1TDGA

Complex of s130g shv-1 beta-lactamase with tazobactam
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-resistant class A beta-lactamases: consequences of the Ser130-to-Gly mutation seen in Apo and tazobactam structures of the SHV-1 variant
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1tdgA00
3E2LA 5EVLA 3ZVWA 4BQMA 4OQHA 3NCKA 3PBSA 1ESUA 3W4PA 5GHXA 5EOOA 1JVJA 5KSCA 3MKFA 4GZBA 3IXBA 2J7VA 4E6XA 2XLNA 4WYYA 4RX2A 3Q07A 3ZG7B 4C75A 2V20A 1NJ4A 4KG2A 3VP4A 4PM9A 3BECA 3N7WA 2H5SA 1ES3A 4CPKA 1GA9A 3OPLA 3OPPA 4BD1A 1W7FA 1PZOA 3PBOA 4JF5A 5HAQA 1YLWA 3IQAA 1JTGA 3HLEA 1WYCA 3IF6A 3QHYA 4BD0A 1VQQA 2UWXA 1E25A 3HLDA 4F94A 2WZZA 3AGFA 4OH0A 4OQIA 4XUXA 4ZBEA 2ZMAA 1KDSA 3WS1A 4E3OA 5AQBA 3G34A 2ZC6B 3BEBA 1FSWA 5E2FA 3HUNA 3RXWA 3CZDA 1PIOA 1DJCA 1I5QA 1ONGA 1FOFA 2Y2QA 2A3UA 4KZAA 2ZM8A 4PM5A 2ZQAA 4JPMA 4ZDXA 3Q7ZA 4IEDA 3VSLA 4FCFA 2ZQ9A 4DE1A 2J9PA 2XFTA 3LY4A 3Q1FA 1IYQA 1JWVA 1MKIA 1YLTA 2XFSA 5GLAA 2Y2JA 2DCFA 1FR1A 2WKHA 3BFDA 3GR2A 3IXGA 3SOIA 3IF6B 1O07A 3ZGAB 1L0DA 1E4DA 5HW3A 4S2KA 4KQRA 2C6WB 3ISGA 3ZCZA 5M1AA 3HUOA 4YINA 2V1ZA 2VGKA 1EI5A 3PTEA 3UDFA 3A3FA 1FQGA 1HZOA 4X55A 5M18A 1M6KA 1K25A 2WUQA 4P0MA 4OOLA 4U0TA 1DJAA 1KVLA 1ES5A 3LO7A 2J9OA 3NIAA 4KZBA 1L0GA 1ZG6A 3VP1A 4MEZA 4BL2A 3WS0A 5KMWA 3EQUA 3PBQA 3UPOA 2XQZA 3I7JA 5G18A 4B88A 2OLUA 2H0YA 3WS2A 4O7DA 4BLMA 1KVMA 2EX2A 1HTZA 3SS3A 3HVFA 4DXCA 4WEJA 5EPHA 4E6WA 1LI0A 1MXOA 1ZG4A 3IXDA 1ONHA 4WELA 2PU2A 2PBYA 3IF6C 1JWPA 2A49A 1WE4A 2XD1A 4R3JA 4LV2A 4X56A 3VMAA 4OPZA 1NYMA 5CXWA 3G2YA 1K56D 1PW1A 4PM7A 1N4OA 1IYPA 1ZKJA 3W4QA 1XX2A 4UA7A 3M2KA 2Y55A 3DW0A 4OKPA 4Y0OA 5CHJA 1W8QA 2DNSA 1ALQA 4OPQA 2E8IA 3NY4A 4YFMA 1U60A 3Q7VB 2OV5A 1K4FA 4DDYA 1KGEA 2Y2GA 4C6YA 1BT5A 3MBZA 4QU3A 5EVIC 4N1XA 3ZG8B 1KE3A 5HARA 4D2OA 4QB8A 1KE0A 1YQSA 3UNWA 4B4ZA 1TDLA 3VOZA 3N8RA 4FH2A 3UY6A 1IKIA 3OCNA 4LV0A 5FASA 1K38A 3N6IA 2Y91A 2V2FF 3V50A 4E3KA 3VP0A 2HDSA 3PBRA 5FATA 3SH9A 3OPRA 4H8RA 3WS5A 4X68A 2ZM0A 4GD6A 3C5AA 4KENB 2C5WB 2ZC3B 4WM9A 4GDBA 1Q2QA 3G4PA 3VFHA 4S2NC 3ZG9B 3RJUA 1CK3A 5F82A 1ES2A 4KZ6A 4KQOA 4DRTA 1G6AA 2P9VA 3G30A 5DF7A 5GHZA 1RGZA 1QMFA 1IELA 3GRJA 5AQ9A 2G2UA 5I94A 1GHPA 5EECA 3VOYA 4DE0A 2WKEA 4KZ8A 3RXXA 3IXHA 3JYIA 4BL3A 5L2FA 1K56A 3BFCA 2ZLYA 2Q9NA 2R9XA 4OP8A 4Y0TA 1VM1A 4EBNA 4C3QA 3HREA 1AXBA 4ID4A 1XPBA 1FSYA 3IT9A 4KZ3A 3ZG5A 2JCHA 1CEFA 4Z9QA 2P9VB 4ZJ2A 2EFUA 4Y0UA 1M40A 5DF9A 1BLCA 2XGNA 2H10A 1PW8A 1Q2PA 2JBFA 3ZVTA 2XK1A 3V3RA 4B4XA 3FKWA 4JXGA 3C7UA 2HP9A 1CI9A 3D4FA 4ZJ1A 3NC8A 3HUMA 2X01A 1CI8A 2WZXA 3BLMA 5DVAA 2EX9A 2QZ6A 2IWDA 4R4SA 1LI9A 3DTMA 3BM6A 3OCLA 3HLBA 1TVFA 2WGIA 3UE3A 4KZ5A 5CEDA 4R4RA 2X71A 5CGXA 3VFFA 4QHCA 2Y2OA 1NYYA 3BFEA 2FFFB 4OQ0A 2WYXA 1E3UA 2G2WA 2RL3A 3IH9A 1K57C 1XKZA 5HX9A 3BYDA 4E3LA 1O7EA 1GHMA 4GNUA 4U0XA 3OC2A 1DJBA 1CEGA 1W79A 5EOEA 4BENA 5CERA 3WRZA 3C4PA 4JLFA 1PYYA 4OOYA 3N8SA 1H8ZA 2Y2LA 2Y2HA 4HBTA 1Y54A 4S2JA 4E3JA 5FAQA 4QD4A 3C4OA 1IYOA 3IHBA 3WWXA 4WEKA 1BSGA 2Y2MA 4PMAA 4MNRA 4E3IA 1KGFA 3G35A 3AGDA 1XGJA 1BLSA 1TEMA 5E2GA 1XA7A 3M6BA 3LY3A 1MWUA 2Y59A 1K57A 4FH4A 2VGJA 3UPNA 1HD8A 1BTLA 1PWDA 1GA0A 5HAPA 4OVDA 1YLYA 2B5RA 4X69A 4MBKA 5GLCA 2CC1A 3OPHA 4M3KA 3TSGA 3AGEA 1YLJA 4UAAA 1K6RA 3MXSA 2XF3A 2WGWA 3HLGA 4IVKA 2WAEA 3VSKA 3A3DA 3FWLA 2ZC7A 4QJGA 4ZTKA 3HLFA 4WZ5C 5CRFA 2DRWA 3OZHA 3IWOA 4KZ9A 4U3TA 4P85A 3CG5A 2Z2LB 1W8YA 5JYPA 3N8LA 3A3IA 4LV1A 4LCMA 4N9LA 4OPRA 4P87A 1LL5A 2QPNA 1EROA 2ZC4B 3SH8A 3GVBA 5EE8A 1YT4A 4K0WA 4EV4A 3HLWA 1RCJA 3BFFA 1K6SA 2HDUA 5BOHA 5E43A 4DDSA 3UN7A 2WAFA 4JF6A 3P98A 4L0LA 5CTNA 1BULA 2EXAA 2ZD8A 3MZEA 3M6HA 4E3MA 1FCNA 4IVIA 5FQ9A 4CJNA 5FAOA 4OOMA 1BUEA 4HEFA 3FYZA 4KZ4A 5EVID 1KDWA 4R3BA 3IH8A 5E2EA 1NY0A 3C7VA 5GL9A 3BRMA 4R1GA 4WZ4A 4S2OA 4GOGA 5CHMA 1FR6A 1PZPA 4R23A 5U47A 5A92A 3PBNA 5E2HA 2IWBA 3DWKA 3O3VA 4UA6A 5DTTA 4MBFA 1N9BA 3MXRA 1IYSA 1K55C 5A93A 1Z6FA 3N4IA 4UHUA 2HP5A 1YLZA 4EBLA 5FA7A 5FQQA 5GHYA 4BJPA 4OP5A 1YMSA 3LCEA 3EQVA 4PM8A 5F83A 1L0EA 3W4OA 3ZHHA 4EUZA 1HVBA 3FKVA 4RYEA 4WBGA 3V3SA 4OPYA 1NXYA 1XGIA 3NBLA 1K4EA 4N9KA 5FDHA 5FQKA 1J9MA 1LHYA 2J8YA 1YM1A 1GHIA 1RGYA 4KG6A 1QMEA 5DTKA 3HL9A 1L0FA 1MWTA 4KG5A 1WYBA 2Y2PA 1SHVA 5IHVA 4S2MA 2JC7A 5DTSA 3SH7A 1KGGA 2H0TA 2XEPA 3IWQA 2WGWB 3G31A 4IBXA 5FI7A 4DKIA 5FI6A 1SDNA 4FD8A 1GCEA 1BLHA 1K54C 3O86A 4FSFA 4DE3A 5FQJA 2EXBA 3GV9A 4K91A 1ERMA 5F1GA 1K54A 1PWCA 3NDEA 4WMCD 1KE4A 3BFGA 1MWSA 2PU4A 2WGVA 2HP6A 3MFDA 1K55A 4HBUA 4XXRA 3ITAA 2GDNA 3UE1A 4DXBA 3S1YA 5CTMA 3GMWA 1SDEA 4S2LA 5A90A 2WK0A 2ZQ8A 4PM6A 5DF8A 3B3XA 3M2JA 5CGWA 3V39A 5CEBA 1I2WA 4RA7A 1LL9A 3ZDJA 4GDNA 2Y4AA 2OLVA 4GN2A 1JTDA 4RVAA 5HFOA 2ZQCA 4JKTA 4N1HA 4QY6A 1L2SA 2WKIA 4UA9A 2I72A 3TG9A 4MLLA 3VP2A 3SS5A 2JE5A 2Y2KA 1E3UD 1PWGA 4JXSA 4XUZA 1MWRA 1MY8A 3MKEA 2XR0A 1NZOA 1BZAA 5JYOA 3NI9A 4GKUA 4HESA 3O88A 3Q81A 3IF5A 3HLCA 4MBHA 3ITBA 4R0QA 2FFYA 3MZFA 3MZDA 3S4XA 4ZAMA 3WS4A 5EVIB 5A91A 3GTCA 3UPPA 3PAGA 3CMZA 1S0WA 4WMCA 2ZQ7A 3QNBA 3DWZA 5TGFA 2ZQDA 2ZC5B 1JWZA 3O87A 1G68A 1PI5A 5EUAA 4NETA 4JXVA 4EQIA 2ZM2A 5D3OA 1SCWA 4Y7PA 5F1FA 2XH9A 4LENA 4OLGA 5FI2A 2RCXA 3WRTA 3ZNYA 2EX6A 2Y2NA 4KZ7A 4DF6A 1PI4A 1DY6A 4QY5A 3UDIA 3W8KA 5GLDA 1W5DA 2OSUA 5FSRA 2Y2IA 1XP4A 3QNCA 4LCLA 5FQIA 3LEZA 5CGSA 5TR7A 3ZFZA 3S22A 4JF4A 4DE2A 3G2ZA 3UE0A 1I2SA 5J8XA 3P09A 1BLPA 5CHUA 1XXMA 2BG1A 4IBRA 1NRFA 2IWCA 1ZC2A 1IKGA 3G32A 1FCOA 4LV3A 4KQQA 4S2PA 2HDRA 2X02A 4X6TA 5AQAA 5GLBA 3UDXA 3FV7A 1EWZA 2EFXA 4X53A 4OONA 1YLPA 4JBFA 3SS4A 3FZCA 3ZNTA 2BLSA 1H5XA 3PBTA 1RP5A 4GB7A 4PPRA 2R9WA 5FAPA 4EWFA 1FCMA 4NK3A 2Z2MB 5M19A 5KSHA 5EVIA 3PAEA 4K0XA 4JXWA 4GD8A 2HDQA 2XD5A 3GQZA 4ZJ3A 4A5RA 4S2IA 5AQ7A 4EBPA 1MPLA 3VP3A 1OMEA 3CJMA 1NZUA 2ZJ9A 4WZ5A 2HPBA 1ERQA 3TOIA 4E3NA 2XDMA 3IWIA 1S6RA 4RX3A 5TFQA 3ZG0A 3UO9A 3HBRA 3V5MA 5KZHA 3A3JA 1H8YA 1MBLA 3Q7VA 4S2NA 1ESIA 2QMIA 5HL1A 2P74A 3Q82A 1IEMA 4OLDA 5FQMA 1YMXA 4OQGA 1XA1A 1TDGA 3A3EA 3GSGA 3NDGA 3BLSA 2WADA 5HAIA 2EX8A 4P6BA 1ES4A 1C3BA 5CECA 3IHAA 4N92A 1LLBA 4Q8IA 3E2KA 2Q9MA 1SKFA
chains in the Genus database with same CATH superfamily
3W4PA 2J7VA 4E6XA 2XLNA 3Q07A 3B47A 4KG2A 3VP4A 4PM9A 3BECA 3OPLA 4BD1A 4R70A 3PBOA 4JF5A 1T1BA 1YLWA 3JVVA 3IF6A 1VQQA 3U4LP 3T1QB 1KDSA 3WS1A 2ZC6B 3BY8A 3RXWA 1H8MA 4AFIA 4YOFA 5FL3A 3S7PA 2A3UA 4KZAA 2ZQAA 4ZDXA 3Q7ZA 3IX3A 3LYXA 4IEDA 3T4OA 2ZQ9A 4DE1A 1MKIA 3SOIA 3ZGAB 2PR5A 1E4DA 5HW3A 1H3QA 4S2KA 2C6WB 3ZCZA 2VGKA 3PTEA 1EI5A 1FQGA 4U0TA 2PD7A 1L0GA 1ZG6A 1F9IA 3QP4A 2XQZA 3HVFA 4DXCA 4WEJA 3KSHA 4WELA 2PU2A 3IF6C 4EW7A 2XD1A 4GS9A 4R3JA 4LV2A 3VMAA 1PW1A 4EEUA 1IYPA 1XX2A 4UA7A 2L4RA 4OKPA 2DNSA 1ALQA 4OPQA 2V9AA 4C6YA 3MBZA 3D72A 3UNWA 2A24A 3UY6A 4LV0A 3VP0A 5FATA 4H8RA 2W3EA 2ZM0A 4GDBA 3G4PA 4S2NC 5TBMA 3RJUA 1CK3A 3F1OA 3G30A 5DF7A 1QMFA 3EGXC 5EECA 4KZ8A 4BL3A 3BFCA 3BWLA 5HZHA 2R9XA 4OP8A 3HREA 1L3LA 1FSYA 1CEFA 2EFUA 1NLZA 1BLCA 2QJ5A 1PW8A 3EOIA 4Y13A 3FKWA 2W3GA 2R78A 2HGVA 1CI9A 4Q0JA 3NC8A 2XA7M 5DVAA 2IWDA 1D06A 3HLBA 5CGXA 1XJ4A 3BFEA 2XSSA 1K57C 3BYDA 5FEFA 3VOLA 4EESA 5CERA 3H7WB 2VV8A 4OOYA 1H8ZA 2ZBBA 2HF6A 4E3JA 4QD4A 1LSVA 4E3IA 1NRJA 1OT6A 3AGDA 1BLSA 1ZHHB 3C2WA 5E2GA 2Y59A 1K57A 3JPUA 1LSWA 1YAXA 1YLYA 4DJ3A 2CC1A 4M3KA 1YLJA 2WGWA 4ETZA 4KUKA 3HLFA 2DRWA 4HJ3A 3IWOA 4KZ9A 4U3TA 3CG5A 3TW8A 5JYPA 3ICYA 4OPRA 1LL5A 4Y17A 3U2AA 3GVBA 1RCJA 2HDUA 3UMEA 2QKPA 2WAFA 4JF6A 4L0LA 2EXAA 4JGPA 3MZEA 3E4OA 4E3MA 4IVIA 4MCWA 3S7QA 4HEFA 3FYZA 5DKKA 5E2EA 3FC7A 4R1GA 4WZ4A 4R23A 3O5YA 2IWBA 5E2HA 2NUTC 1S67L 3O3VA 4UA6A 1N9BA 3IBJA 4CLCA 1K55C 4LPZA 4UHUA 1YLZA 5FA7A 4BJPA 3T4LA 3LR0A 3UB9A 3EQVA 4EUZA 3FKVA 3V3SA 1NXYA 4N9KA 5FDHA 3BJNA 2J8YA 1RGYA 1QMEA 4X1MA 4P6ZM 5IHVA 3SH7A 3TJZC 3QP8A 4BMWA 3O86A 4R6LA 1ERMA 2E8JA 2HZ5A 3NDEA 4WMCD 3BFGA 2HP6A 3ITAA 3UE1A 5AVFA 4EUVA 2MJ6A 3B3XA 2VK3A 2QHKA 4HP4A 1L2SA 4UA9A 3TG9A 4MLLA 4L9FA 3SS5A 2JE5A 3VE3A 1P9RA 4XUZA 4WL9A 3VV4A 4ESPA 1NZOA 1BYWA 3O88A 3L7HA 4PKYA 2FFYA 3MZFA 3MZDA 4EERA 1HLUP 3GTCA 3UPPA 4Y2FA 4MMNA 1A0KA 3CMZA 4WMCA 2ZQ7A 3CPTA 2JKTM 3KSFA 5EUAA 3B42A 3MQ0A 4JXVA 1SCWA 5FI2A 4E04A 1VETB 2Y2NA 4DF6A 1PI4A 1DY6A 2V0UA 4QY5A 4BBUA 3BQAA 3QNCA 5FQIA 5CGSA 1I2SA 4WLAA 2VGLM 5J8XA 3P09A 1BLPA 5CHUA 2BG1A 3QP2A 1VHMA 1ZC2A 2OAQ1 4HJ6A 2HDRA 4XT2A 4X6TA 5AQAA 5HWVA 4OONA 2ZOIA 3SS4A 2BLSA 2K7SA 3PBTA 1RP5A 2Y8HA 2R9WA 4NK3A 2Z2MB 5M19A 2OWHA 2JKGA 3F1PA 3GQZA 4EBPA 1WA9A 3V67A 3TOIA 4E3NA 3UO9A 3HBRA 5IT5A 5KZHA 1MBLA 1T19A 2J3WA 2V8CA 2P74A 1IEMA 2J80A 3LEQA 3NULA 1VB6A 2Q9MA 1XJ6A 5EVLA 3CITA 3ZVWA 2WKRA 4NXGA 5KSCA 3ZG7B 1MZUA 1DP9A 2KLIA 2H5SA 1GA9A 3OPPA 1W7FA 4G3KA 1JTGA 3HLEA 2UWXA 1E25A 4H6JA 4OQIA 2ZMAA 4E3OA 5AQBA 1TF1A 3LIDA 3CZDA 1IYQA 1YLTA 2XFSA 3IX8A 4II7A 1XFNA 4K08A 3IXGA 1L0DA 2W3FA 5M1AA 5KIZA 2V1ZA 4X55A 4OOLA 1DJAA 4KZBA 2O99A 3PBQA 3T1SA 4LRZE 1HTZA 3EWKA 4E6WA 1MXOA 2PBYA 3IS2A 1JWPA 2PR6A 3QP1A 3VE4A 4CLCE 1N4OA 1IOUA 3W4QA 3M2KA 4ARZB 3DW0A 4Y0OA 2EWVA 1NWZA 2E8IA 2P7JA 2ZL1A 2ZOHA 2IA2A 2Y2GA 1XJ2A 4QU3A 3ZG8B 5HARA 3E4PA 1YQSA 2M7UA 1PFLA 3N8RA 4LRYC 3V50A 2V2FF 4ME4A 2HDSA 3PBRA 3SH9A 3WS5A 1V9YA 4KENB 2ZC3B 5F82A 4KZ6A 4KQOA 1NLYA 4I3AA 2P9VA 1RGZA 1IELA 2G2UA 1OTIA 2V8FA 2KOIA 4DE0A 2WKEA 5L2FA 1K56A 2Q9NA 3P01A 2BASA 2OAP1 2GZAA 4EBNA 4C3QA 4P6ZS 1XPBA 3IT9A 4KZ3A 2JN7A 2JCHA 4ZJ2A 3T4KA 1M40A 2XGNA 2XK1A 4B4XA 3C8CA 3D4FA 2PRFA 4ZJ1A 3MMHA 2EX9A 3OCLA 2WGIA 3UE3A 2O9BA 2RL3A 2G2WA 5HX9A 2J3TD 1W79A 4BENA 1X0OA 3WRZA 5HD5A 4JLFA 1PYYA 3N8SA 2Y2HA 4S2JA 3NOTC 5FAQA 1IYOA 3IHBA 4FTXA 4WEKA 3LI8A 4PMAA 3F1NB 4NXEA 3MJQA 4IHQA 3M6BA 3LY3A 3LIBA 1HD8A 1PWDA 1UGUA 5HAPA 3OBFA 4MBKA 3T12B 2YKHA 4UAAA 3TE8A 3UB5P 2WAEA 4JGQA 1GSXA 2AVXA 1FILA 1W8YA 3N8LA 3A3IA 4LV1A 4LCMA 4N9LA 2HV1A 1YT4A 4EV4A 3BFFA 4LLOB 5E43A 3FPWA 3UN7A 4G3WA 2JKRI 2ZD8A 2VGLS 4CJNA 4L9EA 4OOMA 2YKFA 1BUEA 5EVID 2UV0E 3D3OA 3IH8A 2FZ0A 3LIAA 2W27A 3BRMA 5J3WA 1FR6A 2WKQA 5A92A 3DWKA 3MXRA 3N4IA 2V1AA 4EBLA 5J7EA 2INWA 4M4XA 5F83A 1L0EA 2H28A 4RYEA 2LB9A 4OPYA 1XGIA 2B18A 1J9MA 1GHIA 4KG6A 1ACFA 5DTKA 1L0FA 1MWTA 1WYBA 4Y15A 4S2MA 2JC7A 5DTSA 4NKPA 4DN0A 5L10A 1KGGA 2H0TA 4IBXA 4DKIA 1KOUA 4I38A 5FI6A 2PYRA 2KX6A 3NJAA 1W63Q 1GCEA 2O0YA 2EXBA 3GV9A 4NG2A 5F1GA 1TS0A 3LI9A 3IBRA 1K55A 4HBUA 4XXRA 4UEYA 5FEGA 5A90A 2ZQ8A 4PM6A 3V39A 5CEBA 4O8GA 5L07A 4GDNA 1JTDA 5HFOA 2ZQCA 3H7WA 1T1AA 2WKIA 2I72A 3VP2A 1PWGA 1SZVA 2JKTI 3UMDA 3F1NA 4MN6A 4LFUA 3IF5A 5IU1A 3ITBA 2EA9A 4ZAMA 5EVIB 4GHIA 3DWZA 4IJGA 2ZC5B 1JWZA 1T18A 1YSQA 1PI5A 4R3AA 2ZM2A 5D3OA 1D1JA 4Y7PA 4LGWA 1S4SA 4GW9A 3G6OA 3MQQA 3ZNYA 4GLQA 1OTEA 4Q0HA 2V0WA 1W5DA 2OSUA 3F1OB 4DE2A 1G5UA 5TBMB 4O0PA 2IWCA 3LGOA 4KQQA 5HPIA 4HI4A 2W1TB 3UDXA 3FV7A 3MS6A 2B95A 3DBAA 4JBFA 3FZCA 2PT7A 2Z6DA 2M1CA 4GHIB 5KSHA 3PAEA 4K0XA 3ZQ5A 4ZJ3A 4CLCC 1MPLA 3CJMA 2A24B 1YPRA 1OT9A 3SW1A 2XDMA 1S6RA 5TFQA 3ZG0A 3LR4A 2XROA 3V5MA 3A3JA 4I3IA 4OLDA 3QP6A 4ARZA 3GSGA 3BLSA 4P6BA 1C3BA 4GS9B 4N92A 1LLBA 3KSIA 3E2KA 3T4SA 3IS2B 3KSGA 3E2LA 4HH2A 3NCKA 3PBSA 5GHXA 1JVJA 4GZBA 4NXBA 2Z6CA 3R4KA 3A0RA 2K2NA 5G4YA 1ES3A 5DFYA 4ZRRA 2FH5A 1PZOA 5HAQA 2JHEA 3IQAA 3QHYA 4BD0A 2GX5A 4ZBEA 4XUXA 3T4JA 4IUHA 4KUOA 4H6JB 3G34A 1ODVA 1PIOA 2PYPA 1DJCA 3MF0A 3VSLA 4IUKA 1D7EA 4FCFA 2J9PA 2XFTA 3LY4A 3Q1FA 1GSWA 5J4EA 1JWVA 5GLAA 4O01A 2Y2JA 2O9AA 1FR1A 3BFDA 3GR2A 1O07A 3E98A 5EV0A 4KQRA 3ISGA 3HUOA 5M18A 1P97A 1M6KA 1K25A 4P0MA 3NIAA 3VP1A 4HHDA 4Y3IA 4BL2A 3EQUA 3UPOA 4BLMA 3WS2A 2EX2A 4HJ4A 2P08A 3B33A 2Q0OA 1LI0A 1ONHA 3ZYTA 3OLOA 2CMNA 3MFXA 4X56A 4OPZA 1NYMA 5CXWA 3G2YA 1VEUA 3KYQA 1ZKJA 4EQ1A 5CHJA 1W8QA 3NY4A 3Q7VB 1K4FA 1SKOA 1BT5A 2ZMVA 5EVIC 2PBDP 1KE3A 4D2OA 3H9WA 1KE0A 4B4ZA 1TDLA 3LR3A 3VOZA 4FH2A 1IKIA 3OCNA 5FASA 1K38A 3N6IA 1N9LA 3OPRA 4X68A 2BTFP 3CI6A 2Y79A 4GD6A 4WM9A 1Q2QA 3VFHA 1LSXA 1MKMA 3HJKA 3GRJA 5I94A 3IXHA 3JYIA 4G3VA 2ZLYA 5K5BA 4Y0TA 1VM1A 2D01A 2HJEA 4ID4A 1FIKA 2VX8A 1S4RA 3DTKA 2JBFA 3FPVA 3V3RA 3C7UA 2HP9A 1F2KA 2PAVP 3H82B 1LI9A 5CX7A 5EVEA 1TVFA 4KZ5A 5CEDA 3VFFA 4QHCA 2FFFB 3CPTB 1E3UA 3IH9A 5HSQA 1SKOB 1O7EA 4GNUA 1CEGA 3C4PA 2PD8A 4HBTA 3A0VA 1N9OA 1VEUB 3WWXA 1BSGA 4QWOA 4MNRA 1CQAA 3G35A 3CLOA 5C5KA 1TEMA 1MWUA 4FH4A 3T50A 2ZL1B 3EEHA 1BTLA 4EU0A 1GA0A 2J3TC 3OPHA 2OWJA 3TSGA 3AGEA 1K6RA 2XF3A 3VSKA 3NOUC 2VV7A 5CRFA 1LT0A 1TD5A 1F5MA 3DTEA 3S7OA 5F6AA 3MQOA 4P87A 3RFBA 1T1CA 3GECA 2QPNA 1EROA 5MC7A 2JKRM 5EE8A 4K0WA 3HLWA 1K6SA 4DDSA 1BULA 3M6HA 4CLCB 1FCNA 5FQ9A 5FAOA 3PHYA 4KZ4A 3E4QA 1KDWA 4R3BA 4DJ2A 1NY0A 3UB7A 4S2OA 4GOGA 3LIEA 5CHMA 1PZPA 3PBNA 1TS7A 2VLGA 3SZTA 1IYSA 5A93A 1Z6FA 4EETB 3PR6A 5FQQA 3UB6A 3FG8A 1PNEA 3LCEA 4PM8A 3PXPA 2W3DA 3LICA 1HVBA 2A2LA 5LBRA 1K4EA 1LHYA 4GJ4A 1YM1A 4KQDA 2I9VA 1SHVA 4MDZA 2W3HA 3IWQA 2WGWB 3G31A 1STZA 1SDNA 2G7UA 4FD8A 4FSFA 1BLHA 5FQJA 4ETXA 4WUJA 4K91A 3EGDC 5F68A 1PWCA 3MFDA 2GDNA 4JGOA 3S1YA 4BWIA 3GMWA 4WN5A 5DJUA 1Z09A 2WKPA 3M2JA 1AWIA 1I2WA 4RA7A 1LL9A 4RVAA 2OLVA 4GN2A 3MR0A 2Y2KA 1MWRA 2XR0A 3NI9A 4GKUA 4HESA 2QWSA 2W1TA 3HLCA 4I39A 4R0QA 4HP9A 3WS4A 5A91A 3PAGA 3QNBA 2QYBA 2L0WA 2KDKA 1G68A 4NETA 1YSPA 4EQIA 1N9NA 2V1BA 2XH9A 4LENA 4OLGA 3WRTA 4KZ7A 3W8KA 5HWTA 5GLDA 2Y2IA 1XP4A 3ZFZA 3LEZA 4JF4A 3KO6A 2QJ7A 3CUEA 3K3CA 3NECA 1IKGA 2OOLA 3G32A 1S1YA 1FCOA 4JGRA 4S2PA 3D9YA 1DP6A 2XRNA 4EEPA 5GLBA 3ZNTA 1IFQA 1H5XA 4R38A 2O9CA 4GB7A 2GNXA 4PPRA 5FAPA 4EWFA 1JNUA 1OPXA 3CUEC 5EVIA 1CJFA 5DJTA 4Y5FA 4JXWA 4GD8A 1GSVA 3C38A 2HDQA 2XD5A 4A5RA 4S2IA 5AQ7A 3VP3A 1OMEA 4WZ5A 4WF0A 3IWIA 1S1ZA 4CLCD 5DKLA 1ESIA 3Q82A 5FQMA 4OQGA 1TDGA 3A3EA 1V9ZA 3NDGA 5HAIA 2EX8A 4MN5A 1ES4A 3IHAA 1SKFA 4BQMA 3MXQA 4OQHA 1ESUA 4B9OA 2ACGA 5EOOA 3MKFA 4X25A 3IXBA 4WYYA 4RX2A 4C75A 2V20A 1NJ4A 2VKSA 3N7WA 1UWNX 4YWZA 4CPKA 1G28A 1YKDA 3OOVA 2W1RA 1WYCA 4X1LA 3HLDA 4F94A 2WZZA 3AGFA 4OH0A 3BEBA 1FSWA 5E2FA 3HUNA 5AJGA 1I5QA 3TRCA 4PKYG 1ONGA 1FOFA 2Y2QA 1Y28A 4PM5A 2ZM8A 4FUWA 4JPMA 1LL8A 2DCFA 2DMWA 2WKHA 3IF6B 3LFVA 2D02A 4YINA 3S7NA 3UDFA 3A3FA 1HZOA 2VV6A 2WUQA 1KVLA 1ES5A 3LO7A 3CWFA 2J9OA 3UB8A 4MEZA 5KMWA 3WS0A 3UE6A 3I7JA 4B88A 5G18A 2OLUA 2H0YA 4O7DA 1KVMA 3SS3A 5EPHA 1ZG4A 3IXDA 3KYZA 3LIFA 4I3JA 5EM0A 2A49A 1WE4A 4UQIM 1PRQA 5HDSA 1K56D 4PM7A 2Y55A 4YFMA 1U60A 2OV5A 4DDYA 1KGEA 5HPFA 4N1XA 4QB8A 3PYPA 4E3KA 2Y91A 3H82A 3R7WA 1DRMA 2M7VA 5FDSA 3C5AA 2C5WB 4D60A 5F5YA 3ZG9B 4BBVA 2GJ3A 1ES2A 4DRTA 1G6AA 5GHZA 5AQ9A 4BBTA 1GHPA 3VOYA 3RXXA 1UWPX 4HH3A 1OTDA 5EM1A 1AXBA 3ZG5A 4Z9QA 2P9VB 4Y0UA 3ULFA 5DF9A 2W0NA 2LB5A 2H10A 1Q2PA 3ZVTA 4JXGA 4HNBA 3HUMA 2X01A 1CI8A 1OJ5A 2WZXA 3BLMA 2QZ6A 4Z1WA 3QP5A 4R4SA 3DTMA 3BM6A 5L09A 4R4RA 2X71A 2Y2OA 1NYYA 4OQ0A 2WYXA 1XKZA 1G6OA 1TS8A 4E3LA 1P9WA 3T1RA 1GHMA 4U0XA 3OC2A 1DJBA 3LR5A 5EOEA 2HJ9C 1DP8A 2Y2LA 1Y54A 3C4OA 2Y2MA 1KGFA 4PHTA 1XGJA 1XA7A 4LRXC 2PHYA 2K31A 2VGJA 3UPNA 4OVDA 4X69A 2B5RA 3K3DA 4Q0IA 2VJWA 5GLCA 1P0ZA 3MXSA 4IVKA 3HLGA 3NOPC 3A3DA 3FWLA 2ZC7A 4QJGA 4ZTKA 4WZ5C 3KYEA 3OZHA 4P85A 2Z2LB 1H0MA 1CF0A 3W2ZA 2ZC4B 1ZTUA 3SH8A 4F3LA 3KX0X 3GDIA 5BOHA 4B93A 3C30A 3P98A 5CTNA 5HDCA 4MN7A 1K0KA 3C7VA 5GL9A 3T1XA 3HJIA 5U47A 4EXOA 4FOFA 5DTTA 4MBFA 5IS1A 5A8BA 2HP5A 3JVUA 5GHYA 3DAVA 4OP5A 4NEED 5HL6A 1YMSA 4L9GA 3W4OA 5AVEA 4WBGA 4CQHA 5HD3A 3NBLA 5FQKA 5I5LA 5F69A 3HL9A 4HIAA 4KG5A 1J3WA 2Y2PA 2XEPA 3E0YA 5FI7A 2B02A 1K54C 4F3LB 2NUPC 4UQIS 4DE3A 1K54A 1KE4A 1MWSA 2PU4A 3BQ8A 2WGVA 3L9KA 3LUQA 4DXBA 5CTMA 1XJ3A 1SDEA 4S2LA 3RTYA 2WK0A 4NXFA 3CAXA 5DF8A 5CGWA 2EWWA 4QPRA 3ZDJA 2Y4AA 3F1PB 4JKTA 4N1HA 4QY6A 1F98A 3T4TA 3A0SA 1E3UD 4JXSA 1MY8A 1XFQA 4DMZA 1OTBA 3MKEA 3NHQA 1Y4OA 1BZAA 5JYOA 3Q81A 3CHWP 4YNRA 5DFXA 4MBHA 3P7NA 2P04A 5G4ZA 3S4XA 2VZWA 2JKFA 3K2NA 3MSHA 1S0WA 1MC0A 2PDRA 5TGFA 2ZQDA 1TS6A 4XT2B 3O87A 3IX4A 5F1FA 4HQAA 2RCXA 3HCYA 2EX6A 2L1MA 3DTIA 3EEAA 3RH8B 3UDIA 5FSRA 4LCLA 5TR7A 4RQ9A 5EFWA 3S22A 5L8MA 3G2ZA 1VETA 3UE0A 1XXMA 4IBRA 1NRFA 5TJJA 1EW0A 1OTAA 1W63M 4LV3A 3BW6A 2X02A 1EWZA 2EFXA 4X53A 4PAUA 3T4QA 4I5SA 3BY9A 1YLPA 5HWWA 5HDDA 2XA7S 4HOIA 1FCMA 3R7WB 2ZMFA 1NZUA 2ZJ9A 2HPBA 1ERQA 4RX3A 1H8YA 4GCZA 3Q7VA 2VA0A 4S2NA 2QMIA 5HL1A 1YMXA 1XA1A 4HY8A 1OJGA 2WADA 5CECA 2VEAA 4Q8IA 3ZHHA 1S66L
chains in the Genus database with same CATH topology
3E2LA 5EVLA 3ZVWA 4BQMA 4OQHA 3NCKA 3PBSA 1ESUA 3W4PA 5GHXA 5EOOA 1JVJA 5KSCA 3MKFA 4GZBA 3IXBA 2J7VA 4E6XA 2XLNA 4WYYA 4RX2A 3Q07A 3ZG7B 4C75A 2V20A 1NJ4A 4KG2A 3VP4A 4PM9A 3BECA 3N7WA 2H5SA 1ES3A 4CPKA 1GA9A 3OPLA 3OPPA 4BD1A 1W7FA 1PZOA 3PBOA 4JF5A 5HAQA 1YLWA 3IQAA 1JTGA 3HLEA 1WYCA 3IF6A 3QHYA 4BD0A 1VQQA 2UWXA 1E25A 3HLDA 4F94A 2WZZA 3AGFA 4OH0A 4OQIA 4XUXA 4ZBEA 2ZMAA 1KDSA 3WS1A 4E3OA 5AQBA 3G34A 2ZC6B 3BEBA 1FSWA 5E2FA 3HUNA 3RXWA 3CZDA 1PIOA 1DJCA 1I5QA 1ONGA 1FOFA 2Y2QA 2A3UA 4KZAA 2ZM8A 4PM5A 2ZQAA 4JPMA 4ZDXA 3Q7ZA 4IEDA 3VSLA 4FCFA 2ZQ9A 4DE1A 2J9PA 2XFTA 3LY4A 3Q1FA 1IYQA 1JWVA 1MKIA 1YLTA 2XFSA 5GLAA 2Y2JA 2DCFA 1FR1A 2WKHA 3BFDA 3GR2A 3IXGA 3SOIA 3IF6B 1O07A 3ZGAB 1L0DA 1E4DA 5HW3A 4S2KA 4KQRA 2C6WB 3ISGA 3ZCZA 5M1AA 3HUOA 4YINA 2V1ZA 2VGKA 1EI5A 3PTEA 3UDFA 3A3FA 1FQGA 1HZOA 4X55A 5M18A 1M6KA 1K25A 2WUQA 4P0MA 4OOLA 4U0TA 1DJAA 1KVLA 1ES5A 3LO7A 2J9OA 3NIAA 4KZBA 1L0GA 1ZG6A 3VP1A 4MEZA 4BL2A 3WS0A 5KMWA 3EQUA 3PBQA 3UPOA 2XQZA 3I7JA 5G18A 4B88A 2OLUA 2H0YA 3WS2A 4O7DA 4BLMA 1KVMA 2EX2A 1HTZA 3SS3A 3HVFA 4DXCA 4WEJA 5EPHA 4E6WA 1LI0A 1MXOA 1ZG4A 3IXDA 1ONHA 4WELA 2PU2A 2PBYA 3IF6C 1JWPA 2A49A 1WE4A 2XD1A 4R3JA 4LV2A 4X56A 3VMAA 4OPZA 1NYMA 5CXWA 3G2YA 1K56D 1PW1A 4PM7A 1N4OA 1IYPA 1ZKJA 3W4QA 1XX2A 4UA7A 3M2KA 2Y55A 3DW0A 4OKPA 4Y0OA 5CHJA 1W8QA 2DNSA 1ALQA 4OPQA 2E8IA 3NY4A 4YFMA 1U60A 3Q7VB 2OV5A 1K4FA 4DDYA 1KGEA 2Y2GA 4C6YA 1BT5A 3MBZA 4QU3A 5EVIC 4N1XA 3ZG8B 1KE3A 5HARA 4D2OA 4QB8A 1KE0A 1YQSA 3UNWA 4B4ZA 1TDLA 3VOZA 3N8RA 4FH2A 3UY6A 1IKIA 3OCNA 4LV0A 5FASA 1K38A 3N6IA 2Y91A 2V2FF 3V50A 4E3KA 3VP0A 2HDSA 3PBRA 5FATA 3SH9A 3OPRA 4H8RA 3WS5A 4X68A 2ZM0A 4GD6A 3C5AA 4KENB 2C5WB 2ZC3B 4WM9A 4GDBA 1Q2QA 3G4PA 3VFHA 4S2NC 3ZG9B 3RJUA 1CK3A 5F82A 1ES2A 4KZ6A 4KQOA 4DRTA 1G6AA 2P9VA 3G30A 5DF7A 5GHZA 1RGZA 1QMFA 1IELA 3GRJA 5AQ9A 2G2UA 5I94A 1GHPA 5EECA 3VOYA 4DE0A 2WKEA 4KZ8A 3RXXA 3IXHA 3JYIA 4BL3A 5L2FA 1K56A 3BFCA 2ZLYA 2Q9NA 2R9XA 4OP8A 4Y0TA 1VM1A 4EBNA 4C3QA 3HREA 1AXBA 4ID4A 1XPBA 1FSYA 3IT9A 4KZ3A 3ZG5A 2JCHA 1CEFA 4Z9QA 2P9VB 4ZJ2A 2EFUA 4Y0UA 1M40A 5DF9A 1BLCA 2XGNA 2H10A 1PW8A 1Q2PA 2JBFA 3ZVTA 2XK1A 3V3RA 4B4XA 3FKWA 4JXGA 3C7UA 2HP9A 1CI9A 3D4FA 4ZJ1A 3NC8A 3HUMA 2X01A 1CI8A 2WZXA 3BLMA 5DVAA 2EX9A 2QZ6A 2IWDA 4R4SA 1LI9A 3DTMA 3BM6A 3OCLA 3HLBA 1TVFA 2WGIA 3UE3A 4KZ5A 5CEDA 4R4RA 2X71A 5CGXA 3VFFA 4QHCA 2Y2OA 1NYYA 3BFEA 2FFFB 4OQ0A 2WYXA 1E3UA 2G2WA 2RL3A 3IH9A 1K57C 1XKZA 5HX9A 3BYDA 4E3LA 1O7EA 1GHMA 4GNUA 4U0XA 3OC2A 1DJBA 1CEGA 1W79A 5EOEA 4BENA 5CERA 3WRZA 3C4PA 4JLFA 1PYYA 4OOYA 3N8SA 1H8ZA 2Y2LA 2Y2HA 4HBTA 1Y54A 4S2JA 4E3JA 5FAQA 4QD4A 3C4OA 1IYOA 3IHBA 3WWXA 4WEKA 1BSGA 2Y2MA 4PMAA 4MNRA 4E3IA 1KGFA 3G35A 3AGDA 1XGJA 1BLSA 1TEMA 5E2GA 1XA7A 3M6BA 3LY3A 1MWUA 2Y59A 1K57A 4FH4A 2VGJA 3UPNA 1HD8A 1BTLA 1PWDA 1GA0A 5HAPA 4OVDA 1YLYA 2B5RA 4X69A 4MBKA 5GLCA 2CC1A 3OPHA 4M3KA 3TSGA 3AGEA 1YLJA 4UAAA 1K6RA 3MXSA 2XF3A 2WGWA 3HLGA 4IVKA 2WAEA 3VSKA 3A3DA 3FWLA 2ZC7A 4QJGA 4ZTKA 3HLFA 4WZ5C 5CRFA 2DRWA 3OZHA 3IWOA 4KZ9A 4U3TA 4P85A 3CG5A 2Z2LB 1W8YA 5JYPA 3N8LA 3A3IA 4LV1A 4LCMA 4N9LA 4OPRA 4P87A 1LL5A 2QPNA 1EROA 2ZC4B 3SH8A 3GVBA 5EE8A 1YT4A 4K0WA 4EV4A 3HLWA 1RCJA 3BFFA 1K6SA 2HDUA 5BOHA 5E43A 4DDSA 3UN7A 2WAFA 4JF6A 3P98A 4L0LA 5CTNA 1BULA 2EXAA 2ZD8A 3MZEA 3M6HA 4E3MA 1FCNA 4IVIA 5FQ9A 4CJNA 5FAOA 4OOMA 1BUEA 4HEFA 3FYZA 4KZ4A 5EVID 1KDWA 4R3BA 3IH8A 5E2EA 1NY0A 3C7VA 5GL9A 3BRMA 4R1GA 4WZ4A 4S2OA 4GOGA 5CHMA 1FR6A 1PZPA 4R23A 5U47A 5A92A 3PBNA 5E2HA 2IWBA 3DWKA 3O3VA 4UA6A 5DTTA 4MBFA 1N9BA 3MXRA 1IYSA 1K55C 5A93A 1Z6FA 3N4IA 4UHUA 2HP5A 1YLZA 4EBLA 5FA7A 5FQQA 5GHYA 4BJPA 4OP5A 1YMSA 3LCEA 3EQVA 4PM8A 5F83A 1L0EA 3W4OA 3ZHHA 4EUZA 1HVBA 3FKVA 4RYEA 4WBGA 3V3SA 4OPYA 1NXYA 1XGIA 3NBLA 1K4EA 4N9KA 5FDHA 5FQKA 1J9MA 1LHYA 2J8YA 1YM1A 1GHIA 1RGYA 4KG6A 1QMEA 5DTKA 3HL9A 1L0FA 1MWTA 4KG5A 1WYBA 2Y2PA 1SHVA 5IHVA 4S2MA 2JC7A 5DTSA 3SH7A 1KGGA 2H0TA 2XEPA 3IWQA 2WGWB 3G31A 4IBXA 5FI7A 4DKIA 5FI6A 1SDNA 4FD8A 1GCEA 1BLHA 1K54C 3O86A 4FSFA 4DE3A 5FQJA 2EXBA 3GV9A 4K91A 1ERMA 5F1GA 1K54A 1PWCA 3NDEA 4WMCD 1KE4A 3BFGA 1MWSA 2PU4A 2WGVA 2HP6A 3MFDA 1K55A 4HBUA 4XXRA 3ITAA 2GDNA 3UE1A 4DXBA 3S1YA 5CTMA 3GMWA 1SDEA 4S2LA 5A90A 2WK0A 2ZQ8A 4PM6A 5DF8A 3B3XA 3M2JA 5CGWA 3V39A 5CEBA 1I2WA 4RA7A 1LL9A 3ZDJA 4GDNA 2Y4AA 2OLVA 4GN2A 1JTDA 4RVAA 5HFOA 2ZQCA 4JKTA 4N1HA 4QY6A 1L2SA 2WKIA 4UA9A 2I72A 3TG9A 4MLLA 3VP2A 3SS5A 2JE5A 2Y2KA 1E3UD 1PWGA 4JXSA 4XUZA 1MWRA 1MY8A 3MKEA 2XR0A 1NZOA 1BZAA 5JYOA 3NI9A 4GKUA 4HESA 3O88A 3Q81A 3IF5A 3HLCA 4MBHA 3ITBA 4R0QA 2FFYA 3MZFA 3MZDA 3S4XA 4ZAMA 3WS4A 5EVIB 5A91A 3GTCA 3UPPA 3PAGA 3CMZA 1S0WA 4WMCA 2ZQ7A 3QNBA 3DWZA 5TGFA 2ZQDA 2ZC5B 1JWZA 3O87A 1G68A 1PI5A 5EUAA 4NETA 4JXVA 4EQIA 2ZM2A 5D3OA 1SCWA 4Y7PA 5F1FA 2XH9A 4LENA 4OLGA 5FI2A 2RCXA 3WRTA 3ZNYA 2EX6A 2Y2NA 4KZ7A 4DF6A 1PI4A 1DY6A 4QY5A 3UDIA 3W8KA 5GLDA 1W5DA 2OSUA 5FSRA 2Y2IA 1XP4A 3QNCA 4LCLA 5FQIA 3LEZA 5CGSA 5TR7A 3ZFZA 3S22A 4JF4A 4DE2A 3G2ZA 3UE0A 1I2SA 5J8XA 3P09A 1BLPA 5CHUA 1XXMA 2BG1A 4IBRA 1NRFA 2IWCA 1ZC2A 1IKGA 3G32A 1FCOA 4LV3A 4KQQA 4S2PA 2HDRA 2X02A 4X6TA 5AQAA 5GLBA 3UDXA 3FV7A 1EWZA 2EFXA 4X53A 4OONA 1YLPA 4JBFA 3SS4A 3FZCA 3ZNTA 2BLSA 1H5XA 3PBTA 1RP5A 4GB7A 4PPRA 2R9WA 5FAPA 4EWFA 1FCMA 4NK3A 2Z2MB 5M19A 5KSHA 5EVIA 3PAEA 4K0XA 4JXWA 4GD8A 2HDQA 2XD5A 3GQZA 4ZJ3A 4A5RA 4S2IA 5AQ7A 4EBPA 1MPLA 3VP3A 1OMEA 3CJMA 1NZUA 2ZJ9A 4WZ5A 2HPBA 1ERQA 3TOIA 4E3NA 2XDMA 3IWIA 1S6RA 4RX3A 5TFQA 3ZG0A 3UO9A 3HBRA 3V5MA 5KZHA 3A3JA 1H8YA 1MBLA 3Q7VA 4S2NA 1ESIA 2QMIA 5HL1A 2P74A 3Q82A 1IEMA 4OLDA 5FQMA 1YMXA 4OQGA 1XA1A 1TDGA 3A3EA 3GSGA 3NDGA 3BLSA 2WADA 5HAIA 2EX8A 4P6BA 1ES4A 1C3BA 5CECA 3IHAA 4N92A 1LLBA 4Q8IA 3E2KA 2Q9MA 1SKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2L A;  5EVL A;  3ZVW A;  4BQM A;  4OQH A;  3NCK A;  3PBS A;  1ESU A;  3W4P A;  5GHX A;  5EOO A;  1JVJ A;  5KSC A;  3MKF A;  4GZB A;  3IXB A;  2J7V A;  4E6X A;  2XLN A;  4WYY A;  4RX2 A;  3Q07 A;  3ZG7 B;  4C75 A;  2V20 A;  1NJ4 A;  4KG2 A;  3VP4 A;  4PM9 A;  3BEC A;  3N7W A;  2H5S A;  1ES3 A;  4CPK A;  1GA9 A;  3OPL A;  3OPP A;  4BD1 A;  1W7F A;  1PZO A;  3PBO A;  4JF5 A;  5HAQ A;  1YLW A;  3IQA A;  1JTG A;  3HLE A;  1WYC A;  3IF6 A;  3QHY A;  4BD0 A;  1VQQ A;  2UWX A;  1E25 A;  3HLD A;  4F94 A;  2WZZ A;  3AGF A;  4OH0 A;  4OQI A;  4XUX A;  4ZBE A;  2ZMA A;  1KDS A;  3WS1 A;  4E3O A;  5AQB A;  3G34 A;  2ZC6 B;  3BEB A;  1FSW A;  5E2F A;  3HUN A;  3RXW A;  3CZD A;  1PIO A;  1DJC A;  1I5Q A;  1ONG A;  1FOF A;  2Y2Q A;  2A3U A;  4KZA A;  2ZM8 A;  4PM5 A;  2ZQA A;  4JPM A;  4ZDX A;  3Q7Z A;  4IED A;  3VSL A;  4FCF A;  2ZQ9 A;  4DE1 A;  2J9P A;  2XFT A;  3LY4 A;  3Q1F A;  1IYQ A;  1JWV A;  1MKI A;  1YLT A;  2XFS A;  5GLA A;  2Y2J A;  2DCF A;  1FR1 A;  2WKH A;  3BFD A;  3GR2 A;  3IXG A;  3SOI A;  3IF6 B;  1O07 A;  3ZGA B;  1L0D A;  1E4D A;  5HW3 A;  4S2K A;  4KQR A;  2C6W B;  3ISG A;  3ZCZ A;  5M1A A;  3HUO A;  4YIN A;  2V1Z A;  2VGK A;  1EI5 A;  3PTE A;  3UDF A;  3A3F A;  1FQG A;  1HZO A;  4X55 A;  5M18 A;  1M6K A;  1K25 A;  2WUQ A;  4P0M A;  4OOL A;  4U0T A;  1DJA A;  1KVL A;  1ES5 A;  3LO7 A;  2J9O A;  3NIA A;  4KZB A;  1L0G A;  1ZG6 A;  3VP1 A;  4MEZ A;  4BL2 A;  3WS0 A;  5KMW A;  3EQU A;  3PBQ A;  3UPO A;  2XQZ A;  3I7J A;  5G18 A;  4B88 A;  2OLU A;  2H0Y A;  3WS2 A;  4O7D A;  4BLM A;  1KVM A;  2EX2 A;  1HTZ A;  3SS3 A;  3HVF A;  4DXC A;  4WEJ A;  5EPH A;  4E6W A;  1LI0 A;  1MXO A;  1ZG4 A;  3IXD A;  1ONH A;  4WEL A;  2PU2 A;  2PBY A;  3IF6 C;  1JWP A;  2A49 A;  1WE4 A;  2XD1 A;  4R3J A;  4LV2 A;  4X56 A;  3VMA A;  4OPZ A;  1NYM A;  5CXW A;  3G2Y A;  1K56 D;  1PW1 A;  4PM7 A;  1N4O A;  1IYP A;  1ZKJ A;  3W4Q A;  1XX2 A;  4UA7 A;  3M2K A;  2Y55 A;  3DW0 A;  4OKP A;  4Y0O A;  5CHJ A;  1W8Q A;  2DNS A;  1ALQ A;  4OPQ A;  2E8I A;  3NY4 A;  4YFM A;  1U60 A;  3Q7V B;  2OV5 A;  1K4F A;  4DDY A;  1KGE A;  2Y2G A;  4C6Y A;  1BT5 A;  3MBZ A;  4QU3 A;  5EVI C;  4N1X A;  3ZG8 B;  1KE3 A;  5HAR A;  4D2O A;  4QB8 A;  1KE0 A;  1YQS A;  3UNW A;  4B4Z A;  1TDL A;  3VOZ A;  3N8R A;  4FH2 A;  3UY6 A;  1IKI A;  3OCN A;  4LV0 A;  5FAS A;  1K38 A;  3N6I A;  2Y91 A;  2V2F F;  3V50 A;  4E3K A;  3VP0 A;  2HDS A;  3PBR A;  5FAT A;  3SH9 A;  3OPR A;  4H8R A;  3WS5 A;  4X68 A;  2ZM0 A;  4GD6 A;  3C5A A;  4KEN B;  2C5W B;  2ZC3 B;  4WM9 A;  4GDB A;  1Q2Q A;  3G4P A;  3VFH A;  4S2N C;  3ZG9 B;  3RJU A;  1CK3 A;  5F82 A;  1ES2 A;  4KZ6 A;  4KQO A;  4DRT A;  1G6A A;  2P9V A;  3G30 A;  5DF7 A;  5GHZ A;  1RGZ A;  1QMF A;  1IEL A;  3GRJ A;  5AQ9 A;  2G2U A;  5I94 A;  1GHP A;  5EEC A;  3VOY A;  4DE0 A;  2WKE A;  4KZ8 A;  3RXX A;  3IXH A;  3JYI A;  4BL3 A;  5L2F A;  1K56 A;  3BFC A;  2ZLY A;  2Q9N A;  2R9X A;  4OP8 A;  4Y0T A;  1VM1 A;  4EBN A;  4C3Q A;  3HRE A;  1AXB A;  4ID4 A;  1XPB A;  1FSY A;  3IT9 A;  4KZ3 A;  3ZG5 A;  2JCH A;  1CEF A;  4Z9Q A;  2P9V B;  4ZJ2 A;  2EFU A;  4Y0U A;  1M40 A;  5DF9 A;  1BLC A;  2XGN A;  2H10 A;  1PW8 A;  1Q2P A;  2JBF A;  3ZVT A;  2XK1 A;  3V3R A;  4B4X A;  3FKW A;  4JXG A;  3C7U A;  2HP9 A;  1CI9 A;  3D4F A;  4ZJ1 A;  3NC8 A;  3HUM A;  2X01 A;  1CI8 A;  2WZX A;  3BLM A;  5DVA A;  2EX9 A;  2QZ6 A;  2IWD A;  4R4S A;  1LI9 A;  3DTM A;  3BM6 A;  3OCL A;  3HLB A;  1TVF A;  2WGI A;  3UE3 A;  4KZ5 A;  5CED A;  4R4R A;  2X71 A;  5CGX A;  3VFF A;  4QHC A;  2Y2O A;  1NYY A;  3BFE A;  2FFF B;  4OQ0 A;  2WYX A;  1E3U A;  2G2W A;  2RL3 A;  3IH9 A;  1K57 C;  1XKZ A;  5HX9 A;  3BYD A;  4E3L A;  1O7E A;  1GHM A;  4GNU A;  4U0X A;  3OC2 A;  1DJB A;  1CEG A;  1W79 A;  5EOE A;  4BEN A;  5CER A;  3WRZ A;  3C4P A;  4JLF A;  1PYY A;  4OOY A;  3N8S A;  1H8Z A;  2Y2L A;  2Y2H A;  4HBT A;  1Y54 A;  4S2J A;  4E3J A;  5FAQ A;  4QD4 A;  3C4O A;  1IYO A;  3IHB A;  3WWX A;  4WEK A;  1BSG A;  2Y2M A;  4PMA A;  4MNR A;  4E3I A;  1KGF A;  3G35 A;  3AGD A;  1XGJ A;  1BLS A;  1TEM A;  5E2G A;  1XA7 A;  3M6B A;  3LY3 A;  1MWU A;  2Y59 A;  1K57 A;  4FH4 A;  2VGJ A;  3UPN A;  1HD8 A;  1BTL A;  1PWD A;  1GA0 A;  5HAP A;  4OVD A;  1YLY A;  2B5R A;  4X69 A;  4MBK A;  5GLC A;  2CC1 A;  3OPH A;  4M3K A;  3TSG A;  3AGE A;  1YLJ A;  4UAA A;  1K6R A;  3MXS A;  2XF3 A;  2WGW A;  3HLG A;  4IVK A;  2WAE A;  3VSK A;  3A3D A;  3FWL A;  2ZC7 A;  4QJG A;  4ZTK A;  3HLF A;  4WZ5 C;  5CRF A;  2DRW A;  3OZH A;  3IWO A;  4KZ9 A;  4U3T A;  4P85 A;  3CG5 A;  2Z2L B;  1W8Y A;  5JYP A;  3N8L A;  3A3I A;  4LV1 A;  4LCM A;  4N9L A;  4OPR A;  4P87 A;  1LL5 A;  2QPN A;  1ERO A;  2ZC4 B;  3SH8 A;  3GVB A;  5EE8 A;  1YT4 A;  4K0W A;  4EV4 A;  3HLW A;  1RCJ A;  3BFF A;  1K6S A;  2HDU A;  5BOH A;  5E43 A;  4DDS A;  3UN7 A;  2WAF A;  4JF6 A;  3P98 A;  4L0L A;  5CTN A;  1BUL A;  2EXA A;  2ZD8 A;  3MZE A;  3M6H A;  4E3M A;  1FCN A;  4IVI A;  5FQ9 A;  4CJN A;  5FAO A;  4OOM A;  1BUE A;  4HEF A;  3FYZ A;  4KZ4 A;  5EVI D;  1KDW A;  4R3B A;  3IH8 A;  5E2E A;  1NY0 A;  3C7V A;  5GL9 A;  3BRM A;  4R1G A;  4WZ4 A;  4S2O A;  4GOG A;  5CHM A;  1FR6 A;  1PZP A;  4R23 A;  5U47 A;  5A92 A;  3PBN A;  5E2H A;  2IWB A;  3DWK A;  3O3V A;  4UA6 A;  5DTT A;  4MBF A;  1N9B A;  3MXR A;  1IYS A;  1K55 C;  5A93 A;  1Z6F A;  3N4I A;  4UHU A;  2HP5 A;  1YLZ A;  4EBL A;  5FA7 A;  5FQQ A;  5GHY A;  4BJP A;  4OP5 A;  1YMS A;  3LCE A;  3EQV A;  4PM8 A;  5F83 A;  1L0E A;  3W4O A;  3ZHH A;  4EUZ A;  1HVB A;  3FKV A;  4RYE A;  4WBG A;  3V3S A;  4OPY A;  1NXY A;  1XGI A;  3NBL A;  1K4E A;  4N9K A;  5FDH A;  5FQK A;  1J9M A;  1LHY A;  2J8Y A;  1YM1 A;  1GHI A;  1RGY A;  4KG6 A;  1QME A;  5DTK A;  3HL9 A;  1L0F A;  1MWT A;  4KG5 A;  1WYB A;  2Y2P A;  1SHV A;  5IHV A;  4S2M A;  2JC7 A;  5DTS A;  3SH7 A;  1KGG A;  2H0T A;  2XEP A;  3IWQ A;  2WGW B;  3G31 A;  4IBX A;  5FI7 A;  4DKI A;  5FI6 A;  1SDN A;  4FD8 A;  1GCE A;  1BLH A;  1K54 C;  3O86 A;  4FSF A;  4DE3 A;  5FQJ A;  2EXB A;  3GV9 A;  4K91 A;  1ERM A;  5F1G A;  1K54 A;  1PWC A;  3NDE A;  4WMC D;  1KE4 A;  3BFG A;  1MWS A;  2PU4 A;  2WGV A;  2HP6 A;  3MFD A;  1K55 A;  4HBU A;  4XXR A;  3ITA A;  2GDN A;  3UE1 A;  4DXB A;  3S1Y A;  5CTM A;  3GMW A;  1SDE A;  4S2L A;  5A90 A;  2WK0 A;  2ZQ8 A;  4PM6 A;  5DF8 A;  3B3X A;  3M2J A;  5CGW A;  3V39 A;  5CEB A;  1I2W A;  4RA7 A;  1LL9 A;  3ZDJ A;  4GDN A;  2Y4A A;  2OLV A;  4GN2 A;  1JTD A;  4RVA A;  5HFO A;  2ZQC A;  4JKT A;  4N1H A;  4QY6 A;  1L2S A;  2WKI A;  4UA9 A;  2I72 A;  3TG9 A;  4MLL A;  3VP2 A;  3SS5 A;  2JE5 A;  2Y2K A;  1E3U D;  1PWG A;  4JXS A;  4XUZ A;  1MWR A;  1MY8 A;  3MKE A;  2XR0 A;  1NZO A;  1BZA A;  5JYO A;  3NI9 A;  4GKU A;  4HES A;  3O88 A;  3Q81 A;  3IF5 A;  3HLC A;  4MBH A;  3ITB A;  4R0Q A;  2FFY A;  3MZF A;  3MZD A;  3S4X A;  4ZAM A;  3WS4 A;  5EVI B;  5A91 A;  3GTC A;  3UPP A;  3PAG A;  3CMZ A;  1S0W A;  4WMC A;  2ZQ7 A;  3QNB A;  3DWZ A;  5TGF A;  2ZQD A;  2ZC5 B;  1JWZ A;  3O87 A;  1G68 A;  1PI5 A;  5EUA A;  4NET A;  4JXV A;  4EQI A;  2ZM2 A;  5D3O A;  1SCW A;  4Y7P A;  5F1F A;  2XH9 A;  4LEN A;  4OLG A;  5FI2 A;  2RCX A;  3WRT A;  3ZNY A;  2EX6 A;  2Y2N A;  4KZ7 A;  4DF6 A;  1PI4 A;  1DY6 A;  4QY5 A;  3UDI A;  3W8K A;  5GLD A;  1W5D A;  2OSU A;  5FSR A;  2Y2I A;  1XP4 A;  3QNC A;  4LCL A;  5FQI A;  3LEZ A;  5CGS A;  5TR7 A;  3ZFZ A;  3S22 A;  4JF4 A;  4DE2 A;  3G2Z A;  3UE0 A;  1I2S A;  5J8X A;  3P09 A;  1BLP A;  5CHU A;  1XXM A;  2BG1 A;  4IBR A;  1NRF A;  2IWC A;  1ZC2 A;  1IKG A;  3G32 A;  1FCO A;  4LV3 A;  4KQQ A;  4S2P A;  2HDR A;  2X02 A;  4X6T A;  5AQA A;  5GLB A;  3UDX A;  3FV7 A;  1EWZ A;  2EFX A;  4X53 A;  4OON A;  1YLP A;  4JBF A;  3SS4 A;  3FZC A;  3ZNT A;  2BLS A;  1H5X A;  3PBT A;  1RP5 A;  4GB7 A;  4PPR A;  2R9W A;  5FAP A;  4EWF A;  1FCM A;  4NK3 A;  2Z2M B;  5M19 A;  5KSH A;  5EVI A;  3PAE A;  4K0X A;  4JXW A;  4GD8 A;  2HDQ A;  2XD5 A;  3GQZ A;  4ZJ3 A;  4A5R A;  4S2I A;  5AQ7 A;  4EBP A;  1MPL A;  3VP3 A;  1OME A;  3CJM A;  1NZU A;  2ZJ9 A;  4WZ5 A;  2HPB A;  1ERQ A;  3TOI A;  4E3N A;  2XDM A;  3IWI A;  1S6R A;  4RX3 A;  5TFQ A;  3ZG0 A;  3UO9 A;  3HBR A;  3V5M A;  5KZH A;  3A3J A;  1H8Y A;  1MBL A;  3Q7V A;  4S2N A;  1ESI A;  2QMI A;  5HL1 A;  2P74 A;  3Q82 A;  1IEM A;  4OLD A;  5FQM A;  1YMX A;  4OQG A;  1XA1 A;  1TDG A;  3A3E A;  3GSG A;  3NDG A;  3BLS A;  2WAD A;  5HAI A;  2EX8 A;  4P6B A;  1ES4 A;  1C3B A;  5CEC A;  3IHA A;  4N92 A;  1LLB A;  4Q8I A;  3E2K A;  2Q9M A;  1SKF A; 
#chains in the Genus database with same CATH topology
 3W4P A;  2J7V A;  4E6X A;  2XLN A;  3Q07 A;  3B47 A;  4KG2 A;  3VP4 A;  4PM9 A;  3BEC A;  3OPL A;  4BD1 A;  4R70 A;  3PBO A;  4JF5 A;  1T1B A;  1YLW A;  3JVV A;  3IF6 A;  1VQQ A;  3U4L P;  3T1Q B;  1KDS A;  3WS1 A;  2ZC6 B;  3BY8 A;  3RXW A;  1H8M A;  4AFI A;  4YOF A;  5FL3 A;  3S7P A;  2A3U A;  4KZA A;  2ZQA A;  4ZDX A;  3Q7Z A;  3IX3 A;  3LYX A;  4IED A;  3T4O A;  2ZQ9 A;  4DE1 A;  1MKI A;  3SOI A;  3ZGA B;  2PR5 A;  1E4D A;  5HW3 A;  1H3Q A;  4S2K A;  2C6W B;  3ZCZ A;  2VGK A;  3PTE A;  1EI5 A;  1FQG A;  4U0T A;  2PD7 A;  1L0G A;  1ZG6 A;  1F9I A;  3QP4 A;  2XQZ A;  3HVF A;  4DXC A;  4WEJ A;  3KSH A;  4WEL A;  2PU2 A;  3IF6 C;  4EW7 A;  2XD1 A;  4GS9 A;  4R3J A;  4LV2 A;  3VMA A;  1PW1 A;  4EEU A;  1IYP A;  1XX2 A;  4UA7 A;  2L4R A;  4OKP A;  2DNS A;  1ALQ A;  4OPQ A;  2V9A A;  4C6Y A;  3MBZ A;  3D72 A;  3UNW A;  2A24 A;  3UY6 A;  4LV0 A;  3VP0 A;  5FAT A;  4H8R A;  2W3E A;  2ZM0 A;  4GDB A;  3G4P A;  4S2N C;  5TBM A;  3RJU A;  1CK3 A;  3F1O A;  3G30 A;  5DF7 A;  1QMF A;  3EGX C;  5EEC A;  4KZ8 A;  4BL3 A;  3BFC A;  3BWL A;  5HZH A;  2R9X A;  4OP8 A;  3HRE A;  1L3L A;  1FSY A;  1CEF A;  2EFU A;  1NLZ A;  1BLC A;  2QJ5 A;  1PW8 A;  3EOI A;  4Y13 A;  3FKW A;  2W3G A;  2R78 A;  2HGV A;  1CI9 A;  4Q0J A;  3NC8 A;  2XA7 M;  5DVA A;  2IWD A;  1D06 A;  3HLB A;  5CGX A;  1XJ4 A;  3BFE A;  2XSS A;  1K57 C;  3BYD A;  5FEF A;  3VOL A;  4EES A;  5CER A;  3H7W B;  2VV8 A;  4OOY A;  1H8Z A;  2ZBB A;  2HF6 A;  4E3J A;  4QD4 A;  1LSV A;  4E3I A;  1NRJ A;  1OT6 A;  3AGD A;  1BLS A;  1ZHH B;  3C2W A;  5E2G A;  2Y59 A;  1K57 A;  3JPU A;  1LSW A;  1YAX A;  1YLY A;  4DJ3 A;  2CC1 A;  4M3K A;  1YLJ A;  2WGW A;  4ETZ A;  4KUK A;  3HLF A;  2DRW A;  4HJ3 A;  3IWO A;  4KZ9 A;  4U3T A;  3CG5 A;  3TW8 A;  5JYP A;  3ICY A;  4OPR A;  1LL5 A;  4Y17 A;  3U2A A;  3GVB A;  1RCJ A;  2HDU A;  3UME A;  2QKP A;  2WAF A;  4JF6 A;  4L0L A;  2EXA A;  4JGP A;  3MZE A;  3E4O A;  4E3M A;  4IVI A;  4MCW A;  3S7Q A;  4HEF A;  3FYZ A;  5DKK A;  5E2E A;  3FC7 A;  4R1G A;  4WZ4 A;  4R23 A;  3O5Y A;  2IWB A;  5E2H A;  2NUT C;  1S67 L;  3O3V A;  4UA6 A;  1N9B A;  3IBJ A;  4CLC A;  1K55 C;  4LPZ A;  4UHU A;  1YLZ A;  5FA7 A;  4BJP A;  3T4L A;  3LR0 A;  3UB9 A;  3EQV A;  4EUZ A;  3FKV A;  3V3S A;  1NXY A;  4N9K A;  5FDH A;  3BJN A;  2J8Y A;  1RGY A;  1QME A;  4X1M A;  4P6Z M;  5IHV A;  3SH7 A;  3TJZ C;  3QP8 A;  4BMW A;  3O86 A;  4R6L A;  1ERM A;  2E8J A;  2HZ5 A;  3NDE A;  4WMC D;  3BFG A;  2HP6 A;  3ITA A;  3UE1 A;  5AVF A;  4EUV A;  2MJ6 A;  3B3X A;  2VK3 A;  2QHK A;  4HP4 A;  1L2S A;  4UA9 A;  3TG9 A;  4MLL A;  4L9F A;  3SS5 A;  2JE5 A;  3VE3 A;  1P9R A;  4XUZ A;  4WL9 A;  3VV4 A;  4ESP A;  1NZO A;  1BYW A;  3O88 A;  3L7H A;  4PKY A;  2FFY A;  3MZF A;  3MZD A;  4EER A;  1HLU P;  3GTC A;  3UPP A;  4Y2F A;  4MMN A;  1A0K A;  3CMZ A;  4WMC A;  2ZQ7 A;  3CPT A;  2JKT M;  3KSF A;  5EUA A;  3B42 A;  3MQ0 A;  4JXV A;  1SCW A;  5FI2 A;  4E04 A;  1VET B;  2Y2N A;  4DF6 A;  1PI4 A;  1DY6 A;  2V0U A;  4QY5 A;  4BBU A;  3BQA A;  3QNC A;  5FQI A;  5CGS A;  1I2S A;  4WLA A;  2VGL M;  5J8X A;  3P09 A;  1BLP A;  5CHU A;  2BG1 A;  3QP2 A;  1VHM A;  1ZC2 A;  2OAQ 1;  4HJ6 A;  2HDR A;  4XT2 A;  4X6T A;  5AQA A;  5HWV A;  4OON A;  2ZOI A;  3SS4 A;  2BLS A;  2K7S A;  3PBT A;  1RP5 A;  2Y8H A;  2R9W A;  4NK3 A;  2Z2M B;  5M19 A;  2OWH A;  2JKG A;  3F1P A;  3GQZ A;  4EBP A;  1WA9 A;  3V67 A;  3TOI A;  4E3N A;  3UO9 A;  3HBR A;  5IT5 A;  5KZH A;  1MBL A;  1T19 A;  2J3W A;  2V8C A;  2P74 A;  1IEM A;  2J80 A;  3LEQ A;  3NUL A;  1VB6 A;  2Q9M A;  1XJ6 A;  5EVL A;  3CIT A;  3ZVW A;  2WKR A;  4NXG A;  5KSC A;  3ZG7 B;  1MZU A;  1DP9 A;  2KLI A;  2H5S A;  1GA9 A;  3OPP A;  1W7F A;  4G3K A;  1JTG A;  3HLE A;  2UWX A;  1E25 A;  4H6J A;  4OQI A;  2ZMA A;  4E3O A;  5AQB A;  1TF1 A;  3LID A;  3CZD A;  1IYQ A;  1YLT A;  2XFS A;  3IX8 A;  4II7 A;  1XFN A;  4K08 A;  3IXG A;  1L0D A;  2W3F A;  5M1A A;  5KIZ A;  2V1Z A;  4X55 A;  4OOL A;  1DJA A;  4KZB A;  2O99 A;  3PBQ A;  3T1S A;  4LRZ E;  1HTZ A;  3EWK A;  4E6W A;  1MXO A;  2PBY A;  3IS2 A;  1JWP A;  2PR6 A;  3QP1 A;  3VE4 A;  4CLC E;  1N4O A;  1IOU A;  3W4Q A;  3M2K A;  4ARZ B;  3DW0 A;  4Y0O A;  2EWV A;  1NWZ A;  2E8I A;  2P7J A;  2ZL1 A;  2ZOH A;  2IA2 A;  2Y2G A;  1XJ2 A;  4QU3 A;  3ZG8 B;  5HAR A;  3E4P A;  1YQS A;  2M7U A;  1PFL A;  3N8R A;  4LRY C;  3V50 A;  2V2F F;  4ME4 A;  2HDS A;  3PBR A;  3SH9 A;  3WS5 A;  1V9Y A;  4KEN B;  2ZC3 B;  5F82 A;  4KZ6 A;  4KQO A;  1NLY A;  4I3A A;  2P9V A;  1RGZ A;  1IEL A;  2G2U A;  1OTI A;  2V8F A;  2KOI A;  4DE0 A;  2WKE A;  5L2F A;  1K56 A;  2Q9N A;  3P01 A;  2BAS A;  2OAP 1;  2GZA A;  4EBN A;  4C3Q A;  4P6Z S;  1XPB A;  3IT9 A;  4KZ3 A;  2JN7 A;  2JCH A;  4ZJ2 A;  3T4K A;  1M40 A;  2XGN A;  2XK1 A;  4B4X A;  3C8C A;  3D4F A;  2PRF A;  4ZJ1 A;  3MMH A;  2EX9 A;  3OCL A;  2WGI A;  3UE3 A;  2O9B A;  2RL3 A;  2G2W A;  5HX9 A;  2J3T D;  1W79 A;  4BEN A;  1X0O A;  3WRZ A;  5HD5 A;  4JLF A;  1PYY A;  3N8S A;  2Y2H A;  4S2J A;  3NOT C;  5FAQ A;  1IYO A;  3IHB A;  4FTX A;  4WEK A;  3LI8 A;  4PMA A;  3F1N B;  4NXE A;  3MJQ A;  4IHQ A;  3M6B A;  3LY3 A;  3LIB A;  1HD8 A;  1PWD A;  1UGU A;  5HAP A;  3OBF A;  4MBK A;  3T12 B;  2YKH A;  4UAA A;  3TE8 A;  3UB5 P;  2WAE A;  4JGQ A;  1GSX A;  2AVX A;  1FIL A;  1W8Y A;  3N8L A;  3A3I A;  4LV1 A;  4LCM A;  4N9L A;  2HV1 A;  1YT4 A;  4EV4 A;  3BFF A;  4LLO B;  5E43 A;  3FPW A;  3UN7 A;  4G3W A;  2JKR I;  2ZD8 A;  2VGL S;  4CJN A;  4L9E A;  4OOM A;  2YKF A;  1BUE A;  5EVI D;  2UV0 E;  3D3O A;  3IH8 A;  2FZ0 A;  3LIA A;  2W27 A;  3BRM A;  5J3W A;  1FR6 A;  2WKQ A;  5A92 A;  3DWK A;  3MXR A;  3N4I A;  2V1A A;  4EBL A;  5J7E A;  2INW A;  4M4X A;  5F83 A;  1L0E A;  2H28 A;  4RYE A;  2LB9 A;  4OPY A;  1XGI A;  2B18 A;  1J9M A;  1GHI A;  4KG6 A;  1ACF A;  5DTK A;  1L0F A;  1MWT A;  1WYB A;  4Y15 A;  4S2M A;  2JC7 A;  5DTS A;  4NKP A;  4DN0 A;  5L10 A;  1KGG A;  2H0T A;  4IBX A;  4DKI A;  1KOU A;  4I38 A;  5FI6 A;  2PYR A;  2KX6 A;  3NJA A;  1W63 Q;  1GCE A;  2O0Y A;  2EXB A;  3GV9 A;  4NG2 A;  5F1G A;  1TS0 A;  3LI9 A;  3IBR A;  1K55 A;  4HBU A;  4XXR A;  4UEY A;  5FEG A;  5A90 A;  2ZQ8 A;  4PM6 A;  3V39 A;  5CEB A;  4O8G A;  5L07 A;  4GDN A;  1JTD A;  5HFO A;  2ZQC A;  3H7W A;  1T1A A;  2WKI A;  2I72 A;  3VP2 A;  1PWG A;  1SZV A;  2JKT I;  3UMD A;  3F1N A;  4MN6 A;  4LFU A;  3IF5 A;  5IU1 A;  3ITB A;  2EA9 A;  4ZAM A;  5EVI B;  4GHI A;  3DWZ A;  4IJG A;  2ZC5 B;  1JWZ A;  1T18 A;  1YSQ A;  1PI5 A;  4R3A A;  2ZM2 A;  5D3O A;  1D1J A;  4Y7P A;  4LGW A;  1S4S A;  4GW9 A;  3G6O A;  3MQQ A;  3ZNY A;  4GLQ A;  1OTE A;  4Q0H A;  2V0W A;  1W5D A;  2OSU A;  3F1O B;  4DE2 A;  1G5U A;  5TBM B;  4O0P A;  2IWC A;  3LGO A;  4KQQ A;  5HPI A;  4HI4 A;  2W1T B;  3UDX A;  3FV7 A;  3MS6 A;  2B95 A;  3DBA A;  4JBF A;  3FZC A;  2PT7 A;  2Z6D A;  2M1C A;  4GHI B;  5KSH A;  3PAE A;  4K0X A;  3ZQ5 A;  4ZJ3 A;  4CLC C;  1MPL A;  3CJM A;  2A24 B;  1YPR A;  1OT9 A;  3SW1 A;  2XDM A;  1S6R A;  5TFQ A;  3ZG0 A;  3LR4 A;  2XRO A;  3V5M A;  3A3J A;  4I3I A;  4OLD A;  3QP6 A;  4ARZ A;  3GSG A;  3BLS A;  4P6B A;  1C3B A;  4GS9 B;  4N92 A;  1LLB A;  3KSI A;  3E2K A;  3T4S A;  3IS2 B;  3KSG A;  3E2L A;  4HH2 A;  3NCK A;  3PBS A;  5GHX A;  1JVJ A;  4GZB A;  4NXB A;  2Z6C A;  3R4K A;  3A0R A;  2K2N A;  5G4Y A;  1ES3 A;  5DFY A;  4ZRR A;  2FH5 A;  1PZO A;  5HAQ A;  2JHE A;  3IQA A;  3QHY A;  4BD0 A;  2GX5 A;  4ZBE A;  4XUX A;  3T4J A;  4IUH A;  4KUO A;  4H6J B;  3G34 A;  1ODV A;  1PIO A;  2PYP A;  1DJC A;  3MF0 A;  3VSL A;  4IUK A;  1D7E A;  4FCF A;  2J9P A;  2XFT A;  3LY4 A;  3Q1F A;  1GSW A;  5J4E A;  1JWV A;  5GLA A;  4O01 A;  2Y2J A;  2O9A A;  1FR1 A;  3BFD A;  3GR2 A;  1O07 A;  3E98 A;  5EV0 A;  4KQR A;  3ISG A;  3HUO A;  5M18 A;  1P97 A;  1M6K A;  1K25 A;  4P0M A;  3NIA A;  3VP1 A;  4HHD A;  4Y3I A;  4BL2 A;  3EQU A;  3UPO A;  4BLM A;  3WS2 A;  2EX2 A;  4HJ4 A;  2P08 A;  3B33 A;  2Q0O A;  1LI0 A;  1ONH A;  3ZYT A;  3OLO A;  2CMN A;  3MFX A;  4X56 A;  4OPZ A;  1NYM A;  5CXW A;  3G2Y A;  1VEU A;  3KYQ A;  1ZKJ A;  4EQ1 A;  5CHJ A;  1W8Q A;  3NY4 A;  3Q7V B;  1K4F A;  1SKO A;  1BT5 A;  2ZMV A;  5EVI C;  2PBD P;  1KE3 A;  4D2O A;  3H9W A;  1KE0 A;  4B4Z A;  1TDL A;  3LR3 A;  3VOZ A;  4FH2 A;  1IKI A;  3OCN A;  5FAS A;  1K38 A;  3N6I A;  1N9L A;  3OPR A;  4X68 A;  2BTF P;  3CI6 A;  2Y79 A;  4GD6 A;  4WM9 A;  1Q2Q A;  3VFH A;  1LSX A;  1MKM A;  3HJK A;  3GRJ A;  5I94 A;  3IXH A;  3JYI A;  4G3V A;  2ZLY A;  5K5B A;  4Y0T A;  1VM1 A;  2D01 A;  2HJE A;  4ID4 A;  1FIK A;  2VX8 A;  1S4R A;  3DTK A;  2JBF A;  3FPV A;  3V3R A;  3C7U A;  2HP9 A;  1F2K A;  2PAV P;  3H82 B;  1LI9 A;  5CX7 A;  5EVE A;  1TVF A;  4KZ5 A;  5CED A;  3VFF A;  4QHC A;  2FFF B;  3CPT B;  1E3U A;  3IH9 A;  5HSQ A;  1SKO B;  1O7E A;  4GNU A;  1CEG A;  3C4P A;  2PD8 A;  4HBT A;  3A0V A;  1N9O A;  1VEU B;  3WWX A;  1BSG A;  4QWO A;  4MNR A;  1CQA A;  3G35 A;  3CLO A;  5C5K A;  1TEM A;  1MWU A;  4FH4 A;  3T50 A;  2ZL1 B;  3EEH A;  1BTL A;  4EU0 A;  1GA0 A;  2J3T C;  3OPH A;  2OWJ A;  3TSG A;  3AGE A;  1K6R A;  2XF3 A;  3VSK A;  3NOU C;  2VV7 A;  5CRF A;  1LT0 A;  1TD5 A;  1F5M A;  3DTE A;  3S7O A;  5F6A A;  3MQO A;  4P87 A;  3RFB A;  1T1C A;  3GEC A;  2QPN A;  1ERO A;  5MC7 A;  2JKR M;  5EE8 A;  4K0W A;  3HLW A;  1K6S A;  4DDS A;  1BUL A;  3M6H A;  4CLC B;  1FCN A;  5FQ9 A;  5FAO A;  3PHY A;  4KZ4 A;  3E4Q A;  1KDW A;  4R3B A;  4DJ2 A;  1NY0 A;  3UB7 A;  4S2O A;  4GOG A;  3LIE A;  5CHM A;  1PZP A;  3PBN A;  1TS7 A;  2VLG A;  3SZT A;  1IYS A;  5A93 A;  1Z6F A;  4EET B;  3PR6 A;  5FQQ A;  3UB6 A;  3FG8 A;  1PNE A;  3LCE A;  4PM8 A;  3PXP A;  2W3D A;  3LIC A;  1HVB A;  2A2L A;  5LBR A;  1K4E A;  1LHY A;  4GJ4 A;  1YM1 A;  4KQD A;  2I9V A;  1SHV A;  4MDZ A;  2W3H A;  3IWQ A;  2WGW B;  3G31 A;  1STZ A;  1SDN A;  2G7U A;  4FD8 A;  4FSF A;  1BLH A;  5FQJ A;  4ETX A;  4WUJ A;  4K91 A;  3EGD C;  5F68 A;  1PWC A;  3MFD A;  2GDN A;  4JGO A;  3S1Y A;  4BWI A;  3GMW A;  4WN5 A;  5DJU A;  1Z09 A;  2WKP A;  3M2J A;  1AWI A;  1I2W A;  4RA7 A;  1LL9 A;  4RVA A;  2OLV A;  4GN2 A;  3MR0 A;  2Y2K A;  1MWR A;  2XR0 A;  3NI9 A;  4GKU A;  4HES A;  2QWS A;  2W1T A;  3HLC A;  4I39 A;  4R0Q A;  4HP9 A;  3WS4 A;  5A91 A;  3PAG A;  3QNB A;  2QYB A;  2L0W A;  2KDK A;  1G68 A;  4NET A;  1YSP A;  4EQI A;  1N9N A;  2V1B A;  2XH9 A;  4LEN A;  4OLG A;  3WRT A;  4KZ7 A;  3W8K A;  5HWT A;  5GLD A;  2Y2I A;  1XP4 A;  3ZFZ A;  3LEZ A;  4JF4 A;  3KO6 A;  2QJ7 A;  3CUE A;  3K3C A;  3NEC A;  1IKG A;  2OOL A;  3G32 A;  1S1Y A;  1FCO A;  4JGR A;  4S2P A;  3D9Y A;  1DP6 A;  2XRN A;  4EEP A;  5GLB A;  3ZNT A;  1IFQ A;  1H5X A;  4R38 A;  2O9C A;  4GB7 A;  2GNX A;  4PPR A;  5FAP A;  4EWF A;  1JNU A;  1OPX A;  3CUE C;  5EVI A;  1CJF A;  5DJT A;  4Y5F A;  4JXW A;  4GD8 A;  1GSV A;  3C38 A;  2HDQ A;  2XD5 A;  4A5R A;  4S2I A;  5AQ7 A;  3VP3 A;  1OME A;  4WZ5 A;  4WF0 A;  3IWI A;  1S1Z A;  4CLC D;  5DKL A;  1ESI A;  3Q82 A;  5FQM A;  4OQG A;  1TDG A;  3A3E A;  1V9Z A;  3NDG A;  5HAI A;  2EX8 A;  4MN5 A;  1ES4 A;  3IHA A;  1SKF A;  4BQM A;  3MXQ A;  4OQH A;  1ESU A;  4B9O A;  2ACG A;  5EOO A;  3MKF A;  4X25 A;  3IXB A;  4WYY A;  4RX2 A;  4C75 A;  2V20 A;  1NJ4 A;  2VKS A;  3N7W A;  1UWN X;  4YWZ A;  4CPK A;  1G28 A;  1YKD A;  3OOV A;  2W1R A;  1WYC A;  4X1L A;  3HLD A;  4F94 A;  2WZZ A;  3AGF A;  4OH0 A;  3BEB A;  1FSW A;  5E2F A;  3HUN A;  5AJG A;  1I5Q A;  3TRC A;  4PKY G;  1ONG A;  1FOF A;  2Y2Q A;  1Y28 A;  4PM5 A;  2ZM8 A;  4FUW A;  4JPM A;  1LL8 A;  2DCF A;  2DMW A;  2WKH A;  3IF6 B;  3LFV A;  2D02 A;  4YIN A;  3S7N A;  3UDF A;  3A3F A;  1HZO A;  2VV6 A;  2WUQ A;  1KVL A;  1ES5 A;  3LO7 A;  3CWF A;  2J9O A;  3UB8 A;  4MEZ A;  5KMW A;  3WS0 A;  3UE6 A;  3I7J A;  4B88 A;  5G18 A;  2OLU A;  2H0Y A;  4O7D A;  1KVM A;  3SS3 A;  5EPH A;  1ZG4 A;  3IXD A;  3KYZ A;  3LIF A;  4I3J A;  5EM0 A;  2A49 A;  1WE4 A;  4UQI M;  1PRQ A;  5HDS A;  1K56 D;  4PM7 A;  2Y55 A;  4YFM A;  1U60 A;  2OV5 A;  4DDY A;  1KGE A;  5HPF A;  4N1X A;  4QB8 A;  3PYP A;  4E3K A;  2Y91 A;  3H82 A;  3R7W A;  1DRM A;  2M7V A;  5FDS A;  3C5A A;  2C5W B;  4D60 A;  5F5Y A;  3ZG9 B;  4BBV A;  2GJ3 A;  1ES2 A;  4DRT A;  1G6A A;  5GHZ A;  5AQ9 A;  4BBT A;  1GHP A;  3VOY A;  3RXX A;  1UWP X;  4HH3 A;  1OTD A;  5EM1 A;  1AXB A;  3ZG5 A;  4Z9Q A;  2P9V B;  4Y0U A;  3ULF A;  5DF9 A;  2W0N A;  2LB5 A;  2H10 A;  1Q2P A;  3ZVT A;  4JXG A;  4HNB A;  3HUM A;  2X01 A;  1CI8 A;  1OJ5 A;  2WZX A;  3BLM A;  2QZ6 A;  4Z1W A;  3QP5 A;  4R4S A;  3DTM A;  3BM6 A;  5L09 A;  4R4R A;  2X71 A;  2Y2O A;  1NYY A;  4OQ0 A;  2WYX A;  1XKZ A;  1G6O A;  1TS8 A;  4E3L A;  1P9W A;  3T1R A;  1GHM A;  4U0X A;  3OC2 A;  1DJB A;  3LR5 A;  5EOE A;  2HJ9 C;  1DP8 A;  2Y2L A;  1Y54 A;  3C4O A;  2Y2M A;  1KGF A;  4PHT A;  1XGJ A;  1XA7 A;  4LRX C;  2PHY A;  2K31 A;  2VGJ A;  3UPN A;  4OVD A;  4X69 A;  2B5R A;  3K3D A;  4Q0I A;  2VJW A;  5GLC A;  1P0Z A;  3MXS A;  4IVK A;  3HLG A;  3NOP C;  3A3D A;  3FWL A;  2ZC7 A;  4QJG A;  4ZTK A;  4WZ5 C;  3KYE A;  3OZH A;  4P85 A;  2Z2L B;  1H0M A;  1CF0 A;  3W2Z A;  2ZC4 B;  1ZTU A;  3SH8 A;  4F3L A;  3KX0 X;  3GDI A;  5BOH A;  4B93 A;  3C30 A;  3P98 A;  5CTN A;  5HDC A;  4MN7 A;  1K0K A;  3C7V A;  5GL9 A;  3T1X A;  3HJI A;  5U47 A;  4EXO A;  4FOF A;  5DTT A;  4MBF A;  5IS1 A;  5A8B A;  2HP5 A;  3JVU A;  5GHY A;  3DAV A;  4OP5 A;  4NEE D;  5HL6 A;  1YMS A;  4L9G A;  3W4O A;  5AVE A;  4WBG A;  4CQH A;  5HD3 A;  3NBL A;  5FQK A;  5I5L A;  5F69 A;  3HL9 A;  4HIA A;  4KG5 A;  1J3W A;  2Y2P A;  2XEP A;  3E0Y A;  5FI7 A;  2B02 A;  1K54 C;  4F3L B;  2NUP C;  4UQI S;  4DE3 A;  1K54 A;  1KE4 A;  1MWS A;  2PU4 A;  3BQ8 A;  2WGV A;  3L9K A;  3LUQ A;  4DXB A;  5CTM A;  1XJ3 A;  1SDE A;  4S2L A;  3RTY A;  2WK0 A;  4NXF A;  3CAX A;  5DF8 A;  5CGW A;  2EWW A;  4QPR A;  3ZDJ A;  2Y4A A;  3F1P B;  4JKT A;  4N1H A;  4QY6 A;  1F98 A;  3T4T A;  3A0S A;  1E3U D;  4JXS A;  1MY8 A;  1XFQ A;  4DMZ A;  1OTB A;  3MKE A;  3NHQ A;  1Y4O A;  1BZA A;  5JYO A;  3Q81 A;  3CHW P;  4YNR A;  5DFX A;  4MBH A;  3P7N A;  2P04 A;  5G4Z A;  3S4X A;  2VZW A;  2JKF A;  3K2N A;  3MSH A;  1S0W A;  1MC0 A;  2PDR A;  5TGF A;  2ZQD A;  1TS6 A;  4XT2 B;  3O87 A;  3IX4 A;  5F1F A;  4HQA A;  2RCX A;  3HCY A;  2EX6 A;  2L1M A;  3DTI A;  3EEA A;  3RH8 B;  3UDI A;  5FSR A;  4LCL A;  5TR7 A;  4RQ9 A;  5EFW A;  3S22 A;  5L8M A;  3G2Z A;  1VET A;  3UE0 A;  1XXM A;  4IBR A;  1NRF A;  5TJJ A;  1EW0 A;  1OTA A;  1W63 M;  4LV3 A;  3BW6 A;  2X02 A;  1EWZ A;  2EFX A;  4X53 A;  4PAU A;  3T4Q A;  4I5S A;  3BY9 A;  1YLP A;  5HWW A;  5HDD A;  2XA7 S;  4HOI A;  1FCM A;  3R7W B;  2ZMF A;  1NZU A;  2ZJ9 A;  2HPB A;  1ERQ A;  4RX3 A;  1H8Y A;  4GCZ A;  3Q7V A;  2VA0 A;  4S2N A;  2QMI A;  5HL1 A;  1YMX A;  1XA1 A;  4HY8 A;  1OJG A;  2WAD A;  5CEC A;  2VEA A;  4Q8I A;  3ZHH A;  1S66 L; 
#chains in the Genus database with same CATH homology
 3E2L A;  5EVL A;  3ZVW A;  4BQM A;  4OQH A;  3NCK A;  3PBS A;  1ESU A;  3W4P A;  5GHX A;  5EOO A;  1JVJ A;  5KSC A;  3MKF A;  4GZB A;  3IXB A;  2J7V A;  4E6X A;  2XLN A;  4WYY A;  4RX2 A;  3Q07 A;  3ZG7 B;  4C75 A;  2V20 A;  1NJ4 A;  4KG2 A;  3VP4 A;  4PM9 A;  3BEC A;  3N7W A;  2H5S A;  1ES3 A;  4CPK A;  1GA9 A;  3OPL A;  3OPP A;  4BD1 A;  1W7F A;  1PZO A;  3PBO A;  4JF5 A;  5HAQ A;  1YLW A;  3IQA A;  1JTG A;  3HLE A;  1WYC A;  3IF6 A;  3QHY A;  4BD0 A;  1VQQ A;  2UWX A;  1E25 A;  3HLD A;  4F94 A;  2WZZ A;  3AGF A;  4OH0 A;  4OQI A;  4XUX A;  4ZBE A;  2ZMA A;  1KDS A;  3WS1 A;  4E3O A;  5AQB A;  3G34 A;  2ZC6 B;  3BEB A;  1FSW A;  5E2F A;  3HUN A;  3RXW A;  3CZD A;  1PIO A;  1DJC A;  1I5Q A;  1ONG A;  1FOF A;  2Y2Q A;  2A3U A;  4KZA A;  2ZM8 A;  4PM5 A;  2ZQA A;  4JPM A;  4ZDX A;  3Q7Z A;  4IED A;  3VSL A;  4FCF A;  2ZQ9 A;  4DE1 A;  2J9P A;  2XFT A;  3LY4 A;  3Q1F A;  1IYQ A;  1JWV A;  1MKI A;  1YLT A;  2XFS A;  5GLA A;  2Y2J A;  2DCF A;  1FR1 A;  2WKH A;  3BFD A;  3GR2 A;  3IXG A;  3SOI A;  3IF6 B;  1O07 A;  3ZGA B;  1L0D A;  1E4D A;  5HW3 A;  4S2K A;  4KQR A;  2C6W B;  3ISG A;  3ZCZ A;  5M1A A;  3HUO A;  4YIN A;  2V1Z A;  2VGK A;  1EI5 A;  3PTE A;  3UDF A;  3A3F A;  1FQG A;  1HZO A;  4X55 A;  5M18 A;  1M6K A;  1K25 A;  2WUQ A;  4P0M A;  4OOL A;  4U0T A;  1DJA A;  1KVL A;  1ES5 A;  3LO7 A;  2J9O A;  3NIA A;  4KZB A;  1L0G A;  1ZG6 A;  3VP1 A;  4MEZ A;  4BL2 A;  3WS0 A;  5KMW A;  3EQU A;  3PBQ A;  3UPO A;  2XQZ A;  3I7J A;  5G18 A;  4B88 A;  2OLU A;  2H0Y A;  3WS2 A;  4O7D A;  4BLM A;  1KVM A;  2EX2 A;  1HTZ A;  3SS3 A;  3HVF A;  4DXC A;  4WEJ A;  5EPH A;  4E6W A;  1LI0 A;  1MXO A;  1ZG4 A;  3IXD A;  1ONH A;  4WEL A;  2PU2 A;  2PBY A;  3IF6 C;  1JWP A;  2A49 A;  1WE4 A;  2XD1 A;  4R3J A;  4LV2 A;  4X56 A;  3VMA A;  4OPZ A;  1NYM A;  5CXW A;  3G2Y A;  1K56 D;  1PW1 A;  4PM7 A;  1N4O A;  1IYP A;  1ZKJ A;  3W4Q A;  1XX2 A;  4UA7 A;  3M2K A;  2Y55 A;  3DW0 A;  4OKP A;  4Y0O A;  5CHJ A;  1W8Q A;  2DNS A;  1ALQ A;  4OPQ A;  2E8I A;  3NY4 A;  4YFM A;  1U60 A;  3Q7V B;  2OV5 A;  1K4F A;  4DDY A;  1KGE A;  2Y2G A;  4C6Y A;  1BT5 A;  3MBZ A;  4QU3 A;  5EVI C;  4N1X A;  3ZG8 B;  1KE3 A;  5HAR A;  4D2O A;  4QB8 A;  1KE0 A;  1YQS A;  3UNW A;  4B4Z A;  1TDL A;  3VOZ A;  3N8R A;  4FH2 A;  3UY6 A;  1IKI A;  3OCN A;  4LV0 A;  5FAS A;  1K38 A;  3N6I A;  2Y91 A;  2V2F F;  3V50 A;  4E3K A;  3VP0 A;  2HDS A;  3PBR A;  5FAT A;  3SH9 A;  3OPR A;  4H8R A;  3WS5 A;  4X68 A;  2ZM0 A;  4GD6 A;  3C5A A;  4KEN B;  2C5W B;  2ZC3 B;  4WM9 A;  4GDB A;  1Q2Q A;  3G4P A;  3VFH A;  4S2N C;  3ZG9 B;  3RJU A;  1CK3 A;  5F82 A;  1ES2 A;  4KZ6 A;  4KQO A;  4DRT A;  1G6A A;  2P9V A;  3G30 A;  5DF7 A;  5GHZ A;  1RGZ A;  1QMF A;  1IEL A;  3GRJ A;  5AQ9 A;  2G2U A;  5I94 A;  1GHP A;  5EEC A;  3VOY A;  4DE0 A;  2WKE A;  4KZ8 A;  3RXX A;  3IXH A;  3JYI A;  4BL3 A;  5L2F A;  1K56 A;  3BFC A;  2ZLY A;  2Q9N A;  2R9X A;  4OP8 A;  4Y0T A;  1VM1 A;  4EBN A;  4C3Q A;  3HRE A;  1AXB A;  4ID4 A;  1XPB A;  1FSY A;  3IT9 A;  4KZ3 A;  3ZG5 A;  2JCH A;  1CEF A;  4Z9Q A;  2P9V B;  4ZJ2 A;  2EFU A;  4Y0U A;  1M40 A;  5DF9 A;  1BLC A;  2XGN A;  2H10 A;  1PW8 A;  1Q2P A;  2JBF A;  3ZVT A;  2XK1 A;  3V3R A;  4B4X A;  3FKW A;  4JXG A;  3C7U A;  2HP9 A;  1CI9 A;  3D4F A;  4ZJ1 A;  3NC8 A;  3HUM A;  2X01 A;  1CI8 A;  2WZX A;  3BLM A;  5DVA A;  2EX9 A;  2QZ6 A;  2IWD A;  4R4S A;  1LI9 A;  3DTM A;  3BM6 A;  3OCL A;  3HLB A;  1TVF A;  2WGI A;  3UE3 A;  4KZ5 A;  5CED A;  4R4R A;  2X71 A;  5CGX A;  3VFF A;  4QHC A;  2Y2O A;  1NYY A;  3BFE A;  2FFF B;  4OQ0 A;  2WYX A;  1E3U A;  2G2W A;  2RL3 A;  3IH9 A;  1K57 C;  1XKZ A;  5HX9 A;  3BYD A;  4E3L A;  1O7E A;  1GHM A;  4GNU A;  4U0X A;  3OC2 A;  1DJB A;  1CEG A;  1W79 A;  5EOE A;  4BEN A;  5CER A;  3WRZ A;  3C4P A;  4JLF A;  1PYY A;  4OOY A;  3N8S A;  1H8Z A;  2Y2L A;  2Y2H A;  4HBT A;  1Y54 A;  4S2J A;  4E3J A;  5FAQ A;  4QD4 A;  3C4O A;  1IYO A;  3IHB A;  3WWX A;  4WEK A;  1BSG A;  2Y2M A;  4PMA A;  4MNR A;  4E3I A;  1KGF A;  3G35 A;  3AGD A;  1XGJ A;  1BLS A;  1TEM A;  5E2G A;  1XA7 A;  3M6B A;  3LY3 A;  1MWU A;  2Y59 A;  1K57 A;  4FH4 A;  2VGJ A;  3UPN A;  1HD8 A;  1BTL A;  1PWD A;  1GA0 A;  5HAP A;  4OVD A;  1YLY A;  2B5R A;  4X69 A;  4MBK A;  5GLC A;  2CC1 A;  3OPH A;  4M3K A;  3TSG A;  3AGE A;  1YLJ A;  4UAA A;  1K6R A;  3MXS A;  2XF3 A;  2WGW A;  3HLG A;  4IVK A;  2WAE A;  3VSK A;  3A3D A;  3FWL A;  2ZC7 A;  4QJG A;  4ZTK A;  3HLF A;  4WZ5 C;  5CRF A;  2DRW A;  3OZH A;  3IWO A;  4KZ9 A;  4U3T A;  4P85 A;  3CG5 A;  2Z2L B;  1W8Y A;  5JYP A;  3N8L A;  3A3I A;  4LV1 A;  4LCM A;  4N9L A;  4OPR A;  4P87 A;  1LL5 A;  2QPN A;  1ERO A;  2ZC4 B;  3SH8 A;  3GVB A;  5EE8 A;  1YT4 A;  4K0W A;  4EV4 A;  3HLW A;  1RCJ A;  3BFF A;  1K6S A;  2HDU A;  5BOH A;  5E43 A;  4DDS A;  3UN7 A;  2WAF A;  4JF6 A;  3P98 A;  4L0L A;  5CTN A;  1BUL A;  2EXA A;  2ZD8 A;  3MZE A;  3M6H A;  4E3M A;  1FCN A;  4IVI A;  5FQ9 A;  4CJN A;  5FAO A;  4OOM A;  1BUE A;  4HEF A;  3FYZ A;  4KZ4 A;  5EVI D;  1KDW A;  4R3B A;  3IH8 A;  5E2E A;  1NY0 A;  3C7V A;  5GL9 A;  3BRM A;  4R1G A;  4WZ4 A;  4S2O A;  4GOG A;  5CHM A;  1FR6 A;  1PZP A;  4R23 A;  5U47 A;  5A92 A;  3PBN A;  5E2H A;  2IWB A;  3DWK A;  3O3V A;  4UA6 A;  5DTT A;  4MBF A;  1N9B A;  3MXR A;  1IYS A;  1K55 C;  5A93 A;  1Z6F A;  3N4I A;  4UHU A;  2HP5 A;  1YLZ A;  4EBL A;  5FA7 A;  5FQQ A;  5GHY A;  4BJP A;  4OP5 A;  1YMS A;  3LCE A;  3EQV A;  4PM8 A;  5F83 A;  1L0E A;  3W4O A;  3ZHH A;  4EUZ A;  1HVB A;  3FKV A;  4RYE A;  4WBG A;  3V3S A;  4OPY A;  1NXY A;  1XGI A;  3NBL A;  1K4E A;  4N9K A;  5FDH A;  5FQK A;  1J9M A;  1LHY A;  2J8Y A;  1YM1 A;  1GHI A;  1RGY A;  4KG6 A;  1QME A;  5DTK A;  3HL9 A;  1L0F A;  1MWT A;  4KG5 A;  1WYB A;  2Y2P A;  1SHV A;  5IHV A;  4S2M A;  2JC7 A;  5DTS A;  3SH7 A;  1KGG A;  2H0T A;  2XEP A;  3IWQ A;  2WGW B;  3G31 A;  4IBX A;  5FI7 A;  4DKI A;  5FI6 A;  1SDN A;  4FD8 A;  1GCE A;  1BLH A;  1K54 C;  3O86 A;  4FSF A;  4DE3 A;  5FQJ A;  2EXB A;  3GV9 A;  4K91 A;  1ERM A;  5F1G A;  1K54 A;  1PWC A;  3NDE A;  4WMC D;  1KE4 A;  3BFG A;  1MWS A;  2PU4 A;  2WGV A;  2HP6 A;  3MFD A;  1K55 A;  4HBU A;  4XXR A;  3ITA A;  2GDN A;  3UE1 A;  4DXB A;  3S1Y A;  5CTM A;  3GMW A;  1SDE A;  4S2L A;  5A90 A;  2WK0 A;  2ZQ8 A;  4PM6 A;  5DF8 A;  3B3X A;  3M2J A;  5CGW A;  3V39 A;  5CEB A;  1I2W A;  4RA7 A;  1LL9 A;  3ZDJ A;  4GDN A;  2Y4A A;  2OLV A;  4GN2 A;  1JTD A;  4RVA A;  5HFO A;  2ZQC A;  4JKT A;  4N1H A;  4QY6 A;  1L2S A;  2WKI A;  4UA9 A;  2I72 A;  3TG9 A;  4MLL A;  3VP2 A;  3SS5 A;  2JE5 A;  2Y2K A;  1E3U D;  1PWG A;  4JXS A;  4XUZ A;  1MWR A;  1MY8 A;  3MKE A;  2XR0 A;  1NZO A;  1BZA A;  5JYO A;  3NI9 A;  4GKU A;  4HES A;  3O88 A;  3Q81 A;  3IF5 A;  3HLC A;  4MBH A;  3ITB A;  4R0Q A;  2FFY A;  3MZF A;  3MZD A;  3S4X A;  4ZAM A;  3WS4 A;  5EVI B;  5A91 A;  3GTC A;  3UPP A;  3PAG A;  3CMZ A;  1S0W A;  4WMC A;  2ZQ7 A;  3QNB A;  3DWZ A;  5TGF A;  2ZQD A;  2ZC5 B;  1JWZ A;  3O87 A;  1G68 A;  1PI5 A;  5EUA A;  4NET A;  4JXV A;  4EQI A;  2ZM2 A;  5D3O A;  1SCW A;  4Y7P A;  5F1F A;  2XH9 A;  4LEN A;  4OLG A;  5FI2 A;  2RCX A;  3WRT A;  3ZNY A;  2EX6 A;  2Y2N A;  4KZ7 A;  4DF6 A;  1PI4 A;  1DY6 A;  4QY5 A;  3UDI A;  3W8K A;  5GLD A;  1W5D A;  2OSU A;  5FSR A;  2Y2I A;  1XP4 A;  3QNC A;  4LCL A;  5FQI A;  3LEZ A;  5CGS A;  5TR7 A;  3ZFZ A;  3S22 A;  4JF4 A;  4DE2 A;  3G2Z A;  3UE0 A;  1I2S A;  5J8X A;  3P09 A;  1BLP A;  5CHU A;  1XXM A;  2BG1 A;  4IBR A;  1NRF A;  2IWC A;  1ZC2 A;  1IKG A;  3G32 A;  1FCO A;  4LV3 A;  4KQQ A;  4S2P A;  2HDR A;  2X02 A;  4X6T A;  5AQA A;  5GLB A;  3UDX A;  3FV7 A;  1EWZ A;  2EFX A;  4X53 A;  4OON A;  1YLP A;  4JBF A;  3SS4 A;  3FZC A;  3ZNT A;  2BLS A;  1H5X A;  3PBT A;  1RP5 A;  4GB7 A;  4PPR A;  2R9W A;  5FAP A;  4EWF A;  1FCM A;  4NK3 A;  2Z2M B;  5M19 A;  5KSH A;  5EVI A;  3PAE A;  4K0X A;  4JXW A;  4GD8 A;  2HDQ A;  2XD5 A;  3GQZ A;  4ZJ3 A;  4A5R A;  4S2I A;  5AQ7 A;  4EBP A;  1MPL A;  3VP3 A;  1OME A;  3CJM A;  1NZU A;  2ZJ9 A;  4WZ5 A;  2HPB A;  1ERQ A;  3TOI A;  4E3N A;  2XDM A;  3IWI A;  1S6R A;  4RX3 A;  5TFQ A;  3ZG0 A;  3UO9 A;  3HBR A;  3V5M A;  5KZH A;  3A3J A;  1H8Y A;  1MBL A;  3Q7V A;  4S2N A;  1ESI A;  2QMI A;  5HL1 A;  2P74 A;  3Q82 A;  1IEM A;  4OLD A;  5FQM A;  1YMX A;  4OQG A;  1XA1 A;  1TDG A;  3A3E A;  3GSG A;  3NDG A;  3BLS A;  2WAD A;  5HAI A;  2EX8 A;  4P6B A;  1ES4 A;  1C3B A;  5CEC A;  3IHA A;  4N92 A;  1LLB A;  4Q8I A;  3E2K A;  2Q9M A;  1SKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...