 2FQWA 2RARA 3HP1A 1T2CA 4RIIA 1GNRA 4HGPA 1ABBA 1XYYA 5C7YA 4XJSA 3ZLTA 5MN4A 1B43A 4I9NA 5SZKB 1BHQ1 1Q57A 2D8MA 1EDZA 4Q4AA 2XCIA 3AOGA 1CB0A 4G97A 1B14A 2ZI9A 3K1TA 1Y1QA 2ZS8A 1YDMA 5DX0A 1PKXA 1WABA 4CVNA 1Y4ZA 5LQKA 3TFOA 3PDIA 2PKWA 1LRLA 2F8TA 4AP6A 5DV9A 1KARA 1Z06A 1Z0FA 1VMKA 2E7ZA 3UB4A 3FTNA 3H8VA 4K9SA 5DBHX 1ATIA 4KHPB 3NEPX 2AXPA 2JAPA 3B12A 3SZ3A 3IEVA 5CM9C 2QROA 1SVOA 2RGXA 3I0ZA 1H0KA 2CFIA 1KZ4A 1AJEA 3CVVA 3N76A 2AEJA 4G65A 1BX1A 5TT1A 4HNVA 3S5JA 3TPCA 2OYSA 1ATZA 3AI1A 3IAAA 5JI3E 3LX5A 2PMDA 2EEZA 4XI9A 1YC5A 2A4KA 5NULA 1L5HA 3ORQA 3JARA 1IB6A 1YDGA 3OU7A 2KX7A 3D7RA 3INYA 3MRTA 4TTRA 1ACLA 3VJRA 2D2IA 3WGIA 1W4RA 2AL7A 3A58B 3ET5A 4N18A 1MB3A 2C7BA 4ZN6A 5LOVF 4YB8A 2ZR9A 3GEIA 4UUPA 5JO9A 5KS2A 4ONEA 1T0JB 1YVPA 2YMLA 4MLCA 2ZAYA 3DFMA 3DSRA 1KY5A 3LSYA 1G8GA 1TA0A 2B92A 4LZLA 4CKEB 4CEIA 2AXQA 2DQZA 2R48A 1DQPA 3HKCA 5F64A 3SYLA 1YTLA 4MDFA 1U1IA 4GF5A 4PPYA 1EFHA 3E5MA 1EFCA 2EFJA 4TUYF 4PTYA 2OHHA 2B9VA 4IEFB 4CW7A 1BRTA 5FBQB 1INLA 4TV9B 4ZVRA 4ZXFA 2G1UA 1G6HA 1P4JA 1JVSA 4MJXA 3UV7A 1Z4IA 3VR6H 3HDHA 1TQ8A 3AGPA 2ZS9A 1E6CA 3ICCA 3TIVA 2UVDA 4QBTA 1A2KC 1XAGA 1P45A 1D0VA 1BDJA 4DIUA 1N2BA 2UUCB 3F6PA 3WC4A 4PS0A 3RANA 4WBNF 4F91B 2TMKA 5GINE 2V7XA 4PFSA 1F7VA 3MGAA 3AM3A 2F9MA 2VDOB 1OLSA 3N9IA 1VJ0A 1U2QA 3E1SA 4LJRA 2JDID 1AA9A 1E79D 5TY0A 3UV6A 2XSZA 3F46A 5IUJC 4S04A 2ECKA 4WASA 2CFSA 2E5FA 2IE0A 3L7OA 3IVRA 3V8NA 4EYKA 4WJLA 3ZWVA 2JCGA 3L4JA 2YIVX 2QV0A 4KSYA 2B6HA 3MYYA 4EVRA 2XGJA 2EKZA 3QLTA 3DEKA 2G9UA 2VTKA 3OVMA 3B5JA 4I1IA 2ZYVX 4EI2A 3NCTA 3BDAA 3H2SA 5AKYA 1H0RA 2ERXA 1LI5A 1XTTA 3MB5A 4PX2A 3E7XA 5ITZB 5ILGA 2HA4A 4Z7NB 4C43A 4KYTA 4MVJE 1DG3A 4PZDA 5IULC 4P7KA 4KFCA 3BJMA 1Q3HA 2PV7A 2PKYX 5IAAA 1PV4A 1SBQA 4G5FA 1BX0A 3QF4B 5I8ZA 4BPBA 2H31A 4B46A 1JKXA 2JFFA 3L7CA 5DHQA 4YMSA 1Z2AA 5K3BA 3RHFA 2R7AA 1DC7A 1CJCA 1AK1A 3N0WA 4RK7A 1E3QA 1VJTA 4C06A 4H1UA 3ZWQA 2QRNA 2ZIXB 4Z8XA 2EW8A 5AM0A 2C07A 4WOKA 4EFNA 5KU1A 4FCVA 1J24A 4FFBB 4J9UE 1SH7A 2F8SA 1JDJA 5EZ6B 5ITVA 4Z4FA 2XVXA 2G1JA 5BQOA 1E9CA 4TWIA 3C8DA 1Y8CA 3FYCA 3Q3IA 4XX1A 6LDHA 5SYNA 1X1AA 4NPAA 4KBYA 4QOGA 5EWJA 5FV4A 3KOOA 1LLDA 3O2QB 5CVTA 3EA5A 1UFRA 4YC7A 5E4JA 5KYYA 1FJGB 4TS4A 3V4OA 4ALNA 1QPGA 4EMBA 4DV6B 4RD0A 4GL4A 3L8GA 3GEEA 2EZTA 2I03A 3SEQA 3DL7A 3P9NA 4NCXA 1C8KA 3DZBA 3KQLA 4A2WA 2I3AA 2GVZC 1UWKA 4P9NA 3QPUA 1WLSA 1ISJA 4B79A 4BXOA 1T1JA 2YBEA 4I4CA 1VJ1A 4U0JA 1BFUA 3T7IA 2FX5A 1RAHA 2RG7A 3HJBA 3NWPA 4RGVA 2D6FA 4EKEA 2HN9A 3OLQA 4M55A 4RADA 4B2YA 4F2GA 3GUVA 1NIJA 1SHKA 1FF9A 3HP7A 5FI3A 3LQ4A 2JASA 2OBNA 1T4CB 2C0CA 2PL9A 3AUYA 2B4QA 3TW8B 5HVNA 2QAJA 2HDWA 5CG1A 1OHHA 1YB4A 3FLMA 3VU1A 3DCIA 4RVSA 4MUGA 4IIYA 2J1LA 3GRZA 3TJMA 2R3SA 5KWJA 1QWOA 3PPYA 4QTYA 1ZXXA 3DM9B 3WTBA 1WDWB 2XUOA 4L28A 1TIBA 2BP7A 2TS1A 1V7QA 5T7BA 3Q0TA 4K81B 1CY2A 1KEZA 3ZV7A 5JR3A 2X41A 3VKFA 5EHGA 3KK0A 3SQLA 4D3SA 1ZNYA 1TIPA 5CLHA 3MB8A 3MLAA 5JY1A 4F9FA 4XCXA 3PB3A 3ZBQA 1LWOA 4W5QA 5L3VA 1TTTA 2Z83A 1VCIA 2GM5A 3AONB 3N6VA 4D9NA 5FAKA 2PYDA 4F9GA 1ZCZA 4XQ9A 4JU8A 4YXFA 1HO3A 1Y80A 2COKA 2P1ZA 5F73A 1ETUA 3F7TA 4F84A 3ZDFA 2QMUA 4OLFA 1TZ2A 3CSSA 2GWHA 3P9SA 5ITWA 4YRFA 4QHYA 3MAGA 5SZJA 3U4DA 4BJHB 2XI4A 2PMCA 3FB1A 1YBVA 1MR3F 3F67A 4N3GA 4Y2QA 2ZXEA 4NBNA 4ER5A 1X1BA 1JHRA 1YWGO 1E5TA 2DFKB 5I9MA 3CT6A 2ZYUX 3X1XA 2JZCA 1T35A 1P5JA 1DLJA 3I83A 4PRLA 4ZCQA 2J3DA 3OEYA 4XJTA 1PWEA 4Q4CA 3QZUA 2GCGA 2I4IA 1I30A 1QF6A 4CLHA 4AXXA 5F12A 5CJ2A 2CXPA 4OL0A 3NDPA 2YY6A 2H9YA 1SC1A 1TF5A 3C6ZA 5C31A 1EFRA 3RFXA 4P80A 5BT9A 4BO7A 2PS0A 4JB2A 4NIMA 4E2WA 1G16A 1OXVA 1V5GA 2YJ3A 4E33A 1GNQA 4RVFA 1O5IA 3ANSA 5KTTA 3VPFA 1YZKA 4E5PA 1DEOA 1U3GA 1MW9X 5FUMA 2NM0A 3OOSA 2VCEA 1BYUA 2NNLD 5JWOA 4OGWA 1HQYE 2C61A 4D4HA 2ZWMA 4WVLA 2P78A 5G4KA 3VHXA 4BVKA 1UPBA 2EC5A 4QFDA 2AFIE 4RELA 4WUVA 1N9GA 3O31A 1HETA 2JIOA 1T0PA 3MZ0A 1CJKC 4WQMA 4C4ZA 5K0SA 2F4NA 4YT5A 2CD7A 4MWBA 3FOZA 1SXHA 1OX4B 4ZWNA 3MT8A 1E2BA 2GH1A 3CA8A 4FSDA 3ZTTA 5L40A 2IZOA 5D85A 5AVYA 3LCUA 1OGYA 4OPMA 5LMNB 3VPBA 2PS1A 1NM5C 1T6NA 2PMFA 3DB1A 3EQZA 4WXEA 1ZK0A 2MYPA 5EA2A 4XCVA 3M6MD 5AQ1A