1TD2A

Crystal structure of the pdxy protein from escherichia coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
287
Chain Sequence
MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGKWTGCVMPPSHLTEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFCDPVMGHPEKGCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHAVNNVEEAVLAARELIAQGPQIVLVKHLARAGYSRDRFEMLLVTADEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGATLQEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFSATKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PdxY Protein from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Pyridoxamine kinase
total genus 96
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1td2A00
3RTGA 1ESJA 3LHXA 3RQ6A 3RTAA 3RPHA 3RS9A 2I5BA 4S1IB 3H74A 3RSSA 4E8YA 5BYFA 1GC5A 4YWRA 4XDAA 2AJRA 3B1NA 1DGMA 3RTEA 4YL5A 1YGKA 5TRWA 5F11A 3NL2A 3RS8A 5F0ZA 1LHRA 1EKQA 1LIJA 3HICA 3NL6A 1C3QA 3NC9A 4O1GA 3Q1YA 3RU2A 4EN4A 3B1OA 3UBOA 5C3ZA 2V78A 3BF5A 4LC4A 3RREA 3RY7A 1WYEA 2HW1A 3RSQA 5BYEA 2VARA 3FHXA 1LIKA 3RQQA 3RT9A 1YHJA 3IE7A 4B8RA 2F02A 2A9YA 4U7XA 3UQDA 2I6BA 1TD2A 2AWDA 3RTBA 4K8CA 1RFVA 3IQ0A 3NC2A 4K8KA 4K8TA 3GO7A 2XTBA 2HLZA 3PL2A 2C4EA 3BGKA 2QHPA 4UBEA 3HYOA 4PVVA 5B6AA 4KAHA 2DDWA 4JKSA 3MBHA 4S1HA 3LJSA 1LHPA 4S1IA 3N1CA 2R3EA 4C5JA 5BYCA 3KTNA 1RFTA 3NM1A 3UQ6A 3RQ2A 2F7KA 2AX3A 4N09A 5EYNA 1LIIA 3B3LA 3NL3A 4E8WA 3IBQA 5CM5A 4LCAA 5COJA 3W4SA 4C5MA 3OTXA 2PKFA 2DDOA 1YGJA 2A9ZA 4KANA 4JKUA 4XF7A 1TZ3A 3VASA 4GM6A 4E84A 5CGEA 3RSGA 4DC3A 1EKKA 1V1SA 3IH0A 3KEUA 4KALA 2RBCA 3GO6A 3K5WA 4K93A 4O1LA 1JXIA 3RTDA 4N08A 3RO4A 3CQDA 1KYHA 2PKNA 3HPDA 2AFBA 1JXHA 2YXUA 2R3BA 4LBXA 3DZVA 2PKKA 2JG5A 3RSFA 4C5KA 2NWHA 2Q5RA 3FHYA 4KBEA 2ABQA 3B1RA 2QCVA 2DDMA 3H49A 3RRFA 4DU5A 3DRWA 5C41A 4E8ZA 4K8PA 3QAIA 3RTCA 3IN1A 3RQ8A 3RU3A 2FV7A 3UMPA 3ZS7A 5C40A 3UMOA 2AB8A 2ABSA 3B1PA 3I3YA 3RQXA 3NM3A 1BX4A 4E69A 1TZ6A 1LIOA 1UA4A 4JJPA 3RRJA 3NL5A 1V19A 4XCKA 2C49A 3GBUA 3KZHA 1V1BA 3LKIA 4LBGA 4X8FA 3UQ9A 1RKAA 1RK2A 1U2XA 4S1MA 4EBUA 4EUMA 3QA2A 4B8SA 4XF6A 1RKDA 1VM7A 1RFUA 2YXTA 3NCAA 2JGVA 4K9CA 3K9EA 2HQQA 3RQHA 5C3YA 4K9IA 3IKHA 5BYDA 4C5NA 2I6AA 3EWMA 1L2LA 2AJPA 3RRBA 2AA0A 3Q92A 3UQEA 4EOHA 3LOOA 3NBWA 5EY7A 3KD6A 3VAQA 1UB0A 2JG1A 3RPZA 1V1AA 5TQIA 4KADA 2DCNA 3JULA 3B1QA 3NBVA 3PZSA 4C5LA 1ESQA 1VK4A 2PKMA 3MBJA 3RQ5A 3RT7A 1VI9A 3RM5A 5CGAA 1TYYA 4WJMA 4E3AA 1GQTA 1RKSA
chains in the Genus database with same CATH superfamily
3RTGA 1ESJA 2AM2A 3LHXA 2VOSA 3RQ6A 3RTAA 3RPHA 3RS9A 2I5BA 1JBVA 3H74A 4S1IB 3RSSA 4E8YA 5BYFA 1GC5A 4YWRA 4XDAA 4E84A 2AJRA 3B1NA 1DGMA 3RTEA 4YL5A 1YGKA 5TRWA 5F11A 1E0DA 3NL2A 3RS8A 4C12A 5F0ZA 1LHRA 1EKQA 1LIJA 3HICA 3NL6A 1C3QA 3NC9A 4O1GA 3Q1YA 3RU2A 4EN4A 3B1OA 3UBOA 5CGEA 5C3ZA 2V78A 3BF5A 4LC4A 3RREA 3RY7A 1WYEA 2HW1A 3RSQA 5BYEA 2VARA 1GG4A 3FHXA 1LIKA 3RQQA 3RT9A 1YHJA 3IE7A 4B8RA 2F02A 1GQYA 1E8CA 2A9YA 2VORA 4U7XA 3UQDA 2I6BA 1TD2A 2AWDA 3RTBA 4K8CA 1RFVA 2Y67A 3IQ0A 3NC2A 4K8KA 2VTDA 4K8TA 3ZM5A 3GO7A 2XTBA 2HLZA 3PL2A 4ZIYA 2C4EA 1O5ZA 3BGKA 4QF5A 2QHPA 4UBEA 3HYOA 4HV4A 4PVVA 5B6AA 4KAHA 1W7KA 2DDWA 2JFHA 1W78A 4JKSA 4BUCA 2GCAA 3MBHA 4S1HA 3LJSA 1LHPA 2UAGA 4S1IA 3N1CA 2R3EA 4C5JA 5BYCA 3KTNA 1RFTA 2AM1A 3NM1A 3UQ6A 3RQ2A 4CVLA 1P3DA 1GQQA 1P31A 2AX3A 2F7KA 1LIIA 2Y68A 3B3LA 3HJ6A 3NL3A 4N09A 4E8WA 3IBQA 5CM5A 4LCAA 5COJA 3W4SA 4C5MA 2JFFA 3OTXA 2GC6A 2DDOA 1YGJA 1EEHA 2A9ZA 2PKFA 2XPCA 2Y1OA 1TZ3A 4JKUA 4GM6A 4KANA 4XF7A 3RSGA 3ZL8A 4DC3A 1EKKA 1V1SA 3IH0A 3KEUA 4KALA 2RBCA 2F00A 3GO6A 3K5WA 4K93A 1JXIA 2UUPA 1FGSA 4O1LA 4N08A 3RO4A 3RTDA 3CQDA 1KYHA 2PKNA 3HPDA 4CVMA 4QDIA 2AFBA 1JXHA 2YXUA 2R3BA 4LBXA 3DZVA 2PKKA 2JG5A 3RSFA 4C5KA 2VTEA 2NWHA 2Q5RA 3FHYA 4KBEA 2ABQA 1J6UA 3B1RA 4BUBA 2QCVA 2DDMA 3H49A 3RRFA 4DU5A 2X5OA 3DRWA 3NRSA 3PYZA 4E8ZA 5C41A 4K8PA 3QAIA 3RTCA 3IN1A 3RQ8A 3RU3A 3EAGA 2FV7A 4UAGA 3UMPA 3ZS7A 5C40A 3UMOA 2AB8A 2ABSA 3B1PA 3I3YA 3RQXA 3NM3A 1BX4A 2Y66A 4E69A 2XJAA 1TZ6A 1LIOA 1UA4A 3N2AA 4C13A 4JJPA 3RRJA 3NL5A 1V19A 2WJPA 4XCKA 2C49A 2GC5A 3GBUA 3QCZA 1UAGA 1V1BA 3KZHA 3LKIA 3LK7A 4LBGA 1RKAA 1RK2A 1U2XA 4S1MA 4X8FA 3UQ9A 3VASA 4EBUA 4EUMA 3QA2A 5EYNA 4B8SA 4XF6A 1RKDA 1VM7A 1RFUA 2YXTA 3NCAA 5A5EA 2JGVA 3ZM6A 4K9CA 3K9EA 2HQQA 3RQHA 5C3YA 4K9IA 3IKHA 5BYDA 4C5NA 2I6AA 3EWMA 1L2LA 2AJPA 3HN7A 3RRBA 2AA0A 2GCBA 3Q92A 3UAGA 3UQEA 4EOHA 2WTZA 3LOOA 3NBWA 5EY7A 3KD6A 3VAQA 1UB0A 2JG1A 2UUOA 3RPZA 1V1AA 5TQIA 4KADA 2DCNA 3JULA 3B1QA 3NBVA 3PZSA 4C5LA 1ESQA 1VK4A 2JFGA 2PKMA 3MBJA 3RQ5A 3RT7A 1VI9A 3RM5A 4CVKA 5CGAA 5A5FA 1TYYA 4WJMA 4E3AA 1GQTA 1RKSA 1JBWA
chains in the Genus database with same CATH topology
3RTGA 1ESJA 3LHXA 3RQ6A 3RTAA 3RPHA 3RS9A 2I5BA 4S1IB 3H74A 3RSSA 4E8YA 5BYFA 1GC5A 4YWRA 4XDAA 2AJRA 3B1NA 1DGMA 3RTEA 4YL5A 1YGKA 5TRWA 5F11A 3NL2A 3RS8A 5F0ZA 1LHRA 1EKQA 1LIJA 3HICA 3NL6A 1C3QA 3NC9A 4O1GA 3Q1YA 3RU2A 4EN4A 3B1OA 3UBOA 5C3ZA 2V78A 3BF5A 4LC4A 3RREA 3RY7A 1WYEA 2HW1A 3RSQA 5BYEA 2VARA 3FHXA 1LIKA 3RQQA 3RT9A 1YHJA 3IE7A 4B8RA 2F02A 2A9YA 4U7XA 3UQDA 2I6BA 1TD2A 2AWDA 3RTBA 4K8CA 1RFVA 3IQ0A 3NC2A 4K8KA 4K8TA 3GO7A 2XTBA 2HLZA 3PL2A 2C4EA 3BGKA 2QHPA 4UBEA 3HYOA 4PVVA 5B6AA 4KAHA 2DDWA 4JKSA 3MBHA 4S1HA 3LJSA 1LHPA 4S1IA 3N1CA 2R3EA 4C5JA 5BYCA 3KTNA 1RFTA 3NM1A 3UQ6A 3RQ2A 2F7KA 2AX3A 4N09A 5EYNA 1LIIA 3B3LA 3HJ6A 3NL3A 4E8WA 3IBQA 5CM5A 4LCAA 5COJA 3W4SA 4C5MA 3OTXA 2PKFA 2DDOA 1YGJA 2A9ZA 4KANA 4JKUA 4XF7A 1TZ3A 3VASA 4GM6A 4E84A 5CGEA 3RSGA 4DC3A 1EKKA 1V1SA 3IH0A 3KEUA 4KALA 2RBCA 3GO6A 3K5WA 4K93A 4O1LA 1JXIA 3RTDA 4N08A 3RO4A 3CQDA 1KYHA 2PKNA 3HPDA 2AFBA 1JXHA 2YXUA 2R3BA 4LBXA 3DZVA 2PKKA 2JG5A 3RSFA 4C5KA 2NWHA 2Q5RA 3FHYA 4KBEA 2ABQA 3B1RA 2QCVA 2DDMA 3H49A 3RRFA 4DU5A 3DRWA 5C41A 4E8ZA 4K8PA 3QAIA 3RTCA 3IN1A 3RQ8A 3RU3A 2FV7A 3UMPA 3ZS7A 5C40A 3UMOA 2AB8A 2ABSA 3B1PA 3I3YA 3RQXA 3NM3A 1BX4A 4E69A 1TZ6A 1LIOA 1UA4A 4JJPA 3RRJA 3NL5A 1V19A 4XCKA 2C49A 3GBUA 3KZHA 1V1BA 3LKIA 4LBGA 4X8FA 3UQ9A 1RKAA 1RK2A 1U2XA 4S1MA 4EBUA 4EUMA 3QA2A 4B8SA 4XF6A 1RKDA 1VM7A 1RFUA 2YXTA 3NCAA 2JGVA 4K9CA 3K9EA 2HQQA 3RQHA 5C3YA 4K9IA 3IKHA 5BYDA 4C5NA 2I6AA 3EWMA 1L2LA 2AJPA 3RRBA 2AA0A 3Q92A 3UQEA 4EOHA 3LOOA 3NBWA 5EY7A 3KD6A 3VAQA 1UB0A 2JG1A 3RPZA 1V1AA 5TQIA 4KADA 2DCNA 3JULA 3B1QA 3NBVA 3PZSA 4C5LA 1ESQA 1VK4A 2PKMA 3MBJA 3RQ5A 3RT7A 1VI9A 3RM5A 5CGAA 1TYYA 4WJMA 4E3AA 1GQTA 1RKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RTG A;  1ESJ A;  3LHX A;  3RQ6 A;  3RTA A;  3RPH A;  3RS9 A;  2I5B A;  4S1I B;  3H74 A;  3RSS A;  4E8Y A;  5BYF A;  1GC5 A;  4YWR A;  4XDA A;  2AJR A;  3B1N A;  1DGM A;  3RTE A;  4YL5 A;  1YGK A;  5TRW A;  5F11 A;  3NL2 A;  3RS8 A;  5F0Z A;  1LHR A;  1EKQ A;  1LIJ A;  3HIC A;  3NL6 A;  1C3Q A;  3NC9 A;  4O1G A;  3Q1Y A;  3RU2 A;  4EN4 A;  3B1O A;  3UBO A;  5C3Z A;  2V78 A;  3BF5 A;  4LC4 A;  3RRE A;  3RY7 A;  1WYE A;  2HW1 A;  3RSQ A;  5BYE A;  2VAR A;  3FHX A;  1LIK A;  3RQQ A;  3RT9 A;  1YHJ A;  3IE7 A;  4B8R A;  2F02 A;  2A9Y A;  4U7X A;  3UQD A;  2I6B A;  1TD2 A;  2AWD A;  3RTB A;  4K8C A;  1RFV A;  3IQ0 A;  3NC2 A;  4K8K A;  4K8T A;  3GO7 A;  2XTB A;  2HLZ A;  3PL2 A;  2C4E A;  3BGK A;  2QHP A;  4UBE A;  3HYO A;  4PVV A;  5B6A A;  4KAH A;  2DDW A;  4JKS A;  3MBH A;  4S1H A;  3LJS A;  1LHP A;  4S1I A;  3N1C A;  2R3E A;  4C5J A;  5BYC A;  3KTN A;  1RFT A;  3NM1 A;  3UQ6 A;  3RQ2 A;  2F7K A;  2AX3 A;  4N09 A;  5EYN A;  1LII A;  3B3L A;  3NL3 A;  4E8W A;  3IBQ A;  5CM5 A;  4LCA A;  5COJ A;  3W4S A;  4C5M A;  3OTX A;  2PKF A;  2DDO A;  1YGJ A;  2A9Z A;  4KAN A;  4JKU A;  4XF7 A;  1TZ3 A;  3VAS A;  4GM6 A;  4E84 A;  5CGE A;  3RSG A;  4DC3 A;  1EKK A;  1V1S A;  3IH0 A;  3KEU A;  4KAL A;  2RBC A;  3GO6 A;  3K5W A;  4K93 A;  4O1L A;  1JXI A;  3RTD A;  4N08 A;  3RO4 A;  3CQD A;  1KYH A;  2PKN A;  3HPD A;  2AFB A;  1JXH A;  2YXU A;  2R3B A;  4LBX A;  3DZV A;  2PKK A;  2JG5 A;  3RSF A;  4C5K A;  2NWH A;  2Q5R A;  3FHY A;  4KBE A;  2ABQ A;  3B1R A;  2QCV A;  2DDM A;  3H49 A;  3RRF A;  4DU5 A;  3DRW A;  5C41 A;  4E8Z A;  4K8P A;  3QAI A;  3RTC A;  3IN1 A;  3RQ8 A;  3RU3 A;  2FV7 A;  3UMP A;  3ZS7 A;  5C40 A;  3UMO A;  2AB8 A;  2ABS A;  3B1P A;  3I3Y A;  3RQX A;  3NM3 A;  1BX4 A;  4E69 A;  1TZ6 A;  1LIO A;  1UA4 A;  4JJP A;  3RRJ A;  3NL5 A;  1V19 A;  4XCK A;  2C49 A;  3GBU A;  3KZH A;  1V1B A;  3LKI A;  4LBG A;  4X8F A;  3UQ9 A;  1RKA A;  1RK2 A;  1U2X A;  4S1M A;  4EBU A;  4EUM A;  3QA2 A;  4B8S A;  4XF6 A;  1RKD A;  1VM7 A;  1RFU A;  2YXT A;  3NCA A;  2JGV A;  4K9C A;  3K9E A;  2HQQ A;  3RQH A;  5C3Y A;  4K9I A;  3IKH A;  5BYD A;  4C5N A;  2I6A A;  3EWM A;  1L2L A;  2AJP A;  3RRB A;  2AA0 A;  3Q92 A;  3UQE A;  4EOH A;  3LOO A;  3NBW A;  5EY7 A;  3KD6 A;  3VAQ A;  1UB0 A;  2JG1 A;  3RPZ A;  1V1A A;  5TQI A;  4KAD A;  2DCN A;  3JUL A;  3B1Q A;  3NBV A;  3PZS A;  4C5L A;  1ESQ A;  1VK4 A;  2PKM A;  3MBJ A;  3RQ5 A;  3RT7 A;  1VI9 A;  3RM5 A;  5CGA A;  1TYY A;  4WJM A;  4E3A A;  1GQT A;  1RKS A; 
#chains in the Genus database with same CATH topology
 3RTG A;  1ESJ A;  2AM2 A;  3LHX A;  2VOS A;  3RQ6 A;  3RTA A;  3RPH A;  3RS9 A;  2I5B A;  1JBV A;  3H74 A;  4S1I B;  3RSS A;  4E8Y A;  5BYF A;  1GC5 A;  4YWR A;  4XDA A;  4E84 A;  2AJR A;  3B1N A;  1DGM A;  3RTE A;  4YL5 A;  1YGK A;  5TRW A;  5F11 A;  1E0D A;  3NL2 A;  3RS8 A;  4C12 A;  5F0Z A;  1LHR A;  1EKQ A;  1LIJ A;  3HIC A;  3NL6 A;  1C3Q A;  3NC9 A;  4O1G A;  3Q1Y A;  3RU2 A;  4EN4 A;  3B1O A;  3UBO A;  5CGE A;  5C3Z A;  2V78 A;  3BF5 A;  4LC4 A;  3RRE A;  3RY7 A;  1WYE A;  2HW1 A;  3RSQ A;  5BYE A;  2VAR A;  1GG4 A;  3FHX A;  1LIK A;  3RQQ A;  3RT9 A;  1YHJ A;  3IE7 A;  4B8R A;  2F02 A;  1GQY A;  1E8C A;  2A9Y A;  2VOR A;  4U7X A;  3UQD A;  2I6B A;  1TD2 A;  2AWD A;  3RTB A;  4K8C A;  1RFV A;  2Y67 A;  3IQ0 A;  3NC2 A;  4K8K A;  2VTD A;  4K8T A;  3ZM5 A;  3GO7 A;  2XTB A;  2HLZ A;  3PL2 A;  4ZIY A;  2C4E A;  1O5Z A;  3BGK A;  4QF5 A;  2QHP A;  4UBE A;  3HYO A;  4HV4 A;  4PVV A;  5B6A A;  4KAH A;  1W7K A;  2DDW A;  2JFH A;  1W78 A;  4JKS A;  4BUC A;  2GCA A;  3MBH A;  4S1H A;  3LJS A;  1LHP A;  2UAG A;  4S1I A;  3N1C A;  2R3E A;  4C5J A;  5BYC A;  3KTN A;  1RFT A;  2AM1 A;  3NM1 A;  3UQ6 A;  3RQ2 A;  4CVL A;  1P3D A;  1GQQ A;  1P31 A;  2AX3 A;  2F7K A;  1LII A;  2Y68 A;  3B3L A;  3HJ6 A;  3NL3 A;  4N09 A;  4E8W A;  3IBQ A;  5CM5 A;  4LCA A;  5COJ A;  3W4S A;  4C5M A;  2JFF A;  3OTX A;  2GC6 A;  2DDO A;  1YGJ A;  1EEH A;  2A9Z A;  2PKF A;  2XPC A;  2Y1O A;  1TZ3 A;  4JKU A;  4GM6 A;  4KAN A;  4XF7 A;  3RSG A;  3ZL8 A;  4DC3 A;  1EKK A;  1V1S A;  3IH0 A;  3KEU A;  4KAL A;  2RBC A;  2F00 A;  3GO6 A;  3K5W A;  4K93 A;  1JXI A;  2UUP A;  1FGS A;  4O1L A;  4N08 A;  3RO4 A;  3RTD A;  3CQD A;  1KYH A;  2PKN A;  3HPD A;  4CVM A;  4QDI A;  2AFB A;  1JXH A;  2YXU A;  2R3B A;  4LBX A;  3DZV A;  2PKK A;  2JG5 A;  3RSF A;  4C5K A;  2VTE A;  2NWH A;  2Q5R A;  3FHY A;  4KBE A;  2ABQ A;  1J6U A;  3B1R A;  4BUB A;  2QCV A;  2DDM A;  3H49 A;  3RRF A;  4DU5 A;  2X5O A;  3DRW A;  3NRS A;  3PYZ A;  4E8Z A;  5C41 A;  4K8P A;  3QAI A;  3RTC A;  3IN1 A;  3RQ8 A;  3RU3 A;  3EAG A;  2FV7 A;  4UAG A;  3UMP A;  3ZS7 A;  5C40 A;  3UMO A;  2AB8 A;  2ABS A;  3B1P A;  3I3Y A;  3RQX A;  3NM3 A;  1BX4 A;  2Y66 A;  4E69 A;  2XJA A;  1TZ6 A;  1LIO A;  1UA4 A;  3N2A A;  4C13 A;  4JJP A;  3RRJ A;  3NL5 A;  1V19 A;  2WJP A;  4XCK A;  2C49 A;  2GC5 A;  3GBU A;  3QCZ A;  1UAG A;  1V1B A;  3KZH A;  3LKI A;  3LK7 A;  4LBG A;  1RKA A;  1RK2 A;  1U2X A;  4S1M A;  4X8F A;  3UQ9 A;  3VAS A;  4EBU A;  4EUM A;  3QA2 A;  5EYN A;  4B8S A;  4XF6 A;  1RKD A;  1VM7 A;  1RFU A;  2YXT A;  3NCA A;  5A5E A;  2JGV A;  3ZM6 A;  4K9C A;  3K9E A;  2HQQ A;  3RQH A;  5C3Y A;  4K9I A;  3IKH A;  5BYD A;  4C5N A;  2I6A A;  3EWM A;  1L2L A;  2AJP A;  3HN7 A;  3RRB A;  2AA0 A;  2GCB A;  3Q92 A;  3UAG A;  3UQE A;  4EOH A;  2WTZ A;  3LOO A;  3NBW A;  5EY7 A;  3KD6 A;  3VAQ A;  1UB0 A;  2JG1 A;  2UUO A;  3RPZ A;  1V1A A;  5TQI A;  4KAD A;  2DCN A;  3JUL A;  3B1Q A;  3NBV A;  3PZS A;  4C5L A;  1ESQ A;  1VK4 A;  2JFG A;  2PKM A;  3MBJ A;  3RQ5 A;  3RT7 A;  1VI9 A;  3RM5 A;  4CVK A;  5CGA A;  5A5F A;  1TYY A;  4WJM A;  4E3A A;  1GQT A;  1RKS A;  1JBW A; 
#chains in the Genus database with same CATH homology
 3RTG A;  1ESJ A;  3LHX A;  3RQ6 A;  3RTA A;  3RPH A;  3RS9 A;  2I5B A;  4S1I B;  3H74 A;  3RSS A;  4E8Y A;  5BYF A;  1GC5 A;  4YWR A;  4XDA A;  2AJR A;  3B1N A;  1DGM A;  3RTE A;  4YL5 A;  1YGK A;  5TRW A;  5F11 A;  3NL2 A;  3RS8 A;  5F0Z A;  1LHR A;  1EKQ A;  1LIJ A;  3HIC A;  3NL6 A;  1C3Q A;  3NC9 A;  4O1G A;  3Q1Y A;  3RU2 A;  4EN4 A;  3B1O A;  3UBO A;  5C3Z A;  2V78 A;  3BF5 A;  4LC4 A;  3RRE A;  3RY7 A;  1WYE A;  2HW1 A;  3RSQ A;  5BYE A;  2VAR A;  3FHX A;  1LIK A;  3RQQ A;  3RT9 A;  1YHJ A;  3IE7 A;  4B8R A;  2F02 A;  2A9Y A;  4U7X A;  3UQD A;  2I6B A;  1TD2 A;  2AWD A;  3RTB A;  4K8C A;  1RFV A;  3IQ0 A;  3NC2 A;  4K8K A;  4K8T A;  3GO7 A;  2XTB A;  2HLZ A;  3PL2 A;  2C4E A;  3BGK A;  2QHP A;  4UBE A;  3HYO A;  4PVV A;  5B6A A;  4KAH A;  2DDW A;  4JKS A;  3MBH A;  4S1H A;  3LJS A;  1LHP A;  4S1I A;  3N1C A;  2R3E A;  4C5J A;  5BYC A;  3KTN A;  1RFT A;  3NM1 A;  3UQ6 A;  3RQ2 A;  2F7K A;  2AX3 A;  4N09 A;  5EYN A;  1LII A;  3B3L A;  3HJ6 A;  3NL3 A;  4E8W A;  3IBQ A;  5CM5 A;  4LCA A;  5COJ A;  3W4S A;  4C5M A;  3OTX A;  2PKF A;  2DDO A;  1YGJ A;  2A9Z A;  4KAN A;  4JKU A;  4XF7 A;  1TZ3 A;  3VAS A;  4GM6 A;  4E84 A;  5CGE A;  3RSG A;  4DC3 A;  1EKK A;  1V1S A;  3IH0 A;  3KEU A;  4KAL A;  2RBC A;  3GO6 A;  3K5W A;  4K93 A;  4O1L A;  1JXI A;  3RTD A;  4N08 A;  3RO4 A;  3CQD A;  1KYH A;  2PKN A;  3HPD A;  2AFB A;  1JXH A;  2YXU A;  2R3B A;  4LBX A;  3DZV A;  2PKK A;  2JG5 A;  3RSF A;  4C5K A;  2NWH A;  2Q5R A;  3FHY A;  4KBE A;  2ABQ A;  3B1R A;  2QCV A;  2DDM A;  3H49 A;  3RRF A;  4DU5 A;  3DRW A;  5C41 A;  4E8Z A;  4K8P A;  3QAI A;  3RTC A;  3IN1 A;  3RQ8 A;  3RU3 A;  2FV7 A;  3UMP A;  3ZS7 A;  5C40 A;  3UMO A;  2AB8 A;  2ABS A;  3B1P A;  3I3Y A;  3RQX A;  3NM3 A;  1BX4 A;  4E69 A;  1TZ6 A;  1LIO A;  1UA4 A;  4JJP A;  3RRJ A;  3NL5 A;  1V19 A;  4XCK A;  2C49 A;  3GBU A;  3KZH A;  1V1B A;  3LKI A;  4LBG A;  4X8F A;  3UQ9 A;  1RKA A;  1RK2 A;  1U2X A;  4S1M A;  4EBU A;  4EUM A;  3QA2 A;  4B8S A;  4XF6 A;  1RKD A;  1VM7 A;  1RFU A;  2YXT A;  3NCA A;  2JGV A;  4K9C A;  3K9E A;  2HQQ A;  3RQH A;  5C3Y A;  4K9I A;  3IKH A;  5BYD A;  4C5N A;  2I6A A;  3EWM A;  1L2L A;  2AJP A;  3RRB A;  2AA0 A;  3Q92 A;  3UQE A;  4EOH A;  3LOO A;  3NBW A;  5EY7 A;  3KD6 A;  3VAQ A;  1UB0 A;  2JG1 A;  3RPZ A;  1V1A A;  5TQI A;  4KAD A;  2DCN A;  3JUL A;  3B1Q A;  3NBV A;  3PZS A;  4C5L A;  1ESQ A;  1VK4 A;  2PKM A;  3MBJ A;  3RQ5 A;  3RT7 A;  1VI9 A;  3RM5 A;  5CGA A;  1TYY A;  4WJM A;  4E3A A;  1GQT A;  1RKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...