1TDEA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
total genus 91
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdeA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdeA02
1BGJA 3DA1A 4JNQA 2VQ7A 1PBDA 3VRBA 1Y56A 2VVLA 2WHDA 2X50A 3UKHA 1H82A 3DJJA 1PBCA 2RGJA 1NENA 4B63A 4E0VA 2C3CA 2C66A 3K30A 3VRAA 3CPIG 1TDEA 3BHKA 2WOVA 1RP0A 1NHPA 1L9DA 2GF3A 3P1WA 4K8DA 4NTEA 4H2RA 3RNMA 2ACZA 1B8SA 1PBBA 4LU6A 1QJDA 2CULA 2XVEA 1Z6LA 2Y6RA 2OLNA 3DJGX 2V60A 3ATQA 3H8LA 4IA6A 2WP6A 4U8PA 4OPDA 4D03A 2BA9A 2IVEA 2XVHA 4OCGA 2C7GA 3NYCA 4WCTA 3AEBA 3GD4A 4TM4A 1BF3A 3RP8A 1GREA 3LB8A 3E1TA 3C4NA 1H7XA 2XCGA 1ZOVA 3ALLA 1B5QA 2XFOA 5FS8A 3VR8A 4U2LA 1KSSA 3Q6JA 2BABA 2BXSA 1CHUA 3AD7B 3AD9B 3BNUA 1N4VA 4JY3A 4YXDA 3DK9A 3QVRA 2GR0A 4NEVA 1ELIA 4GR1A 4UDRA 1ZMDA 4TM1A 4U8OA 3UKQA 3M12A 1ZMCA 3L1RA 2V5ZA 3M13A 4BK1A 1M64A 2PHHA 2WDQA 3CPJG 3GRSA 4Z43A 4B69A 1O94A 4D04A 1EL7A 1ZKQA 2XVIA 4J36A 1AOGA 4PABA 1TYTA 4EQSA 4DGKA 1GRAA 2WEUA 1E6EA 2YWLA 3C4AA 3DGHA 4B67A 2GQFA 4J57A 2C67A 3RP6A 1JRYA 3F8DA 2WESA 3UOYA 1TDNA 2WBAA 3F8RA 1LPFA 3AECA 3UOXA 4UDPA 2EQ7A 1Y56B 4NTDA 1PDHA 1GTEA 2X3NA 1ZX9A 2XLPA 3AYJA 1IUWA 1H81A 2IVDA 3AE3A 3PS9A 2EQ8A 3AXBA 4J56A 1DOCA 1OJAA 4U8JA 2VVLG 3KVEA 2Q0LA 5U25A 3KA7A 4H4UA 3PVCA 2GR3A 3AE8A 4GDEA 3CIRA 3SFDA 1YY5A 3ATRA 4Y4NA 1BZLA 1GRBA 1PN0A 1F6MA 2BC0A 2HQMA 2YAUA 4K2XA 2C75A 4H4YA 2BYBA 4U2SA 2GAGB 2C73A 4BK3A 1Y0PA 4UP3A 3FG2P 2AQJA 3QFBA 4U2TA 1NHQA 3OZ2A 4NEWA 3QFAA 4BJYA 2QCUA 1PXBA 3UKKA 1LQUA 2YQUA 2WP5A 3UCLA 5CKUA 3UP4A 1PXAA 5BVAA 3GMCA 5KWFA 1LVLA 2WOIA 4OPGA 3B3RA 1GPEA 3EANA 2GEWA 1NHSA 4JY2A 1PXCA 2X8HA 1OJDA 4OPCA 3KKJA 3NLCA 4U8IA 1E1NA 1CL0A 4OPTA 4IVMB 2R46A 2OLOA 3GDPA 3IHGA 3V3OA 3NT6A 5FS9A 4BURA 3NNEA 1FOHA 2OA1A 2B9YA 2WDVA 4P9SA 4H4QA 1TRBA 2FJEA 5U63A 1FEBA 1VG9A 1IUXA 2C72A 2YVJA 2WOWA 3ALJA 3CGCA 4GDPA 3B6DA 4J2WA 2WPCA 2XDOA 4XWZA 3KD9A 5EB5A 3SFEA 4ZN0A 5KXJA 3NK0X 4U8NA 1VQWA 3P9UA 3NTAA 2CVJA 4CCRA 3IF9A 4CY8A 1PHHA 2FJDA 4REKA 4Z2UA 1TDKA 2V3AA 3P4RA 4GRTA 4CCQA 2JB1A 4JN9A 3KPFA 2WPFA 1IUUA 3COXA 2YLRA 3UTEA 4CRTA 3GMBA 3CNPA 5HYMA 2QA1A 4OVIA 4U8MA 4J33A 1LJ1A 2GAHB 2WU2A 1CC6A 1IUSA 1L0VA 2R4JA 1FEAA 1K0JA 3SM8A 5L46A 3EPTA 1PBFA 4H4TA 4A9WA 3I6DA 3NIXA 1N1PA 1NG4A 1UKVG 4B66A 1JNRA 2ARDA 2V6OA 3AE1A 3GDNA 1KFYA 2A87A 4YSZA 3V76A 4AOXA 3SGLA 5ER0A 3LJPA 1K0LA 3UTFA 1XHCA 4C5OA 3AEDA 1GERA 2JB2A 3JSKA 1LQTA 1NG3A 4YKGA 1RYIA 4H4VA 2YM2A 1DODA 2VOUA 4GCMA 4KPRA 5HHFA 2ZZCA 1YQZA 3KLJA 1CF3A 4OPUA 4AP1A 3RP7A 5KOXA 4Z25A 4TM3A 3IWAA 3BNMA 4XWRA 3NHOX 1E1KA 1GEUA 2C3DA 3VRDB 3NK1X 2EQ9A 2R45A 3BI2A 4YSXA 2JAEA 4I59A 1FECA 3WE0A 4ICYA 4K5SA 1XPQA 4NZHA 4GF7A 4BK2A 3AD8B 2YG7A 3CGEA 4EM3A 3CGDA 3I3LA 2XFUA 2DKIA 4RG3A 4IVOB 3VQRA 2ZBWA 4C74A 4K22A 5KVHA 1FCDA 3NYFA 1E7PA 3UKLA 5IQ1A 4FDCB 4DSHA 2H88A 4H4WA 5GSNA 2F5ZA 3V3NA 5IQ4A 2BCGG 2BXRA 2A89A 2AR8A 3P4PA 1MOKA 2R9ZA 3GD3A 1XANA 3ICSA 1NAAA 2R0GA 3LADA 1JRXA 5FS7A 1GXFA 4TM0A 2VVMA 3ITJA 2YG3A 3AE6A 1V59A 2XYOA 4OPIA 1GRFA 2ZZ0A 4CNJA 1GRTA 4J31A 2BK5A 2XVJA 2C64A 4H2PA 4C77A 1GV4A 4TLZA 1ZOYA 2VRLA 3LOVA 5FMHA 4AT2A 5KRQA 4HB9A 3II4A 5JCMA 1YQ4A 1YKJA 4AT0A 2BS4A 2B7RA 2WPEA 3AYIA 4EMWA 3L8KA 3GWFA 5C3JA 1GSNA 1JEHA 1H84A 2GH5A 1LV0A 2WDRA 3QSSA 4FK1A 4J34A 2YLSA 2BS2A 2XFQA 3UTHA 4EIPA 1KDGA 4H2QA 2GV8A 2J3NA 1GOSA 2BK4A 1TDOA 3DMEA 4YSYA 4FX9A 1IUTA 2GMHA 1DNCA 1KNRA 2B9XA 1K4QA 3H4KA 3QSEA 2X99A 4APNA 1CJ4A 3NK2X 1P2HA 1EBDA 4H4PA 1GRGA 4H4XA 4NTCA 2C70A 3AEFA 4Y4LA 2C65A 4C3YA 1KF6A 1NHRA 1QLBA 1TYPA 2XLSA 4B65A 3DGZA 3UOZA 2H89A 4K5RA 3REDA 4EQXA 2YG5A 5EBKA 2WP9A 3NRNA 4AOSA 1PJ5A 4EQWA 4H7UA 2GMJA 1JRZA 2Z5XA 1IJHA 1XDIA 1DOBA 2APGA 1W4XA 4FK1C 3ZYXA 2OAMA 5BRTA 4X9NA 3GYIA 1COYA 1GT8A 4USQA 1ZP0A 5M10A 1FL2A 4Z26A 2BS3A 2YG4A 4YTPA 2JKCA 2RGOA 3CNTA 2X8CA 5EOWA 4YT0A 2GR1A 5JCKA 1EL5A 2FBWA 2E5VA 4JDRA 4EMJA 1P2EA 3FPZA 4WX1A 4A65A 2BCPA 4CBQA 2B7SA 4JQ9A 1RSGA 5LV9A 4IV9A 1VG0A 3GWDA 3NN6X 3FBSA 4GUVA 1EL8A 4XXGA 2WS3A 1H7WA 3AE7A 5BULA 1GETA 1MO9A 3UKFA 4H2NA 4JNAA 1K0IA 3NN0X 2B76A 3G5SA 3KU9A 1KSUA 5HY5A 3GYJA 2JB3A 2QA2A 3DJDA 3NTDA 4Z44A 1YQ3A 3P4SA 2W0HA 4KX6A 1O95A 1D4DA 1NDAA 4USRA 3VR9A 4HA6A 1ZDLA 5BUKA 1JU2A 2YLXA 1OJCA 2Q6UA 1E1MA 3F8PA 1CJCA 2JK6A 2XFPA 3AE2A 1QO8A 3LZXA 5HXIA 1S2QA 4O5QA 4A6NA 1D5TA 3IC9A 3G5QA 2CDUA 4MJWA 3NG7X 2Q7VA 2XVFA 1M6IA 3ISHA 5DBJA 4A99A 4PAAA 3EAOA 4YWOA 3QJ4A 2WETA 1DJNA 1TDFA 3D8XA 5J7XA 1X31B 1OJ9A 3AEGA 2E4GA 1LTXR 3FIMB 3NKSA 2YM1A 3AE5A 3Q9TA 3BHFA 2TPRA 1NEKA 3AE9A 2R4EA 3S5WA 3H8IA 2E1MA 2YLZA 2NPXA 3K7QX 1PJ6A 1GALA 4U8LA 4UDQA 5JCNA 3LXDA 4X4JA 1D4EA 2JBVA 1GESA 2XLTA 2XFNA 2Q0KA 3GSIA 3S61A 4Z2TA 1ZY8A 2GB0A 2Z5YA 5KVIA 3ALMA 4RSLA 1H6VA 4EMIA 2XLRA 1KNPA 1Q1WA 5M0ZA 2IIDA 1D4CA 3NGCX 3CTYA 3HZLA 3R9UA 4C3XA 5IPYA 3EF6A 1JNZA 2QAEA 4U8KA 1S3BA 2WU5A 2GR2A 4B64A 2WQYA 3CGBA 3ZDNA 1B37A 4YSHA 4DSGA 4Z2RA 1ONFA 2C76A 2EQ6A 2GVCA 3UP5A 4ADWA 2OALA 2ZZBA 1BWCA 1F8WA 2CFYA 2V61A 1L9CA 2RGHA 4LA1A 5GRTA 3OC4A 4YTMA 3DJEA 3CNSA 3SQPA 2GQWA 4I58A 1IUVA 1PBEA 2DKHA 3AWIA 1O5WA 4A6NB 3K7TA 4H50A 3ADAB 3IHMA 5FS6A 3ABVA 5J60A 3GRTA 3AEEA 3NYEA 4N9XA 4B68A 2FJBA 2YR5A 1S3EA 2A8XA 2B9WA 4IA5A 3QVPA 3CNDA 2BK3A 4LIIA 3AYLA 4BV6A 2AAQA 5JCLA 1HYUA 1MXTA 4YKFA 2YVGA 5EB4A 3P4QA 2YR6A 1GNDA 2BC1A 4CY6A 2TMDA 2XLUA 4B1BA 1DOEA 2VQBA 4BJZA 3AB1A 2Y6QA 4K7ZA 4X9MA 1Q9IA 2FJAA 5KOWA 3BI5A 1B4VA 1F8RA 2PYXA 1F8SA 3CPHG 3AEAA 1S2YA 3DH9A 3ICTA 3AE4A 4YTNA 3LZWA 4M52A 1Q1RA 5C2TA 2UZZA 1CC2A 5U1OA 4CNKA 2V3BA 2O9ZA 1CBOA 1CC4A 2X8GA 4RG4A 3FMWA 4O5UA 1PJ7A 3G5RA 1DXLA 3RHAA 2RABA 3C96A 3URHA 4A79A 2NVKX 4H4ZA 1E1LA 2R0CA 4AP3A 4H4RA 4EQRA 2VZ2A 3D1CA 4Z24A 1PS9A 3BI4A 3DK8A 4DNAA 1BKWA 4Y4MA 2YG6A 3UOVA 1N4UA 3UKAA 2YLWA 1BGNA 1ZK7A 2R0PA 4A5LA 1REOA 1SEZA 2GRTA 1DJQA 3PO7A 3CN8A 3ICRA 4OPLA 4A7AA 1JOAA 1H86A 1E39A 3CNJA 1VRQB 1F3PA 5TR3A 1VDCA 4ZCCA 2I0ZA 4H4SA 2YR4A 1D7YA 1CJ2A 1GRHA 4ZCDA 4EM4A 3UKPA 3M0OA 3DK4A 1EL9A 3QSMA 2VRMA 1N4WA 3UTGA 1CJ3A 1NPXA 1H83A 3K7MX 3NH3X 1D7LA 4EIQA 2YVFA 3O0HA 4ECHA 3T37A 2BACA 5CQFA 4TLXA 1L9EA 5JCIA 2YLTA 1GTHA 1OJTA
chains in the Genus database with same CATH superfamily
1BGJA 3DA1A 4JNQA 2VQ7A 1PBDA 3VRBA 1Y56A 2VVLA 2WHDA 3T2KA 2X50A 3UKHA 1H82A 3DJJA 1PBCA 2RGJA 1NENA 4B63A 4E0VA 2C3CA 2C66A 3K30A 4G74A 3CPIG 3VRAA 1TDEA 3BHKA 2WOVA 1RP0A 1NHPA 1L9DA 2GF3A 3P1WA 4K8DA 4NTEA 4H2RA 3RNMA 2ACZA 1B8SA 1PBBA 4LU6A 1QJDA 2CULA 2XVEA 1Z6LA 2Y6RA 2OLNA 3DJGX 2V60A 3ATQA 3H8LA 4IA6A 2WP6A 4U8PA 4OPDA 4D03A 2BA9A 2IVEA 2XVHA 4OCGA 2C7GA 3NYCA 4WCTA 3AEBA 3GD4A 4TM4A 1BF3A 3RP8A 1GREA 3LB8A 3E1TA 3C4NA 1H7XA 2XCGA 1ZOVA 3ALLA 1B5QA 2XFOA 5FS8A 3VR8A 4U2LA 1KSSA 3Q6JA 2BABA 2BXSA 1CHUA 3AD7B 3AD9B 3BNUA 1N4VA 4JY3A 4YXDA 3DK9A 3QVRA 2GR0A 4NEVA 1ELIA 4GR1A 4UDRA 1ZMDA 4TM1A 4U8OA 3UKQA 3HYWA 1ZMCA 3M12A 3L1RA 2V5ZA 3M13A 3T31A 4BK1A 5KMRA 1M64A 2PHHA 2WDQA 3CPJG 3GRSA 4Z43A 4B69A 1O94A 4D04A 2BRYA 1EL7A 1ZKQA 2XVIA 4J36A 1AOGA 4PABA 1TYTA 4EQSA 4DGKA 1GRAA 2WEUA 1E6EA 2YWLA 3C4AA 3DGHA 4B67A 2GQFA 4J57A 2C67A 3RP6A 1JRYA 3F8DA 2WESA 3UOYA 1TDNA 2WBAA 3F8RA 1LPFA 3AECA 3UOXA 4UDPA 2EQ7A 1Y56B 4NTDA 1PDHA 1GTEA 2X3NA 1ZX9A 2XLPA 3AYJA 1IUWA 1H81A 2IVDA 3AE3A 3PS9A 2EQ8A 3AXBA 4J56A 1DOCA 1OJAA 4U8JA 2VVLG 3KVEA 2Q0LA 5U25A 3KA7A 4H4UA 3PVCA 2GR3A 3AE8A 4GDEA 3CIRA 4II2A 3SFDA 1YY5A 3ATRA 4Y4NA 1BZLA 1GRBA 1PN0A 1F6MA 2BC0A 2HQMA 2YAUA 4K2XA 2C75A 4H4YA 2BYBA 4U2SA 2GAGB 2C73A 4BK3A 1Y0PA 4UP3A 3FG2P 2AQJA 3QFBA 4U2TA 1NHQA 3OZ2A 4NEWA 3QFAA 4BJYA 2QCUA 1PXBA 3UKKA 1LQUA 2YQUA 2WP5A 3UCLA 5CKUA 3UP4A 1PXAA 5BVAA 3GMCA 5KWFA 1LVLA 2WOIA 4OPGA 3B3RA 1GPEA 3EANA 2GEWA 1NHSA 4JY2A 1PXCA 2X8HA 1OJDA 4OPCA 3KKJA 3NLCA 4U8IA 1E1NA 1CL0A 4OPTA 4IVMB 2R46A 2OLOA 3GDPA 3IHGA 3V3OA 3NT6A 5FS9A 4BURA 3NNEA 1FOHA 2OA1A 2B9YA 2WDVA 4P9SA 4H4QA 1TRBA 2FJEA 5U63A 1FEBA 1VG9A 1IUXA 2C72A 2YVJA 2WOWA 3ALJA 3CGCA 4GDPA 3B6DA 4J2WA 2WPCA 2XDOA 4XWZA 3KD9A 5EB5A 3SFEA 4ZN0A 5KXJA 3NK0X 4U8NA 1VQWA 3P9UA 3NTAA 2CVJA 4CCRA 3IF9A 4CY8A 1PHHA 2FJDA 4REKA 4Z2UA 1TDKA 2V3AA 3P4RA 4GRTA 4CCQA 2JB1A 4JN9A 3KPFA 2WPFA 1IUUA 3COXA 2YLRA 3UTEA 4CRTA 3GMBA 3CNPA 5HYMA 2QA1A 4OVIA 4U8MA 4J33A 1LJ1A 2GAHB 2WU2A 1CC6A 1IUSA 1L0VA 2R4JA 1FEAA 4G9KA 1K0JA 3SM8A 5L46A 3EPTA 1PBFA 4H4TA 4A9WA 3I6DA 3NIXA 1N1PA 1NG4A 1UKVG 4B66A 4G6GA 1JNRA 2ARDA 2V6OA 3AE1A 3GDNA 1KFYA 2A87A 4YSZA 3V76A 4AOXA 3SGLA 5ER0A 3LJPA 1K0LA 3UTFA 1XHCA 4C5OA 3AEDA 1GERA 2JB2A 3JSKA 1LQTA 1NG3A 4YKGA 1RYIA 4H4VA 2YM2A 1DODA 2VOUA 4GCMA 4KPRA 5HHFA 4II3A 2ZZCA 1YQZA 3KLJA 1CF3A 4OPUA 4AP1A 3RP7A 5KOXA 4Z25A 4TM3A 3IWAA 3BNMA 4XWRA 3NHOX 1E1KA 1GEUA 2C3DA 3VRDB 3NK1X 2EQ9A 2R45A 3BI2A 4YSXA 2JAEA 4I59A 1FECA 3WE0A 4ICYA 4K5SA 1XPQA 4NZHA 4GF7A 3SYIA 4BK2A 3AD8B 2YG7A 3CGEA 4EM3A 3CGDA 3I3LA 4G6HA 2XFUA 2DKIA 4RG3A 2C4CA 4IVOB 3VQRA 2ZBWA 4C74A 4K22A 5KVHA 1FCDA 3NYFA 1E7PA 3HYVA 3UKLA 5IQ1A 4FDCB 4DSHA 2H88A 4H4WA 5GSNA 2F5ZA 3V3NA 5IQ4A 2BCGG 2BXRA 2A89A 2AR8A 3P4PA 1MOKA 2R9ZA 3GD3A 1XANA 3ICSA 1NAAA 2R0GA 3LADA 3T0KA 1JRXA 5FS7A 1GXFA 4TM0A 2VVMA 3ITJA 2YG3A 3AE6A 1V59A 2XYOA 4OPIA 1GRFA 2ZZ0A 4CNJA 1GRTA 4J31A 2BK5A 5KMSA 2XVJA 2C64A 3CMMA 4H2PA 4C77A 1GV4A 4TLZA 1ZOYA 2VRLA 3LOVA 5FMHA 4AT2A 5KRQA 4HB9A 3II4A 5JCMA 1YQ4A 3SY4A 1YKJA 4AT0A 2BS4A 2B7RA 2WPEA 3AYIA 4EMWA 3L8KA 4GAVA 3GWFA 5C3JA 1GSNA 1JEHA 1H84A 2GH5A 1LV0A 2WDRA 3QSSA 4FK1A 4J34A 2YLSA 2BS2A 2XFQA 3UTHA 4EIPA 1KDGA 4H2QA 2GV8A 2J3NA 1GOSA 2BK4A 1TDOA 3DMEA 4YSYA 4FX9A 1IUTA 2GMHA 3KPKA 1DNCA 1KNRA 2B9XA 1K4QA 3H4KA 3QSEA 2X99A 4APNA 1CJ4A 3NK2X 1P2HA 1EBDA 4H4PA 1GRGA 4H4XA 4NTCA 2C70A 3AEFA 4Y4LA 2C65A 4C3YA 1KF6A 1NHRA 1QLBA 1TYPA 2XLSA 4B65A 3DGZA 3UOZA 2H89A 4K5RA 3REDA 4EQXA 2YG5A 5EBKA 2WP9A 3NRNA 4AOSA 1PJ5A 4EQWA 4H7UA 2GMJA 1JRZA 2Z5XA 1IJHA 1XDIA 1DOBA 2APGA 1W4XA 4FK1C 3ZYXA 2OAMA 5BRTA 4X9NA 5KNLA 3GYIA 1COYA 1GT8A 4USQA 1ZP0A 5M10A 1FL2A 4Z26A 2BS3A 2YG4A 5KMQA 2JKCA 2RGOA 3CNTA 2X8CA 5EOWA 3T2YA 2GR1A 4YT0A 4YTPA 5JCKA 1EL5A 2FBWA 2E5VA 4JDRA 4EMJA 1P2EA 3FPZA 4WX1A 4A65A 2BCPA 4CBQA 2B7SA 4JQ9A 3T2ZA 1RSGA 5LV9A 4IV9A 1VG0A 3GWDA 3NN6X 3FBSA 4GUVA 1EL8A 4XXGA 2WS3A 1H7WA 3AE7A 5BULA 1GETA 1MO9A 3UKFA 4H2NA 4JNAA 1K0IA 3NN0X 2B76A 3G5SA 3SZFA 3KU9A 1KSUA 5HY5A 3GYJA 2JB3A 2QA2A 3DJDA 3NTDA 4Z44A 1YQ3A 3SZWA 3P4SA 2W0HA 4KX6A 1O95A 1D4DA 1NDAA 4USRA 3VR9A 4HA6A 1ZDLA 5BUKA 1JU2A 2YLXA 1OJCA 2Q6UA 4NWZA 3T14A 1E1MA 3F8PA 1CJCA 2JK6A 2XFPA 3AE2A 1QO8A 3LZXA 5HXIA 1S2QA 4O5QA 4A6NA 1D5TA 3IC9A 3G5QA 2CDUA 4MJWA 3NG7X 2Q7VA 2XVFA 1M6IA 3ISHA 5DBJA 4A99A 4PAAA 3EAOA 4YWOA 3QJ4A 2WETA 1DJNA 1TDFA 3D8XA 4GAPA 5J7XA 1X31B 1OJ9A 3AEGA 2E4GA 1LTXR 3FIMB 3NKSA 2YM1A 3AE5A 3Q9TA 3BHFA 2TPRA 4G73A 1NEKA 3AE9A 2R4EA 3S5WA 3H8IA 2E1MA 2YLZA 2NPXA 3K7QX 1PJ6A 1GALA 4U8LA 4UDQA 5JCNA 3LXDA 4X4JA 1D4EA 2JBVA 1GESA 2XLTA 2XFNA 2Q0KA 3GSIA 3S61A 4Z2TA 1ZY8A 2GB0A 2Z5YA 5KVIA 3ALMA 4RSLA 1H6VA 4EMIA 2XLRA 1KNPA 1Q1WA 4NNJA 5M0ZA 2IIDA 1D4CA 3NGCX 3CTYA 3HZLA 3R9UA 4C3XA 5IPYA 3EF6A 1JNZA 2QAEA 4U8KA 1S3BA 2WU5A 2GR2A 4B64A 2WQYA 3CGBA 3ZDNA 1B37A 4YSHA 4DSGA 4Z2RA 1ONFA 2C76A 2EQ6A 2GVCA 3UP5A 4ADWA 2OALA 2ZZBA 2BRAA 1BWCA 1F8WA 2CFYA 2V61A 3SXIA 1L9CA 2RGHA 4LA1A 5GRTA 3OC4A 4YTMA 3DJEA 3CNSA 3SQPA 2GQWA 4I58A 1IUVA 1PBEA 2DKHA 3AWIA 1O5WA 4A6NB 3K7TA 4H50A 3ADAB 3IHMA 5FS6A 3ABVA 5J60A 3HYXA 3GRTA 3AEEA 3NYEA 4N9XA 4B68A 5KMPA 2FJBA 2YR5A 1S3EA 2A8XA 2B9WA 4IA5A 3QVPA 3CNDA 2BK3A 4LIIA 3AYLA 4BV6A 2AAQA 5JCLA 1HYUA 1MXTA 4YKFA 2YVGA 5EB4A 3P4QA 2YR6A 1GNDA 2BC1A 4CY6A 2TMDA 2XLUA 4B1BA 1DOEA 2VQBA 4BJZA 3AB1A 2Y6QA 4K7ZA 4X9MA 1Q9IA 2FJAA 5KOWA 3BI5A 1B4VA 1F8RA 2PYXA 1F8SA 3CPHG 3AEAA 1S2YA 3SX6A 3DH9A 3ICTA 3AE4A 4YTNA 3GYXA 3LZWA 4M52A 1Q1RA 5C2TA 2UZZA 1CC2A 5U1OA 4CNKA 2V3BA 2O9ZA 1CBOA 1CC4A 2X8GA 4RG4A 3FMWA 4O5UA 1PJ7A 3G5RA 1DXLA 3RHAA 2RABA 3C96A 3SZ0A 3SZCA 2NVKX 4H4ZA 1E1LA 2R0CA 3URHA 4A79A 4AP3A 4H4RA 4EQRA 2VZ2A 3D1CA 4Z24A 1PS9A 3BI4A 3DK8A 4DNAA 1BKWA 4Y4MA 2YG6A 3UOVA 1N4UA 3UKAA 2YLWA 1BGNA 1ZK7A 2R0PA 4A5LA 1REOA 1SEZA 2GRTA 1DJQA 3PO7A 3CN8A 3ICRA 4OPLA 4A7AA 1JOAA 1H86A 1E39A 3CNJA 1VRQB 1F3PA 5TR3A 1VDCA 4ZCCA 2I0ZA 4H4SA 2YR4A 1D7YA 1CJ2A 1GRHA 4ZCDA 4EM4A 3UKPA 3M0OA 3DK4A 1EL9A 3QSMA 2VRMA 1N4WA 3UTGA 1CJ3A 1NPXA 1H83A 3K7MX 3NH3X 1D7LA 4EIQA 2YVFA 3O0HA 4ECHA 3T37A 2BACA 5CQFA 4TLXA 1L9EA 5JCIA 2YLTA 1GTHA 1OJTA
chains in the Genus database with same CATH topology
1BGJA 3DA1A 4JNQA 2VQ7A 1PBDA 3VRBA 1Y56A 2VVLA 2WHDA 3T2KA 2X50A 3UKHA 1H82A 3DJJA 1PBCA 2RGJA 1NENA 4B63A 4E0VA 2C3CA 2C66A 3K30A 4G74A 3CPIG 3VRAA 1TDEA 3BHKA 2WOVA 1RP0A 1NHPA 1L9DA 2GF3A 3P1WA 4K8DA 4NTEA 4H2RA 3RNMA 2ACZA 1B8SA 1PBBA 4LU6A 1QJDA 2CULA 2XVEA 1Z6LA 2Y6RA 2OLNA 3DJGX 2V60A 3ATQA 3H8LA 4IA6A 2WP6A 4U8PA 4OPDA 4D03A 2BA9A 2IVEA 2XVHA 4OCGA 2C7GA 3NYCA 4WCTA 3AEBA 3GD4A 4TM4A 1BF3A 3RP8A 1GREA 3LB8A 3E1TA 3C4NA 1H7XA 2XCGA 1ZOVA 3ALLA 1B5QA 2XFOA 5FS8A 3VR8A 4U2LA 1KSSA 3Q6JA 2BABA 2BXSA 1CHUA 3AD7B 3AD9B 3BNUA 1N4VA 4JY3A 4YXDA 3DK9A 3QVRA 2GR0A 4NEVA 1ELIA 4GR1A 4UDRA 1ZMDA 4TM1A 4U8OA 3UKQA 3HYWA 1ZMCA 3M12A 3L1RA 2V5ZA 3M13A 3T31A 4BK1A 5KMRA 1M64A 2PHHA 2WDQA 3CPJG 3GRSA 4Z43A 4B69A 1O94A 4D04A 2BRYA 1EL7A 1ZKQA 2XVIA 4J36A 1AOGA 4PABA 1TYTA 4EQSA 4DGKA 1GRAA 2WEUA 1E6EA 2YWLA 3C4AA 3DGHA 4B67A 2GQFA 4J57A 2C67A 3RP6A 1JRYA 3F8DA 2WESA 3UOYA 1TDNA 2WBAA 3F8RA 1LPFA 3AECA 3UOXA 4UDPA 2EQ7A 1Y56B 4NTDA 1PDHA 1GTEA 2X3NA 1ZX9A 2XLPA 3AYJA 1IUWA 1H81A 2IVDA 3AE3A 3PS9A 2EQ8A 3AXBA 4J56A 1DOCA 1OJAA 4U8JA 2VVLG 3KVEA 2Q0LA 5U25A 3KA7A 4H4UA 3PVCA 2GR3A 3AE8A 4GDEA 3CIRA 4II2A 3SFDA 1YY5A 3ATRA 4Y4NA 1BZLA 1GRBA 1PN0A 1F6MA 2BC0A 2HQMA 2YAUA 4K2XA 2C75A 4H4YA 2BYBA 4U2SA 2GAGB 2C73A 4BK3A 1Y0PA 4UP3A 3FG2P 2AQJA 3QFBA 4U2TA 1NHQA 3OZ2A 4NEWA 3QFAA 4BJYA 2QCUA 1PXBA 3UKKA 1LQUA 2YQUA 2WP5A 3UCLA 5CKUA 3UP4A 1PXAA 5BVAA 3GMCA 5KWFA 1LVLA 2WOIA 4OPGA 3B3RA 1GPEA 3EANA 2GEWA 1NHSA 4JY2A 1PXCA 2X8HA 1OJDA 4OPCA 3KKJA 3NLCA 4U8IA 1E1NA 1CL0A 4OPTA 4IVMB 2R46A 2OLOA 3GDPA 3IHGA 3V3OA 3NT6A 5FS9A 4BURA 3NNEA 1FOHA 2OA1A 2B9YA 2WDVA 4P9SA 4H4QA 1TRBA 2FJEA 5U63A 1FEBA 1VG9A 1IUXA 2C72A 2YVJA 2WOWA 3ALJA 3CGCA 4GDPA 3B6DA 4J2WA 2WPCA 2XDOA 4XWZA 3KD9A 5EB5A 3SFEA 4ZN0A 5KXJA 3NK0X 4U8NA 1VQWA 3P9UA 3NTAA 2CVJA 4CCRA 3IF9A 4CY8A 1PHHA 2FJDA 4REKA 4Z2UA 1TDKA 2V3AA 3P4RA 4GRTA 4CCQA 2JB1A 4JN9A 3KPFA 2WPFA 1IUUA 3COXA 2YLRA 3UTEA 4CRTA 3GMBA 3CNPA 5HYMA 2QA1A 4OVIA 4U8MA 4J33A 1LJ1A 2GAHB 2WU2A 1CC6A 1IUSA 1L0VA 2R4JA 1FEAA 4G9KA 1K0JA 3SM8A 5L46A 3EPTA 1PBFA 4H4TA 4A9WA 3I6DA 3NIXA 1N1PA 1NG4A 1UKVG 4B66A 4G6GA 1JNRA 2ARDA 2V6OA 3AE1A 3GDNA 1KFYA 2A87A 4YSZA 3V76A 4AOXA 3SGLA 5ER0A 3LJPA 1K0LA 3UTFA 1XHCA 4C5OA 3AEDA 1GERA 2JB2A 3JSKA 1LQTA 1NG3A 4YKGA 1RYIA 4H4VA 2YM2A 1DODA 2VOUA 4GCMA 4KPRA 5HHFA 4II3A 2ZZCA 1YQZA 3KLJA 1CF3A 4OPUA 4AP1A 3RP7A 5KOXA 4Z25A 4TM3A 3IWAA 3BNMA 4XWRA 3NHOX 1E1KA 1GEUA 2C3DA 3VRDB 3NK1X 2EQ9A 2R45A 3BI2A 4YSXA 2JAEA 4I59A 1FECA 3WE0A 4ICYA 4K5SA 1XPQA 4NZHA 4GF7A 3SYIA 4BK2A 3AD8B 2YG7A 3CGEA 4EM3A 3CGDA 3I3LA 4G6HA 2XFUA 2DKIA 4RG3A 2C4CA 4IVOB 3VQRA 2ZBWA 4C74A 4K22A 5KVHA 1FCDA 3NYFA 1E7PA 3HYVA 3UKLA 5IQ1A 4FDCB 4DSHA 2H88A 4H4WA 5GSNA 2F5ZA 3V3NA 5IQ4A 2BCGG 2BXRA 2A89A 2AR8A 3P4PA 1MOKA 2R9ZA 3GD3A 1XANA 3ICSA 1NAAA 2R0GA 3LADA 3T0KA 1JRXA 5FS7A 1GXFA 4TM0A 2VVMA 3ITJA 2YG3A 3AE6A 1V59A 2XYOA 4OPIA 1GRFA 2ZZ0A 4CNJA 1GRTA 4J31A 2BK5A 5KMSA 2XVJA 2C64A 3CMMA 4H2PA 4C77A 1GV4A 4TLZA 1ZOYA 2VRLA 3LOVA 5FMHA 4AT2A 5KRQA 4HB9A 3II4A 5JCMA 1YQ4A 3SY4A 1YKJA 4AT0A 2BS4A 2B7RA 2WPEA 3AYIA 4EMWA 3L8KA 4GAVA 3GWFA 5C3JA 1GSNA 1JEHA 1H84A 2GH5A 1LV0A 2WDRA 3QSSA 4FK1A 4J34A 2YLSA 2BS2A 2XFQA 3UTHA 4EIPA 1KDGA 4H2QA 2GV8A 2J3NA 1GOSA 2BK4A 1TDOA 3DMEA 4YSYA 4FX9A 1IUTA 2GMHA 3KPKA 1DNCA 1KNRA 2B9XA 1K4QA 3H4KA 3QSEA 2X99A 4APNA 1CJ4A 3NK2X 1P2HA 1EBDA 4H4PA 1GRGA 4H4XA 4NTCA 2C70A 3AEFA 4Y4LA 2C65A 4C3YA 1KF6A 1NHRA 1QLBA 1TYPA 2XLSA 4B65A 3DGZA 3UOZA 2H89A 4K5RA 3REDA 4EQXA 2YG5A 5EBKA 2WP9A 3NRNA 4AOSA 1PJ5A 4EQWA 4H7UA 2GMJA 1JRZA 2Z5XA 1IJHA 1XDIA 1DOBA 2APGA 1W4XA 4FK1C 3ZYXA 2OAMA 5BRTA 4X9NA 5KNLA 3GYIA 1COYA 1GT8A 4USQA 1ZP0A 5M10A 1FL2A 4Z26A 2BS3A 2YG4A 5KMQA 2JKCA 2RGOA 3CNTA 2X8CA 5EOWA 3T2YA 2GR1A 4YT0A 4YTPA 5JCKA 1EL5A 2FBWA 2E5VA 4JDRA 4EMJA 1P2EA 3FPZA 4WX1A 4A65A 2BCPA 4CBQA 2B7SA 4JQ9A 3T2ZA 1RSGA 5LV9A 4IV9A 1VG0A 3GWDA 3NN6X 3FBSA 4GUVA 1EL8A 4XXGA 2WS3A 1H7WA 3AE7A 5BULA 1GETA 1MO9A 3UKFA 4H2NA 4JNAA 1K0IA 3NN0X 2B76A 3G5SA 3SZFA 3KU9A 1KSUA 5HY5A 3GYJA 2JB3A 2QA2A 3DJDA 3NTDA 4Z44A 1YQ3A 3SZWA 3P4SA 2W0HA 4KX6A 1O95A 1D4DA 1NDAA 4USRA 3VR9A 4HA6A 1ZDLA 5BUKA 1JU2A 2YLXA 1OJCA 2Q6UA 4NWZA 3T14A 1E1MA 3F8PA 1CJCA 2JK6A 2XFPA 3AE2A 1QO8A 3LZXA 5HXIA 1S2QA 4O5QA 4A6NA 1D5TA 3IC9A 3G5QA 2CDUA 4MJWA 3NG7X 2Q7VA 2XVFA 1M6IA 3ISHA 5DBJA 4A99A 4PAAA 3EAOA 4YWOA 3QJ4A 2WETA 1DJNA 1TDFA 3D8XA 4GAPA 5J7XA 1X31B 1OJ9A 3AEGA 2E4GA 1LTXR 3FIMB 3NKSA 2YM1A 3AE5A 3Q9TA 3BHFA 2TPRA 4G73A 1NEKA 3AE9A 2R4EA 3S5WA 3H8IA 2E1MA 2YLZA 2NPXA 3K7QX 1PJ6A 1GALA 4U8LA 4UDQA 5JCNA 3LXDA 4X4JA 1D4EA 2JBVA 1GESA 2XLTA 2XFNA 2Q0KA 3GSIA 3S61A 4Z2TA 1ZY8A 2GB0A 2Z5YA 5KVIA 3ALMA 4RSLA 1H6VA 4EMIA 2XLRA 1KNPA 1Q1WA 4NNJA 5M0ZA 2IIDA 1D4CA 3NGCX 3CTYA 3HZLA 3R9UA 4C3XA 5IPYA 3EF6A 1JNZA 2QAEA 4U8KA 1S3BA 2WU5A 2GR2A 4B64A 2WQYA 3CGBA 3ZDNA 1B37A 4YSHA 4DSGA 4Z2RA 1ONFA 2C76A 2EQ6A 2GVCA 3UP5A 4ADWA 2OALA 2ZZBA 2BRAA 1BWCA 1F8WA 2CFYA 2V61A 3SXIA 1L9CA 2RGHA 4LA1A 5GRTA 3OC4A 4YTMA 3DJEA 3CNSA 3SQPA 2GQWA 4I58A 1IUVA 1PBEA 2DKHA 3AWIA 1O5WA 4A6NB 3K7TA 4H50A 3ADAB 3IHMA 5FS6A 3ABVA 5J60A 3HYXA 3GRTA 3AEEA 3NYEA 4N9XA 4B68A 5KMPA 2FJBA 2YR5A 1S3EA 2A8XA 2B9WA 4IA5A 3QVPA 3CNDA 2BK3A 4LIIA 3AYLA 4BV6A 2AAQA 5JCLA 1HYUA 1MXTA 4YKFA 2YVGA 5EB4A 3P4QA 2YR6A 1GNDA 2BC1A 4CY6A 2TMDA 2XLUA 4B1BA 1DOEA 2VQBA 4BJZA 3AB1A 2Y6QA 4K7ZA 4X9MA 1Q9IA 2FJAA 5KOWA 3BI5A 1B4VA 1F8RA 2PYXA 1F8SA 3CPHG 3AEAA 1S2YA 3SX6A 3DH9A 3ICTA 3AE4A 4YTNA 3GYXA 3LZWA 4M52A 1Q1RA 5C2TA 2UZZA 1CC2A 5U1OA 4CNKA 2V3BA 2O9ZA 1CBOA 1CC4A 2X8GA 4RG4A 3FMWA 4O5UA 1PJ7A 3G5RA 1DXLA 3RHAA 2RABA 3C96A 3SZ0A 3SZCA 2NVKX 4H4ZA 1E1LA 2R0CA 3URHA 4A79A 4AP3A 4H4RA 4EQRA 2VZ2A 3D1CA 4Z24A 1PS9A 3BI4A 3DK8A 4DNAA 1BKWA 4Y4MA 2YG6A 3UOVA 1N4UA 3UKAA 2YLWA 1BGNA 1ZK7A 2R0PA 4A5LA 1REOA 1SEZA 2GRTA 1DJQA 3PO7A 3CN8A 3ICRA 4OPLA 4A7AA 1JOAA 1H86A 1E39A 3CNJA 1VRQB 1F3PA 5TR3A 1VDCA 4ZCCA 2I0ZA 4H4SA 2YR4A 1D7YA 1CJ2A 1GRHA 4ZCDA 4EM4A 3UKPA 3M0OA 3DK4A 1EL9A 3QSMA 2VRMA 1N4WA 3UTGA 1CJ3A 1NPXA 1H83A 3K7MX 3NH3X 1D7LA 4EIQA 2YVFA 3O0HA 4ECHA 3T37A 2BACA 5CQFA 4TLXA 1L9EA 5JCIA 2YLTA 1GTHA 1OJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGJ A;  3DA1 A;  4JNQ A;  2VQ7 A;  1PBD A;  3VRB A;  1Y56 A;  2VVL A;  2WHD A;  2X50 A;  3UKH A;  1H82 A;  3DJJ A;  1PBC A;  2RGJ A;  1NEN A;  4B63 A;  4E0V A;  2C3C A;  2C66 A;  3K30 A;  3VRA A;  3CPI G;  1TDE A;  3BHK A;  2WOV A;  1RP0 A;  1NHP A;  1L9D A;  2GF3 A;  3P1W A;  4K8D A;  4NTE A;  4H2R A;  3RNM A;  2ACZ A;  1B8S A;  1PBB A;  4LU6 A;  1QJD A;  2CUL A;  2XVE A;  1Z6L A;  2Y6R A;  2OLN A;  3DJG X;  2V60 A;  3ATQ A;  3H8L A;  4IA6 A;  2WP6 A;  4U8P A;  4OPD A;  4D03 A;  2BA9 A;  2IVE A;  2XVH A;  4OCG A;  2C7G A;  3NYC A;  4WCT A;  3AEB A;  3GD4 A;  4TM4 A;  1BF3 A;  3RP8 A;  1GRE A;  3LB8 A;  3E1T A;  3C4N A;  1H7X A;  2XCG A;  1ZOV A;  3ALL A;  1B5Q A;  2XFO A;  5FS8 A;  3VR8 A;  4U2L A;  1KSS A;  3Q6J A;  2BAB A;  2BXS A;  1CHU A;  3AD7 B;  3AD9 B;  3BNU A;  1N4V A;  4JY3 A;  4YXD A;  3DK9 A;  3QVR A;  2GR0 A;  4NEV A;  1ELI A;  4GR1 A;  4UDR A;  1ZMD A;  4TM1 A;  4U8O A;  3UKQ A;  3M12 A;  1ZMC A;  3L1R A;  2V5Z A;  3M13 A;  4BK1 A;  1M64 A;  2PHH A;  2WDQ A;  3CPJ G;  3GRS A;  4Z43 A;  4B69 A;  1O94 A;  4D04 A;  1EL7 A;  1ZKQ A;  2XVI A;  4J36 A;  1AOG A;  4PAB A;  1TYT A;  4EQS A;  4DGK A;  1GRA A;  2WEU A;  1E6E A;  2YWL A;  3C4A A;  3DGH A;  4B67 A;  2GQF A;  4J57 A;  2C67 A;  3RP6 A;  1JRY A;  3F8D A;  2WES A;  3UOY A;  1TDN A;  2WBA A;  3F8R A;  1LPF A;  3AEC A;  3UOX A;  4UDP A;  2EQ7 A;  1Y56 B;  4NTD A;  1PDH A;  1GTE A;  2X3N A;  1ZX9 A;  2XLP A;  3AYJ A;  1IUW A;  1H81 A;  2IVD A;  3AE3 A;  3PS9 A;  2EQ8 A;  3AXB A;  4J56 A;  1DOC A;  1OJA A;  4U8J A;  2VVL G;  3KVE A;  2Q0L A;  5U25 A;  3KA7 A;  4H4U A;  3PVC A;  2GR3 A;  3AE8 A;  4GDE A;  3CIR A;  3SFD A;  1YY5 A;  3ATR A;  4Y4N A;  1BZL A;  1GRB A;  1PN0 A;  1F6M A;  2BC0 A;  2HQM A;  2YAU A;  4K2X A;  2C75 A;  4H4Y A;  2BYB A;  4U2S A;  2GAG B;  2C73 A;  4BK3 A;  1Y0P A;  4UP3 A;  3FG2 P;  2AQJ A;  3QFB A;  4U2T A;  1NHQ A;  3OZ2 A;  4NEW A;  3QFA A;  4BJY A;  2QCU A;  1PXB A;  3UKK A;  1LQU A;  2YQU A;  2WP5 A;  3UCL A;  5CKU A;  3UP4 A;  1PXA A;  5BVA A;  3GMC A;  5KWF A;  1LVL A;  2WOI A;  4OPG A;  3B3R A;  1GPE A;  3EAN A;  2GEW A;  1NHS A;  4JY2 A;  1PXC A;  2X8H A;  1OJD A;  4OPC A;  3KKJ A;  3NLC A;  4U8I A;  1E1N A;  1CL0 A;  4OPT A;  4IVM B;  2R46 A;  2OLO A;  3GDP A;  3IHG A;  3V3O A;  3NT6 A;  5FS9 A;  4BUR A;  3NNE A;  1FOH A;  2OA1 A;  2B9Y A;  2WDV A;  4P9S A;  4H4Q A;  1TRB A;  2FJE A;  5U63 A;  1FEB A;  1VG9 A;  1IUX A;  2C72 A;  2YVJ A;  2WOW A;  3ALJ A;  3CGC A;  4GDP A;  3B6D A;  4J2W A;  2WPC A;  2XDO A;  4XWZ A;  3KD9 A;  5EB5 A;  3SFE A;  4ZN0 A;  5KXJ A;  3NK0 X;  4U8N A;  1VQW A;  3P9U A;  3NTA A;  2CVJ A;  4CCR A;  3IF9 A;  4CY8 A;  1PHH A;  2FJD A;  4REK A;  4Z2U A;  1TDK A;  2V3A A;  3P4R A;  4GRT A;  4CCQ A;  2JB1 A;  4JN9 A;  3KPF A;  2WPF A;  1IUU A;  3COX A;  2YLR A;  3UTE A;  4CRT A;  3GMB A;  3CNP A;  5HYM A;  2QA1 A;  4OVI A;  4U8M A;  4J33 A;  1LJ1 A;  2GAH B;  2WU2 A;  1CC6 A;  1IUS A;  1L0V A;  2R4J A;  1FEA A;  1K0J A;  3SM8 A;  5L46 A;  3EPT A;  1PBF A;  4H4T A;  4A9W A;  3I6D A;  3NIX A;  1N1P A;  1NG4 A;  1UKV G;  4B66 A;  1JNR A;  2ARD A;  2V6O A;  3AE1 A;  3GDN A;  1KFY A;  2A87 A;  4YSZ A;  3V76 A;  4AOX A;  3SGL A;  5ER0 A;  3LJP A;  1K0L A;  3UTF A;  1XHC A;  4C5O A;  3AED A;  1GER A;  2JB2 A;  3JSK A;  1LQT A;  1NG3 A;  4YKG A;  1RYI A;  4H4V A;  2YM2 A;  1DOD A;  2VOU A;  4GCM A;  4KPR A;  5HHF A;  2ZZC A;  1YQZ A;  3KLJ A;  1CF3 A;  4OPU A;  4AP1 A;  3RP7 A;  5KOX A;  4Z25 A;  4TM3 A;  3IWA A;  3BNM A;  4XWR A;  3NHO X;  1E1K A;  1GEU A;  2C3D A;  3VRD B;  3NK1 X;  2EQ9 A;  2R45 A;  3BI2 A;  4YSX A;  2JAE A;  4I59 A;  1FEC A;  3WE0 A;  4ICY A;  4K5S A;  1XPQ A;  4NZH A;  4GF7 A;  4BK2 A;  3AD8 B;  2YG7 A;  3CGE A;  4EM3 A;  3CGD A;  3I3L A;  2XFU A;  2DKI A;  4RG3 A;  4IVO B;  3VQR A;  2ZBW A;  4C74 A;  4K22 A;  5KVH A;  1FCD A;  3NYF A;  1E7P A;  3UKL A;  5IQ1 A;  4FDC B;  4DSH A;  2H88 A;  4H4W A;  5GSN A;  2F5Z A;  3V3N A;  5IQ4 A;  2BCG G;  2BXR A;  2A89 A;  2AR8 A;  3P4P A;  1MOK A;  2R9Z A;  3GD3 A;  1XAN A;  3ICS A;  1NAA A;  2R0G A;  3LAD A;  1JRX A;  5FS7 A;  1GXF A;  4TM0 A;  2VVM A;  3ITJ A;  2YG3 A;  3AE6 A;  1V59 A;  2XYO A;  4OPI A;  1GRF A;  2ZZ0 A;  4CNJ A;  1GRT A;  4J31 A;  2BK5 A;  2XVJ A;  2C64 A;  4H2P A;  4C77 A;  1GV4 A;  4TLZ A;  1ZOY A;  2VRL A;  3LOV A;  5FMH A;  4AT2 A;  5KRQ A;  4HB9 A;  3II4 A;  5JCM A;  1YQ4 A;  1YKJ A;  4AT0 A;  2BS4 A;  2B7R A;  2WPE A;  3AYI A;  4EMW A;  3L8K A;  3GWF A;  5C3J A;  1GSN A;  1JEH A;  1H84 A;  2GH5 A;  1LV0 A;  2WDR A;  3QSS A;  4FK1 A;  4J34 A;  2YLS A;  2BS2 A;  2XFQ A;  3UTH A;  4EIP A;  1KDG A;  4H2Q A;  2GV8 A;  2J3N A;  1GOS A;  2BK4 A;  1TDO A;  3DME A;  4YSY A;  4FX9 A;  1IUT A;  2GMH A;  1DNC A;  1KNR A;  2B9X A;  1K4Q A;  3H4K A;  3QSE A;  2X99 A;  4APN A;  1CJ4 A;  3NK2 X;  1P2H A;  1EBD A;  4H4P A;  1GRG A;  4H4X A;  4NTC A;  2C70 A;  3AEF A;  4Y4L A;  2C65 A;  4C3Y A;  1KF6 A;  1NHR A;  1QLB A;  1TYP A;  2XLS A;  4B65 A;  3DGZ A;  3UOZ A;  2H89 A;  4K5R A;  3RED A;  4EQX A;  2YG5 A;  5EBK A;  2WP9 A;  3NRN A;  4AOS A;  1PJ5 A;  4EQW A;  4H7U A;  2GMJ A;  1JRZ A;  2Z5X A;  1IJH A;  1XDI A;  1DOB A;  2APG A;  1W4X A;  4FK1 C;  3ZYX A;  2OAM A;  5BRT A;  4X9N A;  3GYI A;  1COY A;  1GT8 A;  4USQ A;  1ZP0 A;  5M10 A;  1FL2 A;  4Z26 A;  2BS3 A;  2YG4 A;  4YTP A;  2JKC A;  2RGO A;  3CNT A;  2X8C A;  5EOW A;  4YT0 A;  2GR1 A;  5JCK A;  1EL5 A;  2FBW A;  2E5V A;  4JDR A;  4EMJ A;  1P2E A;  3FPZ A;  4WX1 A;  4A65 A;  2BCP A;  4CBQ A;  2B7S A;  4JQ9 A;  1RSG A;  5LV9 A;  4IV9 A;  1VG0 A;  3GWD A;  3NN6 X;  3FBS A;  4GUV A;  1EL8 A;  4XXG A;  2WS3 A;  1H7W A;  3AE7 A;  5BUL A;  1GET A;  1MO9 A;  3UKF A;  4H2N A;  4JNA A;  1K0I A;  3NN0 X;  2B76 A;  3G5S A;  3KU9 A;  1KSU A;  5HY5 A;  3GYJ A;  2JB3 A;  2QA2 A;  3DJD A;  3NTD A;  4Z44 A;  1YQ3 A;  3P4S A;  2W0H A;  4KX6 A;  1O95 A;  1D4D A;  1NDA A;  4USR A;  3VR9 A;  4HA6 A;  1ZDL A;  5BUK A;  1JU2 A;  2YLX A;  1OJC A;  2Q6U A;  1E1M A;  3F8P A;  1CJC A;  2JK6 A;  2XFP A;  3AE2 A;  1QO8 A;  3LZX A;  5HXI A;  1S2Q A;  4O5Q A;  4A6N A;  1D5T A;  3IC9 A;  3G5Q A;  2CDU A;  4MJW A;  3NG7 X;  2Q7V A;  2XVF A;  1M6I A;  3ISH A;  5DBJ A;  4A99 A;  4PAA A;  3EAO A;  4YWO A;  3QJ4 A;  2WET A;  1DJN A;  1TDF A;  3D8X A;  5J7X A;  1X31 B;  1OJ9 A;  3AEG A;  2E4G A;  1LTX R;  3FIM B;  3NKS A;  2YM1 A;  3AE5 A;  3Q9T A;  3BHF A;  2TPR A;  1NEK A;  3AE9 A;  2R4E A;  3S5W A;  3H8I A;  2E1M A;  2YLZ A;  2NPX A;  3K7Q X;  1PJ6 A;  1GAL A;  4U8L A;  4UDQ A;  5JCN A;  3LXD A;  4X4J A;  1D4E A;  2JBV A;  1GES A;  2XLT A;  2XFN A;  2Q0K A;  3GSI A;  3S61 A;  4Z2T A;  1ZY8 A;  2GB0 A;  2Z5Y A;  5KVI A;  3ALM A;  4RSL A;  1H6V A;  4EMI A;  2XLR A;  1KNP A;  1Q1W A;  5M0Z A;  2IID A;  1D4C A;  3NGC X;  3CTY A;  3HZL A;  3R9U A;  4C3X A;  5IPY A;  3EF6 A;  1JNZ A;  2QAE A;  4U8K A;  1S3B A;  2WU5 A;  2GR2 A;  4B64 A;  2WQY A;  3CGB A;  3ZDN A;  1B37 A;  4YSH A;  4DSG A;  4Z2R A;  1ONF A;  2C76 A;  2EQ6 A;  2GVC A;  3UP5 A;  4ADW A;  2OAL A;  2ZZB A;  1BWC A;  1F8W A;  2CFY A;  2V61 A;  1L9C A;  2RGH A;  4LA1 A;  5GRT A;  3OC4 A;  4YTM A;  3DJE A;  3CNS A;  3SQP A;  2GQW A;  4I58 A;  1IUV A;  1PBE A;  2DKH A;  3AWI A;  1O5W A;  4A6N B;  3K7T A;  4H50 A;  3ADA B;  3IHM A;  5FS6 A;  3ABV A;  5J60 A;  3GRT A;  3AEE A;  3NYE A;  4N9X A;  4B68 A;  2FJB A;  2YR5 A;  1S3E A;  2A8X A;  2B9W A;  4IA5 A;  3QVP A;  3CND A;  2BK3 A;  4LII A;  3AYL A;  4BV6 A;  2AAQ A;  5JCL A;  1HYU A;  1MXT A;  4YKF A;  2YVG A;  5EB4 A;  3P4Q A;  2YR6 A;  1GND A;  2BC1 A;  4CY6 A;  2TMD A;  2XLU A;  4B1B A;  1DOE A;  2VQB A;  4BJZ A;  3AB1 A;  2Y6Q A;  4K7Z A;  4X9M A;  1Q9I A;  2FJA A;  5KOW A;  3BI5 A;  1B4V A;  1F8R A;  2PYX A;  1F8S A;  3CPH G;  3AEA A;  1S2Y A;  3DH9 A;  3ICT A;  3AE4 A;  4YTN A;  3LZW A;  4M52 A;  1Q1R A;  5C2T A;  2UZZ A;  1CC2 A;  5U1O A;  4CNK A;  2V3B A;  2O9Z A;  1CBO A;  1CC4 A;  2X8G A;  4RG4 A;  3FMW A;  4O5U A;  1PJ7 A;  3G5R A;  1DXL A;  3RHA A;  2RAB A;  3C96 A;  3URH A;  4A79 A;  2NVK X;  4H4Z A;  1E1L A;  2R0C A;  4AP3 A;  4H4R A;  4EQR A;  2VZ2 A;  3D1C A;  4Z24 A;  1PS9 A;  3BI4 A;  3DK8 A;  4DNA A;  1BKW A;  4Y4M A;  2YG6 A;  3UOV A;  1N4U A;  3UKA A;  2YLW A;  1BGN A;  1ZK7 A;  2R0P A;  4A5L A;  1REO A;  1SEZ A;  2GRT A;  1DJQ A;  3PO7 A;  3CN8 A;  3ICR A;  4OPL A;  4A7A A;  1JOA A;  1H86 A;  1E39 A;  3CNJ A;  1VRQ B;  1F3P A;  5TR3 A;  1VDC A;  4ZCC A;  2I0Z A;  4H4S A;  2YR4 A;  1D7Y A;  1CJ2 A;  1GRH A;  4ZCD A;  4EM4 A;  3UKP A;  3M0O A;  3DK4 A;  1EL9 A;  3QSM A;  2VRM A;  1N4W A;  3UTG A;  1CJ3 A;  1NPX A;  1H83 A;  3K7M X;  3NH3 X;  1D7L A;  4EIQ A;  2YVF A;  3O0H A;  4ECH A;  3T37 A;  2BAC A;  5CQF A;  4TLX A;  1L9E A;  5JCI A;  2YLT A;  1GTH A;  1OJT A; 
#chains in the Genus database with same CATH topology
 1BGJ A;  3DA1 A;  4JNQ A;  2VQ7 A;  1PBD A;  3VRB A;  1Y56 A;  2VVL A;  2WHD A;  3T2K A;  2X50 A;  3UKH A;  1H82 A;  3DJJ A;  1PBC A;  2RGJ A;  1NEN A;  4B63 A;  4E0V A;  2C3C A;  2C66 A;  3K30 A;  4G74 A;  3CPI G;  3VRA A;  1TDE A;  3BHK A;  2WOV A;  1RP0 A;  1NHP A;  1L9D A;  2GF3 A;  3P1W A;  4K8D A;  4NTE A;  4H2R A;  3RNM A;  2ACZ A;  1B8S A;  1PBB A;  4LU6 A;  1QJD A;  2CUL A;  2XVE A;  1Z6L A;  2Y6R A;  2OLN A;  3DJG X;  2V60 A;  3ATQ A;  3H8L A;  4IA6 A;  2WP6 A;  4U8P A;  4OPD A;  4D03 A;  2BA9 A;  2IVE A;  2XVH A;  4OCG A;  2C7G A;  3NYC A;  4WCT A;  3AEB A;  3GD4 A;  4TM4 A;  1BF3 A;  3RP8 A;  1GRE A;  3LB8 A;  3E1T A;  3C4N A;  1H7X A;  2XCG A;  1ZOV A;  3ALL A;  1B5Q A;  2XFO A;  5FS8 A;  3VR8 A;  4U2L A;  1KSS A;  3Q6J A;  2BAB A;  2BXS A;  1CHU A;  3AD7 B;  3AD9 B;  3BNU A;  1N4V A;  4JY3 A;  4YXD A;  3DK9 A;  3QVR A;  2GR0 A;  4NEV A;  1ELI A;  4GR1 A;  4UDR A;  1ZMD A;  4TM1 A;  4U8O A;  3UKQ A;  3HYW A;  1ZMC A;  3M12 A;  3L1R A;  2V5Z A;  3M13 A;  3T31 A;  4BK1 A;  5KMR A;  1M64 A;  2PHH A;  2WDQ A;  3CPJ G;  3GRS A;  4Z43 A;  4B69 A;  1O94 A;  4D04 A;  2BRY A;  1EL7 A;  1ZKQ A;  2XVI A;  4J36 A;  1AOG A;  4PAB A;  1TYT A;  4EQS A;  4DGK A;  1GRA A;  2WEU A;  1E6E A;  2YWL A;  3C4A A;  3DGH A;  4B67 A;  2GQF A;  4J57 A;  2C67 A;  3RP6 A;  1JRY A;  3F8D A;  2WES A;  3UOY A;  1TDN A;  2WBA A;  3F8R A;  1LPF A;  3AEC A;  3UOX A;  4UDP A;  2EQ7 A;  1Y56 B;  4NTD A;  1PDH A;  1GTE A;  2X3N A;  1ZX9 A;  2XLP A;  3AYJ A;  1IUW A;  1H81 A;  2IVD A;  3AE3 A;  3PS9 A;  2EQ8 A;  3AXB A;  4J56 A;  1DOC A;  1OJA A;  4U8J A;  2VVL G;  3KVE A;  2Q0L A;  5U25 A;  3KA7 A;  4H4U A;  3PVC A;  2GR3 A;  3AE8 A;  4GDE A;  3CIR A;  4II2 A;  3SFD A;  1YY5 A;  3ATR A;  4Y4N A;  1BZL A;  1GRB A;  1PN0 A;  1F6M A;  2BC0 A;  2HQM A;  2YAU A;  4K2X A;  2C75 A;  4H4Y A;  2BYB A;  4U2S A;  2GAG B;  2C73 A;  4BK3 A;  1Y0P A;  4UP3 A;  3FG2 P;  2AQJ A;  3QFB A;  4U2T A;  1NHQ A;  3OZ2 A;  4NEW A;  3QFA A;  4BJY A;  2QCU A;  1PXB A;  3UKK A;  1LQU A;  2YQU A;  2WP5 A;  3UCL A;  5CKU A;  3UP4 A;  1PXA A;  5BVA A;  3GMC A;  5KWF A;  1LVL A;  2WOI A;  4OPG A;  3B3R A;  1GPE A;  3EAN A;  2GEW A;  1NHS A;  4JY2 A;  1PXC A;  2X8H A;  1OJD A;  4OPC A;  3KKJ A;  3NLC A;  4U8I A;  1E1N A;  1CL0 A;  4OPT A;  4IVM B;  2R46 A;  2OLO A;  3GDP A;  3IHG A;  3V3O A;  3NT6 A;  5FS9 A;  4BUR A;  3NNE A;  1FOH A;  2OA1 A;  2B9Y A;  2WDV A;  4P9S A;  4H4Q A;  1TRB A;  2FJE A;  5U63 A;  1FEB A;  1VG9 A;  1IUX A;  2C72 A;  2YVJ A;  2WOW A;  3ALJ A;  3CGC A;  4GDP A;  3B6D A;  4J2W A;  2WPC A;  2XDO A;  4XWZ A;  3KD9 A;  5EB5 A;  3SFE A;  4ZN0 A;  5KXJ A;  3NK0 X;  4U8N A;  1VQW A;  3P9U A;  3NTA A;  2CVJ A;  4CCR A;  3IF9 A;  4CY8 A;  1PHH A;  2FJD A;  4REK A;  4Z2U A;  1TDK A;  2V3A A;  3P4R A;  4GRT A;  4CCQ A;  2JB1 A;  4JN9 A;  3KPF A;  2WPF A;  1IUU A;  3COX A;  2YLR A;  3UTE A;  4CRT A;  3GMB A;  3CNP A;  5HYM A;  2QA1 A;  4OVI A;  4U8M A;  4J33 A;  1LJ1 A;  2GAH B;  2WU2 A;  1CC6 A;  1IUS A;  1L0V A;  2R4J A;  1FEA A;  4G9K A;  1K0J A;  3SM8 A;  5L46 A;  3EPT A;  1PBF A;  4H4T A;  4A9W A;  3I6D A;  3NIX A;  1N1P A;  1NG4 A;  1UKV G;  4B66 A;  4G6G A;  1JNR A;  2ARD A;  2V6O A;  3AE1 A;  3GDN A;  1KFY A;  2A87 A;  4YSZ A;  3V76 A;  4AOX A;  3SGL A;  5ER0 A;  3LJP A;  1K0L A;  3UTF A;  1XHC A;  4C5O A;  3AED A;  1GER A;  2JB2 A;  3JSK A;  1LQT A;  1NG3 A;  4YKG A;  1RYI A;  4H4V A;  2YM2 A;  1DOD A;  2VOU A;  4GCM A;  4KPR A;  5HHF A;  4II3 A;  2ZZC A;  1YQZ A;  3KLJ A;  1CF3 A;  4OPU A;  4AP1 A;  3RP7 A;  5KOX A;  4Z25 A;  4TM3 A;  3IWA A;  3BNM A;  4XWR A;  3NHO X;  1E1K A;  1GEU A;  2C3D A;  3VRD B;  3NK1 X;  2EQ9 A;  2R45 A;  3BI2 A;  4YSX A;  2JAE A;  4I59 A;  1FEC A;  3WE0 A;  4ICY A;  4K5S A;  1XPQ A;  4NZH A;  4GF7 A;  3SYI A;  4BK2 A;  3AD8 B;  2YG7 A;  3CGE A;  4EM3 A;  3CGD A;  3I3L A;  4G6H A;  2XFU A;  2DKI A;  4RG3 A;  2C4C A;  4IVO B;  3VQR A;  2ZBW A;  4C74 A;  4K22 A;  5KVH A;  1FCD A;  3NYF A;  1E7P A;  3HYV A;  3UKL A;  5IQ1 A;  4FDC B;  4DSH A;  2H88 A;  4H4W A;  5GSN A;  2F5Z A;  3V3N A;  5IQ4 A;  2BCG G;  2BXR A;  2A89 A;  2AR8 A;  3P4P A;  1MOK A;  2R9Z A;  3GD3 A;  1XAN A;  3ICS A;  1NAA A;  2R0G A;  3LAD A;  3T0K A;  1JRX A;  5FS7 A;  1GXF A;  4TM0 A;  2VVM A;  3ITJ A;  2YG3 A;  3AE6 A;  1V59 A;  2XYO A;  4OPI A;  1GRF A;  2ZZ0 A;  4CNJ A;  1GRT A;  4J31 A;  2BK5 A;  5KMS A;  2XVJ A;  2C64 A;  3CMM A;  4H2P A;  4C77 A;  1GV4 A;  4TLZ A;  1ZOY A;  2VRL A;  3LOV A;  5FMH A;  4AT2 A;  5KRQ A;  4HB9 A;  3II4 A;  5JCM A;  1YQ4 A;  3SY4 A;  1YKJ A;  4AT0 A;  2BS4 A;  2B7R A;  2WPE A;  3AYI A;  4EMW A;  3L8K A;  4GAV A;  3GWF A;  5C3J A;  1GSN A;  1JEH A;  1H84 A;  2GH5 A;  1LV0 A;  2WDR A;  3QSS A;  4FK1 A;  4J34 A;  2YLS A;  2BS2 A;  2XFQ A;  3UTH A;  4EIP A;  1KDG A;  4H2Q A;  2GV8 A;  2J3N A;  1GOS A;  2BK4 A;  1TDO A;  3DME A;  4YSY A;  4FX9 A;  1IUT A;  2GMH A;  3KPK A;  1DNC A;  1KNR A;  2B9X A;  1K4Q A;  3H4K A;  3QSE A;  2X99 A;  4APN A;  1CJ4 A;  3NK2 X;  1P2H A;  1EBD A;  4H4P A;  1GRG A;  4H4X A;  4NTC A;  2C70 A;  3AEF A;  4Y4L A;  2C65 A;  4C3Y A;  1KF6 A;  1NHR A;  1QLB A;  1TYP A;  2XLS A;  4B65 A;  3DGZ A;  3UOZ A;  2H89 A;  4K5R A;  3RED A;  4EQX A;  2YG5 A;  5EBK A;  2WP9 A;  3NRN A;  4AOS A;  1PJ5 A;  4EQW A;  4H7U A;  2GMJ A;  1JRZ A;  2Z5X A;  1IJH A;  1XDI A;  1DOB A;  2APG A;  1W4X A;  4FK1 C;  3ZYX A;  2OAM A;  5BRT A;  4X9N A;  5KNL A;  3GYI A;  1COY A;  1GT8 A;  4USQ A;  1ZP0 A;  5M10 A;  1FL2 A;  4Z26 A;  2BS3 A;  2YG4 A;  5KMQ A;  2JKC A;  2RGO A;  3CNT A;  2X8C A;  5EOW A;  3T2Y A;  2GR1 A;  4YT0 A;  4YTP A;  5JCK A;  1EL5 A;  2FBW A;  2E5V A;  4JDR A;  4EMJ A;  1P2E A;  3FPZ A;  4WX1 A;  4A65 A;  2BCP A;  4CBQ A;  2B7S A;  4JQ9 A;  3T2Z A;  1RSG A;  5LV9 A;  4IV9 A;  1VG0 A;  3GWD A;  3NN6 X;  3FBS A;  4GUV A;  1EL8 A;  4XXG A;  2WS3 A;  1H7W A;  3AE7 A;  5BUL A;  1GET A;  1MO9 A;  3UKF A;  4H2N A;  4JNA A;  1K0I A;  3NN0 X;  2B76 A;  3G5S A;  3SZF A;  3KU9 A;  1KSU A;  5HY5 A;  3GYJ A;  2JB3 A;  2QA2 A;  3DJD A;  3NTD A;  4Z44 A;  1YQ3 A;  3SZW A;  3P4S A;  2W0H A;  4KX6 A;  1O95 A;  1D4D A;  1NDA A;  4USR A;  3VR9 A;  4HA6 A;  1ZDL A;  5BUK A;  1JU2 A;  2YLX A;  1OJC A;  2Q6U A;  4NWZ A;  3T14 A;  1E1M A;  3F8P A;  1CJC A;  2JK6 A;  2XFP A;  3AE2 A;  1QO8 A;  3LZX A;  5HXI A;  1S2Q A;  4O5Q A;  4A6N A;  1D5T A;  3IC9 A;  3G5Q A;  2CDU A;  4MJW A;  3NG7 X;  2Q7V A;  2XVF A;  1M6I A;  3ISH A;  5DBJ A;  4A99 A;  4PAA A;  3EAO A;  4YWO A;  3QJ4 A;  2WET A;  1DJN A;  1TDF A;  3D8X A;  4GAP A;  5J7X A;  1X31 B;  1OJ9 A;  3AEG A;  2E4G A;  1LTX R;  3FIM B;  3NKS A;  2YM1 A;  3AE5 A;  3Q9T A;  3BHF A;  2TPR A;  4G73 A;  1NEK A;  3AE9 A;  2R4E A;  3S5W A;  3H8I A;  2E1M A;  2YLZ A;  2NPX A;  3K7Q X;  1PJ6 A;  1GAL A;  4U8L A;  4UDQ A;  5JCN A;  3LXD A;  4X4J A;  1D4E A;  2JBV A;  1GES A;  2XLT A;  2XFN A;  2Q0K A;  3GSI A;  3S61 A;  4Z2T A;  1ZY8 A;  2GB0 A;  2Z5Y A;  5KVI A;  3ALM A;  4RSL A;  1H6V A;  4EMI A;  2XLR A;  1KNP A;  1Q1W A;  4NNJ A;  5M0Z A;  2IID A;  1D4C A;  3NGC X;  3CTY A;  3HZL A;  3R9U A;  4C3X A;  5IPY A;  3EF6 A;  1JNZ A;  2QAE A;  4U8K A;  1S3B A;  2WU5 A;  2GR2 A;  4B64 A;  2WQY A;  3CGB A;  3ZDN A;  1B37 A;  4YSH A;  4DSG A;  4Z2R A;  1ONF A;  2C76 A;  2EQ6 A;  2GVC A;  3UP5 A;  4ADW A;  2OAL A;  2ZZB A;  2BRA A;  1BWC A;  1F8W A;  2CFY A;  2V61 A;  3SXI A;  1L9C A;  2RGH A;  4LA1 A;  5GRT A;  3OC4 A;  4YTM A;  3DJE A;  3CNS A;  3SQP A;  2GQW A;  4I58 A;  1IUV A;  1PBE A;  2DKH A;  3AWI A;  1O5W A;  4A6N B;  3K7T A;  4H50 A;  3ADA B;  3IHM A;  5FS6 A;  3ABV A;  5J60 A;  3HYX A;  3GRT A;  3AEE A;  3NYE A;  4N9X A;  4B68 A;  5KMP A;  2FJB A;  2YR5 A;  1S3E A;  2A8X A;  2B9W A;  4IA5 A;  3QVP A;  3CND A;  2BK3 A;  4LII A;  3AYL A;  4BV6 A;  2AAQ A;  5JCL A;  1HYU A;  1MXT A;  4YKF A;  2YVG A;  5EB4 A;  3P4Q A;  2YR6 A;  1GND A;  2BC1 A;  4CY6 A;  2TMD A;  2XLU A;  4B1B A;  1DOE A;  2VQB A;  4BJZ A;  3AB1 A;  2Y6Q A;  4K7Z A;  4X9M A;  1Q9I A;  2FJA A;  5KOW A;  3BI5 A;  1B4V A;  1F8R A;  2PYX A;  1F8S A;  3CPH G;  3AEA A;  1S2Y A;  3SX6 A;  3DH9 A;  3ICT A;  3AE4 A;  4YTN A;  3GYX A;  3LZW A;  4M52 A;  1Q1R A;  5C2T A;  2UZZ A;  1CC2 A;  5U1O A;  4CNK A;  2V3B A;  2O9Z A;  1CBO A;  1CC4 A;  2X8G A;  4RG4 A;  3FMW A;  4O5U A;  1PJ7 A;  3G5R A;  1DXL A;  3RHA A;  2RAB A;  3C96 A;  3SZ0 A;  3SZC A;  2NVK X;  4H4Z A;  1E1L A;  2R0C A;  3URH A;  4A79 A;  4AP3 A;  4H4R A;  4EQR A;  2VZ2 A;  3D1C A;  4Z24 A;  1PS9 A;  3BI4 A;  3DK8 A;  4DNA A;  1BKW A;  4Y4M A;  2YG6 A;  3UOV A;  1N4U A;  3UKA A;  2YLW A;  1BGN A;  1ZK7 A;  2R0P A;  4A5L A;  1REO A;  1SEZ A;  2GRT A;  1DJQ A;  3PO7 A;  3CN8 A;  3ICR A;  4OPL A;  4A7A A;  1JOA A;  1H86 A;  1E39 A;  3CNJ A;  1VRQ B;  1F3P A;  5TR3 A;  1VDC A;  4ZCC A;  2I0Z A;  4H4S A;  2YR4 A;  1D7Y A;  1CJ2 A;  1GRH A;  4ZCD A;  4EM4 A;  3UKP A;  3M0O A;  3DK4 A;  1EL9 A;  3QSM A;  2VRM A;  1N4W A;  3UTG A;  1CJ3 A;  1NPX A;  1H83 A;  3K7M X;  3NH3 X;  1D7L A;  4EIQ A;  2YVF A;  3O0H A;  4ECH A;  3T37 A;  2BAC A;  5CQF A;  4TLX A;  1L9E A;  5JCI A;  2YLT A;  1GTH A;  1OJT A; 
#chains in the Genus database with same CATH homology
 1BGJ A;  3DA1 A;  4JNQ A;  2VQ7 A;  1PBD A;  3VRB A;  1Y56 A;  2VVL A;  2WHD A;  3T2K A;  2X50 A;  3UKH A;  1H82 A;  3DJJ A;  1PBC A;  2RGJ A;  1NEN A;  4B63 A;  4E0V A;  2C3C A;  2C66 A;  3K30 A;  4G74 A;  3CPI G;  3VRA A;  1TDE A;  3BHK A;  2WOV A;  1RP0 A;  1NHP A;  1L9D A;  2GF3 A;  3P1W A;  4K8D A;  4NTE A;  4H2R A;  3RNM A;  2ACZ A;  1B8S A;  1PBB A;  4LU6 A;  1QJD A;  2CUL A;  2XVE A;  1Z6L A;  2Y6R A;  2OLN A;  3DJG X;  2V60 A;  3ATQ A;  3H8L A;  4IA6 A;  2WP6 A;  4U8P A;  4OPD A;  4D03 A;  2BA9 A;  2IVE A;  2XVH A;  4OCG A;  2C7G A;  3NYC A;  4WCT A;  3AEB A;  3GD4 A;  4TM4 A;  1BF3 A;  3RP8 A;  1GRE A;  3LB8 A;  3E1T A;  3C4N A;  1H7X A;  2XCG A;  1ZOV A;  3ALL A;  1B5Q A;  2XFO A;  5FS8 A;  3VR8 A;  4U2L A;  1KSS A;  3Q6J A;  2BAB A;  2BXS A;  1CHU A;  3AD7 B;  3AD9 B;  3BNU A;  1N4V A;  4JY3 A;  4YXD A;  3DK9 A;  3QVR A;  2GR0 A;  4NEV A;  1ELI A;  4GR1 A;  4UDR A;  1ZMD A;  4TM1 A;  4U8O A;  3UKQ A;  3HYW A;  1ZMC A;  3M12 A;  3L1R A;  2V5Z A;  3M13 A;  3T31 A;  4BK1 A;  5KMR A;  1M64 A;  2PHH A;  2WDQ A;  3CPJ G;  3GRS A;  4Z43 A;  4B69 A;  1O94 A;  4D04 A;  2BRY A;  1EL7 A;  1ZKQ A;  2XVI A;  4J36 A;  1AOG A;  4PAB A;  1TYT A;  4EQS A;  4DGK A;  1GRA A;  2WEU A;  1E6E A;  2YWL A;  3C4A A;  3DGH A;  4B67 A;  2GQF A;  4J57 A;  2C67 A;  3RP6 A;  1JRY A;  3F8D A;  2WES A;  3UOY A;  1TDN A;  2WBA A;  3F8R A;  1LPF A;  3AEC A;  3UOX A;  4UDP A;  2EQ7 A;  1Y56 B;  4NTD A;  1PDH A;  1GTE A;  2X3N A;  1ZX9 A;  2XLP A;  3AYJ A;  1IUW A;  1H81 A;  2IVD A;  3AE3 A;  3PS9 A;  2EQ8 A;  3AXB A;  4J56 A;  1DOC A;  1OJA A;  4U8J A;  2VVL G;  3KVE A;  2Q0L A;  5U25 A;  3KA7 A;  4H4U A;  3PVC A;  2GR3 A;  3AE8 A;  4GDE A;  3CIR A;  4II2 A;  3SFD A;  1YY5 A;  3ATR A;  4Y4N A;  1BZL A;  1GRB A;  1PN0 A;  1F6M A;  2BC0 A;  2HQM A;  2YAU A;  4K2X A;  2C75 A;  4H4Y A;  2BYB A;  4U2S A;  2GAG B;  2C73 A;  4BK3 A;  1Y0P A;  4UP3 A;  3FG2 P;  2AQJ A;  3QFB A;  4U2T A;  1NHQ A;  3OZ2 A;  4NEW A;  3QFA A;  4BJY A;  2QCU A;  1PXB A;  3UKK A;  1LQU A;  2YQU A;  2WP5 A;  3UCL A;  5CKU A;  3UP4 A;  1PXA A;  5BVA A;  3GMC A;  5KWF A;  1LVL A;  2WOI A;  4OPG A;  3B3R A;  1GPE A;  3EAN A;  2GEW A;  1NHS A;  4JY2 A;  1PXC A;  2X8H A;  1OJD A;  4OPC A;  3KKJ A;  3NLC A;  4U8I A;  1E1N A;  1CL0 A;  4OPT A;  4IVM B;  2R46 A;  2OLO A;  3GDP A;  3IHG A;  3V3O A;  3NT6 A;  5FS9 A;  4BUR A;  3NNE A;  1FOH A;  2OA1 A;  2B9Y A;  2WDV A;  4P9S A;  4H4Q A;  1TRB A;  2FJE A;  5U63 A;  1FEB A;  1VG9 A;  1IUX A;  2C72 A;  2YVJ A;  2WOW A;  3ALJ A;  3CGC A;  4GDP A;  3B6D A;  4J2W A;  2WPC A;  2XDO A;  4XWZ A;  3KD9 A;  5EB5 A;  3SFE A;  4ZN0 A;  5KXJ A;  3NK0 X;  4U8N A;  1VQW A;  3P9U A;  3NTA A;  2CVJ A;  4CCR A;  3IF9 A;  4CY8 A;  1PHH A;  2FJD A;  4REK A;  4Z2U A;  1TDK A;  2V3A A;  3P4R A;  4GRT A;  4CCQ A;  2JB1 A;  4JN9 A;  3KPF A;  2WPF A;  1IUU A;  3COX A;  2YLR A;  3UTE A;  4CRT A;  3GMB A;  3CNP A;  5HYM A;  2QA1 A;  4OVI A;  4U8M A;  4J33 A;  1LJ1 A;  2GAH B;  2WU2 A;  1CC6 A;  1IUS A;  1L0V A;  2R4J A;  1FEA A;  4G9K A;  1K0J A;  3SM8 A;  5L46 A;  3EPT A;  1PBF A;  4H4T A;  4A9W A;  3I6D A;  3NIX A;  1N1P A;  1NG4 A;  1UKV G;  4B66 A;  4G6G A;  1JNR A;  2ARD A;  2V6O A;  3AE1 A;  3GDN A;  1KFY A;  2A87 A;  4YSZ A;  3V76 A;  4AOX A;  3SGL A;  5ER0 A;  3LJP A;  1K0L A;  3UTF A;  1XHC A;  4C5O A;  3AED A;  1GER A;  2JB2 A;  3JSK A;  1LQT A;  1NG3 A;  4YKG A;  1RYI A;  4H4V A;  2YM2 A;  1DOD A;  2VOU A;  4GCM A;  4KPR A;  5HHF A;  4II3 A;  2ZZC A;  1YQZ A;  3KLJ A;  1CF3 A;  4OPU A;  4AP1 A;  3RP7 A;  5KOX A;  4Z25 A;  4TM3 A;  3IWA A;  3BNM A;  4XWR A;  3NHO X;  1E1K A;  1GEU A;  2C3D A;  3VRD B;  3NK1 X;  2EQ9 A;  2R45 A;  3BI2 A;  4YSX A;  2JAE A;  4I59 A;  1FEC A;  3WE0 A;  4ICY A;  4K5S A;  1XPQ A;  4NZH A;  4GF7 A;  3SYI A;  4BK2 A;  3AD8 B;  2YG7 A;  3CGE A;  4EM3 A;  3CGD A;  3I3L A;  4G6H A;  2XFU A;  2DKI A;  4RG3 A;  2C4C A;  4IVO B;  3VQR A;  2ZBW A;  4C74 A;  4K22 A;  5KVH A;  1FCD A;  3NYF A;  1E7P A;  3HYV A;  3UKL A;  5IQ1 A;  4FDC B;  4DSH A;  2H88 A;  4H4W A;  5GSN A;  2F5Z A;  3V3N A;  5IQ4 A;  2BCG G;  2BXR A;  2A89 A;  2AR8 A;  3P4P A;  1MOK A;  2R9Z A;  3GD3 A;  1XAN A;  3ICS A;  1NAA A;  2R0G A;  3LAD A;  3T0K A;  1JRX A;  5FS7 A;  1GXF A;  4TM0 A;  2VVM A;  3ITJ A;  2YG3 A;  3AE6 A;  1V59 A;  2XYO A;  4OPI A;  1GRF A;  2ZZ0 A;  4CNJ A;  1GRT A;  4J31 A;  2BK5 A;  5KMS A;  2XVJ A;  2C64 A;  3CMM A;  4H2P A;  4C77 A;  1GV4 A;  4TLZ A;  1ZOY A;  2VRL A;  3LOV A;  5FMH A;  4AT2 A;  5KRQ A;  4HB9 A;  3II4 A;  5JCM A;  1YQ4 A;  3SY4 A;  1YKJ A;  4AT0 A;  2BS4 A;  2B7R A;  2WPE A;  3AYI A;  4EMW A;  3L8K A;  4GAV A;  3GWF A;  5C3J A;  1GSN A;  1JEH A;  1H84 A;  2GH5 A;  1LV0 A;  2WDR A;  3QSS A;  4FK1 A;  4J34 A;  2YLS A;  2BS2 A;  2XFQ A;  3UTH A;  4EIP A;  1KDG A;  4H2Q A;  2GV8 A;  2J3N A;  1GOS A;  2BK4 A;  1TDO A;  3DME A;  4YSY A;  4FX9 A;  1IUT A;  2GMH A;  3KPK A;  1DNC A;  1KNR A;  2B9X A;  1K4Q A;  3H4K A;  3QSE A;  2X99 A;  4APN A;  1CJ4 A;  3NK2 X;  1P2H A;  1EBD A;  4H4P A;  1GRG A;  4H4X A;  4NTC A;  2C70 A;  3AEF A;  4Y4L A;  2C65 A;  4C3Y A;  1KF6 A;  1NHR A;  1QLB A;  1TYP A;  2XLS A;  4B65 A;  3DGZ A;  3UOZ A;  2H89 A;  4K5R A;  3RED A;  4EQX A;  2YG5 A;  5EBK A;  2WP9 A;  3NRN A;  4AOS A;  1PJ5 A;  4EQW A;  4H7U A;  2GMJ A;  1JRZ A;  2Z5X A;  1IJH A;  1XDI A;  1DOB A;  2APG A;  1W4X A;  4FK1 C;  3ZYX A;  2OAM A;  5BRT A;  4X9N A;  5KNL A;  3GYI A;  1COY A;  1GT8 A;  4USQ A;  1ZP0 A;  5M10 A;  1FL2 A;  4Z26 A;  2BS3 A;  2YG4 A;  5KMQ A;  2JKC A;  2RGO A;  3CNT A;  2X8C A;  5EOW A;  3T2Y A;  2GR1 A;  4YT0 A;  4YTP A;  5JCK A;  1EL5 A;  2FBW A;  2E5V A;  4JDR A;  4EMJ A;  1P2E A;  3FPZ A;  4WX1 A;  4A65 A;  2BCP A;  4CBQ A;  2B7S A;  4JQ9 A;  3T2Z A;  1RSG A;  5LV9 A;  4IV9 A;  1VG0 A;  3GWD A;  3NN6 X;  3FBS A;  4GUV A;  1EL8 A;  4XXG A;  2WS3 A;  1H7W A;  3AE7 A;  5BUL A;  1GET A;  1MO9 A;  3UKF A;  4H2N A;  4JNA A;  1K0I A;  3NN0 X;  2B76 A;  3G5S A;  3SZF A;  3KU9 A;  1KSU A;  5HY5 A;  3GYJ A;  2JB3 A;  2QA2 A;  3DJD A;  3NTD A;  4Z44 A;  1YQ3 A;  3SZW A;  3P4S A;  2W0H A;  4KX6 A;  1O95 A;  1D4D A;  1NDA A;  4USR A;  3VR9 A;  4HA6 A;  1ZDL A;  5BUK A;  1JU2 A;  2YLX A;  1OJC A;  2Q6U A;  4NWZ A;  3T14 A;  1E1M A;  3F8P A;  1CJC A;  2JK6 A;  2XFP A;  3AE2 A;  1QO8 A;  3LZX A;  5HXI A;  1S2Q A;  4O5Q A;  4A6N A;  1D5T A;  3IC9 A;  3G5Q A;  2CDU A;  4MJW A;  3NG7 X;  2Q7V A;  2XVF A;  1M6I A;  3ISH A;  5DBJ A;  4A99 A;  4PAA A;  3EAO A;  4YWO A;  3QJ4 A;  2WET A;  1DJN A;  1TDF A;  3D8X A;  4GAP A;  5J7X A;  1X31 B;  1OJ9 A;  3AEG A;  2E4G A;  1LTX R;  3FIM B;  3NKS A;  2YM1 A;  3AE5 A;  3Q9T A;  3BHF A;  2TPR A;  4G73 A;  1NEK A;  3AE9 A;  2R4E A;  3S5W A;  3H8I A;  2E1M A;  2YLZ A;  2NPX A;  3K7Q X;  1PJ6 A;  1GAL A;  4U8L A;  4UDQ A;  5JCN A;  3LXD A;  4X4J A;  1D4E A;  2JBV A;  1GES A;  2XLT A;  2XFN A;  2Q0K A;  3GSI A;  3S61 A;  4Z2T A;  1ZY8 A;  2GB0 A;  2Z5Y A;  5KVI A;  3ALM A;  4RSL A;  1H6V A;  4EMI A;  2XLR A;  1KNP A;  1Q1W A;  4NNJ A;  5M0Z A;  2IID A;  1D4C A;  3NGC X;  3CTY A;  3HZL A;  3R9U A;  4C3X A;  5IPY A;  3EF6 A;  1JNZ A;  2QAE A;  4U8K A;  1S3B A;  2WU5 A;  2GR2 A;  4B64 A;  2WQY A;  3CGB A;  3ZDN A;  1B37 A;  4YSH A;  4DSG A;  4Z2R A;  1ONF A;  2C76 A;  2EQ6 A;  2GVC A;  3UP5 A;  4ADW A;  2OAL A;  2ZZB A;  2BRA A;  1BWC A;  1F8W A;  2CFY A;  2V61 A;  3SXI A;  1L9C A;  2RGH A;  4LA1 A;  5GRT A;  3OC4 A;  4YTM A;  3DJE A;  3CNS A;  3SQP A;  2GQW A;  4I58 A;  1IUV A;  1PBE A;  2DKH A;  3AWI A;  1O5W A;  4A6N B;  3K7T A;  4H50 A;  3ADA B;  3IHM A;  5FS6 A;  3ABV A;  5J60 A;  3HYX A;  3GRT A;  3AEE A;  3NYE A;  4N9X A;  4B68 A;  5KMP A;  2FJB A;  2YR5 A;  1S3E A;  2A8X A;  2B9W A;  4IA5 A;  3QVP A;  3CND A;  2BK3 A;  4LII A;  3AYL A;  4BV6 A;  2AAQ A;  5JCL A;  1HYU A;  1MXT A;  4YKF A;  2YVG A;  5EB4 A;  3P4Q A;  2YR6 A;  1GND A;  2BC1 A;  4CY6 A;  2TMD A;  2XLU A;  4B1B A;  1DOE A;  2VQB A;  4BJZ A;  3AB1 A;  2Y6Q A;  4K7Z A;  4X9M A;  1Q9I A;  2FJA A;  5KOW A;  3BI5 A;  1B4V A;  1F8R A;  2PYX A;  1F8S A;  3CPH G;  3AEA A;  1S2Y A;  3SX6 A;  3DH9 A;  3ICT A;  3AE4 A;  4YTN A;  3GYX A;  3LZW A;  4M52 A;  1Q1R A;  5C2T A;  2UZZ A;  1CC2 A;  5U1O A;  4CNK A;  2V3B A;  2O9Z A;  1CBO A;  1CC4 A;  2X8G A;  4RG4 A;  3FMW A;  4O5U A;  1PJ7 A;  3G5R A;  1DXL A;  3RHA A;  2RAB A;  3C96 A;  3SZ0 A;  3SZC A;  2NVK X;  4H4Z A;  1E1L A;  2R0C A;  3URH A;  4A79 A;  4AP3 A;  4H4R A;  4EQR A;  2VZ2 A;  3D1C A;  4Z24 A;  1PS9 A;  3BI4 A;  3DK8 A;  4DNA A;  1BKW A;  4Y4M A;  2YG6 A;  3UOV A;  1N4U A;  3UKA A;  2YLW A;  1BGN A;  1ZK7 A;  2R0P A;  4A5L A;  1REO A;  1SEZ A;  2GRT A;  1DJQ A;  3PO7 A;  3CN8 A;  3ICR A;  4OPL A;  4A7A A;  1JOA A;  1H86 A;  1E39 A;  3CNJ A;  1VRQ B;  1F3P A;  5TR3 A;  1VDC A;  4ZCC A;  2I0Z A;  4H4S A;  2YR4 A;  1D7Y A;  1CJ2 A;  1GRH A;  4ZCD A;  4EM4 A;  3UKP A;  3M0O A;  3DK4 A;  1EL9 A;  3QSM A;  2VRM A;  1N4W A;  3UTG A;  1CJ3 A;  1NPX A;  1H83 A;  3K7M X;  3NH3 X;  1D7L A;  4EIQ A;  2YVF A;  3O0H A;  4ECH A;  3T37 A;  2BAC A;  5CQF A;  4TLX A;  1L9E A;  5JCI A;  2YLT A;  1GTH A;  1OJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...