1TDEA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
total genus 91
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdeA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdeA02
1YQZA 4X9NA 4H7UA 3EAOA 1TYPA 1K0JA 1H84A 2C76A 1FOHA 3KKJA 2X3NA 1B8SA 3CGEA 3GRSA 4BK3A 3UKLA 4Z2UA 3JSKA 2JBVA 1NHRA 3QVPA 2B9XA 2J3NA 1B5QA 1GOSA 3T37A 2R4JA 5EOWA 1OJAA 1S3EA 4BJYA 1GREA 2V61A 2V6OA 3RHAA 4CBQA 1LQUA 3D8XA 2WU2A 1ZOVA 4OPDA 1ELIA 3KD9A 2YVGA 1YQ4A 3BNUA 3RP7A 3VRBA 2XVJA 4TM4A 1P2EA 2RGOA 1S2YA 1NG4A 3PVCA 5KOXA 5HXIA 1F8SA 2ZZCA 1EL8A 2BK5A 4NTCA 1LPFA 1PS9A 3GDNA 3UKKA 4U2TA 4AOXA 3ALLA 4B67A 3L8KA 3UOZA 5CKUA 3PO7A 2VVLG 4U8NA 1Y56B 1KNRA 2XLTA 3NK0X 2C67A 2RGJA 3NYFA 4B66A 4Z2RA 4CNJA 2CFYA 1YKJA 3OC4A 1D7YA 1F8RA 2YG3A 3GWDA 1COYA 4U8KA 3LXDA 1ZX9A 3AE2A 3NH3X 2Q7VA 2C66A 3C4NA 2YG4A 1D7LA 4CCQA 2VQBA 2C73A 3UTGA 3CNSA 3CGCA 2X8CA 4YSHA 3II4A 3AEEA 1GEUA 1VRQB 3F8PA 4XWRA 3SFEA 4TLZA 4Z25A 1CJ3A 1EL5A 1L9EA 3DJEA 4A6NB 1E7PA 4H4SA 1DOEA 5FS9A 3S5WA 4B65A 3URHA 2AR8A 1IUUA 3LOVA 4KPRA 1S2QA 4ZN0A 2BXSA 2JKCA 2QA1A 2YLWA 4H4PA 1OJCA 3V3OA 2JB1A 2WETA 4CCRA 4A79A 1FECA 2C7GA 4J2WA 4A9WA 1OJ9A 3F8DA 4CY8A 1TDNA 2XLSA 3AXBA 4K8DA 4O5UA 5TR3A 4ICYA 2E1MA 2YG7A 1X31B 1CC4A 2ARDA 1H7XA 4EQWA 3LADA 1KF6A 1CHUA 3AYLA 3ATQA 2R0GA 3AE5A 3NGCX 4GF7A 2UZZA 2GVCA 4NEVA 1MOKA 3B3RA 4K5RA 4YXDA 1S3BA 2B7RA 4U8PA 1CJCA 4K5SA 1D5TA 3AE6A 2B9WA 1TDOA 1GERA 4K2XA 4MJWA 1LQTA 4NEWA 4ZCCA 5KVIA 4TLXA 3Q9TA 1PJ5A 4C74A 1RYIA 3AECA 5JCNA 4P9SA 3C96A 3AB1A 3UOXA 1Q1RA 3K30A 2CULA 2GQFA 4B68A 4JNAA 4B69A 5LV9A 3AE3A 4UDRA 1DJQA 1JNRA 3AEDA 2OALA 4AT0A 4H50A 3GYJA 4WX1A 3CNPA 1YY5A 1ZOYA 1JRXA 3UKFA 2NPXA 1RP0A 1BKWA 2BCPA 1E6EA 3M12A 2B9YA 2QCUA 3UKAA 2VQ7A 2E4GA 1GRFA 1PBFA 3DGHA 2YVJA 1CBOA 1EBDA 2A8XA 2FJEA 4GUVA 4U8IA 5ER0A 4EQXA 4IVMB 4YKGA 3QJ4A 1YQ3A 5KXJA 1BGJA 5C2TA 1O5WA 1PBEA 4H4VA 1Q1WA 4JN9A 1H81A 2X99A 3DA1A 3LZXA 4EM3A 4JQ9A 3CNDA 4N9XA 5KVHA 4XWZA 4H4RA 1LJ1A 1QJDA 2WPCA 1NDAA 2AQJA 2C65A 4U2LA 1JEHA 3KPFA 1JNZA 3SM8A 1CJ2A 2A89A 3FPZA 4D04A 1OJDA 1B4VA 4Z26A 1H83A 4JY3A 4OPIA 1NEKA 1IUSA 2GQWA 3LB8A 4U8OA 4EQRA 5KRQA 4OPTA 3GSIA 2OLNA 3EPTA 2O9ZA 4H4YA 4J31A 1VDCA 2WPFA 2WQYA 4IV9A 5HYMA 4LU6A 3UOVA 1GRHA 2QA2A 2V60A 3AYJA 1PJ7A 4IVOB 4TM1A 1IUVA 2GMJA 3NNEA 4B63A 4H4QA 3RP8A 4E0VA 1M64A 4DGKA 2YLSA 4YTPA 1H86A 5L46A 3DJJA 3QSSA 2BC0A 4H2NA 4B64A 3CNTA 1GT8A 3BI4A 1VQWA 3C4AA 5U63A 1VG9A 4XXGA 3SFDA 4H4ZA 1SEZA 2FJAA 3NHOX 2VRMA 1UKVG 3ATRA 1PXCA 5C3JA 2BS4A 4U8LA 4FK1C 1ZMCA 2C3CA 3NK1X 3DK4A 5GSNA 4Z24A 3CPHG 4AT2A 1DOCA 4H2RA 4UP3A 2IVEA 4ZCDA 3CPJG 4J33A 2C72A 1BGNA 5HY5A 1JU2A 3P4SA 5GRTA 2EQ8A 1O95A 5EBKA 4D03A 1NHSA 1PN0A 2TPRA 2JB3A 3Q6JA 3CIRA 2RABA 3AEBA 3IHGA 2XVHA 4GR1A 4REKA 5FS7A 3AD9B 2XFNA 4YSYA 1ZY8A 2XLUA 3NK2X 4H4WA 5J7XA 3AE4A 2B7SA 3M0OA 1NHQA 4GRTA 2WBAA 5U25A 1N1PA 2YLTA 1CL0A 1GESA 3P4RA 2ZBWA 3RP6A 2Z5XA 2EQ7A 4CY6A 1IUWA 3AD8B 2EQ6A 4CRTA 1Q9IA 2BS3A 3IC9A 2VVLA 1GRAA 3NN0X 2CVJA 3BNMA 5U1OA 3CTYA 1ZKQA 2WOVA 4GCMA 2V3BA 1B37A 4HB9A 1L0VA 3KLJA 5EB5A 4YT0A 5BRTA 1FCDA 4OCGA 2R0PA 3IWAA 3QFBA 1PJ6A 4JNQA 2QAEA 2Q0KA 1GXFA 1GETA 4GDPA 2YVFA 4RG3A 1MXTA 3AE7A 4LA1A 2YQUA 1TYTA 4AP1A 2YG6A 3BI2A 3UP5A 3VRAA 2WESA 2WDQA 3GDPA 3ISHA 1CC6A 1NPXA 3NG7X 1ZMDA 4EIQA 3UTFA 1BZLA 1L9CA 2JB2A 1GTEA 1EL7A 1PXBA 1RSGA 4NTDA 5FMHA 2OLOA 4YTMA 2VZ2A 4UDPA 4YTNA 3I3LA 3S61A 3NIXA 1L9DA 5JCKA 4IA5A 1GSNA 1KSUA 3NT6A 4BURA 2R46A 3UKQA 3K7TA 2ZZ0A 1CC2A 2R4EA 4Y4MA 3ABVA 2WOIA 3EF6A 3UKPA 3GWFA 3P9UA 4U2SA 5JCLA 3GMCA 2AAQA 1DOBA 1N4VA 1TDKA 1HYUA 3G5RA 1D4CA 2EQ9A 3I6DA 5IPYA 4ADWA 4NTEA 1K4QA 1E1LA 2WP6A 3CN8A 1QLBA 3IF9A 2BXRA 3FBSA 4JY2A 4ECHA 2Q0LA 3CNJA 2Y6RA 2C75A 5J60A 1K0IA 4B1BA 2BABA 1LTXR 4NZHA 4M52A 3D1CA 4APNA 2V5ZA 1MO9A 3PS9A 2FJBA 2XVEA 1GRGA 3OZ2A 2BC1A 3P4QA 4JDRA 4TM0A 1F3PA 2BA9A 2OA1A 3ALMA 4OPLA 2WDRA 3M13A 5JCMA 1E1MA 3KVEA 4USRA 3LJPA 1PBDA 1GRBA 2HQMA 1DXLA 1KNPA 2XFOA 4J57A 2GR2A 2GEWA 1PDHA 3SQPA 3NTDA 1N4WA 3NKSA 4H4UA 4C5OA 2YG5A 1DODA 1ZK7A 4PAAA 4OPGA 3P1WA 2XCGA 3GMBA 4FX9A 4EMWA 2JK6A 5M10A 4X9MA 1GRTA 1JRYA 3AEAA 2XLPA 2BK3A 3LZWA 3QSMA 1E1NA 3H8IA 2VRLA 4RSLA 2DKIA 4YSZA 1KDGA 2CDUA 2XFUA 2XVFA 1FEBA 2WPEA 3AE8A 2X8HA 4C3XA 4Z44A 1JRZA 1GPEA 2BS2A 2GV8A 2GF3A 3QFAA 4YWOA 3ZYXA 2I0ZA 2WOWA 1IJHA 2YWLA 1JOAA 1CJ4A 1D4EA 4X4JA 5BULA 2PHHA 1XPQA 4H4TA 2ZZBA 4BK2A 2C3DA 3NTAA 2GAHB 3DK9A 1W4XA 4K7ZA 2GB0A 5BUKA 3AWIA 4H2QA 3NYEA 1BF3A 3ZDNA 2YR5A 1GALA 1PBCA 3K7MX 4A99A 3NRNA 4RG4A 5KOWA 3BHKA 4DNAA 1XHCA 2XFPA 3QSEA 2OAMA 4KX6A 2BK4A 2R9ZA 3WE0A 4A65A 2B76A 3FMWA 1BWCA 4U8JA 3V76A 1KFYA 3G5QA 3GYIA 3NYCA 2JAEA 4U8MA 3VR8A 4J56A 4O5QA 4A7AA 1H82A 4Z2TA 1E1KA 3GD3A 3K7QX 4OVIA 2GMHA 1CF3A 2WDVA 2F5ZA 2IVDA 4A5LA 1AOGA 1DNCA 1ZP0A 3G5SA 2W0HA 2YLXA 4J36A 3GD4A 3R9UA 1PHHA 3ICTA 4EMJA 4UDQA 4C3YA 2VOUA 3DH9A 3SGLA 3DGZA 4BK1A 1N4UA 3FG2P 3ICSA 2A87A 1O94A 3HZLA 3EANA 3ITJA 2V3AA 1GV4A 5IQ4A 5JCIA 2WEUA 2YLZA 1V59A 3DMEA 2GR1A 4I58A 3KU9A 5FS8A 2R45A 3AEFA 5KWFA 3AYIA 2WU5A 3BI5A 2GRTA 4IA6A 3VQRA 3UCLA 3O0HA 1NHPA 1OJTA 3QVRA 4J34A 2XFQA 3B6DA 3IHMA 4BJZA 4I59A 1GTHA 4AOSA 3V3NA 2GH5A 3UP4A 1Y0PA 4FK1A 2BCGG 2PYXA 2X50A 2FJDA 1Z6LA 2WP5A 2X8GA 1LV0A 2E5VA 1IUXA 1QO8A 3P4PA 3CGDA 2WHDA 4H4XA 2R0CA 4GDEA 4EM4A 1REOA 2Y6QA 1TDEA 3ALJA 4OPUA 1VG0A 2BYBA 2YAUA 1F8WA 3NLCA 5M0ZA 4C77A 1XANA 1XDIA 2GR3A 2ACZA 1LVLA 4FDCB 1D4DA 2VVMA 1TDFA 1KSSA 3AE9A 2BACA 3ICRA 2XDOA 3KA7A 4YKFA 3VR9A 4Y4LA 4DSGA 2Z5YA 3NN6X 2YM2A 3H4KA 2GAGB 1Y56A 2IIDA 4Z43A 3AEGA 3GRTA 5HHFA 4LIIA 2RGHA 3CGBA 1H6VA 1K0LA 4WCTA 3L1RA 1GNDA 1FL2A 1ZDLA 2XLRA 1NAAA 4H2PA 5EB4A 5CQFA 2FBWA 3F8RA 4HA6A 1PXAA 2YLRA 1E39A 2C70A 4EQSA 2Q6UA 1PBBA 2YR6A 2WP9A 2YM1A 4EIPA 4Y4NA 2TMDA 3UKHA 1ONFA 1F6MA 5DBJA 3REDA 3UOYA 1H7WA 3UTEA 4A6NA 4AP3A 4BV6A 2H88A 1P2HA 1M6IA 2C64A 2NVKX 3RNMA 2XVIA 4TM3A 3VRDB 5FS6A 4DSHA 4YSXA 2DKHA 3UTHA 4EMIA 5BVAA 1TRBA 3DJGX 3E1TA 4OPCA 4CNKA 5IQ1A 2APGA 2XYOA 3AE1A 1DJNA 1EL9A 4USQA 1IUTA 3AD7B 3CPIG 2WS3A 4PABA 1NG3A 3FIMB 2H89A 4K22A 3DJDA 1FEAA 1NENA 3DK8A 2GR0A 3BHFA 3ADAB 3COXA 2YR4A 3H8LA
chains in the Genus database with same CATH superfamily
1YQZA 4X9NA 4H7UA 4G9KA 3EAOA 1TYPA 1K0JA 1H84A 2C76A 1FOHA 3KKJA 2X3NA 1B8SA 3CGEA 3GRSA 4BK3A 3UKLA 4Z2UA 3JSKA 2JBVA 1NHRA 3QVPA 2B9XA 2J3NA 1B5QA 1GOSA 3T37A 2R4JA 5EOWA 1OJAA 1S3EA 4BJYA 1GREA 2V61A 2V6OA 3RHAA 4CBQA 1LQUA 3D8XA 2WU2A 3HYWA 1ZOVA 4OPDA 1ELIA 3KD9A 2YVGA 1YQ4A 3BNUA 3RP7A 3VRBA 2XVJA 4TM4A 1P2EA 2RGOA 1S2YA 1NG4A 3PVCA 3T14A 5KOXA 5HXIA 1F8SA 2ZZCA 1EL8A 2BK5A 4NTCA 1LPFA 1PS9A 3GDNA 3UKKA 4U2TA 4AOXA 3ALLA 4B67A 3L8KA 3UOZA 5CKUA 3PO7A 2VVLG 4U8NA 1Y56B 1KNRA 2XLTA 3NK0X 2C67A 2RGJA 3NYFA 4B66A 4Z2RA 4CNJA 2CFYA 1YKJA 3OC4A 1D7YA 1F8RA 2YG3A 3GWDA 1COYA 4U8KA 3LXDA 1ZX9A 3AE2A 3NH3X 2Q7VA 2C66A 3C4NA 2YG4A 1D7LA 4CCQA 2VQBA 3T0KA 2C73A 3UTGA 3CNSA 3CGCA 2X8CA 4YSHA 3II4A 3AEEA 1GEUA 1VRQB 3F8PA 4XWRA 3SFEA 4TLZA 4Z25A 1CJ3A 1EL5A 1L9EA 3DJEA 4A6NB 1E7PA 4H4SA 1DOEA 5FS9A 3S5WA 4B65A 3URHA 2AR8A 1IUUA 3LOVA 4KPRA 1S2QA 4ZN0A 2BXSA 2JKCA 2QA1A 2YLWA 4H4PA 1OJCA 3V3OA 2JB1A 2WETA 4CCRA 4A79A 1FECA 2C7GA 4J2WA 4A9WA 1OJ9A 3F8DA 4CY8A 1TDNA 2BRAA 2XLSA 3AXBA 4K8DA 4O5UA 5TR3A 3SXIA 4ICYA 2E1MA 2YG7A 1X31B 1CC4A 2ARDA 1H7XA 4EQWA 3LADA 1KF6A 1CHUA 3AYLA 3ATQA 2R0GA 3AE5A 3NGCX 4GF7A 2UZZA 2GVCA 4NEVA 1MOKA 3B3RA 4K5RA 4YXDA 1S3BA 3SY4A 2B7RA 4U8PA 1CJCA 4K5SA 1D5TA 3AE6A 2B9WA 1TDOA 1GERA 4G74A 4K2XA 1LQTA 4MJWA 4NEWA 4ZCCA 5KVIA 4TLXA 3Q9TA 1PJ5A 4C74A 1RYIA 3AECA 3T31A 5JCNA 4P9SA 3C96A 3AB1A 3UOXA 1Q1RA 3K30A 2CULA 2GQFA 4B68A 4JNAA 4B69A 5LV9A 3AE3A 4UDRA 1DJQA 1JNRA 3AEDA 2OALA 4AT0A 4H50A 3GYJA 4WX1A 3CNPA 1YY5A 1ZOYA 1JRXA 3UKFA 2NPXA 1RP0A 1BKWA 2BCPA 1E6EA 3M12A 2B9YA 2QCUA 3UKAA 2VQ7A 2E4GA 1GRFA 1PBFA 3DGHA 2YVJA 1CBOA 1EBDA 2A8XA 2FJEA 4GUVA 4U8IA 5ER0A 4EQXA 4IVMB 4YKGA 3QJ4A 1YQ3A 5KXJA 1BGJA 5C2TA 1O5WA 1PBEA 4H4VA 1Q1WA 4JN9A 1H81A 2X99A 3DA1A 3LZXA 4EM3A 4JQ9A 3CNDA 4N9XA 5KVHA 4XWZA 4H4RA 1LJ1A 1QJDA 2WPCA 1NDAA 2AQJA 2C65A 4U2LA 1JEHA 3KPFA 1JNZA 3SM8A 1CJ2A 2A89A 3FPZA 4D04A 1OJDA 1B4VA 4Z26A 1H83A 4JY3A 4OPIA 1NEKA 1IUSA 2GQWA 3LB8A 4U8OA 4EQRA 5KRQA 4OPTA 3GSIA 2OLNA 3EPTA 2O9ZA 4H4YA 4J31A 1VDCA 2WPFA 2WQYA 4IV9A 5HYMA 4LU6A 3UOVA 1GRHA 2QA2A 2V60A 3AYJA 1PJ7A 4IVOB 4TM1A 1IUVA 2GMJA 3NNEA 4B63A 4H4QA 3RP8A 4E0VA 1M64A 4DGKA 2YLSA 4YTPA 1H86A 4G73A 5L46A 3DJJA 3QSSA 2BC0A 4H2NA 4B64A 3CNTA 1GT8A 3BI4A 1VQWA 3C4AA 5U63A 1VG9A 5KMRA 4XXGA 3SFDA 4H4ZA 1SEZA 2FJAA 3NHOX 2VRMA 1UKVG 2BRYA 3ATRA 1PXCA 5C3JA 2BS4A 4U8LA 4FK1C 1ZMCA 2C3CA 3NK1X 3DK4A 5GSNA 4Z24A 3CPHG 4AT2A 1DOCA 4H2RA 4UP3A 2IVEA 4ZCDA 3CPJG 4J33A 2C72A 1BGNA 5HY5A 1JU2A 3P4SA 3SZWA 5GRTA 2EQ8A 1O95A 5EBKA 4D03A 1NHSA 1PN0A 2TPRA 2JB3A 3Q6JA 3CIRA 2RABA 3AEBA 3IHGA 2XVHA 4GR1A 4REKA 5FS7A 3AD9B 2XFNA 4YSYA 1ZY8A 2XLUA 3NK2X 4H4WA 5J7XA 3AE4A 2B7SA 3M0OA 1NHQA 4GRTA 3SYIA 2WBAA 5U25A 1N1PA 2YLTA 3T2KA 1CL0A 1GESA 3P4RA 2ZBWA 3RP6A 2Z5XA 2EQ7A 4CY6A 1IUWA 3AD8B 4NNJA 2EQ6A 4CRTA 1Q9IA 2BS3A 3HYXA 3IC9A 2VVLA 1GRAA 3NN0X 2CVJA 3BNMA 5U1OA 3CTYA 1ZKQA 2WOVA 4GCMA 4GAPA 2V3BA 1B37A 4HB9A 3CMMA 1L0VA 3KLJA 5EB5A 4YT0A 5BRTA 1FCDA 4OCGA 2R0PA 3IWAA 3QFBA 1PJ6A 4JNQA 2QAEA 2Q0KA 3SZFA 1GXFA 1GETA 4GDPA 2YVFA 4RG3A 1MXTA 3AE7A 4LA1A 2YQUA 1TYTA 4AP1A 2YG6A 3BI2A 3UP5A 3VRAA 2WESA 2WDQA 3GDPA 3ISHA 1CC6A 1NPXA 3NG7X 4II3A 1ZMDA 4EIQA 3UTFA 1BZLA 1L9CA 2JB2A 1GTEA 1EL7A 1PXBA 1RSGA 4NTDA 5FMHA 2OLOA 4YTMA 2VZ2A 4UDPA 3SZCA 3I3LA 3S61A 4YTNA 3NIXA 1L9DA 5JCKA 4IA5A 1GSNA 1KSUA 3NT6A 4BURA 2R46A 3UKQA 3KPKA 3K7TA 2ZZ0A 1CC2A 2R4EA 4Y4MA 3ABVA 2WOIA 3EF6A 3UKPA 3GWFA 3P9UA 4U2SA 5JCLA 3GMCA 2AAQA 1DOBA 1N4VA 1TDKA 1HYUA 3G5RA 1D4CA 2EQ9A 3I6DA 5IPYA 4ADWA 4NTEA 1K4QA 1E1LA 2WP6A 3CN8A 1QLBA 3IF9A 2BXRA 3FBSA 4JY2A 4ECHA 2Q0LA 3CNJA 2Y6RA 2C75A 4G6HA 5J60A 1K0IA 4B1BA 2BABA 1LTXR 4NZHA 4M52A 3D1CA 4APNA 2V5ZA 1MO9A 3PS9A 2FJBA 2XVEA 1GRGA 3OZ2A 2BC1A 3P4QA 4JDRA 4TM0A 1F3PA 2BA9A 2OA1A 3ALMA 4OPLA 2WDRA 3M13A 5JCMA 1E1MA 3KVEA 4USRA 3LJPA 1PBDA 1GRBA 2HQMA 1DXLA 1KNPA 2XFOA 4J57A 2GR2A 2GEWA 1PDHA 3SQPA 3NTDA 1N4WA 3NKSA 4H4UA 4C5OA 2YG5A 1DODA 1ZK7A 4PAAA 4OPGA 3P1WA 2XCGA 3GMBA 4FX9A 4EMWA 2JK6A 5M10A 4X9MA 1GRTA 1JRYA 3AEAA 2XLPA 3SX6A 2BK3A 3LZWA 3QSMA 1E1NA 3H8IA 2VRLA 4RSLA 2DKIA 4YSZA 1KDGA 2CDUA 2XFUA 2XVFA 1FEBA 2WPEA 3AE8A 2X8HA 4C3XA 4Z44A 1JRZA 1GPEA 2BS2A 2GV8A 2GF3A 3QFAA 4YWOA 3ZYXA 2I0ZA 2WOWA 1IJHA 2YWLA 1JOAA 1CJ4A 1D4EA 4X4JA 5BULA 2PHHA 1XPQA 4H4TA 2ZZBA 4BK2A 2C3DA 3NTAA 2GAHB 3DK9A 1W4XA 4K7ZA 2GB0A 5BUKA 3AWIA 4H2QA 3NYEA 1BF3A 3ZDNA 2YR5A 1GALA 1PBCA 3K7MX 4A99A 3NRNA 4RG4A 5KOWA 3BHKA 4DNAA 1XHCA 2XFPA 3QSEA 2OAMA 4KX6A 2BK4A 2R9ZA 3WE0A 4A65A 2B76A 3FMWA 1BWCA 4U8JA 3V76A 1KFYA 3G5QA 3GYIA 3NYCA 2JAEA 4U8MA 3VR8A 4J56A 4O5QA 4A7AA 4NWZA 1H82A 4Z2TA 1E1KA 3GD3A 3K7QX 4OVIA 2GMHA 1CF3A 2WDVA 2F5ZA 2IVDA 4A5LA 1AOGA 1DNCA 1ZP0A 3G5SA 2W0HA 2YLXA 4J36A 3GD4A 3R9UA 1PHHA 3ICTA 4EMJA 4UDQA 3T2ZA 4C3YA 3SZ0A 2VOUA 3DH9A 3SGLA 3DGZA 4BK1A 1N4UA 3FG2P 3ICSA 2A87A 1O94A 3HZLA 3EANA 3ITJA 2V3AA 1GV4A 5IQ4A 5JCIA 2WEUA 2YLZA 1V59A 3DMEA 2GR1A 4I58A 3KU9A 5FS8A 2R45A 3AEFA 5KWFA 3AYIA 2WU5A 3BI5A 2GRTA 4IA6A 3VQRA 3UCLA 3O0HA 1NHPA 1OJTA 3QVRA 4GAVA 4J34A 2XFQA 3B6DA 3IHMA 4BJZA 4I59A 1GTHA 4AOSA 3V3NA 2GH5A 3UP4A 1Y0PA 4FK1A 2BCGG 2PYXA 2X50A 2FJDA 1Z6LA 2WP5A 2X8GA 1LV0A 2E5VA 1IUXA 1QO8A 3P4PA 4II2A 3CGDA 2WHDA 4H4XA 2R0CA 3HYVA 4GDEA 5KNLA 5KMQA 4EM4A 1REOA 2Y6QA 1TDEA 3ALJA 4OPUA 1VG0A 2BYBA 2YAUA 1F8WA 3NLCA 5M0ZA 4C77A 1XANA 1XDIA 2GR3A 2ACZA 1LVLA 4FDCB 1D4DA 2VVMA 1TDFA 1KSSA 3AE9A 2BACA 3ICRA 5KMSA 2XDOA 3KA7A 4YKFA 3VR9A 4Y4LA 4DSGA 2Z5YA 3NN6X 2YM2A 3H4KA 2GAGB 1Y56A 2IIDA 4Z43A 3AEGA 3GRTA 5HHFA 4LIIA 2RGHA 3CGBA 1H6VA 1K0LA 4WCTA 3L1RA 1GNDA 1FL2A 1ZDLA 2XLRA 1NAAA 4H2PA 5EB4A 5CQFA 2FBWA 3F8RA 4HA6A 1PXAA 2YLRA 1E39A 2C70A 4EQSA 2Q6UA 1PBBA 2YR6A 2WP9A 2YM1A 3T2YA 4EIPA 4Y4NA 2C4CA 2TMDA 3UKHA 1ONFA 1F6MA 5DBJA 3REDA 3UOYA 1H7WA 3UTEA 4A6NA 4AP3A 4BV6A 2H88A 1P2HA 5KMPA 1M6IA 2C64A 2NVKX 3RNMA 2XVIA 4TM3A 3VRDB 5FS6A 4DSHA 4YSXA 2DKHA 3UTHA 4EMIA 5BVAA 1TRBA 3DJGX 3E1TA 4OPCA 4CNKA 5IQ1A 2APGA 2XYOA 3AE1A 1DJNA 1EL9A 4USQA 1IUTA 3AD7B 3CPIG 2WS3A 4PABA 1NG3A 3FIMB 2H89A 4K22A 3DJDA 1FEAA 1NENA 3DK8A 4G6GA 2GR0A 3BHFA 3ADAB 3COXA 2YR4A 3H8LA 3GYXA
chains in the Genus database with same CATH topology
1YQZA 4X9NA 4H7UA 4G9KA 3EAOA 1TYPA 1K0JA 1H84A 2C76A 1FOHA 3KKJA 2X3NA 1B8SA 3CGEA 3GRSA 4BK3A 3UKLA 4Z2UA 3JSKA 2JBVA 1NHRA 3QVPA 2B9XA 2J3NA 1B5QA 1GOSA 3T37A 2R4JA 5EOWA 1OJAA 1S3EA 4BJYA 1GREA 2V61A 2V6OA 3RHAA 4CBQA 1LQUA 3D8XA 2WU2A 3HYWA 1ZOVA 4OPDA 1ELIA 3KD9A 2YVGA 1YQ4A 3BNUA 3RP7A 3VRBA 2XVJA 4TM4A 1P2EA 2RGOA 1S2YA 1NG4A 3PVCA 3T14A 5KOXA 5HXIA 1F8SA 2ZZCA 1EL8A 2BK5A 4NTCA 1LPFA 1PS9A 3GDNA 3UKKA 4U2TA 4AOXA 3ALLA 4B67A 3L8KA 3UOZA 5CKUA 3PO7A 2VVLG 4U8NA 1Y56B 1KNRA 2XLTA 3NK0X 2C67A 2RGJA 3NYFA 4B66A 4Z2RA 4CNJA 2CFYA 1YKJA 3OC4A 1D7YA 1F8RA 2YG3A 3GWDA 1COYA 4U8KA 3LXDA 1ZX9A 3AE2A 3NH3X 2Q7VA 2C66A 3C4NA 2YG4A 1D7LA 4CCQA 2VQBA 3T0KA 2C73A 3UTGA 3CNSA 3CGCA 2X8CA 4YSHA 3II4A 3AEEA 1GEUA 1VRQB 3F8PA 4XWRA 3SFEA 4TLZA 4Z25A 1CJ3A 1EL5A 1L9EA 3DJEA 4A6NB 1E7PA 4H4SA 1DOEA 5FS9A 3S5WA 4B65A 3URHA 2AR8A 1IUUA 3LOVA 4KPRA 1S2QA 4ZN0A 2BXSA 2JKCA 2QA1A 2YLWA 4H4PA 1OJCA 3V3OA 2JB1A 2WETA 4CCRA 4A79A 1FECA 2C7GA 4J2WA 4A9WA 1OJ9A 3F8DA 4CY8A 1TDNA 2BRAA 2XLSA 3AXBA 4K8DA 4O5UA 5TR3A 3SXIA 4ICYA 2E1MA 2YG7A 1X31B 1CC4A 2ARDA 1H7XA 4EQWA 3LADA 1KF6A 1CHUA 3AYLA 3ATQA 2R0GA 3AE5A 3NGCX 4GF7A 2UZZA 2GVCA 4NEVA 1MOKA 3B3RA 4K5RA 4YXDA 1S3BA 3SY4A 2B7RA 4U8PA 1CJCA 4K5SA 1D5TA 3AE6A 2B9WA 1TDOA 1GERA 4G74A 4K2XA 1LQTA 4MJWA 4NEWA 4ZCCA 5KVIA 4TLXA 3Q9TA 1PJ5A 4C74A 1RYIA 3AECA 3T31A 5JCNA 4P9SA 3C96A 3AB1A 3UOXA 1Q1RA 3K30A 2CULA 2GQFA 4B68A 4JNAA 4B69A 5LV9A 3AE3A 4UDRA 1DJQA 1JNRA 3AEDA 2OALA 4AT0A 4H50A 3GYJA 4WX1A 3CNPA 1YY5A 1ZOYA 1JRXA 3UKFA 2NPXA 1RP0A 1BKWA 2BCPA 1E6EA 3M12A 2B9YA 2QCUA 3UKAA 2VQ7A 2E4GA 1GRFA 1PBFA 3DGHA 2YVJA 1CBOA 1EBDA 2A8XA 2FJEA 4GUVA 4U8IA 5ER0A 4EQXA 4IVMB 4YKGA 3QJ4A 1YQ3A 5KXJA 1BGJA 5C2TA 1O5WA 1PBEA 4H4VA 1Q1WA 4JN9A 1H81A 2X99A 3DA1A 3LZXA 4EM3A 4JQ9A 3CNDA 4N9XA 5KVHA 4XWZA 4H4RA 1LJ1A 1QJDA 2WPCA 1NDAA 2AQJA 2C65A 4U2LA 1JEHA 3KPFA 1JNZA 3SM8A 1CJ2A 2A89A 3FPZA 4D04A 1OJDA 1B4VA 4Z26A 1H83A 4JY3A 4OPIA 1NEKA 1IUSA 2GQWA 3LB8A 4U8OA 4EQRA 5KRQA 4OPTA 3GSIA 2OLNA 3EPTA 2O9ZA 4H4YA 4J31A 1VDCA 2WPFA 2WQYA 4IV9A 5HYMA 4LU6A 3UOVA 1GRHA 2QA2A 2V60A 3AYJA 1PJ7A 4IVOB 4TM1A 1IUVA 2GMJA 3NNEA 4B63A 4H4QA 3RP8A 4E0VA 1M64A 4DGKA 2YLSA 4YTPA 1H86A 4G73A 5L46A 3DJJA 3QSSA 2BC0A 4H2NA 4B64A 3CNTA 1GT8A 3BI4A 1VQWA 3C4AA 5U63A 1VG9A 5KMRA 4XXGA 3SFDA 4H4ZA 1SEZA 2FJAA 3NHOX 2VRMA 1UKVG 2BRYA 3ATRA 1PXCA 5C3JA 2BS4A 4U8LA 4FK1C 1ZMCA 2C3CA 3NK1X 3DK4A 5GSNA 4Z24A 3CPHG 4AT2A 1DOCA 4H2RA 4UP3A 2IVEA 4ZCDA 3CPJG 4J33A 2C72A 1BGNA 5HY5A 1JU2A 3P4SA 3SZWA 5GRTA 2EQ8A 1O95A 5EBKA 4D03A 1NHSA 1PN0A 2TPRA 2JB3A 3Q6JA 3CIRA 2RABA 3AEBA 3IHGA 2XVHA 4GR1A 4REKA 5FS7A 3AD9B 2XFNA 4YSYA 1ZY8A 2XLUA 3NK2X 4H4WA 5J7XA 3AE4A 2B7SA 3M0OA 1NHQA 4GRTA 3SYIA 2WBAA 5U25A 1N1PA 2YLTA 3T2KA 1CL0A 1GESA 3P4RA 2ZBWA 3RP6A 2Z5XA 2EQ7A 4CY6A 1IUWA 3AD8B 4NNJA 2EQ6A 4CRTA 1Q9IA 2BS3A 3HYXA 3IC9A 2VVLA 1GRAA 3NN0X 2CVJA 3BNMA 5U1OA 3CTYA 1ZKQA 2WOVA 4GCMA 4GAPA 2V3BA 1B37A 4HB9A 3CMMA 1L0VA 3KLJA 5EB5A 4YT0A 5BRTA 1FCDA 4OCGA 2R0PA 3IWAA 3QFBA 1PJ6A 4JNQA 2QAEA 2Q0KA 3SZFA 1GXFA 1GETA 4GDPA 2YVFA 4RG3A 1MXTA 3AE7A 4LA1A 2YQUA 1TYTA 4AP1A 2YG6A 3BI2A 3UP5A 3VRAA 2WESA 2WDQA 3GDPA 3ISHA 1CC6A 1NPXA 3NG7X 4II3A 1ZMDA 4EIQA 3UTFA 1BZLA 1L9CA 2JB2A 1GTEA 1EL7A 1PXBA 1RSGA 4NTDA 5FMHA 2OLOA 4YTMA 2VZ2A 4UDPA 3SZCA 3I3LA 3S61A 4YTNA 3NIXA 1L9DA 5JCKA 4IA5A 1GSNA 1KSUA 3NT6A 4BURA 2R46A 3UKQA 3KPKA 3K7TA 2ZZ0A 1CC2A 2R4EA 4Y4MA 3ABVA 2WOIA 3EF6A 3UKPA 3GWFA 3P9UA 4U2SA 5JCLA 3GMCA 2AAQA 1DOBA 1N4VA 1TDKA 1HYUA 3G5RA 1D4CA 2EQ9A 3I6DA 5IPYA 4ADWA 4NTEA 1K4QA 1E1LA 2WP6A 3CN8A 1QLBA 3IF9A 2BXRA 3FBSA 4JY2A 4ECHA 2Q0LA 3CNJA 2Y6RA 2C75A 4G6HA 5J60A 1K0IA 4B1BA 2BABA 1LTXR 4NZHA 4M52A 3D1CA 4APNA 2V5ZA 1MO9A 3PS9A 2FJBA 2XVEA 1GRGA 3OZ2A 2BC1A 3P4QA 4JDRA 4TM0A 1F3PA 2BA9A 2OA1A 3ALMA 4OPLA 2WDRA 3M13A 5JCMA 1E1MA 3KVEA 4USRA 3LJPA 1PBDA 1GRBA 2HQMA 1DXLA 1KNPA 2XFOA 4J57A 2GR2A 2GEWA 1PDHA 3SQPA 3NTDA 1N4WA 3NKSA 4H4UA 4C5OA 2YG5A 1DODA 1ZK7A 4PAAA 4OPGA 3P1WA 2XCGA 3GMBA 4FX9A 4EMWA 2JK6A 5M10A 4X9MA 1GRTA 1JRYA 3AEAA 2XLPA 3SX6A 2BK3A 3LZWA 3QSMA 1E1NA 3H8IA 2VRLA 4RSLA 2DKIA 4YSZA 1KDGA 2CDUA 2XFUA 2XVFA 1FEBA 2WPEA 3AE8A 2X8HA 4C3XA 4Z44A 1JRZA 1GPEA 2BS2A 2GV8A 2GF3A 3QFAA 4YWOA 3ZYXA 2I0ZA 2WOWA 1IJHA 2YWLA 1JOAA 1CJ4A 1D4EA 4X4JA 5BULA 2PHHA 1XPQA 4H4TA 2ZZBA 4BK2A 2C3DA 3NTAA 2GAHB 3DK9A 1W4XA 4K7ZA 2GB0A 5BUKA 3AWIA 4H2QA 3NYEA 1BF3A 3ZDNA 2YR5A 1GALA 1PBCA 3K7MX 4A99A 3NRNA 4RG4A 5KOWA 3BHKA 4DNAA 1XHCA 2XFPA 3QSEA 2OAMA 4KX6A 2BK4A 2R9ZA 3WE0A 4A65A 2B76A 3FMWA 1BWCA 4U8JA 3V76A 1KFYA 3G5QA 3GYIA 3NYCA 2JAEA 4U8MA 3VR8A 4J56A 4O5QA 4A7AA 4NWZA 1H82A 4Z2TA 1E1KA 3GD3A 3K7QX 4OVIA 2GMHA 1CF3A 2WDVA 2F5ZA 2IVDA 4A5LA 1AOGA 1DNCA 1ZP0A 3G5SA 2W0HA 2YLXA 4J36A 3GD4A 3R9UA 1PHHA 3ICTA 4EMJA 4UDQA 3T2ZA 4C3YA 3SZ0A 2VOUA 3DH9A 3SGLA 3DGZA 4BK1A 1N4UA 3FG2P 3ICSA 2A87A 1O94A 3HZLA 3EANA 3ITJA 2V3AA 1GV4A 5IQ4A 5JCIA 2WEUA 2YLZA 1V59A 3DMEA 2GR1A 4I58A 3KU9A 5FS8A 2R45A 3AEFA 5KWFA 3AYIA 2WU5A 3BI5A 2GRTA 4IA6A 3VQRA 3UCLA 3O0HA 1NHPA 1OJTA 3QVRA 4GAVA 4J34A 2XFQA 3B6DA 3IHMA 4BJZA 4I59A 1GTHA 4AOSA 3V3NA 2GH5A 3UP4A 1Y0PA 4FK1A 2BCGG 2PYXA 2X50A 2FJDA 1Z6LA 2WP5A 2X8GA 1LV0A 2E5VA 1IUXA 1QO8A 3P4PA 4II2A 3CGDA 2WHDA 4H4XA 2R0CA 3HYVA 4GDEA 5KNLA 5KMQA 4EM4A 1REOA 2Y6QA 1TDEA 3ALJA 4OPUA 1VG0A 2BYBA 2YAUA 1F8WA 3NLCA 5M0ZA 4C77A 1XANA 1XDIA 2GR3A 2ACZA 1LVLA 4FDCB 1D4DA 2VVMA 1TDFA 1KSSA 3AE9A 2BACA 3ICRA 5KMSA 2XDOA 3KA7A 4YKFA 3VR9A 4Y4LA 4DSGA 2Z5YA 3NN6X 2YM2A 3H4KA 2GAGB 1Y56A 2IIDA 4Z43A 3AEGA 3GRTA 5HHFA 4LIIA 2RGHA 3CGBA 1H6VA 1K0LA 4WCTA 3L1RA 1GNDA 1FL2A 1ZDLA 2XLRA 1NAAA 4H2PA 5EB4A 5CQFA 2FBWA 3F8RA 4HA6A 1PXAA 2YLRA 1E39A 2C70A 4EQSA 2Q6UA 1PBBA 2YR6A 2WP9A 2YM1A 3T2YA 4EIPA 4Y4NA 2C4CA 2TMDA 3UKHA 1ONFA 1F6MA 5DBJA 3REDA 3UOYA 1H7WA 3UTEA 4A6NA 4AP3A 4BV6A 2H88A 1P2HA 5KMPA 1M6IA 2C64A 2NVKX 3RNMA 2XVIA 4TM3A 3VRDB 5FS6A 4DSHA 4YSXA 2DKHA 3UTHA 4EMIA 5BVAA 1TRBA 3DJGX 3E1TA 4OPCA 4CNKA 5IQ1A 2APGA 2XYOA 3AE1A 1DJNA 1EL9A 4USQA 1IUTA 3AD7B 3CPIG 2WS3A 4PABA 1NG3A 3FIMB 2H89A 4K22A 3DJDA 1FEAA 1NENA 3DK8A 4G6GA 2GR0A 3BHFA 3ADAB 3COXA 2YR4A 3H8LA 3GYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQZ A;  4X9N A;  4H7U A;  3EAO A;  1TYP A;  1K0J A;  1H84 A;  2C76 A;  1FOH A;  3KKJ A;  2X3N A;  1B8S A;  3CGE A;  3GRS A;  4BK3 A;  3UKL A;  4Z2U A;  3JSK A;  2JBV A;  1NHR A;  3QVP A;  2B9X A;  2J3N A;  1B5Q A;  1GOS A;  3T37 A;  2R4J A;  5EOW A;  1OJA A;  1S3E A;  4BJY A;  1GRE A;  2V61 A;  2V6O A;  3RHA A;  4CBQ A;  1LQU A;  3D8X A;  2WU2 A;  1ZOV A;  4OPD A;  1ELI A;  3KD9 A;  2YVG A;  1YQ4 A;  3BNU A;  3RP7 A;  3VRB A;  2XVJ A;  4TM4 A;  1P2E A;  2RGO A;  1S2Y A;  1NG4 A;  3PVC A;  5KOX A;  5HXI A;  1F8S A;  2ZZC A;  1EL8 A;  2BK5 A;  4NTC A;  1LPF A;  1PS9 A;  3GDN A;  3UKK A;  4U2T A;  4AOX A;  3ALL A;  4B67 A;  3L8K A;  3UOZ A;  5CKU A;  3PO7 A;  2VVL G;  4U8N A;  1Y56 B;  1KNR A;  2XLT A;  3NK0 X;  2C67 A;  2RGJ A;  3NYF A;  4B66 A;  4Z2R A;  4CNJ A;  2CFY A;  1YKJ A;  3OC4 A;  1D7Y A;  1F8R A;  2YG3 A;  3GWD A;  1COY A;  4U8K A;  3LXD A;  1ZX9 A;  3AE2 A;  3NH3 X;  2Q7V A;  2C66 A;  3C4N A;  2YG4 A;  1D7L A;  4CCQ A;  2VQB A;  2C73 A;  3UTG A;  3CNS A;  3CGC A;  2X8C A;  4YSH A;  3II4 A;  3AEE A;  1GEU A;  1VRQ B;  3F8P A;  4XWR A;  3SFE A;  4TLZ A;  4Z25 A;  1CJ3 A;  1EL5 A;  1L9E A;  3DJE A;  4A6N B;  1E7P A;  4H4S A;  1DOE A;  5FS9 A;  3S5W A;  4B65 A;  3URH A;  2AR8 A;  1IUU A;  3LOV A;  4KPR A;  1S2Q A;  4ZN0 A;  2BXS A;  2JKC A;  2QA1 A;  2YLW A;  4H4P A;  1OJC A;  3V3O A;  2JB1 A;  2WET A;  4CCR A;  4A79 A;  1FEC A;  2C7G A;  4J2W A;  4A9W A;  1OJ9 A;  3F8D A;  4CY8 A;  1TDN A;  2XLS A;  3AXB A;  4K8D A;  4O5U A;  5TR3 A;  4ICY A;  2E1M A;  2YG7 A;  1X31 B;  1CC4 A;  2ARD A;  1H7X A;  4EQW A;  3LAD A;  1KF6 A;  1CHU A;  3AYL A;  3ATQ A;  2R0G A;  3AE5 A;  3NGC X;  4GF7 A;  2UZZ A;  2GVC A;  4NEV A;  1MOK A;  3B3R A;  4K5R A;  4YXD A;  1S3B A;  2B7R A;  4U8P A;  1CJC A;  4K5S A;  1D5T A;  3AE6 A;  2B9W A;  1TDO A;  1GER A;  4K2X A;  4MJW A;  1LQT A;  4NEW A;  4ZCC A;  5KVI A;  4TLX A;  3Q9T A;  1PJ5 A;  4C74 A;  1RYI A;  3AEC A;  5JCN A;  4P9S A;  3C96 A;  3AB1 A;  3UOX A;  1Q1R A;  3K30 A;  2CUL A;  2GQF A;  4B68 A;  4JNA A;  4B69 A;  5LV9 A;  3AE3 A;  4UDR A;  1DJQ A;  1JNR A;  3AED A;  2OAL A;  4AT0 A;  4H50 A;  3GYJ A;  4WX1 A;  3CNP A;  1YY5 A;  1ZOY A;  1JRX A;  3UKF A;  2NPX A;  1RP0 A;  1BKW A;  2BCP A;  1E6E A;  3M12 A;  2B9Y A;  2QCU A;  3UKA A;  2VQ7 A;  2E4G A;  1GRF A;  1PBF A;  3DGH A;  2YVJ A;  1CBO A;  1EBD A;  2A8X A;  2FJE A;  4GUV A;  4U8I A;  5ER0 A;  4EQX A;  4IVM B;  4YKG A;  3QJ4 A;  1YQ3 A;  5KXJ A;  1BGJ A;  5C2T A;  1O5W A;  1PBE A;  4H4V A;  1Q1W A;  4JN9 A;  1H81 A;  2X99 A;  3DA1 A;  3LZX A;  4EM3 A;  4JQ9 A;  3CND A;  4N9X A;  5KVH A;  4XWZ A;  4H4R A;  1LJ1 A;  1QJD A;  2WPC A;  1NDA A;  2AQJ A;  2C65 A;  4U2L A;  1JEH A;  3KPF A;  1JNZ A;  3SM8 A;  1CJ2 A;  2A89 A;  3FPZ A;  4D04 A;  1OJD A;  1B4V A;  4Z26 A;  1H83 A;  4JY3 A;  4OPI A;  1NEK A;  1IUS A;  2GQW A;  3LB8 A;  4U8O A;  4EQR A;  5KRQ A;  4OPT A;  3GSI A;  2OLN A;  3EPT A;  2O9Z A;  4H4Y A;  4J31 A;  1VDC A;  2WPF A;  2WQY A;  4IV9 A;  5HYM A;  4LU6 A;  3UOV A;  1GRH A;  2QA2 A;  2V60 A;  3AYJ A;  1PJ7 A;  4IVO B;  4TM1 A;  1IUV A;  2GMJ A;  3NNE A;  4B63 A;  4H4Q A;  3RP8 A;  4E0V A;  1M64 A;  4DGK A;  2YLS A;  4YTP A;  1H86 A;  5L46 A;  3DJJ A;  3QSS A;  2BC0 A;  4H2N A;  4B64 A;  3CNT A;  1GT8 A;  3BI4 A;  1VQW A;  3C4A A;  5U63 A;  1VG9 A;  4XXG A;  3SFD A;  4H4Z A;  1SEZ A;  2FJA A;  3NHO X;  2VRM A;  1UKV G;  3ATR A;  1PXC A;  5C3J A;  2BS4 A;  4U8L A;  4FK1 C;  1ZMC A;  2C3C A;  3NK1 X;  3DK4 A;  5GSN A;  4Z24 A;  3CPH G;  4AT2 A;  1DOC A;  4H2R A;  4UP3 A;  2IVE A;  4ZCD A;  3CPJ G;  4J33 A;  2C72 A;  1BGN A;  5HY5 A;  1JU2 A;  3P4S A;  5GRT A;  2EQ8 A;  1O95 A;  5EBK A;  4D03 A;  1NHS A;  1PN0 A;  2TPR A;  2JB3 A;  3Q6J A;  3CIR A;  2RAB A;  3AEB A;  3IHG A;  2XVH A;  4GR1 A;  4REK A;  5FS7 A;  3AD9 B;  2XFN A;  4YSY A;  1ZY8 A;  2XLU A;  3NK2 X;  4H4W A;  5J7X A;  3AE4 A;  2B7S A;  3M0O A;  1NHQ A;  4GRT A;  2WBA A;  5U25 A;  1N1P A;  2YLT A;  1CL0 A;  1GES A;  3P4R A;  2ZBW A;  3RP6 A;  2Z5X A;  2EQ7 A;  4CY6 A;  1IUW A;  3AD8 B;  2EQ6 A;  4CRT A;  1Q9I A;  2BS3 A;  3IC9 A;  2VVL A;  1GRA A;  3NN0 X;  2CVJ A;  3BNM A;  5U1O A;  3CTY A;  1ZKQ A;  2WOV A;  4GCM A;  2V3B A;  1B37 A;  4HB9 A;  1L0V A;  3KLJ A;  5EB5 A;  4YT0 A;  5BRT A;  1FCD A;  4OCG A;  2R0P A;  3IWA A;  3QFB A;  1PJ6 A;  4JNQ A;  2QAE A;  2Q0K A;  1GXF A;  1GET A;  4GDP A;  2YVF A;  4RG3 A;  1MXT A;  3AE7 A;  4LA1 A;  2YQU A;  1TYT A;  4AP1 A;  2YG6 A;  3BI2 A;  3UP5 A;  3VRA A;  2WES A;  2WDQ A;  3GDP A;  3ISH A;  1CC6 A;  1NPX A;  3NG7 X;  1ZMD A;  4EIQ A;  3UTF A;  1BZL A;  1L9C A;  2JB2 A;  1GTE A;  1EL7 A;  1PXB A;  1RSG A;  4NTD A;  5FMH A;  2OLO A;  4YTM A;  2VZ2 A;  4UDP A;  4YTN A;  3I3L A;  3S61 A;  3NIX A;  1L9D A;  5JCK A;  4IA5 A;  1GSN A;  1KSU A;  3NT6 A;  4BUR A;  2R46 A;  3UKQ A;  3K7T A;  2ZZ0 A;  1CC2 A;  2R4E A;  4Y4M A;  3ABV A;  2WOI A;  3EF6 A;  3UKP A;  3GWF A;  3P9U A;  4U2S A;  5JCL A;  3GMC A;  2AAQ A;  1DOB A;  1N4V A;  1TDK A;  1HYU A;  3G5R A;  1D4C A;  2EQ9 A;  3I6D A;  5IPY A;  4ADW A;  4NTE A;  1K4Q A;  1E1L A;  2WP6 A;  3CN8 A;  1QLB A;  3IF9 A;  2BXR A;  3FBS A;  4JY2 A;  4ECH A;  2Q0L A;  3CNJ A;  2Y6R A;  2C75 A;  5J60 A;  1K0I A;  4B1B A;  2BAB A;  1LTX R;  4NZH A;  4M52 A;  3D1C A;  4APN A;  2V5Z A;  1MO9 A;  3PS9 A;  2FJB A;  2XVE A;  1GRG A;  3OZ2 A;  2BC1 A;  3P4Q A;  4JDR A;  4TM0 A;  1F3P A;  2BA9 A;  2OA1 A;  3ALM A;  4OPL A;  2WDR A;  3M13 A;  5JCM A;  1E1M A;  3KVE A;  4USR A;  3LJP A;  1PBD A;  1GRB A;  2HQM A;  1DXL A;  1KNP A;  2XFO A;  4J57 A;  2GR2 A;  2GEW A;  1PDH A;  3SQP A;  3NTD A;  1N4W A;  3NKS A;  4H4U A;  4C5O A;  2YG5 A;  1DOD A;  1ZK7 A;  4PAA A;  4OPG A;  3P1W A;  2XCG A;  3GMB A;  4FX9 A;  4EMW A;  2JK6 A;  5M10 A;  4X9M A;  1GRT A;  1JRY A;  3AEA A;  2XLP A;  2BK3 A;  3LZW A;  3QSM A;  1E1N A;  3H8I A;  2VRL A;  4RSL A;  2DKI A;  4YSZ A;  1KDG A;  2CDU A;  2XFU A;  2XVF A;  1FEB A;  2WPE A;  3AE8 A;  2X8H A;  4C3X A;  4Z44 A;  1JRZ A;  1GPE A;  2BS2 A;  2GV8 A;  2GF3 A;  3QFA A;  4YWO A;  3ZYX A;  2I0Z A;  2WOW A;  1IJH A;  2YWL A;  1JOA A;  1CJ4 A;  1D4E A;  4X4J A;  5BUL A;  2PHH A;  1XPQ A;  4H4T A;  2ZZB A;  4BK2 A;  2C3D A;  3NTA A;  2GAH B;  3DK9 A;  1W4X A;  4K7Z A;  2GB0 A;  5BUK A;  3AWI A;  4H2Q A;  3NYE A;  1BF3 A;  3ZDN A;  2YR5 A;  1GAL A;  1PBC A;  3K7M X;  4A99 A;  3NRN A;  4RG4 A;  5KOW A;  3BHK A;  4DNA A;  1XHC A;  2XFP A;  3QSE A;  2OAM A;  4KX6 A;  2BK4 A;  2R9Z A;  3WE0 A;  4A65 A;  2B76 A;  3FMW A;  1BWC A;  4U8J A;  3V76 A;  1KFY A;  3G5Q A;  3GYI A;  3NYC A;  2JAE A;  4U8M A;  3VR8 A;  4J56 A;  4O5Q A;  4A7A A;  1H82 A;  4Z2T A;  1E1K A;  3GD3 A;  3K7Q X;  4OVI A;  2GMH A;  1CF3 A;  2WDV A;  2F5Z A;  2IVD A;  4A5L A;  1AOG A;  1DNC A;  1ZP0 A;  3G5S A;  2W0H A;  2YLX A;  4J36 A;  3GD4 A;  3R9U A;  1PHH A;  3ICT A;  4EMJ A;  4UDQ A;  4C3Y A;  2VOU A;  3DH9 A;  3SGL A;  3DGZ A;  4BK1 A;  1N4U A;  3FG2 P;  3ICS A;  2A87 A;  1O94 A;  3HZL A;  3EAN A;  3ITJ A;  2V3A A;  1GV4 A;  5IQ4 A;  5JCI A;  2WEU A;  2YLZ A;  1V59 A;  3DME A;  2GR1 A;  4I58 A;  3KU9 A;  5FS8 A;  2R45 A;  3AEF A;  5KWF A;  3AYI A;  2WU5 A;  3BI5 A;  2GRT A;  4IA6 A;  3VQR A;  3UCL A;  3O0H A;  1NHP A;  1OJT A;  3QVR A;  4J34 A;  2XFQ A;  3B6D A;  3IHM A;  4BJZ A;  4I59 A;  1GTH A;  4AOS A;  3V3N A;  2GH5 A;  3UP4 A;  1Y0P A;  4FK1 A;  2BCG G;  2PYX A;  2X50 A;  2FJD A;  1Z6L A;  2WP5 A;  2X8G A;  1LV0 A;  2E5V A;  1IUX A;  1QO8 A;  3P4P A;  3CGD A;  2WHD A;  4H4X A;  2R0C A;  4GDE A;  4EM4 A;  1REO A;  2Y6Q A;  1TDE A;  3ALJ A;  4OPU A;  1VG0 A;  2BYB A;  2YAU A;  1F8W A;  3NLC A;  5M0Z A;  4C77 A;  1XAN A;  1XDI A;  2GR3 A;  2ACZ A;  1LVL A;  4FDC B;  1D4D A;  2VVM A;  1TDF A;  1KSS A;  3AE9 A;  2BAC A;  3ICR A;  2XDO A;  3KA7 A;  4YKF A;  3VR9 A;  4Y4L A;  4DSG A;  2Z5Y A;  3NN6 X;  2YM2 A;  3H4K A;  2GAG B;  1Y56 A;  2IID A;  4Z43 A;  3AEG A;  3GRT A;  5HHF A;  4LII A;  2RGH A;  3CGB A;  1H6V A;  1K0L A;  4WCT A;  3L1R A;  1GND A;  1FL2 A;  1ZDL A;  2XLR A;  1NAA A;  4H2P A;  5EB4 A;  5CQF A;  2FBW A;  3F8R A;  4HA6 A;  1PXA A;  2YLR A;  1E39 A;  2C70 A;  4EQS A;  2Q6U A;  1PBB A;  2YR6 A;  2WP9 A;  2YM1 A;  4EIP A;  4Y4N A;  2TMD A;  3UKH A;  1ONF A;  1F6M A;  5DBJ A;  3RED A;  3UOY A;  1H7W A;  3UTE A;  4A6N A;  4AP3 A;  4BV6 A;  2H88 A;  1P2H A;  1M6I A;  2C64 A;  2NVK X;  3RNM A;  2XVI A;  4TM3 A;  3VRD B;  5FS6 A;  4DSH A;  4YSX A;  2DKH A;  3UTH A;  4EMI A;  5BVA A;  1TRB A;  3DJG X;  3E1T A;  4OPC A;  4CNK A;  5IQ1 A;  2APG A;  2XYO A;  3AE1 A;  1DJN A;  1EL9 A;  4USQ A;  1IUT A;  3AD7 B;  3CPI G;  2WS3 A;  4PAB A;  1NG3 A;  3FIM B;  2H89 A;  4K22 A;  3DJD A;  1FEA A;  1NEN A;  3DK8 A;  2GR0 A;  3BHF A;  3ADA B;  3COX A;  2YR4 A;  3H8L A; 
#chains in the Genus database with same CATH topology
 1YQZ A;  4X9N A;  4H7U A;  4G9K A;  3EAO A;  1TYP A;  1K0J A;  1H84 A;  2C76 A;  1FOH A;  3KKJ A;  2X3N A;  1B8S A;  3CGE A;  3GRS A;  4BK3 A;  3UKL A;  4Z2U A;  3JSK A;  2JBV A;  1NHR A;  3QVP A;  2B9X A;  2J3N A;  1B5Q A;  1GOS A;  3T37 A;  2R4J A;  5EOW A;  1OJA A;  1S3E A;  4BJY A;  1GRE A;  2V61 A;  2V6O A;  3RHA A;  4CBQ A;  1LQU A;  3D8X A;  2WU2 A;  3HYW A;  1ZOV A;  4OPD A;  1ELI A;  3KD9 A;  2YVG A;  1YQ4 A;  3BNU A;  3RP7 A;  3VRB A;  2XVJ A;  4TM4 A;  1P2E A;  2RGO A;  1S2Y A;  1NG4 A;  3PVC A;  3T14 A;  5KOX A;  5HXI A;  1F8S A;  2ZZC A;  1EL8 A;  2BK5 A;  4NTC A;  1LPF A;  1PS9 A;  3GDN A;  3UKK A;  4U2T A;  4AOX A;  3ALL A;  4B67 A;  3L8K A;  3UOZ A;  5CKU A;  3PO7 A;  2VVL G;  4U8N A;  1Y56 B;  1KNR A;  2XLT A;  3NK0 X;  2C67 A;  2RGJ A;  3NYF A;  4B66 A;  4Z2R A;  4CNJ A;  2CFY A;  1YKJ A;  3OC4 A;  1D7Y A;  1F8R A;  2YG3 A;  3GWD A;  1COY A;  4U8K A;  3LXD A;  1ZX9 A;  3AE2 A;  3NH3 X;  2Q7V A;  2C66 A;  3C4N A;  2YG4 A;  1D7L A;  4CCQ A;  2VQB A;  3T0K A;  2C73 A;  3UTG A;  3CNS A;  3CGC A;  2X8C A;  4YSH A;  3II4 A;  3AEE A;  1GEU A;  1VRQ B;  3F8P A;  4XWR A;  3SFE A;  4TLZ A;  4Z25 A;  1CJ3 A;  1EL5 A;  1L9E A;  3DJE A;  4A6N B;  1E7P A;  4H4S A;  1DOE A;  5FS9 A;  3S5W A;  4B65 A;  3URH A;  2AR8 A;  1IUU A;  3LOV A;  4KPR A;  1S2Q A;  4ZN0 A;  2BXS A;  2JKC A;  2QA1 A;  2YLW A;  4H4P A;  1OJC A;  3V3O A;  2JB1 A;  2WET A;  4CCR A;  4A79 A;  1FEC A;  2C7G A;  4J2W A;  4A9W A;  1OJ9 A;  3F8D A;  4CY8 A;  1TDN A;  2BRA A;  2XLS A;  3AXB A;  4K8D A;  4O5U A;  5TR3 A;  3SXI A;  4ICY A;  2E1M A;  2YG7 A;  1X31 B;  1CC4 A;  2ARD A;  1H7X A;  4EQW A;  3LAD A;  1KF6 A;  1CHU A;  3AYL A;  3ATQ A;  2R0G A;  3AE5 A;  3NGC X;  4GF7 A;  2UZZ A;  2GVC A;  4NEV A;  1MOK A;  3B3R A;  4K5R A;  4YXD A;  1S3B A;  3SY4 A;  2B7R A;  4U8P A;  1CJC A;  4K5S A;  1D5T A;  3AE6 A;  2B9W A;  1TDO A;  1GER A;  4G74 A;  4K2X A;  1LQT A;  4MJW A;  4NEW A;  4ZCC A;  5KVI A;  4TLX A;  3Q9T A;  1PJ5 A;  4C74 A;  1RYI A;  3AEC A;  3T31 A;  5JCN A;  4P9S A;  3C96 A;  3AB1 A;  3UOX A;  1Q1R A;  3K30 A;  2CUL A;  2GQF A;  4B68 A;  4JNA A;  4B69 A;  5LV9 A;  3AE3 A;  4UDR A;  1DJQ A;  1JNR A;  3AED A;  2OAL A;  4AT0 A;  4H50 A;  3GYJ A;  4WX1 A;  3CNP A;  1YY5 A;  1ZOY A;  1JRX A;  3UKF A;  2NPX A;  1RP0 A;  1BKW A;  2BCP A;  1E6E A;  3M12 A;  2B9Y A;  2QCU A;  3UKA A;  2VQ7 A;  2E4G A;  1GRF A;  1PBF A;  3DGH A;  2YVJ A;  1CBO A;  1EBD A;  2A8X A;  2FJE A;  4GUV A;  4U8I A;  5ER0 A;  4EQX A;  4IVM B;  4YKG A;  3QJ4 A;  1YQ3 A;  5KXJ A;  1BGJ A;  5C2T A;  1O5W A;  1PBE A;  4H4V A;  1Q1W A;  4JN9 A;  1H81 A;  2X99 A;  3DA1 A;  3LZX A;  4EM3 A;  4JQ9 A;  3CND A;  4N9X A;  5KVH A;  4XWZ A;  4H4R A;  1LJ1 A;  1QJD A;  2WPC A;  1NDA A;  2AQJ A;  2C65 A;  4U2L A;  1JEH A;  3KPF A;  1JNZ A;  3SM8 A;  1CJ2 A;  2A89 A;  3FPZ A;  4D04 A;  1OJD A;  1B4V A;  4Z26 A;  1H83 A;  4JY3 A;  4OPI A;  1NEK A;  1IUS A;  2GQW A;  3LB8 A;  4U8O A;  4EQR A;  5KRQ A;  4OPT A;  3GSI A;  2OLN A;  3EPT A;  2O9Z A;  4H4Y A;  4J31 A;  1VDC A;  2WPF A;  2WQY A;  4IV9 A;  5HYM A;  4LU6 A;  3UOV A;  1GRH A;  2QA2 A;  2V60 A;  3AYJ A;  1PJ7 A;  4IVO B;  4TM1 A;  1IUV A;  2GMJ A;  3NNE A;  4B63 A;  4H4Q A;  3RP8 A;  4E0V A;  1M64 A;  4DGK A;  2YLS A;  4YTP A;  1H86 A;  4G73 A;  5L46 A;  3DJJ A;  3QSS A;  2BC0 A;  4H2N A;  4B64 A;  3CNT A;  1GT8 A;  3BI4 A;  1VQW A;  3C4A A;  5U63 A;  1VG9 A;  5KMR A;  4XXG A;  3SFD A;  4H4Z A;  1SEZ A;  2FJA A;  3NHO X;  2VRM A;  1UKV G;  2BRY A;  3ATR A;  1PXC A;  5C3J A;  2BS4 A;  4U8L A;  4FK1 C;  1ZMC A;  2C3C A;  3NK1 X;  3DK4 A;  5GSN A;  4Z24 A;  3CPH G;  4AT2 A;  1DOC A;  4H2R A;  4UP3 A;  2IVE A;  4ZCD A;  3CPJ G;  4J33 A;  2C72 A;  1BGN A;  5HY5 A;  1JU2 A;  3P4S A;  3SZW A;  5GRT A;  2EQ8 A;  1O95 A;  5EBK A;  4D03 A;  1NHS A;  1PN0 A;  2TPR A;  2JB3 A;  3Q6J A;  3CIR A;  2RAB A;  3AEB A;  3IHG A;  2XVH A;  4GR1 A;  4REK A;  5FS7 A;  3AD9 B;  2XFN A;  4YSY A;  1ZY8 A;  2XLU A;  3NK2 X;  4H4W A;  5J7X A;  3AE4 A;  2B7S A;  3M0O A;  1NHQ A;  4GRT A;  3SYI A;  2WBA A;  5U25 A;  1N1P A;  2YLT A;  3T2K A;  1CL0 A;  1GES A;  3P4R A;  2ZBW A;  3RP6 A;  2Z5X A;  2EQ7 A;  4CY6 A;  1IUW A;  3AD8 B;  4NNJ A;  2EQ6 A;  4CRT A;  1Q9I A;  2BS3 A;  3HYX A;  3IC9 A;  2VVL A;  1GRA A;  3NN0 X;  2CVJ A;  3BNM A;  5U1O A;  3CTY A;  1ZKQ A;  2WOV A;  4GCM A;  4GAP A;  2V3B A;  1B37 A;  4HB9 A;  3CMM A;  1L0V A;  3KLJ A;  5EB5 A;  4YT0 A;  5BRT A;  1FCD A;  4OCG A;  2R0P A;  3IWA A;  3QFB A;  1PJ6 A;  4JNQ A;  2QAE A;  2Q0K A;  3SZF A;  1GXF A;  1GET A;  4GDP A;  2YVF A;  4RG3 A;  1MXT A;  3AE7 A;  4LA1 A;  2YQU A;  1TYT A;  4AP1 A;  2YG6 A;  3BI2 A;  3UP5 A;  3VRA A;  2WES A;  2WDQ A;  3GDP A;  3ISH A;  1CC6 A;  1NPX A;  3NG7 X;  4II3 A;  1ZMD A;  4EIQ A;  3UTF A;  1BZL A;  1L9C A;  2JB2 A;  1GTE A;  1EL7 A;  1PXB A;  1RSG A;  4NTD A;  5FMH A;  2OLO A;  4YTM A;  2VZ2 A;  4UDP A;  3SZC A;  3I3L A;  3S61 A;  4YTN A;  3NIX A;  1L9D A;  5JCK A;  4IA5 A;  1GSN A;  1KSU A;  3NT6 A;  4BUR A;  2R46 A;  3UKQ A;  3KPK A;  3K7T A;  2ZZ0 A;  1CC2 A;  2R4E A;  4Y4M A;  3ABV A;  2WOI A;  3EF6 A;  3UKP A;  3GWF A;  3P9U A;  4U2S A;  5JCL A;  3GMC A;  2AAQ A;  1DOB A;  1N4V A;  1TDK A;  1HYU A;  3G5R A;  1D4C A;  2EQ9 A;  3I6D A;  5IPY A;  4ADW A;  4NTE A;  1K4Q A;  1E1L A;  2WP6 A;  3CN8 A;  1QLB A;  3IF9 A;  2BXR A;  3FBS A;  4JY2 A;  4ECH A;  2Q0L A;  3CNJ A;  2Y6R A;  2C75 A;  4G6H A;  5J60 A;  1K0I A;  4B1B A;  2BAB A;  1LTX R;  4NZH A;  4M52 A;  3D1C A;  4APN A;  2V5Z A;  1MO9 A;  3PS9 A;  2FJB A;  2XVE A;  1GRG A;  3OZ2 A;  2BC1 A;  3P4Q A;  4JDR A;  4TM0 A;  1F3P A;  2BA9 A;  2OA1 A;  3ALM A;  4OPL A;  2WDR A;  3M13 A;  5JCM A;  1E1M A;  3KVE A;  4USR A;  3LJP A;  1PBD A;  1GRB A;  2HQM A;  1DXL A;  1KNP A;  2XFO A;  4J57 A;  2GR2 A;  2GEW A;  1PDH A;  3SQP A;  3NTD A;  1N4W A;  3NKS A;  4H4U A;  4C5O A;  2YG5 A;  1DOD A;  1ZK7 A;  4PAA A;  4OPG A;  3P1W A;  2XCG A;  3GMB A;  4FX9 A;  4EMW A;  2JK6 A;  5M10 A;  4X9M A;  1GRT A;  1JRY A;  3AEA A;  2XLP A;  3SX6 A;  2BK3 A;  3LZW A;  3QSM A;  1E1N A;  3H8I A;  2VRL A;  4RSL A;  2DKI A;  4YSZ A;  1KDG A;  2CDU A;  2XFU A;  2XVF A;  1FEB A;  2WPE A;  3AE8 A;  2X8H A;  4C3X A;  4Z44 A;  1JRZ A;  1GPE A;  2BS2 A;  2GV8 A;  2GF3 A;  3QFA A;  4YWO A;  3ZYX A;  2I0Z A;  2WOW A;  1IJH A;  2YWL A;  1JOA A;  1CJ4 A;  1D4E A;  4X4J A;  5BUL A;  2PHH A;  1XPQ A;  4H4T A;  2ZZB A;  4BK2 A;  2C3D A;  3NTA A;  2GAH B;  3DK9 A;  1W4X A;  4K7Z A;  2GB0 A;  5BUK A;  3AWI A;  4H2Q A;  3NYE A;  1BF3 A;  3ZDN A;  2YR5 A;  1GAL A;  1PBC A;  3K7M X;  4A99 A;  3NRN A;  4RG4 A;  5KOW A;  3BHK A;  4DNA A;  1XHC A;  2XFP A;  3QSE A;  2OAM A;  4KX6 A;  2BK4 A;  2R9Z A;  3WE0 A;  4A65 A;  2B76 A;  3FMW A;  1BWC A;  4U8J A;  3V76 A;  1KFY A;  3G5Q A;  3GYI A;  3NYC A;  2JAE A;  4U8M A;  3VR8 A;  4J56 A;  4O5Q A;  4A7A A;  4NWZ A;  1H82 A;  4Z2T A;  1E1K A;  3GD3 A;  3K7Q X;  4OVI A;  2GMH A;  1CF3 A;  2WDV A;  2F5Z A;  2IVD A;  4A5L A;  1AOG A;  1DNC A;  1ZP0 A;  3G5S A;  2W0H A;  2YLX A;  4J36 A;  3GD4 A;  3R9U A;  1PHH A;  3ICT A;  4EMJ A;  4UDQ A;  3T2Z A;  4C3Y A;  3SZ0 A;  2VOU A;  3DH9 A;  3SGL A;  3DGZ A;  4BK1 A;  1N4U A;  3FG2 P;  3ICS A;  2A87 A;  1O94 A;  3HZL A;  3EAN A;  3ITJ A;  2V3A A;  1GV4 A;  5IQ4 A;  5JCI A;  2WEU A;  2YLZ A;  1V59 A;  3DME A;  2GR1 A;  4I58 A;  3KU9 A;  5FS8 A;  2R45 A;  3AEF A;  5KWF A;  3AYI A;  2WU5 A;  3BI5 A;  2GRT A;  4IA6 A;  3VQR A;  3UCL A;  3O0H A;  1NHP A;  1OJT A;  3QVR A;  4GAV A;  4J34 A;  2XFQ A;  3B6D A;  3IHM A;  4BJZ A;  4I59 A;  1GTH A;  4AOS A;  3V3N A;  2GH5 A;  3UP4 A;  1Y0P A;  4FK1 A;  2BCG G;  2PYX A;  2X50 A;  2FJD A;  1Z6L A;  2WP5 A;  2X8G A;  1LV0 A;  2E5V A;  1IUX A;  1QO8 A;  3P4P A;  4II2 A;  3CGD A;  2WHD A;  4H4X A;  2R0C A;  3HYV A;  4GDE A;  5KNL A;  5KMQ A;  4EM4 A;  1REO A;  2Y6Q A;  1TDE A;  3ALJ A;  4OPU A;  1VG0 A;  2BYB A;  2YAU A;  1F8W A;  3NLC A;  5M0Z A;  4C77 A;  1XAN A;  1XDI A;  2GR3 A;  2ACZ A;  1LVL A;  4FDC B;  1D4D A;  2VVM A;  1TDF A;  1KSS A;  3AE9 A;  2BAC A;  3ICR A;  5KMS A;  2XDO A;  3KA7 A;  4YKF A;  3VR9 A;  4Y4L A;  4DSG A;  2Z5Y A;  3NN6 X;  2YM2 A;  3H4K A;  2GAG B;  1Y56 A;  2IID A;  4Z43 A;  3AEG A;  3GRT A;  5HHF A;  4LII A;  2RGH A;  3CGB A;  1H6V A;  1K0L A;  4WCT A;  3L1R A;  1GND A;  1FL2 A;  1ZDL A;  2XLR A;  1NAA A;  4H2P A;  5EB4 A;  5CQF A;  2FBW A;  3F8R A;  4HA6 A;  1PXA A;  2YLR A;  1E39 A;  2C70 A;  4EQS A;  2Q6U A;  1PBB A;  2YR6 A;  2WP9 A;  2YM1 A;  3T2Y A;  4EIP A;  4Y4N A;  2C4C A;  2TMD A;  3UKH A;  1ONF A;  1F6M A;  5DBJ A;  3RED A;  3UOY A;  1H7W A;  3UTE A;  4A6N A;  4AP3 A;  4BV6 A;  2H88 A;  1P2H A;  5KMP A;  1M6I A;  2C64 A;  2NVK X;  3RNM A;  2XVI A;  4TM3 A;  3VRD B;  5FS6 A;  4DSH A;  4YSX A;  2DKH A;  3UTH A;  4EMI A;  5BVA A;  1TRB A;  3DJG X;  3E1T A;  4OPC A;  4CNK A;  5IQ1 A;  2APG A;  2XYO A;  3AE1 A;  1DJN A;  1EL9 A;  4USQ A;  1IUT A;  3AD7 B;  3CPI G;  2WS3 A;  4PAB A;  1NG3 A;  3FIM B;  2H89 A;  4K22 A;  3DJD A;  1FEA A;  1NEN A;  3DK8 A;  4G6G A;  2GR0 A;  3BHF A;  3ADA B;  3COX A;  2YR4 A;  3H8L A;  3GYX A; 
#chains in the Genus database with same CATH homology
 1YQZ A;  4X9N A;  4H7U A;  4G9K A;  3EAO A;  1TYP A;  1K0J A;  1H84 A;  2C76 A;  1FOH A;  3KKJ A;  2X3N A;  1B8S A;  3CGE A;  3GRS A;  4BK3 A;  3UKL A;  4Z2U A;  3JSK A;  2JBV A;  1NHR A;  3QVP A;  2B9X A;  2J3N A;  1B5Q A;  1GOS A;  3T37 A;  2R4J A;  5EOW A;  1OJA A;  1S3E A;  4BJY A;  1GRE A;  2V61 A;  2V6O A;  3RHA A;  4CBQ A;  1LQU A;  3D8X A;  2WU2 A;  3HYW A;  1ZOV A;  4OPD A;  1ELI A;  3KD9 A;  2YVG A;  1YQ4 A;  3BNU A;  3RP7 A;  3VRB A;  2XVJ A;  4TM4 A;  1P2E A;  2RGO A;  1S2Y A;  1NG4 A;  3PVC A;  3T14 A;  5KOX A;  5HXI A;  1F8S A;  2ZZC A;  1EL8 A;  2BK5 A;  4NTC A;  1LPF A;  1PS9 A;  3GDN A;  3UKK A;  4U2T A;  4AOX A;  3ALL A;  4B67 A;  3L8K A;  3UOZ A;  5CKU A;  3PO7 A;  2VVL G;  4U8N A;  1Y56 B;  1KNR A;  2XLT A;  3NK0 X;  2C67 A;  2RGJ A;  3NYF A;  4B66 A;  4Z2R A;  4CNJ A;  2CFY A;  1YKJ A;  3OC4 A;  1D7Y A;  1F8R A;  2YG3 A;  3GWD A;  1COY A;  4U8K A;  3LXD A;  1ZX9 A;  3AE2 A;  3NH3 X;  2Q7V A;  2C66 A;  3C4N A;  2YG4 A;  1D7L A;  4CCQ A;  2VQB A;  3T0K A;  2C73 A;  3UTG A;  3CNS A;  3CGC A;  2X8C A;  4YSH A;  3II4 A;  3AEE A;  1GEU A;  1VRQ B;  3F8P A;  4XWR A;  3SFE A;  4TLZ A;  4Z25 A;  1CJ3 A;  1EL5 A;  1L9E A;  3DJE A;  4A6N B;  1E7P A;  4H4S A;  1DOE A;  5FS9 A;  3S5W A;  4B65 A;  3URH A;  2AR8 A;  1IUU A;  3LOV A;  4KPR A;  1S2Q A;  4ZN0 A;  2BXS A;  2JKC A;  2QA1 A;  2YLW A;  4H4P A;  1OJC A;  3V3O A;  2JB1 A;  2WET A;  4CCR A;  4A79 A;  1FEC A;  2C7G A;  4J2W A;  4A9W A;  1OJ9 A;  3F8D A;  4CY8 A;  1TDN A;  2BRA A;  2XLS A;  3AXB A;  4K8D A;  4O5U A;  5TR3 A;  3SXI A;  4ICY A;  2E1M A;  2YG7 A;  1X31 B;  1CC4 A;  2ARD A;  1H7X A;  4EQW A;  3LAD A;  1KF6 A;  1CHU A;  3AYL A;  3ATQ A;  2R0G A;  3AE5 A;  3NGC X;  4GF7 A;  2UZZ A;  2GVC A;  4NEV A;  1MOK A;  3B3R A;  4K5R A;  4YXD A;  1S3B A;  3SY4 A;  2B7R A;  4U8P A;  1CJC A;  4K5S A;  1D5T A;  3AE6 A;  2B9W A;  1TDO A;  1GER A;  4G74 A;  4K2X A;  1LQT A;  4MJW A;  4NEW A;  4ZCC A;  5KVI A;  4TLX A;  3Q9T A;  1PJ5 A;  4C74 A;  1RYI A;  3AEC A;  3T31 A;  5JCN A;  4P9S A;  3C96 A;  3AB1 A;  3UOX A;  1Q1R A;  3K30 A;  2CUL A;  2GQF A;  4B68 A;  4JNA A;  4B69 A;  5LV9 A;  3AE3 A;  4UDR A;  1DJQ A;  1JNR A;  3AED A;  2OAL A;  4AT0 A;  4H50 A;  3GYJ A;  4WX1 A;  3CNP A;  1YY5 A;  1ZOY A;  1JRX A;  3UKF A;  2NPX A;  1RP0 A;  1BKW A;  2BCP A;  1E6E A;  3M12 A;  2B9Y A;  2QCU A;  3UKA A;  2VQ7 A;  2E4G A;  1GRF A;  1PBF A;  3DGH A;  2YVJ A;  1CBO A;  1EBD A;  2A8X A;  2FJE A;  4GUV A;  4U8I A;  5ER0 A;  4EQX A;  4IVM B;  4YKG A;  3QJ4 A;  1YQ3 A;  5KXJ A;  1BGJ A;  5C2T A;  1O5W A;  1PBE A;  4H4V A;  1Q1W A;  4JN9 A;  1H81 A;  2X99 A;  3DA1 A;  3LZX A;  4EM3 A;  4JQ9 A;  3CND A;  4N9X A;  5KVH A;  4XWZ A;  4H4R A;  1LJ1 A;  1QJD A;  2WPC A;  1NDA A;  2AQJ A;  2C65 A;  4U2L A;  1JEH A;  3KPF A;  1JNZ A;  3SM8 A;  1CJ2 A;  2A89 A;  3FPZ A;  4D04 A;  1OJD A;  1B4V A;  4Z26 A;  1H83 A;  4JY3 A;  4OPI A;  1NEK A;  1IUS A;  2GQW A;  3LB8 A;  4U8O A;  4EQR A;  5KRQ A;  4OPT A;  3GSI A;  2OLN A;  3EPT A;  2O9Z A;  4H4Y A;  4J31 A;  1VDC A;  2WPF A;  2WQY A;  4IV9 A;  5HYM A;  4LU6 A;  3UOV A;  1GRH A;  2QA2 A;  2V60 A;  3AYJ A;  1PJ7 A;  4IVO B;  4TM1 A;  1IUV A;  2GMJ A;  3NNE A;  4B63 A;  4H4Q A;  3RP8 A;  4E0V A;  1M64 A;  4DGK A;  2YLS A;  4YTP A;  1H86 A;  4G73 A;  5L46 A;  3DJJ A;  3QSS A;  2BC0 A;  4H2N A;  4B64 A;  3CNT A;  1GT8 A;  3BI4 A;  1VQW A;  3C4A A;  5U63 A;  1VG9 A;  5KMR A;  4XXG A;  3SFD A;  4H4Z A;  1SEZ A;  2FJA A;  3NHO X;  2VRM A;  1UKV G;  2BRY A;  3ATR A;  1PXC A;  5C3J A;  2BS4 A;  4U8L A;  4FK1 C;  1ZMC A;  2C3C A;  3NK1 X;  3DK4 A;  5GSN A;  4Z24 A;  3CPH G;  4AT2 A;  1DOC A;  4H2R A;  4UP3 A;  2IVE A;  4ZCD A;  3CPJ G;  4J33 A;  2C72 A;  1BGN A;  5HY5 A;  1JU2 A;  3P4S A;  3SZW A;  5GRT A;  2EQ8 A;  1O95 A;  5EBK A;  4D03 A;  1NHS A;  1PN0 A;  2TPR A;  2JB3 A;  3Q6J A;  3CIR A;  2RAB A;  3AEB A;  3IHG A;  2XVH A;  4GR1 A;  4REK A;  5FS7 A;  3AD9 B;  2XFN A;  4YSY A;  1ZY8 A;  2XLU A;  3NK2 X;  4H4W A;  5J7X A;  3AE4 A;  2B7S A;  3M0O A;  1NHQ A;  4GRT A;  3SYI A;  2WBA A;  5U25 A;  1N1P A;  2YLT A;  3T2K A;  1CL0 A;  1GES A;  3P4R A;  2ZBW A;  3RP6 A;  2Z5X A;  2EQ7 A;  4CY6 A;  1IUW A;  3AD8 B;  4NNJ A;  2EQ6 A;  4CRT A;  1Q9I A;  2BS3 A;  3HYX A;  3IC9 A;  2VVL A;  1GRA A;  3NN0 X;  2CVJ A;  3BNM A;  5U1O A;  3CTY A;  1ZKQ A;  2WOV A;  4GCM A;  4GAP A;  2V3B A;  1B37 A;  4HB9 A;  3CMM A;  1L0V A;  3KLJ A;  5EB5 A;  4YT0 A;  5BRT A;  1FCD A;  4OCG A;  2R0P A;  3IWA A;  3QFB A;  1PJ6 A;  4JNQ A;  2QAE A;  2Q0K A;  3SZF A;  1GXF A;  1GET A;  4GDP A;  2YVF A;  4RG3 A;  1MXT A;  3AE7 A;  4LA1 A;  2YQU A;  1TYT A;  4AP1 A;  2YG6 A;  3BI2 A;  3UP5 A;  3VRA A;  2WES A;  2WDQ A;  3GDP A;  3ISH A;  1CC6 A;  1NPX A;  3NG7 X;  4II3 A;  1ZMD A;  4EIQ A;  3UTF A;  1BZL A;  1L9C A;  2JB2 A;  1GTE A;  1EL7 A;  1PXB A;  1RSG A;  4NTD A;  5FMH A;  2OLO A;  4YTM A;  2VZ2 A;  4UDP A;  3SZC A;  3I3L A;  3S61 A;  4YTN A;  3NIX A;  1L9D A;  5JCK A;  4IA5 A;  1GSN A;  1KSU A;  3NT6 A;  4BUR A;  2R46 A;  3UKQ A;  3KPK A;  3K7T A;  2ZZ0 A;  1CC2 A;  2R4E A;  4Y4M A;  3ABV A;  2WOI A;  3EF6 A;  3UKP A;  3GWF A;  3P9U A;  4U2S A;  5JCL A;  3GMC A;  2AAQ A;  1DOB A;  1N4V A;  1TDK A;  1HYU A;  3G5R A;  1D4C A;  2EQ9 A;  3I6D A;  5IPY A;  4ADW A;  4NTE A;  1K4Q A;  1E1L A;  2WP6 A;  3CN8 A;  1QLB A;  3IF9 A;  2BXR A;  3FBS A;  4JY2 A;  4ECH A;  2Q0L A;  3CNJ A;  2Y6R A;  2C75 A;  4G6H A;  5J60 A;  1K0I A;  4B1B A;  2BAB A;  1LTX R;  4NZH A;  4M52 A;  3D1C A;  4APN A;  2V5Z A;  1MO9 A;  3PS9 A;  2FJB A;  2XVE A;  1GRG A;  3OZ2 A;  2BC1 A;  3P4Q A;  4JDR A;  4TM0 A;  1F3P A;  2BA9 A;  2OA1 A;  3ALM A;  4OPL A;  2WDR A;  3M13 A;  5JCM A;  1E1M A;  3KVE A;  4USR A;  3LJP A;  1PBD A;  1GRB A;  2HQM A;  1DXL A;  1KNP A;  2XFO A;  4J57 A;  2GR2 A;  2GEW A;  1PDH A;  3SQP A;  3NTD A;  1N4W A;  3NKS A;  4H4U A;  4C5O A;  2YG5 A;  1DOD A;  1ZK7 A;  4PAA A;  4OPG A;  3P1W A;  2XCG A;  3GMB A;  4FX9 A;  4EMW A;  2JK6 A;  5M10 A;  4X9M A;  1GRT A;  1JRY A;  3AEA A;  2XLP A;  3SX6 A;  2BK3 A;  3LZW A;  3QSM A;  1E1N A;  3H8I A;  2VRL A;  4RSL A;  2DKI A;  4YSZ A;  1KDG A;  2CDU A;  2XFU A;  2XVF A;  1FEB A;  2WPE A;  3AE8 A;  2X8H A;  4C3X A;  4Z44 A;  1JRZ A;  1GPE A;  2BS2 A;  2GV8 A;  2GF3 A;  3QFA A;  4YWO A;  3ZYX A;  2I0Z A;  2WOW A;  1IJH A;  2YWL A;  1JOA A;  1CJ4 A;  1D4E A;  4X4J A;  5BUL A;  2PHH A;  1XPQ A;  4H4T A;  2ZZB A;  4BK2 A;  2C3D A;  3NTA A;  2GAH B;  3DK9 A;  1W4X A;  4K7Z A;  2GB0 A;  5BUK A;  3AWI A;  4H2Q A;  3NYE A;  1BF3 A;  3ZDN A;  2YR5 A;  1GAL A;  1PBC A;  3K7M X;  4A99 A;  3NRN A;  4RG4 A;  5KOW A;  3BHK A;  4DNA A;  1XHC A;  2XFP A;  3QSE A;  2OAM A;  4KX6 A;  2BK4 A;  2R9Z A;  3WE0 A;  4A65 A;  2B76 A;  3FMW A;  1BWC A;  4U8J A;  3V76 A;  1KFY A;  3G5Q A;  3GYI A;  3NYC A;  2JAE A;  4U8M A;  3VR8 A;  4J56 A;  4O5Q A;  4A7A A;  4NWZ A;  1H82 A;  4Z2T A;  1E1K A;  3GD3 A;  3K7Q X;  4OVI A;  2GMH A;  1CF3 A;  2WDV A;  2F5Z A;  2IVD A;  4A5L A;  1AOG A;  1DNC A;  1ZP0 A;  3G5S A;  2W0H A;  2YLX A;  4J36 A;  3GD4 A;  3R9U A;  1PHH A;  3ICT A;  4EMJ A;  4UDQ A;  3T2Z A;  4C3Y A;  3SZ0 A;  2VOU A;  3DH9 A;  3SGL A;  3DGZ A;  4BK1 A;  1N4U A;  3FG2 P;  3ICS A;  2A87 A;  1O94 A;  3HZL A;  3EAN A;  3ITJ A;  2V3A A;  1GV4 A;  5IQ4 A;  5JCI A;  2WEU A;  2YLZ A;  1V59 A;  3DME A;  2GR1 A;  4I58 A;  3KU9 A;  5FS8 A;  2R45 A;  3AEF A;  5KWF A;  3AYI A;  2WU5 A;  3BI5 A;  2GRT A;  4IA6 A;  3VQR A;  3UCL A;  3O0H A;  1NHP A;  1OJT A;  3QVR A;  4GAV A;  4J34 A;  2XFQ A;  3B6D A;  3IHM A;  4BJZ A;  4I59 A;  1GTH A;  4AOS A;  3V3N A;  2GH5 A;  3UP4 A;  1Y0P A;  4FK1 A;  2BCG G;  2PYX A;  2X50 A;  2FJD A;  1Z6L A;  2WP5 A;  2X8G A;  1LV0 A;  2E5V A;  1IUX A;  1QO8 A;  3P4P A;  4II2 A;  3CGD A;  2WHD A;  4H4X A;  2R0C A;  3HYV A;  4GDE A;  5KNL A;  5KMQ A;  4EM4 A;  1REO A;  2Y6Q A;  1TDE A;  3ALJ A;  4OPU A;  1VG0 A;  2BYB A;  2YAU A;  1F8W A;  3NLC A;  5M0Z A;  4C77 A;  1XAN A;  1XDI A;  2GR3 A;  2ACZ A;  1LVL A;  4FDC B;  1D4D A;  2VVM A;  1TDF A;  1KSS A;  3AE9 A;  2BAC A;  3ICR A;  5KMS A;  2XDO A;  3KA7 A;  4YKF A;  3VR9 A;  4Y4L A;  4DSG A;  2Z5Y A;  3NN6 X;  2YM2 A;  3H4K A;  2GAG B;  1Y56 A;  2IID A;  4Z43 A;  3AEG A;  3GRT A;  5HHF A;  4LII A;  2RGH A;  3CGB A;  1H6V A;  1K0L A;  4WCT A;  3L1R A;  1GND A;  1FL2 A;  1ZDL A;  2XLR A;  1NAA A;  4H2P A;  5EB4 A;  5CQF A;  2FBW A;  3F8R A;  4HA6 A;  1PXA A;  2YLR A;  1E39 A;  2C70 A;  4EQS A;  2Q6U A;  1PBB A;  2YR6 A;  2WP9 A;  2YM1 A;  3T2Y A;  4EIP A;  4Y4N A;  2C4C A;  2TMD A;  3UKH A;  1ONF A;  1F6M A;  5DBJ A;  3RED A;  3UOY A;  1H7W A;  3UTE A;  4A6N A;  4AP3 A;  4BV6 A;  2H88 A;  1P2H A;  5KMP A;  1M6I A;  2C64 A;  2NVK X;  3RNM A;  2XVI A;  4TM3 A;  3VRD B;  5FS6 A;  4DSH A;  4YSX A;  2DKH A;  3UTH A;  4EMI A;  5BVA A;  1TRB A;  3DJG X;  3E1T A;  4OPC A;  4CNK A;  5IQ1 A;  2APG A;  2XYO A;  3AE1 A;  1DJN A;  1EL9 A;  4USQ A;  1IUT A;  3AD7 B;  3CPI G;  2WS3 A;  4PAB A;  1NG3 A;  3FIM B;  2H89 A;  4K22 A;  3DJD A;  1FEA A;  1NEN A;  3DK8 A;  4G6G A;  2GR0 A;  3BHF A;  3ADA B;  3COX A;  2YR4 A;  3H8L A;  3GYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...