1TD1A

Crystal structure of the purine nucleoside phosphorylase from schistosoma mansoni in complex with acetate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
282
Chain Sequence
ESVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures for the Potential Drug Target Purine Nucleoside Phosphorylase from Schistosoma mansoni Causal Agent of Schistosomiasis.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords purine-nucleoside phosphorylase
total genus 90
structure length 282
sequence length 285
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1td1A00
2A8YA 1ECPA 1VFNA 1TD1A 1JPVA 1PK9A 5F73A 4QAQA 2OC9A 4OF4A 1CB0A 4G8JA 4LDNA 4BMZA 4LKRA 1TCVA 4LNHA 4LNAA 4OY3A 2HWUA 4X24A 1ULBA 1JP7A 1QE5A 5ETJA 1LX7A 1JDTA 4QEZA 3K8QA 4TTIA 1RXSA 4NS1A 4JP5A 5IFKA 3QPBA 4WKNA 5B7QA 4TTAA 2OECA 4TS9A 4DARA 1Z38A 1SD1A 3E0QA 4G89A 2I8AA 3KU4A 3OOHA 1RSZA 2PGAA 3E9RA 3T94A 2A0WA 2QDKA 3EEIA 1A9PA 4OGKA 5IU6A 1CG6A 1TCUA 2QTGA 4TYMA 4DABA 1VHWA 1PR2A 4LZWA 1A9TA 3PHBE 4L0MA 5B7GA 2HN9A 4FFSA 3E9ZA 2HRDA 3GB9A 2BSXA 4QASA 1Z37A 3OF3A 4TXHA 4YO8A 1C3XA 4NSNA 5F78A 3NM6B 3FNQA 4PNPA 4JWTA 1M73E 2AI2A 4YNBA 5B7PA 4H1TA 3KVRA 5EPUA 1Y1SA 5CXQA 1OU4A 1U1DA 4OGLA 4UC0A 1NW4A 2H8GA 1VHJA 3OZDA 5F7ZA 1PWYE 4MCHA 5JPCA 4F1WA 2GUWA 3PNPA 1TGYA 3LGSA 3UAWA 3FB1A 2I4TA 2P4SA 1SD2A 3EUFA 1NC1A 4D9HA 3DP9A 1YR3A 1K27A 1JDUA 3ODGA 4F3CA 5F7XA 1U1EA 1OTYA 1A9SA 3DDOA 1T8SA 3IOMA 4DA7A 2QTTA 4R2WA 1JDSA 4E1VA 1PR0A 1A9QA 1U1CA 4QATA 5FAKA 1V45E 4L5YA 1T0UA 1V2HE 1A9RA 3BJEA 3O4VA 1T8WA 1LVUA 4D8YA 2B94A 2XRFA 4L5AA 3MMSA 3UAZA 4M3NA 3BSFA 4WKPA 5F77A 4JOSA 1K9SA 1RCTE 1V4NA 4TXMA 5EFOA 4M7WA 4YJKA 4I2VA 1NC3A 1Z5NA 3P0EA 1Y1QA 4F3KA 5CCDA 1JDVA 4MARA 3UT6A 4OJTA 3OZBA 1RFGE 1T8RA 3LA8A 4OEHA 3FWPA 1VMKA 4WKOA 3KUKA 1JYSA 5CYGA 1U1FA 4MCIA 3SCZA 3NM4A 4WKCA 4YMLA 3TL6A 3INYA 4DA0A 1PKEA 1B8NA 1PK7A 4DAOA 1Z33A 2ON6A 2AI1A 1PR5A 3KHSA 1YQUA 4K6OA 4QFBA 1RXUA 4DA8A 1U1GA 1WTAA 4L5CA 3UAYA 2Q7OE 3BGSA 2HSWA 3OOEA 3IEXA 3O6VA 5KB3A 3GGSA 1SQ6A 1PF7E 3LBAA 5F76A 4TXLA 4R2XA 4BMYA 3U40A 1V48A 5C80A 5CCEA 1ZOSA 2QSUA 4ECEA 3DJFA 3OZEA 1RXCA 5EUBA 3OZCA 4TS3A 3NM5A 4L6IA 4G41A 1OTXA 1JE1A 2A0YA 3OPVA 4D8VA 4P54A 3ONVA 1OUMA 1RYZA 3DPSA 5CXSA 4BN0A 4GMHA 1Q1GA 3NBQA 5DK6A 1RR6A 1FXUA 1ODLA 4TXJA 4QARA 1I80A 3KVYA 4F2WA 1OV6A 1T8YA 1TGVA 1ODIA 3MB8A 4GKAA 1Y6QA 4TXNA 3UAXA 2OXFA 1Z34A 3K8OE 2A0XA 1RT9A 3BL6A 4EARA 1ULAA 1Y1RA 1PW7A 4RJ2A 1A69A 4KN5A 1RXYA 3DF9A 1B8OA 1Y1TA 3D1VA 5K1ZA 4DAEA 1N3IA 3PHCA 3ENZA 4EB8A 1YRYE 1SJ9A 4WKBA 2RJ3A 4NY1A 1PBNA 1ODJA 4D98A 4U2KA 1JE0A 3UAVA 4F2PA 4DA6A 1V3QE 1PR4A 3EMVA 5B7NA 1Z5OA 1OVGA 5CYFA 4D8XA 3EUEA 4TTJA 1Z35A 4IP0A 2OC4A 1YQQA 1Z39A 5F7JA 2ISCA 3C74A 3PNSA 4R31A 3FUCA 1YBFA 1ODKA 1Z5PA 3F8WA 1Z36A 3KVVA 1G2OA 1V41E 5F7OA 4M1EA 3FOWA 1A9OA 4DANA 1JDZA 1K3FA 2IQ5A 1PR1A 3OCCA 5I3CA 4BMXA 3FAZA 1LV8A 1XE3A 1PR6A 4GLJA 4GLFA 4PR3A 2AI3A 3P0FA 1ZL2A 2QPLA 1Y6RA 2AC7A
chains in the Genus database with same CATH superfamily
3W1EA 3NYQA 5EC8A 3FX2A 4PYQA 4BO0A 2JBHA 1FYXA 1QHHA 3PDHA 2GF0A 1KOLA 2ONCA 5CB6A 1Q1NA 4Y6QA 4M0MA 3E8MA 3NWJA 2IU0A 5ECGC 5ITSA 1JV2B 1YC2A 1G0NA 2QQEA 2V55B 1V96A 1EZZA 3OWXA 1HEYA 1NKTA 3IPRA 3GJXC 2QRNA 3ECSA 1JGTA 2OGUA 1CUUA 4E3WA 3FGZA 3DWEX 3IALA 3RS7A 2FFBA 2E87A 2NZ2A 2XDAA 4MYDA 4X0EA 2GJAA 5DMXA 4LFBB 3GZTB 1VE6A 1E69A 3KO8A 3KT8A 1NBWB 1J23A 2FWMX 5D1NA 2ZS7A 4J3NA 3TW6A 3GLGB 1JFLA 2C96A 5B37A 4GI2A 1N2BA 2W6IA 4V1CB 1OWNA 5F23A 3U0VA 2N3ZA 4G5XA 2I34A 5JMPA 3UJHA 3TCKA 3QEAZ 4Y9SA 1P7PA 4NE7A 1YV9A 4FKZA 4YT4A 3IEPA 3ROEA 4WNCA 1R9GA 2J9YB 4JI8B 2CD7A 3ICQB 1J90A 3K5IA 3BD8A 3KJIA 3SHWA 1CDZA 4Q3CA 4KPEC 2JGKA 1B41A 1LPOA 3FVVA 3QWIA 3OM0A 1H66A 1L9XA 2W83A 2XYHA 3FSJX 1UBMS 1BD3A 3OZIA 2H2HA 1W6UA 4ANFA 4LMBA 2DR0A 4UM8B 4YCDA 1Z5GA 3P97A 4G1BA 5G3ZA 4MUGA 4DCCA 4J0FA 4EY5A 2KMLA 4JN6B 4V3CA 2HF8A 3BGWA 1X80B 4HDSA 3U4MA 2I3ZA 2RHRA 1YXMA 1RDFA 3LQQA 4OB6A 4JQSA 1R12A 3O7MA 2PZJA 4BVHA 3ECAA 3PUIA 2J46A 4I8DA 5AP9A 1F1BA 1LY1A 4GXTA 1IL0A 2DKFA 4KIJA 4IO1A 2QNIA 1NHGA 2CMFA 1MHTA 1MJNA 4PYLA 1X70A 5ALXA 2PTHA 2BM8A 1RSZA 3KXPA 4A8HA 3KTAA 5HOQA 5ICMA 1E0JA 2A30A 2GNAA 3QBJA 4DLBA 3G02A 4UBOA 4QUGA 1KSGA 5DM2A 4X1YB 5J5CA 4YJDA 2GVZC 4XVUA 2GVNA 3O8QB 3P9PA 1QLHA 2CEAA 3TAUA 3AP2A 2GZRA 2NACA 2O7NA 4RGYA 2QZPA 4PEVA 2VJMA 3G5LA 4KAAA 3ZX5A 3HCRA 1HEUA 3LWNA 1R50A 2H51A 3ZK9A 2HT6A 2Y0CA 1YQXA 2J3IA 3FMGA 4R0NA 2QVYX 3IDSA 4QBIA 8GPBA 2CMKA 1SUSA 2K7ZA 3X43A 5DHAA 3G9QA 4CV3A 3D4PA 2PZFA 4TV8A 4HB3A 5HIIA 4DDKA 4QUDA 2HHHB 2NVBA 2Z9CA 1SGWA 2PK3A 4MLZA 4DCVA 3EZ2A 4QAJA 3DM9B 1JEYB 4QREA 1CEQA 1Z08A 4OMFG 2R60A 1ZVJA 1OI4A 5IVIA 3UV6A 4W1RA 4F8EA 1EB8A 2WJAA 1VKOA 2FMKA 1CE8A 4G6ZA 4L4UA 4OQYA 2R5FA 4DRYA 2M6SA 2Q9AA 2H4XA 4TUYB 3ADDA 1NXSA 4R2HA 1XL0A 1ZGCA 1E2DA 5EE0A 5C5EA 4RMHA 4GX2A 5JIBA 4RVGA 2QU7A 3AM3A 3EZ9A 5B58C 3KFVA 2FOIA 1TYDE 3G9UA 4UEKA 4Q15A 5JV5A 4NJEA 3E1GA 4K6FA 4X97A 3QA9A 3UXEA 3HVKA 3HYTA 3PDJA 3I0ZA 5HILA 5BQXA 1CT9A 1G1MA 1EI9A 3AJDA 3UYLA 1Q0LA 3PGLA 4QFCA 4DE5A 4J4TA 1FDUA 3QK7A 1XDSA 5G0WA 3A10A 2BISA 3LECA 4WOBA 4BAGA 4E7PA 1T36A 4Z7QB 2D7DA 1FFYA 3A3KA 3B6MA 3CMCO 4UUBA 3WDLA 1WSBA 4ZU3A 2OB1A 2VVTA 1DHTA 1N2XA 3M4YA 3T54A 5CFMA 1E18A 2VHCA 4OGLA 4K28A 3G8BA 4J3FA 1Z2CA 5JEEA 3PYXA 4G5OA 2PMCA 3ZIAA 4OU4A 5BNZA 4ZGWA 4MMYB 1PGJA 1W30A 1V16B 3DE6X 4AF8A 4MUAA 1JFFA 3QVGA 1MJHA 2OUIA 4PXYA 4KVAA 3L41A 5FOSA 3ACBA 3AUKA 3AR3A 3NFRA 5HKOA 2IYEA 3C5WP 5HJ5A 2XNSA 3NGLA 1THTA 2DPYA 2V6MA 2R8XA 3G2KA 2QU8A 3HA2A 1TVKB 4GC9A 4FOTA 4GOKA 5BNWA 3G2JA 1W85A 2O2HA 3CUKA 2ETXA 3I2IA 4N3BA 2BSAA 1TGYA 1V5IA 1PTKA 4TWBA 4E32A 5D1HA 3DB2A 1U1IA 2C2BA 4LHVA 3RS9A 1K8ZB 2HMYB 1MR3F 4A6XA 3LPDA 2NU8B 1HKUA 4NNPA 4X94A 1NC1A 5LD2B 1JH8A 1GKKA 1FFCA 2B21A 2MYPA 1N9GB 4FC6A 4JX9A 1UKEA 2QTLA 1FTGA 2LRHA 2GN9A 2Q1UA 2HJSA 2IP2A 4FCCA 5FORA 1UFOA 3BMQA 2AVDA 3O83A 3QLJA 3WIVA 1YOVB 3Q1LA 3Q7TA 4P8RA 3AOEA 1QV6A 2M98A 2O2GA 3OCYA 2XMCA 3IB6A 5CNKA 5B53A 3AGQA 2HQBA 4FHCA 1N0WA 2HHCA 1E2FA 4NV3A 3BKWA 3KDAA 1FTSA 2R6HA 4U7WA 3IOYA 2OENG 2GPSA 4JB8A 1G291 3HCOA 4XCXA 1P1KA 2OUKA 3C3DA 3NTLA 3WLMA 1A7AA 4E14A 5A4AA 4HBZA 1GQRA 2WKWA 4U7TB 1YI8A 4KTVE 2EF1A 2IXEA 4F7WA 4WZBA 3FW1A 1PFKA 2RK3A 3I3OA 4QQFA 3CLTD 3WB2A 2JB9A 1GEEA 1U1CA 3B3AA 1NBIA 4B82A 3UM9A 3NOQA 4G4GA 4RA6B 1QPBA 1YDMA 2QRQA 1NXOA 4ZVOA 3BOSA 5KNLA 1MKYA 1A9RA 4ZGBA 4LF4B 1VKZA 3EIFA 3HSKA 2O9JA 3PCRB 5AI9A 5BUQA 1JNXX 2O0LA 4TKLA 1RM4A 3AUXA 1AGXA 1L7XA 4I0WB 2X6QA 4XIIA 3ZD8A 2X5JO 1SM4A 4IDQA 2BP7B 4M3NA 4JBNA 3CUSA 1PL6A 3H9JA 3Q6IA 3CWQA 3K1ZA 3PUXA 5K3EA 1NM5C 1DRWA 1PQYA 4M86A 3UXMA 3TLJA 2GPWA 5LNK1 1GR1A 1XALA 3OIWA 2PZEA 4HVAA 1X0XA 1ZZEA 2O2DA 3RBXA 1HGXA 1LJ8A 2VDWA 1QS0A 2OHOA 2P75A 2PD6A 4P81A 4S2EA 4BV2A 4BCDA 4BRSA 2XMPA 3PVCA 4D3ZA 4DJEC 3QMVA 3N28A 5TQVA 3L7OA 2VNIA 3U44A 1SKMA 2HW8A 2WTUA 1F8FA 2VRCD 1I5OA 2Q2WA 3NNNA 4PU0A 3AP3A 4CW7A 4C7XA 2ZYHA 3HL0A 2TMKA 4IS3A 1U3WA 1WUTA 2W2LD 4X71A 3W1VA 1Z47A 3BB1A 3EQ9A 5AK6A 3LHSA 2RH4A 4NZOA 4XYBA 5LWQA 2Z98A 3LL7A 5ALSA 5HTKA 5DTIA 2PCLA 3CH6A 3MERA 4Q9JA 2B0CA 4COOA 1A1SA 4HWTA 2OO7A 2J6HA 2EDCA 4OQMA 3K4QA 2I71A 1WOMA 3MLAA 1SU4A 3JQQA 1QR2A 4JT4A 1IZYA 1YAJA 3QM1A 4N0PA 1M2GA 2XF2A 2IPLA 1TD9A 4QGHA 3UWPA 4DDVA 4N76A 4WERA 4WGFA 3F9RA 1BG6A 2FSHA 4B8WA 1NURA 3O47A 3W04A 1VXOA 2FVYA 1CRQA 4FOSA 4TYQA 3WR5A 1A9XB 4TMKA 4PINA 2DLCX 3PRKE 4K0KB 2PKCA 1VPVA 2PUGA 2ZCJA 3T7EA 5L7WA 1L1RA 1OKKA 4DRZA 5FPTA 1WP9A 2EAUA 1DUIA 4L5JA 3D2AA 2PZKA 3KKPA 3Q85A 4R0VA 3L9WA 1SVNA 1NF3A 1HDGO 3JQPA 3EVFA 1V6SA 2WEKA 2H0RA 3FPFA 1SZPA 1XTKA 2W2PA 1II8A 2J0VA 3KPWA 3GGSA 2IEZA 4H35A 4RSMA 4XB2A 4JLBA 2CJPA 5F76A 2NZYA 1C0PA 4Q21A 1CJSA 5GINE 5CD1A 3WB9A 1CUXA 2DUJA 3DLPX 4BTVA 4ZZ3A 5BYAA 1OX4A 4ZAYA 1XPOA 3OFKA 5ALOA 2Y0PA 5DGXA 3GT7A 3OIGA 1HZZA 3KXKA 4L4XA 1GU0A 2VWQA 1GKYA 1F0KA 1M2JA 1VKRA 2CLLB 3KB2A 3ZBQA 4YUZA 3RVRA 1XWFA 5BWOA 4YXWA 3R23A 4KAXA 4NDAA 4PICA 1KPGA 4Q4LA 2NSHA 1AIPA 2PO5A 1AHPA 5ECDA 3V9PA 2Z95A 1OI2A 4COKA 2YJZA 3H86A 4QO7A 5JDCC 2NWQA 3NEYA 2IU3A 1EB9A 3ABIA 4GXRA 4UPVA 2WJJA 1ZRHA 4B74A 2XQFA 2F9MA 3FPLA 2CC2A 1TX4B 2GYYA 1RYZA 1CW2B 2QORA 1RQRA 4BJ5A 2C42A 3ROGA 3HRHA 3QVVA 4U8GA 5B3AA 1FOEB 5TQ0A 5LQKA 1ISPA 3DVAA 4GI3A 1RM3A 2O5VA 2I7VA 4CKCA 1C9JA 1H9BA 1OA0A 1RVV1 1W6RA 4BMVA 1O6BA 4XQ9A 4MVJA 5F1YA 1RR6A 2HZ7A 2Z3WA 4KQXA 1QGED 4MV7A 4NFLA 3H99A 4JODA 2PN1A 3PUKA 3EVAA 4HATA 3H97A 5CDYA 3KTOA 3EFOB 4F4JA 3O4FA 1DQYA 1OE0A 3C7KA 1OFTA 3KVYA 2VTKA 3ZY6A 4A0HA 1W36C 3EY4A 2ECFA 3BWBA 4EHJA 5IBRA 4KLZA 2VRCA 1Y34E 1UWVA 1ZOPA 5A6SA 5EJ8A 1W48A 1ODIA 2DH6A 16PKA 4MQFB 3JATB 1DRVA 4MW7A 2M6KA 3PFWO 3MXTA 1GTMA 2HBYA 1KH1A 4GXNA 4IJMA 2XHZA 1F5SA 4JIGA 3ZJVA 4ARVA 5HQ3A 3HJBA 2D2XA 2LPMA 1G8MA 1M8PA 5D2CA 1A97A 3TM4A 3NAMA 4QULA 2BEVA 3A70A 1YDFA 1ANKA 1UIMA 2FMHA 2I6QA 5JC8A 2Y4NA 2EKLA 4E5VA 3ILXA 1N32B 4F9FA 2BHLA 5U1PA 2OZVA 2NZUG 4OOEA 3WI7A 5DFAA 2G1PA 1P5HA 4RELA 5AHOA 4G4SP 1VJ0A 2JCSA 1E1RD 2BONA 2Z6AA 3CZQA 3VX4A 1Z6GA 3WDMA 3GAMA 2B82A 4WV3A 1JIJA 1MTOA 4MP8A 3W9UA 3ELYA 1E4YA 1IOLA 1Y1TA 3DH0A 4MV0A 4N0EA 3H1FA 1TU3A 3UMBA 4JVLA 3SQXA 3DKIA 1YJQA 2F1IA 3V7WA 4NK5A 1NP3A 3QXHA 4GPZA 2AOTA 1I0ZA 1XMXA 1Z4MA 2HEIA 3I2HA 4J75A 4JJ7A 3LP6A 5K0EA 3VYUB 1U3FA 4Q1CA 3CVJA 4MVJP 4ZKDA 2ZBRA 4C5CA 1USUA 2UZ3A 4ETMA 1JU9A 2W4MA 4ZYYA 1UDRA 1QCCA 2QR5A 3ZHTA 1DAPA 2GBGA 2Z3VA 3AG6A 4NE2A 4KR9A 2BH2A 5C8DA 4YCNA 2XXJA 2PZAA 4RKWA 4QM7A 4F86A 1E9RA 4ND1A 2A0KA 5LM3A 4GRDA 3W6ZA 5GIOE 5FBKA 4NHOA 5KBYA 4HS9A 3IA2A 3VVMA 1PU2A 2C1ZA 4DDTA 1W9HA 1ZFNA 4NU0A 2O1XA 3VKWA 3OA0A 1FNSA 2N42A 3KT3A 3EMVA 2V7VA 2BBTA 3NIGB 2Q1TA 3RAFC 4PZ9A 2CXNA 5CT4A 1UKYA 3CLTC 3Q88A 5TV2A 5U4XA 2PS9A 3KEGA 2DCMA 4B84A 4Q1VA 5LCXA 3EDCA 2QAJA 3AFNA 3URMA 4CIVA 4FGLA 3K2QA 4YQEA 4D3XA 2DMRA 3KYCA 3RVKA 2P7HA 3EPHA 5BOSB 3D5QA 1E2MA 2JH9A 2VBFA 3ZWQA 1EKXA 3PUZA 4LZAA 1D6SA 1MB3A 2ZQYA 4MW4A 3WC4A 4JQZA 1FLDA 3EDQA 5LQMA 2Y1GA 1V0JA 2ATVA 1HQCA 1PZMA 4PX2A 4UXJA 1JQJC 1YR9A 1NXQA 1U98A 1ORTA 3O4IA 5TJ9A 4E2XA 1QP0A 1AURA 5BURA 3NT5A 4JC0A 3A1EA 4WJKB 2PEYA 3A4MA 4EMTA 4JI2B 1U6KA 1UWLA 3O0TA 5BWLA 4MV1A 2OZPA 4PCLA 1WF6A 3GCXA 1W36D 3CQ9A 4JLUA 1KEEA 2GBIA 1GN8A 1CE8B 1V9CA 3AR5A 2W4IA 1K7CA 3SQMA 3A7EA 2VFAA 3LQ1A 3R74A 4ALIA 4QGSA 4JY7A 2ZUFA 1DWUA 4OJNA 4BO5A 4BVGA 3DGFC 2DEUA 1EFLA 3R77A 1V41E 4MQEB 4RHYA 4JGBA 2PGJA 1WZIA 1MG5A 2VHUA 3B48A 2RH8A 4XQEA 2JATA 1NIPA 1PNVA 2K2QB 5A71A 1HQYE 1IZ0A 4NK4A 5L45A 3P9CA 4L4RA 5AT1A 2L19A 4JI5B 1MOQA 4OVKA 1DJNA 2GHRA 3DT9A 3A1FA 3CV3A 3UAOA 2J3KA 2O5CA 2F8LA 1P9NA 2WJZB 3B9QA 2HB6A 1H22A 3QY0A 1LH0A 4FYIA 4UNIA 5EIBC 5I3CA 5JQGF 1ZM4A 4RK0A 2YW9A 5HFAA 3UHPA 3A4YA 2QTZA 2ZIXA 4I46A 3ZN2A 4ZI2A 4KIWA 1GD1O 1DOZA 1PR6A 2UZ1B 3L4BC 1XRMA 1C8LA 2CDAA 5JAOA 1EVQA 1EVLA 1YHZA 2H1CA 1MAAA 4FCWA 2A9VA 2RHTA 4FWBA 3P0FA 4ZHQF 2PUAA 3ZNOA 2KHZA 1RQNA 3LCRA 5HUQA 5JZ9A 1YCGA 2AC7A 2F8SA 3K0KA 3WTBA 1TZBA 2B6HA 4A4DA 2ZDQA 5AD1A 3ZGOA 4QU9A 4LJ9A 4DHWA 4DWJA 5IXYA 4DBLE 3SQOA 3K70C 5A0VA 1KL7A 1Q1ZA 1TJPB 2ADMA 2G3YA 3N5KA 1LBSA 1TD1A 4L15A 5THKA 3H5AA 3KZMA 4C01A 1YA8A 3JAMA 3DMGA 1JG7A 1ZR4A 3H9GA 5DBGA 5AVKA 3RYFB 4PLWA 3RFUA 2HKIA 1DAFA 2JLSA 3F1LA 4OF4A 3VHXA 3ZV5A 2PUBA 4XIGS 4UQOA 3VH3A 2HHAA 1NOIA 4ZRMA 4UE6A 2JIMA 3COVA 4IUBS 2EEZA 4HDKB 1F0NA 1J2UA 4K5QA 3WWCA 4RPHA 4BWVA 4IDHA 4QIHA 1AKYA 4IHJF 4KZKA 1RJGA 2NU7B 2HWUA 1MX3A 4Q3DA 1M7GA 2XMDA 4HJRA 4TLMB 3L8EA 4WY8A 2JAPA 3RJMA 1IBCA 4WINA 3AKYA 1NE2A 2FZ4A 2ODPA 2ZVPX 3SSOA 4E1AA 2C4TA 5EWLA 1VLHA 2Q2VA 2CFOA 4AYWA 4F2HA 2DWQA 4NV0A 1A8QA 4RMJA 1AS3A 2NO5A 1W29A 1HG0A 2G88A 2B25A 3IXQA 4RC9A 5DBOA 2B8TA 1DTEA 1CBUA 1DAOA 4B3CA 3GEEA 4F72A 2ZUBA 3E9EA 3AHGA 4GLOA 5ERXA 5LA6F 4RAOA 2ZJ3A 1W4ZA 1EMDA 3G5MA 4NZZA 2EQ5A 1H5NA 3GGCA 3RABA 5FWAA 2V5AA 3A4IA 5FUWA 2HJVA 3TSYA 3V34A 4DTCA 3QG5A 2EATA 2OHVA 1J33A 3T1QA 4YRNA 2JDIA 3G6KA 1E0KA 3ZDYB 3UGTA 2YTZA 4JCCA 5BSRA 1PT9A 1Q0ZA 1UBJS 1P60A 1WCYA 2JH3A 3DEKA 3EIHA 3NG1A 3NOOA 4YCBA 1E0DA 1KO1A 1P3Y1 3EVNA 3MJ4A 1KMCA 5LDHA 3S44A 4YJGB 2VCHA 2IPNA 5C1PA 2I0FA 3SMQA 5KQRA 4JHXA 5ESRA 3KJQA 1XSEA 3OFNA 3M4NA 4U7PB 3T94A 2V96A 2WFLA 3I9MA 4A15A 2RGBA 3UT5B 3HMKA 3LKVA 2II6A 1PJ4A 1VKJA 4WASA 1PD0A 4ZVVA 5I4IA 3O3MB 1CG6A 3HDHA 4D6YA 1P61B 1CF2O 1YBAA 2GAFA 3AY3A 4ARAA 1Q16A 2PX4A 1MVOA 3D54D 3N8DA 3FUUA 3TUIC 1KYIA 3IBFA 3VAZA 3WL5A 1D4FA 1RI4A 2ONYA 2DQ4A 1M6YA 3BBPA 3TJMA 4R3NA 3OE4A 3JAWA 2WMNB 4KKXB 2VEOA 3D6JA 4Y2JA 4H7FA 5E7QA 2PKRA 2WOOA 4I19A 3AI2A 3N6RA 4F45A 3KQNA 4CEHA 3LWZA 1IM8A 1N6NA 4BRZA 3HR7A 1B76A 1GSHA 1QQBA 3OUUA 2OCBA 2P4UA 4BEJA 1P2GA 2F8TA 5FA8A 4OM7A 1CJCA 1FFBA 1EVEA 1FQOA 2QSJA 3ND7A 4G4JA 4GBMA 4GH5A 5F52A 2JFVA 4DIUA 2O59A 5HBRA 4N8SA 1ABEA 4MEBA 4NSNA 5F78A 1GTG1 2DP4E 4CVNA 2BDTA 5FFNA 5M2QA 2CHUA 2ERCA 2Q07A 1V5EA 2ZUUA 1L5ZA 3LUFA 3S1AA 4YK7A 4M7OA 1IOWA 3QKUA 2YJ6A 2A58A 4BV9A 2EIHA 1C3OB 4HGRA 5IUKC 4GRIA 1F0YA 1A8HA 1Z0IA 1PHRA 2XYPA 2H7YA 3PQDA 4R6XA 3RRBA 2AYYA 1XCBA 2NUPA 4ETWA 2P35A 2KX7A 4I4TA 5JECA 3WY9A 4YALA 4RL6A 1YGYA 2HXSA 1U1DA 5DNEA 1SVOA 2DX7A 1C4WA 2FKNA 3QZUA 2O2IA 4YRCA 2XNCA 5MHTA 2P8SA 1VHJA 2IEIA 3OZDA 4BFXA 5KWEA 3CUYA 4A16A 3QH4A 4A8TA 3OC6A 4ND3A 3Q1KA 4F5YA 3ESDA 3PXGA 5J47A 3QSGA 3KYJB 1KDTA 5E9JA 5JWHA 2APJA 1AMNA 4IHJA 3I9NA 1YKGA 1FRVA 4S1WA 3NCTA 2ZIZA 3W2FA 1PWZA 2H2DA 4LDZA 2Q6LA 3DDSA 1VL1A 1EG2A 1J0DA 2IZ1A 4CNQA 4EWLA 3IIMA 1EA7A 3WJ1A 4MWDA 1ZGHA 3EUFA 5EP2A 3AM5A 2BFEA 1KJWA 1JXOA 2OL4A 4ZCIA 4CF7A 1TM1E 4Q3LA 1GZUA 3QE2A 3T3HA 3MCUA 4IG9A 1K89A 3DTTA 2CHVA 4V0RA 4LF6B 3MCAA 2FDXA 4INOA 3SPXA 421PA 1YA6A 1JRLA 2UYQA 2OXIA 1BHQ1 3OQIA 1Y4DE 4FTWA 1G4UR 4G2TA 3A27A 4N0MA 4LMPA 1HQKA 4RKYA 2YMPA 3G89A 3HVIA 5YASA 4CIXA 3MCWA 3NUQA 5FBWB 4CF5A 5CDHA 2RK6A 4JJFA 4B81A 2XQIA 1QH9A 1Y5IA 1PP4A 1SVSA 2GHTA 2XYQA 4IZOA 1PWXA 3QELB 3HWSA 5HM6A 2NYAA 4JYPA 1KOGA 4I5DA 4UMFA 2B1RA 3ROZA 3G0HA 5JUWA 2HFJA 4E1VA 3KZCA 2A7XA 2X42A 3I09A 3FMVA 4YHBA 1UBGA 2R6R1 1U65A 1JILA 1UK7A 3DG9A 4CMEA 1ECLA 2JGEA 1QIDA 3ICPA 3W5HA 4CEHB 4YJFA 2R00C 3LP5A 5LNK6 2OQIA 4QDTA 1DAGA 1CVRA 1ZA1A 5D8DA 4KBYA 1M1YE 2FHPA 3GWZA 5KYUA 3FAKA 3CBGA 5BR1A 2HUNA 2B1IA 3NTOA 2QQGA 5J9FA 4UMDA 3IVXA 2XD9A 3NFYA 3BWEA 3BSFA 4LXYA 1S2LA 4NEHB 1D0SA 2J07A 2XT0A 3S55A 2NU6B 5TPZD 4RVUA 4ADSG 3FZEA 1G41A 1F06A 3WICA 1XEXA 2G0TA 2Z8YM 4KPFC 4MVJH 3HP1A 4PZ0A 4EHFA 1M7BA 3FDZA 3QTLA 1LRKA 4JHLA 1PGQA 2WTAA 4MKIA 4LYFA 1CYEA 3DZJA 3UT6A 1XOIA 2VRWA 1V4VA 2FZCA 2ZYTX 1EVIA 3F6BX 3L5OA 3NH6A 3QPDA 5FUMA 5F3WB 1IK6A 2WE7A 2BTOA 1MP0A 3WK6A 4XPZA 4EJ2A 3QVKA 1EH5A 3BPSA 3FPHA 5K0ZA 1T0BA 2HIAA 3Q2IA 3LHIA 2F48A 3QUBA 4DG9A 4QUKA 4C9BA 3E3NA 2QVGA 3PLRA 3R3SA 2OTCA 1LKZA 2QT1A 4MI3A 3IQGX 4KQIA 5EQJB 4W8HA 2A5LA 3PR2B 1NLFA 5IAGA 2B83A 1M1YA 1TKRA 2FNAA 3EFHA 3IR7A 5KKAA 3ZE9A 3I5AA 4NWIA 3LHFA 4DAOA 5EMHA 1QWOA 1W87A 2PT7A 2WWTA 2ZTMA 1X9IA 3DBVO 3X1JA 4YEDA 2FPXA 3RT7A 4R1UA 4PTLA 5CU7A 1X1TA 4HL6A 1YQUA 3CZAA 1KVSA 4PXAA 1J07A 1OZHA 2N9UA 5AI0A 5CIWA 4BAZA 1E6CA 1V47A 1A72A 1JEQA 3MPUA 4FKBA 2C98A 4NG4A 3L0OA 3RYIB 2R8EA 4CUZA 4XYLA 3V42A 3R5SA 2BUAA 1KE2A 2TECE 2LIPA 3G0BA 3PITA 2G8NA 3A1SA 1KMHA 1ZOIA 1XTUA 2HTFA 2Z4SA 5I9MA 4RPGA 3SGLA 4CTMA 1YQDA 1F2UA 3HSYA 4LHEA 2O50A 4JT9A 4NX2A 5DYTA 2WVJA 2O7RA 1AN0A 5C80A 3ILVA 1ZOSA 3C4QA 2IRWA 3GRKA 1CJVC 3PC8A 2R1VB 2X1VA 4LDPA 2BPOA 2H31A 3TLZA 1W85B 4EVIA 4X7MA 1J0BA 4I6EA 4ZTUB 1MA0A 4R84A 2C5BA 4FW9A 1AE1A 3E27A 2YJ3A 3QENA 4Q34A 2A4MA 4KYVA 3NMUF 3KS9A 1XWWA 5TS3A 1SBNE 2CSXA 4CV1A 3UICA 5EMNA 3VR5A 4GS5A 4RHXA 3DMTA 2JZOA 4BFZA 4UM9B 3SHFA 1OASA 3EW9A 1BE6A 4EHDA 3EXG2 3AEYA 2Y92A 2OO3A 4HFNA 2F6RA 4RORA 3N2GB 2HRRA 4HYEA 5G0UA 5D6NA 4C2TA 1K8RA 2NW6A 3ONNA 3RSCA 1H0HA 2E0IA 2NZXA 1UXGA 1Y6JA 1EJ6A 1S3GA 2HSZA 3FETA 1EWQA 5JE8A 1SQGA 3TKLA 4EM6A 4UEWA 2DGDA 5E95A 4B71A 4BS9A 5T57A 1AA9A 3IDZA 1NF9A 2OCIA 1N4AA 4RX1A 1N6IA 5KDOA 2Q4BA 3VI4B 5F5XA 5C5CA 3V3KA 1PWHA 3AF5A 1X14A 3TE7A 2ZTVA 4XJVA 3V8EA 2JA2A 1ZA2A 3MJCA 3MTAA 2HXYA 4IHQA 1N6RA 3LYHA 1KO4A 5BWMA 1NI4A 3RKRA 3OT1B 1RS0A 1VBMA 1ZGZA 1KAHA 3AR9A 2IY7A 5KYWB 3S81A 5K99A 4U4AA 2R9VA 4YR7A 2G9VA 3LCUA 1VOTA 1ZVKA 2H1VA 2J3HA 3ROQA 2HCJB 3BDIA 3IUMA 1TQDA 1C9NA 3RU2A 2C2MA 4WCFB 3IBCA 4EGSA 3EXIB 3ODPA 1ZJWA 2C78A 1QU2A 2JDID 4EABA 2QXTA 1G20A 1WXHA 4MWEA 2ZRKA 4RMNA 5AUOB 4LDJA 3KSMA 1SBQA 3CTPA 1F9AA 5JARA 2PUEA 2FOXA 2CVQA 2NPIA 5LMNB 4R1TA 4E5YA 4YI3A 1WUIS 1HA3A 2JHAA 3KYCB 4MUXA 3R2JA 4G1FA 4UAUA 4C6TB 3LP8A 1A82A 4DMFA 2FEPA 1XNQB 4P7BA 1NBME 3BIFA 3PEFA 3E3AA 3RAJA 2I3BA 3AYXB 4CFYA 4DSNA 2ZR9A 4L72A 2JJ2A 1TKCA 4DJDC 2YIVX 3PNLA 1D5CA 1XJCA 2IWHA 1KYQA 2GBLC 3HSSA 4DXHA 1FXWA 2EZTA 1FS5A 1W0JD 1G8JA 1XDUA 3FSEA 5FPYA 1SOWA 2QYHA 1W5SA 1RVDA 2XDWA 4QNRA 1IATA 3KWLA 3N7AA 3DLHA 4URUR 1EX1A 3FWNA 1PBNA 1XVLA 1BE1A 1D7OA 2I6UA 3MYRA 3HV2A 4YA6A 3TVDA 1T3SA 4N3NA 1MIOA 5FWYA 3U61B 3A1VA 1K4YA 2ILVA 1T2CA 1ZIPA 3KG2A 3TMAA 4BFTA 4BTLA 1J39A 4YAKA 5BXYA 1V3TA 1H65A 3BB3A 1NVXQ 3W77A 2WILA 2OV1A 2YXNA 2P2GA 4DA6A 5H3LA 4BFWA 2I87A 3P52A 1EPUA 2Z2IA 4Q93A 1HRDA 2ORVA 3QFCA 4RY2A 4YRRA 2W6JD 2ZRPA 4BKMA 4CKEB 3E53A 3QV2A 1S0UA 4D0NA 2E5LB 2RI1A 1EVJA 1AZTA 1F12A 3UFBA 2O8FA 1E7YA 1OAKA 1U8XX 1T2AA 1FUIA 2BY4A 2C4HA 1Z5OA 4QRHA 5CBPB 5JNTA 4TMVA 4FE4A 2PLRA 3WMRA 1P5FA 1G21A 4GSKA 1M2HA 4Y2UA 1K0UA 2EFHB 4RHCA 1TYBE 2A9OA 1P1FA 3HEBA 1Z39A 3DTVB 4NU5A 4FT2A 3WMWA 2JHGA 2Q45A 2Q3LA 1ATIA 3JD2A 4JL6A 1VSTA 4EJSA 4MICA 4UD6A 1QQTA 1XFAA 2P9GA 1DWPA 3NCHA 2CE2X 3CEMA 4RXTA 3D1LA 2WAAA 2J9XB 2PDAA 3AO0B 2QOEA 3U13A 4BFSA 1L7RA 5DM0A 3QMWA 5E1OA 5ITVA 1LBQA 4UDOA 3FUCA 3ZVLA 1AB5A 2CGEA 1JNYA 3S29A 2AUTA 4DWVA 1W4BA 2WYIA 2XEXA 1ZICA 1W5FA 4NCKA 4M1TA 4DNPA 4D3SA 4ZT6A 4DLPA 1GNVA 4Q4AB 2G9NA 1Y6ZA 1LD3A 5KQSA 4GOND 3IGFA 3VR6D 2OZEA 3L1UA 1DX6A 2FJUA 3E6AA 1KKUA 4M1EA 1NLUA 1L5KA 3WJ2A 3LD9A 5L40A 4UFPA 1XCMA 1SCKA 3Q87B 3F4KA 1C3JA 3H0KA 4KV7A 1BXGA 1SCUA 4WJZA 5IDWA 4HCJA 4Q9DA 1DBVO 2QN1A 2Q5IA 3USCS 3CVUA 3KPJA 2WSSA 4B46A 5KYNA 1XMPA 4CQJA 4TZKA 4F3NA 3DFUA 1U11A 4B4UA 4NYMQ 3I83A 2QBYA 5DYNA 4QDJA 3THRA 2I1QA 5ABPA 5I3ZA 5M04A 3JXEA 4PZDA 1TU0A 1XZLA 3E1SA 4U2CA 1SKBA 1DRKA 2QW0X 4FYYA 1N6OA 1E3DA 2PS1A 1VE9A 2I1VB 3N5CA 2W0SA 1KI1A 2ZM6B 3WGNA 1T8PA 3DO8A 4NMWA 1Z6ZA 1Y3DE 1QO7A 5JAUA 5ALWA 1JPVA 2P27A 1QJCA 1ZGGA 1HK7A 4S1OA 1BGVA 2FWBA 5H68A 4B6SA 5BRNA 1DOAA 3KR1A 4DTIA 1UANA 2O8DA 3GZNA 1Z6TA 3TTXA 1U31A 3CSSA 3N3BC 3DDUA 4RANA 3DAGA 4QDOA 1MNQA 4ZANA 1X7WB 3BTOA 3BHIA 5PGMA 4UARA 5E9QA 2R79A 3AUTA 5TARA 2OFFA 5L3VA 4GI7A 5JJIA 2P2YA 1Q1EA 2ROQA 2VH2A 2XQGA 2SCUA 3KB6A 5T3UA 2OLEA 4PO1A 3VC2A 3C8MA 4XX1A 1OVMA 2E5FA 2XUZA 2YS7A 3F74A 3PIDA 4LNHA 3U3ZA 3SQWA 1E1NA 1N2CA 4RZUA 1V7PC 2O3UA 2C1XA 2XDQB 2FETA 4X1IA 4L0CA 1QH8A 2YNMC 4MGIR 5B57C 3M83A 2B4YA 3SLKA 1UK8A 2X4DA 1QGAA 4RM3A 5G4KB 1ST3A 2XNJA 4QXOA 4BZZA 2XGJA 1B00A 2GXQA 3D6TB 1YDWA 4NMHA 5EIEA 2F62A 4WESA 5I7WA 3PDUA 4JYZA 4A36A 4CDRA 2VXYA 3BJMA 3M5WA 2Q9BA 4C43A 4AM8A 1OFGA 2WWYA 4NZNA 2CN1A 2ZB7A 4F4HA 2W2MA 1G16A 3WL8A 1U28A 4UHCA 1IEXA 3QQPA 3TGWA 1T2VA 4DARA 1NQAO 4M89A 5IX8A 5L7YA 1C50A 1G3IA 3SR4A 2PMBA 1ZK4A 3MD9A 1G4HA 2VKQA 4P53A 3OZFA 4FFVA 1EFRA 4X1KB 4PX5A 4A27A 4AWBA 4CL3A 4FB4A 1AY0A 1X38A 2HM7A 3SVTA 4WZZA 3SKXA 1ZKMA 3OSUA 2IHYA 2QG6A 1U80A 1O87A 2GXAA 1HDOA 3NNDA 1UMCA 2CFIA 2G83A 3G68A 3HEAA 3NTUA 1WU7A 4IGEA 4IXWA 4MW0A 1A88A 1XF9A 2ZR8A 4HB2A 2QUJA 2H59A 1T6ZA 5ALKA 3SF8A 4CMJA 1OXTA 4ES6A 2PGAA 1PR9A 4GFDA 1XG5A 3GUHA 1LA2A 1ZH4A 3L84A 2QDKA 4YUVA 4DV3B 1X3LA 4LPKA 4M22A 4I14A 4EP1A 4FDUA 5E7MA 4DLLA 1VLVA 3HUUA 2M6RA 2CD9A 2OV3A 2VAWA 1M6HA 3JV7A 4TL7A 2H1SA 1ZXXA 3GLHB 4Q02A 2AR7A 3A0RB 4BNFA 3W5VA 3E7DA 3O4HA 1D1TA 3C3KA 2Q7XA 3KEOA 1NBHA 4YJ3B 3PWKA 1V71A 5BY2A 2VTEA 4R7GA 2PCJA 3TFOA 2ICAA 3ENQA 1L4MA 3HUDA 1QE3A 3KKZA 2CUNA 3JRNA 4CYMA 1OWLA 4D1YA 4GP6A 2ERXA 1NQUA 1A2OA 4KMRA 1G2QA 5KOHA 1U4SA 1C7EA 3G2MA 1XU4A 2V4MA 3NC4A 4N3CA 4TMTA 4UEJA 4XIJA 2LGJA 3SC3A 4TXHA 2AOXA 1VE1A 2ZXEA 2HJ9A 2WPNA 3O4RA 3PA6A 4P4SB 2G67A 2GPTA 4GPTA 2REXB 3I0MA 2O3JA 4TTRA 4UJ5A 4YWJA 2VPTA 1U4NA 3P4XA 1ESCA 4ONEA 5FFMA 3SS8A 2CUKA 3AF1A 2F9FA 4DPMA 4HTFB 4FFBA 1T5LA 2X1HA 2XRZA 3JSAA 3H2JA 4HLDA 3CLSD 4P83A 1ZK2A 2R8RA 3FHLA 4XXHA 5TY0A 3TZCA 1M73E 4HO1X 1RIFA 1G6Q1 1Z4KA 2XAUA 2H4HA 1U8ZA 4REQA 2VSOA 4R2MA 3E9DA 3FFXA 4J0QA 1B3BA 2UZ1A 1QKKA 1WUKS 5TGTA 3GDGA 5E4FA 3H4MA 2X76A 4EZIA 1OU4A 1OCEA 3M6AA 5EKUA 1PFUA 2PUTA 2WJWA 5FTWA 5JXHA 4ALMA 6ABPA 3UWDA 5FNVF 3UMJA 4JI4B 3JRXA 4R16A 3GP8A 1CFZA 3ZWKA 3M6LA 5C31A 2FMIA 4J7UA 2QQ5A 2D3TA 1KY5A 1SQFA 2Q0XA 4HR7A 4A3SA 2R0QC 3HCWA 4MUKA 2NYRA 3D4NA 4Q9KA 3D3NA 1J70A 1K63A 1NGSA 3PDIA 5LJIA 1AVTA 2PJUA 3GLFB 5IVKA 3D7MA 4WJLA 1G6KA 2I4TA 4MJLA 3RDPA 1PZFA 3UQYS 4CODB 1ELOA 2NU6A 1EHIA 1KDPA 1MC4A 1Z4NA 2PG3A 3A9WA 3D0RA 4OYHA 4EJFA 821PA 5KYGA 1Z8DA 1CY6A 1TFRA 2RMKA 4EI7A 4WD3A 4HNUA 1CKEA 2NADA 2R6AA 2V8BA 5ALQA 4EECA 2C7RA 4ZCRA 2GAAA 2RBGA 4G01B 5FNZA 3DYVA 3WDSA 2DCUA 1NMZA 1N4DA 2BLLA 4NDNE 1ZIOA 1ESMA 1GT91 2XMQA 3AF3A 3O4GA 4OHKA 1C3OA 3MT0A 4QGFA 2QX8A 2XMGA 1ESZA 2QVXX 3E2IA 2BBSA 5FWXA 5B1IA 1CEYA 3B3GA 3VDNB 4U3JA 3OICA 3ZBPA 1L2TA 1E3LA 1WOYA 4KL8S 4R2WA 1JQ5A 5F33A 4CLOB 4CQLB 3Q7EA 2P41A 4RTOA 2OSBA 3C3WA 2CCKA 2GD1O 3G0IA 5E6RB 4KYTA 1HT3A 4NQRA 2J85A 1XA0A 4GT1A 1NQTA 1O4WA 3H4TA 4P08A 5T4EA 2CB0A 3DO6A 3WZMA 4E0BA 3MUNA 2GKGA 3ZLJA 4EBBA 1SHZA 1CUVA 1T0UA 4A2PA 3B1YA 3WKCA 1E1QD 1EE9A 3HI4A 4EYOA 2PHZA 9LDBA 3G7NA 5BV2P 3VZSA 3M81A 3TTTA 1DC6A 1JQ3A 4D8YA 1GP2A 1A4XA 1GG8A 2KYRA 3U0BA 2CJYA 3ABSB 2QUHA 3V4SA 1RQLA 3KCNA 3KVOA 4U63A 1ONSA 3JQFC 3M6XA 3W5DA 4D8WA 2GH1A 2B3TA 3SIWA 1IY8A 5IBQA 1RMTA 2I3AA 2QMUA 2DH5A 3GLIB 3MNFA 3OEEA 4HVLA 1RHMA 4IRXA 1LEHA 3KOZA 4I36A 3WNZA 5ESXA 4YXWD 4BUCA 4OP3A 5CW2A 3K73O 3DVAB 1NUHA 3MN1A 3SY8A 5KHOC 1I7LA 3LHDA 4CLXA 3IBYA 4RK6A 4EEKA 2QGZA 2VHEA 1PHPA 3T7RA 4YRTA 3CKYA 5CFNA 5K8UA 1CRZA 4LOLA 4PPQA 2P40A 1E6UA 1RE1A 5CEJA 3CUTA 3P4YA 5I9SA 3HWWA 3MTGA 3Q7QA 3ZZUA 4O08A 5LSAA 3N76A 1JYSA 4MPRA 1TA4A 2YWFA 5UKDA 4QTYA 1J4AA 3GCWA 3R44A 1IEQA 4FGWA 4YRLA 1KP2A 1O0BA 5FTKA 3AF0A 2FWNA 3W8FA 5LIRA 3BHJA 3SCZA 3TFWA 1Q3KA 2WQ6A 1W4LA 3U26A 1K6EA 1EFUA 3EBOA 2QTVB 2W6NA 4ZOBA 1I10A 4OK6A 4LYGA 1VJCA 3A8TA 4WXPA 5H02A 1M6VB 2FN7A 3KB8A 4MWZA 1GFWA 4CG1A 4LUCA 4ZN6A 3H2ZA 3PFFA 3ZWPA 5DASA 1SB8A 4KQ1A 3DLCA 3MGKA 4O5AA 4TN5A 2AW3A 5FB3A 2XT9A 3OKPA 4LZLA 3WGMA 5ALRA 5ITWA 4B7ZA 1KMIY 1MX5A 5AK5A 2W8ZA 4FYJA 4JELA 5HX7A 2E21A 1SD5A 3HP4A 4QFBA 4LXQA 4LJSA 5ANRB 4B4WA 3DUWA 4Z49A 2JI4A 2WKSA 1NRXA 4HAYA 5CNMA 3AL2A 1JAIA 3UAYA 1DWOA 1PI3A 4P93A 1XF1A 1YH3A 4U39A 3VZDA 4MIYA 4DIBA 3Q5GA 4ZYXA 2IP1A 4LZZA 4HGNA 4IMRA 4NULA 1EUCA 4MLCA 1XKTA 3MMZA 1KYYA 1II9A 1SUEA 1VI6A 1X8LA 3CNNA 3O3OB 3R3YA 1SUDA 3SSAA 3W06A 4LWZA 4UREA 1DAHA 1YQWA 5JSZA 3QEOA 4ER7A 5F1OA 4AN0A 1EG7A 1VM6A 1R64A 4EW6A 4KXVA 2EC5A 1Q44A 5BMVB 1MPXA 4LRQA 3IAM6 4LXXA 2EKQA 2RHLA 4FMBB 2F00A 2O6HA 1QVZA 4KUGA 1SK9A 4QQKA 3R5JA 2YNMA 4XB6B 2C9YA 3DHVA 3RC8A 1CLUA 1H9AA 1RBZA 4MS4B 1Y8QB 1ZC3A 4FGKA 4GECA 4R2JA 3PBKA 3TNJA 1I8TA 1BX1A 4J4BA 3ZWOA 5F5NA 2C5LA 3W6UA 1W49A 4NL4H 4DDMA 3L7CA 4MV3A 4G41A 1XKLA 2XVXA 2VDVE 1CZUA 2XBUA 3FNGA 4O8ZA 4OHWA 4B9AA 2XT6A 4BNXA 3CWZA 2R4UA 5BMOA 3DE7X 3H17A 1I2MA 1SC1A 2BFMA 1UKZA 3ZX4A 2GM3A 4O4LA 1T6XA 3HB5X 1FVOA 3ZDCA 3W5JA 1QGYA 1D2HA 3IKJA 3MUEA 4IFBA 5LA6A 4BGIA 4BJ6A 3ORRA 3P2JA 2P6OA 4FKMA 1OREA 4LYDA 4GSYA 5I8PA 2IH4A 8OHMA 2UYYA 3BERA 7ADHA 2X8BA 1Z0KA 3D6MA 1YMQA 4RFVA 1E9SA 1SO8A 1IXYA 5F98A 3IH5A 3GT3A 1GPWB 1DBIA 3RYIA 1WDKA 1QFMA 2KI5A 3CF0A 3H19A 4G25A 4XD2A 1PCXA 1U0TA 2P6NA 2AYZA 4Q01A 1XB2A 1UJ4A 1FSSA 3A2LA 4WN9A 3IA7A 5D3MA 2Y4OA 4B48A 1RPJA 4BY9E 4JOBA 2ZB2A 3IV6A 4WMLA 3AEKA 1YFKA 2WBLC 2WUGA 3A06A 3ORSA 2H4YA 4LY9A 5IK2A 3UUEA 1BW9B 1FSFA 3B3JA 1T13A 1L8QA 1GRNA 5E9WA 1FU7A 3CG0A 3CZ5A 4EUKA 1SXJE 2XTMA 2VSXA 2QTVA 2P69A 2QN2A 3G8YA 5HK9A 1WRBA 1A3CA 1NOKA 2DE0X 3EH1A 3K6RA 5CT5A 1BVHA 3DWIA 4OP1A 4JMLA 1OQAA 5CITA 2Q3DA 4PX9A 2DXIA 3P0HA 2A0XA 2PL5A 2VPPA 3KZOA 4WGGA 2MR5A 3L0CA 3PPWA 4FD3A 4LE1A 1H6CA 4XWKA 3VC3A 2EIXA 4K9LA 1NJ2A 3TR0A 3VJRA 2WNIA 3RJ9A 2VAXA 5GP1A 2V45A 3CUVA 4F5ZA 4XKJA 1VGRA 3RFTA 4IOJA 2WFLB 4ZAWA 3OEYA 5D5PA 1L8OA 3PD0A 4KH1A 4C29A 3D1VA 2CLEB 2OV2A 3BXPA 4RZHA 2MWMA 1I1NA 4TWJA 3TLGA 1Y1LA 3HXQA 4UCFA 4ZAFA 2OB2A 3WNCA 2WTNA 3VH4A 3FOFC 4LIPD 4KE6A 2C04A 4Q03A 3UKJA 1DCKA 1K6IA 2QZSA 2C9BA 3TRIA 2Z09A 1JKJA 2BHSA 3GD7A 4RVFA 4GMXA 5G53C 3AZPA 3S8YA 4MEJA 3LCVB 3LQKA 3ZS9A 4AIRA 1X80A 3LW8A 2C9MA 4HDSB 5KNDA 3VKFA 2CLMB 3Q3EA 4RD4A 4U9UA 4OUDB 4LDAA 4D8TA 4WI1A 4ZIRB 1Y5NA 4WNYA 2AJTA 2C82A 2GNOA 1T2EA 5JS2A 5FUYA 4OATA 5FWDA 2YQZA 5MFZA 5K3CA 1W5TA 1U8FO 2O4UX 1G3UA 4DIFA 2AXPA 4EA8A 3A1NA 4NG5A 2FK8A 3K05A 3KDPA 2CK3D 1SVLA 2YX1A 2GESA 2LP4Y 3ICWA 4EGAA 4MDFA 3WYEA 1DUSA 3EZFA 3I04M 1ZGAA 3GDFA 3TJZA 1G6OA 2WWHA 3BL5A 4LJLA 1YJXA 1DUVG 1GAEO 1N57A 4OQ4A 3EPLA 5CYFA 2X0JA 4Q24A 2J67A 4DSTA 2Y77A 2OZKA 2A94A 1RQXA 5D84A 2IPOA 2J1LA 4MYUA 4Y67A 3LLUA 4QTTB 5U4QA 3ZWAA 2XMRA 1M0TA 2OC4A 5I5EA 1YZTA 3M3DA 4OH7A 4AJ4A 3NBYC 5EHGA 1JTVA 3F7TA 3A6DA 2PGLA 4RTMA 2JAOA 3VV2A 3LDGA 3PC6A 1J24A 2VDRB 3F46A 3I73A 4S1PA 5DV9A 3OLYA 4C7JA 3H6HA 1W76A 3R0VA 4FLMA 3LT0A 3KLBA 4XSHA 4C3UA 4ER5A 1BW9A 1XWIA 3K30A 3NAZA 3RSGA 4D57A 1W7AA 3VDMA 3QE9Y 2YVUA 1YBFA 2QX4A 5CRIA 1ZI8A 2Y93A 4QOSA 1V1RA 2B1JA 3PGXA 3V8NA 5LZ4A 4XOIA 4I5EA 2PLNA 4AULA 5A5DA 5H83A 4N6GA 1B6RA 1OXUA 4OREX 5EJGA 3M70A 5B1HA 2IYLD 4CM4B 1C29B 4RTKA 5F7OA 5FI0B 1H69A 4P92A 2CVZA 2IX9A 5E6UA 1NP7A 5EJ7A 3QKWA 1JTEA 4P3KA 1IE3A 9LDTA 4U02A 2WHQA 4R71A 3THYB 4A82A 2H6EA 2WQ7A 4FU0A 3QFFA 4YFVA 4CPDA 4FN4A 1IAQA 1I3CA 1PAUA 1G8HA 3ANXA 3TYXA 3D2BA 2IQ5A 3SHVA 3UNXA 5FPSA 1AKTA 1NMYA 4EHLA 2NNWB 1S6YA 2B9VA 3ENWA 3F6PA 4B3RB 3CURA 4Z4GA 1IMOA 3FPKA 4IMPA 4AZVA 3GAAA 5DYWA 1PT7A 1R0YA 1U7PA 2ACWA 4QWWA 5KNBH 2HCBA 2CNLA 2ZVQX 3LX8A 3E61A 5AOAA 2AOTB 1EESA 3ZK8A 1ZU4A 5KKCA 1KFJB 1T43A 4PAGA 4NYIQ 3ON5A 3PYLA 3RSSA 1JR2A 2WLSA 3D7NA 5C4IA 2AF4C 5KSZA 1ECPA 3OQPA 2BKVA 2H1WA 1P4SA 5LP6B 4O2BA 2JVJA 5KJCA 5E8JA 4AKIA 4MUHA 1FJHA 1T6BY 3A26A 4V0OA 3HRKA 4ODIA 3ROTA 4ZMSA 2FEMA 4DPKA 4OX9Y 3NV7A 4UVEA 2D54A 1D5WA 4D4IA 1J5XA 5EXEA 1QRAA 3IEIA 4QRIA 1VHDA 3LBFA 1PEDA 2GPYA 1CZRA 3FYTA 2FFHA 3N2YA 3RTEA 3V80A 1E63A 2NT3A 1SBCA 1LSSA 3MVEA 2O3RA 2HNBA 1P0PA 1OXBB 4YROA 4XGIA 5CFRA 4MA4A 1Z2NX 2FPGA 2CL0X 4PLFA 1BA3A 1U3UA 2FEWB 1DIOB 3V8PA 4A0SA 5A0TA 4IIYA 3PQ7A 5EL0A 1NLMA 3LZCA 3LQFA 4BLRA 3AK4A 4JI1B 3MAGA 3B20A 4PC6A 3GCDA 5IM5A 1KVQA 3C5VA 4G5HA 2JJ1A 2Q8QA 1L4BA 2RGRA 4KNVA 2FPLA 5BSUA 2X0FA 3TQSA 1X7GA 3L0ZA 1SQ5A 2GHQA 3ELDA 2P9BA 1SCJA 2C5SA 4Z54A 4RDXA 3M0EA 3CR7A 3SC2B 5LU8A 2ONZA 1EK2A 1GOTA 2ZROA 3MA0A 1EP3B 1TE2A 3WIBA 3D8TA 2NUAB 3I92A 5AYVA 2FPKA 2PMFA 3CF4G 4BYGA 4C78A 2ZIGA 3BRWD 4ZGGA 4Z7NB 1DIAA 2BZ0A 4POOA 4LK3A 4DWWA 1FSPA 3L06A 2NG1A 3L7YA 4DNQA 1U94A 2AMFA 3NEPX 3MILA 1L9KA 1Z4PX 2IOYA 2FQYA 5IC5A 1ONNA 2VT6A 2CL7X 2IHBA 3RAPR 3TUJC 4HRXA 5AJYA 3I6BA 4DDWA 2HA5A 2YFQA 1NW5A 3DZ8A 4U6NA 1HI9A 3AI3A 3JTMA 3TO5A 2GCEA 2COUA 3IEMA 2C1EA 2VT3A 4C6HA 2PA0A 4Q1DA 5EI5A 2BH9A 1UKVY 3CVOA 3DW1X 4PZCA 4HAWA 4UBKA 4ETNA 5AVQA 3CEHA 3M1AA 5LBIA 3W8RA 2CNOA 1YB5A 3A37A 5BNFA 4AS2A 1KTIA 3H2YA 2O2EA 4C7OB 1CJMA 3IILA 3GN2A 3R76A 4BFUA 1O58A 2ZYRA 4ITUA 3EE6A 4JA2A 3SVLA 1Z5UA 1QS0B 3GP3A 3IOBA 4G4IA 1RPNA 1L5HA 4LK2A 3KT6A 3T4XA 2GJ8A 1NWCA 2JIRA 2PWZA 3H1GA 2O19A 4K1LA 4CTJA 4XASA 3L4EA 4G26A 1NPTO 2FPIA 3QWFA 4RVOA 4D5EA 1PJSA 1RWXA 2AW5A 5T4HA 4BFCA 4EJSB 3FFTA 1D6JA 3IDFA 3PHBE 5B7GA 4M49A 2J0SA 3I3SR 4BCBA 5LKAA 1SOUA 2QPOA 4NI5A 1PG0A 3EA0A 3R3JA 3GFTA 4JEUA 1ZH2A 1K68A 1WSDA 2HRDA 3JVEA 3EG5A 4HX2A 1V8DA 3VH2A 1B3RA 2C7VA 3WLJA 2FR8C 3ZD9A 1N8NA 1EE1A 1MOZA 3DB1A 3PG5A 1LLQA 1PQUA 4LS3A 1TUIA 5SZHB 4MNTA 3VNQA 1HTBA 2GRJA 2ZJBA 1JXMA 5GONB 1MAUA 4HDAA 1FQKA 4KPYA 4PZAA 1QK4A 3AERB 2QW8A 5EXDA 1KI9A 4PSKA 2HY7A 3QUAA 4MRMA 5FUBA 2R7NA 3L40A 3TIVA 1YDEA 3BIWA 1B6TA 3OE7D 1Z28A 4X1OA 1QIEA 4CMAA 5AVRA 2C4NA 2PZBA 1NVTA 4KAFA 4KIUA 1TAQA 1FRNA 1XAGA 1YA4A 3X1KA 5LXTA 2PXHA 4IMIB 3U49A 1W581 2XECA 4Z3KA 4Z5XA 1KRHA 1QIMA 2HQOA 3ETHA 3KOYA 3DL2A 5L3SA 3AY6A 1P74A 2E4AA 4CJXA 1E5LA 4CMIA 2QROA 3N05A 4N49A 3D8RA 5ALEA 4I1PA 4EY8A 3HGQA 1KFKB 4BZPA 3RC7A 4D9IA 1F7VA 5E2IA 1D9XA 4PVCA 2WTXA 2M2IA 4RFLA 4K9RA 2QQFA 1E96A 2O8NA 5AVYA 2I8CA 5JPDA 5CUQA 4N5HX 2FKAA 1G63A 3GLHA 3M3PA 3NHWA 1XD2A 1W36B 4XEHA 4QBTA 4C7VA 5LLTA 3B85A 1EWTA 4WCFC 4XRRA 3FKSA 5I9BA 2V6JA 2YY5A 4M36A 1ZLYA 1CUGA 2QY9A 4DJAA 5A4IS 2Q62A 3MELA 4ND8A 4E5NA 2V8OA 2GJSA 3FNIA 1NYTA 3IAM1 3QHPA 1XK7A 3KXIA 4RSGA 1GPKA 3TMYA 3HXMA 1IOVA 2D3WA 4ILEA 3WKDA 4YAJA 3Q7PA 3GGJA 1EGHA 3ZI4A 4DMKA 4A6DA 2ZSAA 2J9GA 1I4EB 4WK0B 1E2JA 1B8PA 1G8GA 4HC4A 4FLEA 3UIEA 2R6GA 5FI5A 3RS4A 2OFWA 2R25B 4DQUA 3LQRA 2CYBA 3IVCA 5JYBA 1HTTA 4QYIA 4UOQA 3GLKA 4E5MA 3X1WA 1JR3A 1OYYA 3PQFA 1N2CB 1RACA 1Z22A 2IGTA 3QEMA 4ILKA 4YCJA 3VR5D 2ZSIA 3KIPA 4C1BA 7YASA 1KA9H 1QAOA 3VZBA 4D74A 3FOEC 1H9CA 3W9BA 4DNXA 6ADHA 3KELA 4YLGA 3N2EA 4LF5B 4PLYA 5T8KA 4XYGA 3WB0A 5KU7A 3BTVA 5E2BA 4H31A 5HPYB 5GM1A 3RSFA 3INNA 4NP6A 4OHZA 1JVNA 2D0DA 5TX7A 3O2QB 2YHSA 4MW1A 1C9EA 3P96A 1PR0A 4LWQA 1HMPA 4OA5A 1A5AB 1SURA 3RODA 1QIHA 3UUGA 2BJHA 4BNDB 4JL5A 1OB2A 5G2OA 3JQFA 4H4CA 2X0RA 4C0BA 2MSWA 4X44A 4Y7DA 1I94B 4LWOA 1Z4IA 1WPXA 3GLGE 4MVJE 2IBSA 1JDBB 4XCVA 3DFIA 3JARA 4O4LF 2PXXA 3RC1A 4GD3Q 4DCTA 5C8XA 3VHXB 3ONWA 4L8WB 5DLYA 3ZE1B 2CFSA 2C2GA 5LZ8A 3TZKA 3AF4A 4ARBA 1EUZA 1MV5A 5EXTA 3U9SA 4NZMA 2PPLA 3RBVA 1W1IA 3AR7A 4II2A 5A3VA 4YVFA 1G8SA 3MSCA 3SDBA 2AOVA 4W5QA 4L22A 5HZHA 3E3MA 2JCXA 2I2BA 4M9CA 3AB7A 3T7AA 3NYRA 4DA4A 2IOFA 1MQ9A 4M53A 4MJXA 1ZMBA 4MXDA 2LBPA 3FNBA 5EERA 4CE6A 4FZVA 5B3JC 4QBHA 4B3MB 1LDBA 1V26A 2AJDA 4ZO7A 2D4HA 5BN1A 3RFXA 3CCBA 3IXMA 3SLRA 1E5QA 4XGNA 5EIHA 2RCNA 2DBYA 2EX4A 4K8OA 2F43B 3L8GA 1AD2A 2V5UA 3C48A 2W8BB 1XD2B 1TECE 5IBCA 1F51E 3BCRA 4UTVA 2SKCA 5AM0A 1K7FB 1Z75A 1Q92A 2ZUSA 2L17A 5HR5A 2QA5A 5HSGA 1ZNXA 2WSMA 4ZCQA 4I50A 2IY8A 3LUBA 3I6ZA 4UM9D 5EZQA 3TL6A 2ARKA 5LQNA 1RHJA 3HB9A 3RKSA 3VA7A 4IV0A 3SMVA 2QLBA 2NAPA 4RY8A 1DINA 1GZ5A 1HSZA 1XRJA 2JLCA 3A32A 3V6MA 3W05A 1P19A 4TOIA 4CBVA 2BFNA 3FWZA 1C4OA 2FP3A 3OP1A 4I5GA 1A71A 4B6FA 5BUSA 2XUGA 4QT4A 1WMBA 1UBHS 1QC5A 5KSYA 2C3MA 3DEHA 2UVPB 2HMUA 2WZDA 4QL3A 3KAKA 3SI7A 5LD2C 4RJKA 1JXAA 1KEZA 3KHSA 3OBIA 4TKVB 3KT0A 3JQDA 1MORA 2VYCA 2CJFA 3NTVA 5BRJA 5EINA 4M37A 3EWSA 3FMFA 5AM5A 5HW0A 5BN5A 2Q7OE 3GV0A 2Q5QA 1K4KA 4DM3A 1VMIA 3R6LA 2PRSA 2HFKA 3OX2A 2XVMA 4NJOA 4Q3KA 3T8YA 3WKBA 4BECA 4FYVA 4L28A 2FG5A 4H7HA 3IUSA 2PRJA 1HT0A 3HO6A 1U5AA 3EGEA 3RWOA 2VSYA 4DLVA 4MWTA 3OM9A 1JAZA 1M34E 2HCTA 2Z8YA 4HDCA 1PF7E 4Q1FA 3LBAA 4L50A 3AWDA 2XVYA 5JTUA 7MHTA 1U0NA 2OSVA 4RGQA 3ZNNA 4TXLA 1RPZA 4G0YA 4HT3B 4HEQA 2QDXA 3BAZA 1PJAA 3TX6A 4R1MA 1ZHOA 1KP9A 2OWEA 3ESCA 3QVUA 5GONF 1R4NB 3E5MA 4BQRA 1GVHA 1GTSA 5CT8A 1KZYC 1QHHB 1DJPA 5EESA 4AO6A 1PL0A 3X1MA 1BFUA 3OZCA 2Q29A 4JUIA 4PANA 2K5UA 1SAYA 4QYSA 1RZUA 4KFRA 1WZNA 3TECE 3JQ8B 1A2KC 3UA4A 4NBRA 2B30A 1Z2OX 1L7OA 3UHFA 2H3HA 3PWSA 3HKEA 4HAOA 3PQCA 4ENQA 4HEA6 4LY3A 3A1DA 4W8OA 1FDVA 5JQGA 4LHSA 4NYMR 3DGEC 2VC2B 2H92A 2VBCA 3RIHA 3WLPA 2B37A 3D4IA 4NQZA 2OYSA 3TSCA 3A6FA 2BFFB 4FJ1A 2C54A 3VR1A 5FA6A 1T8UA 3CJRA 3JCZA 4HAIA 5CNJA 2EJBA 3EWIA 4N6NA 1QIFA 3C0KA 1EUCB 4QARA 3ZOZA 4BGVA 2ODWA 4LGCA 4XX0B 2WVAA 4HQ6A 2GN8A 2UZ4A 3KX2A 4MAFA 2EDAA 5I9LA 4F38A 2WIGA 2IEDA 4B3DA 2VJYA 1NSTA 1RYBA 1WF3A 1N9ZA 3DFZA 5DN6A 4NAVA 3C5EA 4CTOA 1IHDA 3KQPA 1RM0A 2YOFA 1W8DA 2HK8A 4JB3A 5C46F 2DVMA 2C5HA 3PGVA 3RSQA 1WPRA 3AZOA 4X65B 1Q7BA 2X2FA 4F46A 1XZHA 4AICA 2FPMA 1GPBA 4OHYA 4ESEA 2CXQA 2NX2A 1KERA 3NDJA 3KYDB 5M7EA 4P82A 3SLGA 1QBKC 4TKZA 1IIRA 4FDMA 5JJBA 3K1TA 4DR2B 1C4XA 5IM4A 4BMSA 5JI2E 4ZMBA 1LFAA 5DNWA 4GKKB 2EHJA 3HJTA 4EJSC 1FSZA 1G3MA 1XDDA 5BUCA 2AJ8A 5IK2D 5IHPA 4JBLA 4C2BA 4JEMA 3RV3A 4GZMA 1ZM2A 3AFMA 3QHQA 1Q2XA 3Q0EA 4KE9A 4QPCA 3T35A 5C4MA 2OCXA 2FSIA 3O26A 5IJZA 4RF5A 1DCMA 1T9GR 2LWIA 1M6NA 3GUUA 2ZXFA 1N5OX 1RNLA 3QEJA 3NDIA 1N3IA 1R27A 2ZWAA 2BFDB 1KBQA 4EEXA 1YFJA 3A6PC 4D9MA 1XPJA 5M3BA 3DMYA 2H4WA 3AL3A 2ZB8A 3HH8A 3D7SA 4UNSA 3WWPA 4S0XA 3DE1X 3NS7A 1P4RA 1NQWA 1G19A 1R4NA 2L2QA 5FUXA 2WSIA 1ZZGA 1ZI6A 1H5QA 1QH1B 2RJOA 2PWYA 3BVPA 3GEDA 1VPTA 4NARA 3RFCA 1OX5A 2YJNA 3JR3A 2CZQA 1TCAA 4K3VA 1IN7A 4MULA 5FT9A 3TLKA 1ARZA 4UM5A 2VSFA 4PYNA 3IS3A 1MZVA 1FP4B 4YMVA 1QZ3A 1SA0B 3P7MA 1K7SN 2ZRMA 3NVMB 1DKPA 3SEQA 4EQ6B 3CISA 2VBIA 4DIMA 4DMRA 1C9MA 3ZQJA 3N0RA 2W7TA 3I9JA 4HZUA 1VBNA 4MPDA 1CHNA 5EYPB 2BFPA 1X8KA 4XJTA 5JTTA 2VK2A 5C37A 2AXNA 2D8AA 1D8TA 1NN0A 1WSAA 3PIRA 1Z88A 1T4CA 4EFMA 4ERXA 1H0KA 4KNYA 1TT5B 5JY1A 1E8NA 2ZBUA 1ZWKA 3H5IA 4CQMB 1O9GA 1QH8B 2WHRA 5DIZA 5B2ZA 1QRUA 4GYJA 3ZQKA 3CLRC 4R1PA 1PTJA 4JS0A 4BJ3A 3INGA 3I1IA 1E3WA 4GHWA 2BFBB 3PLAE 3GFOA 4NE9A 4BO3A 3CSDA 2EL7A 2X3YA 4ZJZA 1JLHA 1R0LA 4L0QA 1TZMA 1AQYA 4FNAA 3W2HA 4B32A 1XZBA 2Y2VA 1AQIA 3OM8A 5EZYB 4YV7A 1QNFA 1U7XA 4BNVA 3K6JA 4AAYA 3ZV3A 3GH1A 4BN4A 1ATZA 5IJ9A 4JJZA 4O4IF 3ONEA 1C2YA 3G5UA 1YZHA 3ZGZA 5JZSA 1B8VA 1CUDA 2GEJA 3UUFA 2O8EA 3F8WA 1Q7EA 2GYVA 4MYSA 1BRMA 1ONOA 3WK8A 2AOUB 1JX6A 4KI0A 4WBNF 1DIHA 2I6FA 1MOSA 2Y1LA 1SXIA 1VPLA 3OO0A 5BR7A 4RJLA 3VPXA 3DAFA 4Y2PA 4ZV4A 4MK4A 3NATA 2FQ1A 2FXIA 1LF0A 1P2VA 1Y6GA 2HPZA 3IEUA 4YRKA 1UC4B 4LYHA 1NVGA 4DLNA 1TEVA 3FOWA 4HHEA 1FJGB 4D25A 1T91A 2FWJA 2NO7A 3L9XA 4LZJA 4KPGA 1E5XA 5KKNB 2BV3A 3GLIE 5EJ2A 1J6UA 4FJ2A 1YFZA 4R69A 4KRYA 1CR1A 2JK1A 3BZUA 2ZTHA 2C4UA 3F3SA 3H5NA 4MTCA 4ZPJA 3B51X 3FWKA 3EVCA 5LQDA 4BKPA 3LX6A 1XE3A 3BJZA 2B7BA 2P90A 1PR3A 3HVHA 1IXKA 4GLFA 4PR3A 1CCWA 2DHEA 2DQSA 2HDHA 3NX4A 4HYYA 2QGNA 4QJ4A 3R20A 1Y7LA 4CFSA 3RJTA 3O31A 4M0FA 5I6DA 2NQ8A 2YC4C 1NLZA 5FUQA 4OX9B 5CDFE 2JFWA 2R8YA 2YKGA 5FTLA 2XDYA 1Q3HA 1YTLA 4FBLA 3QX7A 1R10A 2GTIA 3C4VA 4AUEA 4PQFA 4QBGB 4BV3A 2W2VA 3D8BA 3MQ2A 1RWVA 1PK9A 1VECA 2QX9A 2QN8A 3C7DB 4MW9A 5DI3A 4KYIB 1DTSA 1B1AA 1LDGA 3F5QA 3TLBA 1BEUB 1SIBE 1Z0JA 2XITA 3EDRA 3GA5A 3S2UA 3ZIDA 3Q9UA 3QF7A 5JCJA 3W34A 3OFND 4QUAA 4GQIA 3GZJA 5KPJA 1W0JA 2R87A 4H3SA 5J5AA 4MR7A 1E2LA 2IYUA 2H54A 3IOCA 3TIFA 4ABYA 3LC0A 5JQGB 3TQOA 4DF3A 5DM1A 4LKRA 5ESDA 2BEUB 1OAOA 1TCVA 2PY6A 3USZA 1H2ZA 1W0CA 3WLEA 3LCMA 4FIDA 3NQ41 4OXKA 5DF1A 1ZH6A 2ZRGA 4QKQA 3CVVA 2HR1A 4QC2A 3IJEB 3E03A 2ZBEA 3HUFA 3ZOKA 2PUDA 3MGCA 2O8FB 4WCVA 2OBBA 4Y6LA 2PXAA 3IHWA 5IW8A 4LZNA 4B7CA 5DNUA 3CHYA 3ZV4A 1DHRA 1E9FA 3ULKA 3SBOA 1E3JA 2I4RA 4MYTA 4WLOA 1ML4A 3TPFA 1P0CA 3DONA 1YB6A 2IW1A 4XARA 3LJKA 3QU9A 3KP1A 2PQ0A 2QL7A 4LISA 1UMBB 4TQUS 2J33A 1A96A 2IH2A 2XWPA 3UA3A 3G8DA 1RXSA 4XE5A 3H5VA 4NS1A 2GYUA 4EA9A 3OF5A 1AHHA 3M6VA 2B5VA 4O4HA 1GQQA 2V3VA 2Z5FA 3QVJA 4MVYA 1V5WA 2B4RO 4P7FA 5A6VA 1SHTX 3LUKA 4G2NA 1V8OA 1L5WA 3G7UA 3M3HA 5L95A 1AS0A 2HO5A 2YH2A 3COWA 121PA 4UTNA 1JHVA 3ORHA 1F17A 2QJTA 4WHMA 3WMEA 1MPTA 1DC8A 1NI5A 1ZN9A 1MABB 2J0UB 2BDEA 2CW5A 1X2BA 2VNAA 2ZRFA 4ID9A 4PPGA 3ND8A 1NZFA 3VO8A 1G1AA 1GPH1 2QUAA 3AOEC 1Q5PA 1TM3E 3G79A 1EFHA 2EFDB 4EYSA 3ABZA 1Z6PA 4K46A 1EAYA 1W1UA 3H9UA 4K03A 1EX6A 3B38A 3ER8A 4Q4JA 2E4UA 1V43A 2D2FA 2I7TA 2ZXUA 1A9PA 4J9UE 4LECA 1XZMA 1YZYA 1HQDA 3LZ6A 3DEJA 4FMCF 4PQGA 3G0CA 4Y2HA 3IAS6 2P2LA 4TWAA 3ZJ5A 4S0ZA 2R62A 4ZK6A 3NBMA 1LI4A 5LQSA 1UC5B 3B52X 3P2MA 4S3MA 4CQLA 1R6AA 3KC2A 3RG8A 4DILA 2ZATA 3ANLA 5EKDA 2PANA 3T12A 1UXKA 4R1LA 5AXDA 3I42A 4TS1A 5A9SB 1RBQA 1MZPA 4WFJA 2QXUA 3ANMA 1A76A 5IXSA 3C16C 5B1DA 3EVZA 4BASA 4Q4CA 2WNHA 5LYJB 5JJKA 2LCIA 5B3JA 4F6LA 4GOOD 1N9KA 3HR4A 4L74A 5AH0A 3I9KA 3LO8A 1SXJD 3OQNA 2IHJA 5CA1A 3E4DA 2FN3A 3PC8C 1PX2A 4I55F 4HNHA 3ZGNA 2A1TR 2R6JA 3C8ZA 4HI0E 4Y98A 4WWHA 3WZ2A 2BKAA 1N78A 1JSCA 2QAGC 1YDHA 1FRQA 1G7RA 1Y8RA 3LKBA 3R5HA 5JS6A 3LGAA 1ORHA 2EG5A 2I4OA 3LUAA 4JLJA 4P0TA 1XJWA 2HLPA 4H6XA 3UMGA 2J3MA 1NVEA 2ZIUB 1NYRA 1VIVA 4PNPA 2A67A 4W6QA 2H07A 4B4OA 1MT0A 2PYZA 5G40A 5AVSA 5TIIA 1KWKA 4BDSA 3FPEA 5ALZA 4MPJA 2G36A 3T4EA 5EUCA 3IQFA 3T3DA 1D8AA 2ST1A 3O9VA 3PTLA 5AHRA 1R8XA 1C2TA 1RWMA 4NYJR 1PJQA 4Y6SA 4ZHQB 1KZ6A 4UC0A 3PL1A 4JQYA 3RRZA 4QU0A 1V39A 3AHCA 3NJ4A 2C97A 1I7DA 1ZGBA 2Z3ZA 1J5EB 3HDTA 1PWYE 3OHPA 4HB4A 3EB9A 1LLCA 1ZSNA 5T8KC 1SC3A 4XVRA 1CB7A 3DBRA 2N75A 1LI5A 1FE8A 3NV9A 4RETA 4WFQA 4ZCSA 4GOJA 4B3HA 2A1TS 2N1BA 2I29A 3D4BA 3U31A 4ERNA 4Q1EA 4RWZA 4W5HA 4X6UA 1ZNYA 1KZ1A 2BLNA 3HB1A 3MQ4A 3NHUA 2G5CA 2H2IA 4PIVA 3UAWA 3EZGA 1X9HA 3CU5A 4MJ3A 5DBHX 2RAVA 1WE2A 4WUVA 3H1BA 2CF5A 1NW7A 3U62A 4DZTA 3JYPA 1L1EA 4FFOA 5H70A 5JATA 1PLJA 4EYEA 3JQ6A 2I1LA 2JHCA 2UKDA 2XUOA 1XD9A 3AESB 2I5PO 3IJ5A 1PT6A 1U9JA 3CNQS 3OPYB 1M8GA 2NU7A 2A5JA 2A9QA 1Z82A 4V1CI 4TQGA 1DV2A 5BW6B 1UBSB 1LVHA 2C20A 4KBFA 1JR3E 2Z08A 2A5FA 1BYIA 1KAMA 1U1EA 1OTYA 4GZ6A 3RS3A 4NF2A 4FS3A 2W5UA 2PQ6A 1SXHA 2RIRA 3RR2A 2XF8A 2ZE8A 4HMQA 4BIIA 1TVMA 4M1MA 2AC2A 5LYYA 3BRCA 3L49A 3DD1A 2NUBA 4MV8A 3N8KA 4S1NA 4UW9A 3ORFA 4IILA 4A5OA 5LVAA 3M1YA 1A9QA 2G9ZA 1E1LA 2Q3FA 2I2FA 3C6KA 4H60A 1HDIA 1TAUA 1ZJYA 1DAKA 1N5DA 3A3OA 3EG9A 1Y4AE 2QV0A 4A0RA 2YJ4A 5ESWA 5E9AA 3UMSA 3Q4GA 1PUIA 1N0IA 1CQJA 4V0NA 4AU1A 2ODQA 1YWGO 4AMZA 2PV0A 3K0EA 2J09A 1S4QA 1TB4A 4N82A 3UG6A 4FS8A 5CM8B 5JD6A 3L1JA 1OT3A 1NBEA 5CH8A 1WSWA 2GI4A 3EW7A 1R8YA 4H4DA 1EFKA 5DLEA 4D82A 3QUQA 2AOWA 3R6WA 2C4VA 2WU0A 1GV0A 1J0XO 2C5AA 5EJ6A 1ZJ5A 4S1TA 1WUHS 1H2AS 2X0EA 1VDZA 3OAAA 3WYDA 6REQA 4EKDA 1AGPA 5BN3B 2FFQA 4QDXA 4Q66C 1K9VF 3CLUD 3VXKA 1FRFS 4DUGD 1ILWA 3ENVA 1XHEA 1NU8A 4DL9A 5IVDA 1DIBA 4Q47A 6YASA 3H1PA 4KBGA 2ZULA 4MQBA 5AKGA 4E6EA 1PJCA 2IXDA 2MSEB 4IKEA 5K4GA 3B7GA 1VMKA 4WKOA 5AI5A 1KOJA 3QHAA 3B1XA 3OWOA 1KQPA 3H11A 5D6OA 3U7JA 3I62A 4WLVA 4F97A 5HTOA 1MNAA 1U1FA 2NYVA 4P98A 1C0IA 4V3BA 1IDOA 2H1HA 3IQZA 4NZPA 2GDJA 5FV7A 3WL7A 1P7WA 1JPUA 1ZUNA 4JUCA 1KPHA 1Q1AA 4XSGA 5E6SB 3ZIUA 4DKXA 3LTNC 2DFDA 2VEDA 2OESA 3HU1A 5TGDA 2O0JA 3U4HA 4D41A 4B83A 3IHKA 1SG9A 1XZCA 2ON6A 2QYTA 4X64B 2OAP1 3NXSA 2XGMA 3BEOA 2V3WA 3OU7A 4B09A 1UK6A 3DE4X 3OJCA 1I36A 5G41A 2GCPA 3AUSA 3DMHA 1B0UA 1GU1A 3KALA 5EJFA 2JGMA 4F91B 3EVGA 3WBKA 4HZUB 3PXEA 3DCIA 2XMBA 2DHRA 4UHJA 4NR0A 3IVMA 1EDDA 3CXUA 1JT9A 3WIOA 3I1FA 4L08A 2BFWA 1MB4A 1TJ3A 4UE3S 3CKLA 4IGAA 4OJYA 2VWGA 3HU2A 3IKLA 1NRIA 4JENA 4YJ3A 2JL1A 4KU4A 4O5OA 4PLCA 1ZY2A 4WPGA 2ZIXB 3NTRA 4PPYA 5IMSA 4KQ9A 4IIDA 1L4KA 5TB5A 3ST7A 4XDHA 4TMZA 4DV6B 1OAOC 3H18A 1B15A 2JI8A 1JU4A 1CIPA 2C7GA 3U40A 4CI9A 5KHAA 3AKZA 1GSOA 1UMDA 4P3YA 2V74B 1R9JA 3OECA 1N1GA 3C5CA 5FCDA 1RYDA 1VYTA 3ZXSA 3PSAA 4OQZA 2W6JA 1EK0A 3DJFA 3EZYA 4TMXA 3BC1A 1PT5A 1ZNWA 4Y0VA 5HF9A 3RS8A 1X77A 2Z2YA 3AJ9A 3FPGA 1J2RA 3HYLA 3VBCA 5JCOC 1CR2A 4ALLA 4GGMX 1NW3A 3DLBA 3DZIA 1ECGA 2JGJA 2K4MA 3U56A 4YT2A 3J7AC 1NNLA 3DR3A 1C1HA 1HE8B 1WHTB 4NTZA 4JL8A 2VHYA 4PQYA 1OTXA 2WT4A 3HKBB 4L1KA 3OPVA 3PNOA 3G13A 3TKYA 1J1ZA 2V1XA 1T5IA 3ZJ4A 2FSVC 3MLBA 1Q20A 3HKCB 4H6WA 1XXHE 2QRKA 5SZIA 3KKQA 4QODA 1C7IA 4JP8A 4AKSA 3O38A 4M0EA 2PKQO 1R0SA 3PENA 4Q18A 4B3TB 4PRLA 2QNBA 3SG0A 2WAOA 2QUZA 3L4BA 5BN5B 1DBRA 2R8PA 3NHFA 2VNHA 3D3KA 3H05A 5F1KA 3KQTA 4DXDA 2VL7A 3DVLA 5AKZA 3GQVA 4Y6RA 1IN8A 1FDSA 4I1VA 1JLMA 3H65A 1S5PA 2O52A 2Q4OA 5A4JA 3N2LA 2IIVA 4HWKA 3E1KA 1WTCA 1D0IA 2FW7A 5IN4A 1A95A 1E92A 2EWMA 2UZIR 3A14A 1R2QA 4KK4A 1MN6A 1A98A 3RCBA 1ZJJA 3LXXA 5LLSA 2GKOA 3NHJA 1Y3FE 3LVQE 1DBPA 1KI2A 4DRXB 1U90A 4UUNA 1CQPA 1L3BA 1R00A 3KSZO 3C24A 2IITA 1WZ2A 2SECE 2D74A 4UNQA 5FL7D 2OXFA 3TD6A 1KY4A 2PBZA 1SQ0A 3M7IA 3LM8A 4FDAA 1SC9A 4B9EA 1CZLA 1DKMA 4JDPA 2PGNA 4MR8A 3ZHXA 1NN1A 3MFQA 2ZRJA 1GPNA 1TK3A 2CLIB 3ZWXA 1GM5A 5CBPA 1HWYA 1SU8A 1YS1X 3AQ4A 3O91A 2QVLA 1GSIA 3VI3B 1E4VA 3JYQA 1LBTA 4XCQA 4C7OA 1XTRA 1Y37A 3HFSA 4LC0A 1M66A 2FP4B 2X6RA 4Q1BA 1Z6AA 3WOHA 1Z07A 2PPVA 3ZEIA 4C4AA 2WUFA 1OBHA 1XDZA 2XKAA 4CLEA 2OFPA 3HO8A 1TMOA 3L01A 3K9HA 3IIEA 5J40A 3T5CA 3TEMA 4MS1A 3B2EA 2VQDA 3O1LA 1UM9B 2XOEA 3A3YA 1OBFO 2Z2XA 4G0ZA 4WA7A 5DTQA 2WV9A 2GK4A 3HDJA 1U0HC 5EA2A 3UAGA 1TMYA 4E5SA 1UK9A 2Z5LA 2RJ3A 1VP9A 2BZ1A 2D13A 2GTHA 3LTEA 3OUTA 2WU1A 3WADA 5AUPB 1TQHA 3RRXA 5EIBD 2RHHA 1JIXA 2VWHA 1YB2A 4OYLA 4X60A 4B6QA 1D6MA 1IY0A 4KHZA 1S2MA 5ALMA 3WKAA 2NP6A 4K40A 4OI4A 3QBEA 1E9BA 4BLWA 4Q37A 3L6DA 2AQIA 3IQXA 4R05A 1UODA 4DDUA 1IBRA 5FPQA 3AVVA 2OBLA 4ZV7A 2FPUA 1CC1S 3RSLA 4PG7A 4XUDA 3LWBA 3M33A 4Q9AA 1YOBA 3QF4A 1PS0A 1R8SA 1XRSB 4K86A 1G66A 1I2AA 2R65A 2V7PA 3Q3CA 3T7SA 2JJ2D 3F8SA 2HBRA 3HPQA 4NCIA 5E7IA 5KX5A 3ZR4B 4F6RA 3W0LB 5J63A 1PGNA 3A0UA 2C2KA 3ZDEA 4MUYA 4KACA 4R40A 4TVBA 4HMPA 4ACAA 1FZTA 1FK8A 1GAWA 1JMKC 1E2NA 2CYAA 1FW6A 3I2KA 2ZSJA 5AOBA