1TDGA

Complex of s130g shv-1 beta-lactamase with tazobactam
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Inhibitor-resistant class A beta-lactamases: consequences of the Ser130-to-Gly mutation seen in Apo and tazobactam structures of the SHV-1 variant
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1tdgA00
3N4IA 4KZ6A 5FQKA 5GHXA 1W5DA 5CGSA 3CZDA 4IEDA 4S2OA 3UPPA 1E3UD 4B4XA 1YLJA 4YINA 3V39A 5FATA 2Y2LA 4BLMA 1MWRA 2ZD8A 2Y59A 2J8YA 4FSFA 4QD4A 5EVLA 1GHIA 1CEFA 4HBUA 2IWCA 3ITBA 4OKPA 4ZDXA 3V3SA 4KZ8A 4X6TA 2IWBA 3V5MA 1IYPA 1NRFA 1YLTA 2J9PA 1I5QA 4JLFA 5M18A 1MWTA 3M2KA 4EQIA 2XEPA 1L0FA 5FAPA 3PBQA 5FAQA 4IVKA 1E25A 5CHMA 5HAQA 3RXXA 1DJAA 3G30A 4EBLA 3O3VA 2X01A 3GSGA 4JF5A 4GZBA 3P09A 4ZJ3A 4LCLA 4P0MA 5AQ7A 4OQHA 4RX2A 4BENA 2OLVA 2BG1A 1JTGA 4DE0A 4GD8A 3ZHHA 5EVIC 2PU4A 4WELA 1W7FA 1ZG4A 3HBRA 1EWZA 3WRZA 4R4SA 4S2NA 4WMCD 1KGEA 4EUZA 5DF8A 3NC8A 5GHZA 4KG5A 4RA7A 4WM9A 2EFUA 1FQGA 1FCOA 1GHMA 1WYCA 1TDGA 1ZG6A 2XDMA 2ZMAA 1DJBA 1K6RA 2Y2JA 2ZC5B 5KSHA 2ZJ9A 4OLGA 4ZBEA 2P74A 4GB7A 5CHUA 3C4OA 5F1FA 5E2GA 3C7VA 4GN2A 4BJPA 4P6BA 3Q07A 1FCMA 1FSWA 3UE3A 1YLPA 3TOIA 3UO9A 2H10A 3UDFA 3BLMA 1HZOA 4LENA 4FD8A 3SS5A 2G2UA 1TEMA 3W8KA 4X53A 1FR6A 1K25A 1NXYA 3SH7A 3WS0A 2WZZA 1BTLA 2Y2GA 4E3NA 4WZ5C 1BLSA 4E6XA 1XGIA 3VOYA 4E3MA 1WE4A 4OOYA 3MXRA 4JBFA 4DKIA 5EUAA 3IXBA 3VP1A 3PBSA 3WS4A 2ZQ8A 2Y2IA 3OPLA 4PM5A 5HL1A 4JXWA 5CERA 4C6YA 2XR0A 4H8RA 3UE0A 3G35A 2V1ZA 3SH8A 3ZFZA 1VQQA 1PZPA 3AGEA 2J9OA 2WUQA 3BLSA 3CG5A 5FQIA 3VSKA 1G68A 5GLBA 4RYEA 4EV4A 1FSYA 4E6WA 1MXOA 4GD6A 3WS2A 2RL3A 4OQ0A 3OPHA 4KENB 2HP6A 1XGJA 5EVIA 1S6RA 3MZFA 3E2LA 4BL2A 2HPBA 1BLPA 3IT9A 5FAOA 4JF4A 4KQOA 3VOZA 3VFFA 1W8YA 3C5AA 1ESIA 1PI4A 3E2KA 1PZOA 3UDIA 3OCNA 4KZ5A 1ERMA 3A3JA 1ZC2A 2OLUA 3HLBA 3PBRA 1YM1A 4OLDA 1Y54A 4MEZA 4QU3A 4S2LA 1KE3A 4ZJ2A 5EPHA 4KZBA 1YMXA 5E43A 2JE5A 5DF9A 3FYZA 3HUMA 2XD5A 3NCKA 1SDNA 4PMAA 4QB8A 2JCHA 3ZNTA 2C5WB 2ZQ7A 4JXVA 2ZC3B 2Q9MA 4CPKA 3IQAA 5CEDA 3ZG5A 1N9BA 3N7WA 3S1YA 4KQRA 3UE1A 2WADA 3HUNA 1O07A 1DJCA 1PI5A 5DF7A 3SOIA 5CXWA 1YLWA 3FV7A 3ZNYA 1W79A 3IXDA 4P85A 3VP0A 3G32A 2E8IA 4E3OA 3BFCA 3GVBA 3VFHA 3GTCA 4WZ5A 3Q1FA 5EECA 2EX6A 4B88A 3IF6B 1KE0A 5HFOA 2CC1A 4RX3A 1PYYA 4LV1A 2RCXA 2WYXA 3MKEA 1ES5A 1SCWA 2EX8A 2JC7A 4OQGA 4LV3A 4Y7PA 3SS3A 2V2FF 2Y55A 3HLWA 3OPPA 3IHBA 2WGWB 3BECA 3G2ZA 4JPMA 5HARA 3ZDJA 3ZG8B 3BFDA 1ONGA 4KZAA 1LI0A 3N6IA 1QMEA 4DE2A 3Q7VB 4X68A 2H5SA 4GNUA 3IWQA 2WKIA 3OCLA 3PTEA 1K56A 1MWUA 3VP4A 3UY6A 1BLHA 3G4PA 5CTMA 1YMSA 4GOGA 5GLAA 5D3OA 4NETA 1VM1A 3HREA 4ZJ1A 4OVDA 1JTDA 3IH9A 1ES2A 3I7JA 3BFEA 3PAGA 1K57C 2ZQAA 5EE8A 1LI9A 2ZLYA 1HTZA 4XXRA 1M40A 5FQMA 2VGKA 2A3UA 3GR2A 1K38A 4IBRA 3GRJA 2FFYA 4FH4A 1JWVA 2WAFA 4OH0A 1Q2PA 4S2IA 1ALQA 4DF6A 3MXSA 3SS4A 1L0GA 5A93A 3BRMA 1U60A 4OOLA 4EBNA 5F1GA 2XK1A 2ZC6B 4MLLA 1EROA 4ZAMA 1FR1A 1NZUA 5DTKA 5EOOA 2EX9A 3QNBA 3IXGA 4DE1A 4ZTKA 1GHPA 2A49A 4KG6A 4UA6A 4E3LA 2XH9A 4R3JA 1BUEA 3P98A 4Q8IA 1HVBA 1L2SA 2Y4AA 1MPLA 3WRTA 5CECA 2EXBA 1J9MA 4R23A 1IKGA 3C4PA 4LCMA 3MFDA 3V50A 4S2MA 4JXSA 2X02A 5JYPA 2DRWA 5F82A 3Q82A 5FSRA 3ZVWA 3LY4A 4GDBA 5AQ9A 4IVIA 1BLCA 1QMFA 4E3KA 2EFXA 2WKHA 2JBFA 4CJNA 4X56A 1MY8A 3BEBA 1NYYA 3VMAA 4QHCA 4Y0UA 2R9XA 4PM7A 3V3RA 3JYIA 5KSCA 2ZQ9A 1K6SA 1AXBA 3NDGA 4JF6A 2B5RA 5M1AA 2IWDA 1I2WA 2BLSA 2X71A 1SHVA 5GL9A 1XA7A 5FQ9A 3TG9A 3BM6A 5HAPA 3ZG7B 3MZDA 4DE3A 2P9VB 2Z2LB 2ZM8A 3MBZA 1LHYA 3TSGA 4BD1A 1CI8A 2ZC7A 5HX9A 1MBLA 3GQZA 1N4OA 1PWGA 2QZ6A 1BSGA 2WK0A 1LL9A 5A92A 4KZ9A 3ZGAB 1K57A 2ZM0A 3CJMA 5TGFA 3M2JA 1TDLA 5GLDA 1NZOA 4ID4A 4C3QA 2OSUA 3AGDA 1XA1A 2DNSA 1E3UA 1L0DA 1PW8A 3IXHA 3OPRA 3Q81A 1IKIA 4R3BA 1JWPA 1K55C 1KGFA 2FFFB 1KVLA 2HP5A 2VGJA 3HLCA 3Q7ZA 5FI6A 2UWXA 4L0LA 4OP5A 5EVIB 4YFMA 2H0TA 4PM6A 1XX2A 4U0TA 5GHYA 3G34A 1Z6FA 4XUZA 1IYOA 3LEZA 1O7EA 1JVJA 4PM9A 5CGWA 2WAEA 1K4EA 3GMWA 4O7DA 3HUOA 3ZVTA 1GA9A 2XF3A 3PBTA 4N9LA 1NY0A 1FOFA 4U0XA 1CEGA 3W4PA 4C75A 2ZQDA 1RGZA 3ZG9B 1JWZA 1W8QA 2HDUA 3ISGA 4WMCA 5HAIA 4N1HA 2XQZA 1LL5A 4OQIA 3RXWA 2XFTA 4MNRA 3MZEA 1PIOA 4X69A 5TFQA 2WGWA 2Q9NA 3B3XA 1RGYA 1S0WA 1E4DA 3GV9A 2Y2OA 5EOEA 3SH9A 3WWXA 3ZG0A 2Y2NA 4E3IA 4OOMA 4WBGA 2R9WA 3OZHA 3Q7VA 5EVID 4DDYA 5FA7A 1ES4A 1RCJA 1GCEA 1BULA 3HLEA 3NBLA 3UPNA 3IWOA 4S2JA 5DTSA 1G6AA 4HESA 3FWLA 2XGNA 1CI9A 5G18A 5TR7A 2Y2KA 2Y2HA 4FH2A 1MWSA 3ZCZA 3IF5A 4LV2A 5CTNA 2HDRA 3UPOA 1M6KA 3DTMA 2Y2QA 4OPRA 4GDNA 1RP5A 3BFGA 3EQUA 3N8SA 5DVAA 4FCFA 4HBTA 1PWCA 3LCEA 3PBOA 4WEKA 3D4FA 1EI5A 2J7VA 3OC2A 4UAAA 5A91A 4DRTA 5A90A 1PWDA 1K54C 1K55A 4Y0OA 4DDSA 1HD8A 4B4ZA 1YLYA 1NYMA 3W4OA 4BQMA 2C6WB 1IYSA 5FDHA 4DXBA 3BFFA 1MKIA 4EWFA 1KDWA 5J8XA 2Z2MB 2XFSA 5AQAA 4P87A 4Y0TA 1ESUA 4IBXA 3PBNA 5KMWA 3NI9A 3EQVA 4M3KA 3FZCA 4E3JA 1SKFA 3HLGA 2G2WA 4KQQA 5IHVA 1BZAA 5CGXA 1DY6A 2HDQA 4U3TA 4UHUA 4KZ4A 1XXMA 5U47A 1ZKJA 3QNCA 3VP3A 3NY4A 3IF6C 2EX2A 1OMEA 4F94A 3HLDA 1XP4A 1SDEA 4UA7A 3S4XA 4JKTA 1K56D 3O87A 1H8ZA 3IWIA 2WGIA 3PAEA 1KGGA 4UA9A 2H0YA 1WYBA 2HDSA 1XPBA 5CRFA 1YQSA 3G2YA 3N8LA 1ONHA 5DTTA 5FQJA 1TVFA 4XUXA 3FKWA 3WS1A 5M19A 1H8YA 5E2HA 5L2FA 2XLNA 4LV0A 1KDSA 5AQBA 3QHYA 3O88A 4X55A 2P9VA 2OV5A 2QPNA 3NDEA 4WYYA 4Z9QA 3HVFA 3RJUA 3FKVA 1ES3A 1ERQA 3ITAA 4QY6A 1H5XA 1IEMA 4PPRA 3DWZA 4JXGA 1PW1A 5CEBA 3A3DA 5KZHA 4R1GA 3A3FA 2DCFA 4S2KA 2GDNA 1L0EA 5HW3A 1YLZA 4KG2A 4MBFA 1NJ4A 1IELA 4WEJA 4KZ3A 3WS5A 4S2PA 2QMIA 1XKZA 3UDXA 4OONA 3S22A 5FI7A 1K54A 4MBKA 2WKEA 2EXAA 4N1XA 1CK3A 3A3EA 4OPYA 3UNWA 1GA0A 1LLBA 1K4FA 4K0WA 4BD0A 3UN7A 3IH8A 3DWKA 3DW0A 5CHJA 4KZ7A 1YT4A 4HEFA 4K91A 5F83A 4S2NC 4D2OA 5E2EA 2Y91A 4R4RA 3M6HA 4RVAA 4DXCA 2WZXA 4OPQA 3O86A 3MKFA 3BYDA 1IYQA 3C7UA 2WGVA 2ZQCA 2ZC4B 3W4QA 1FCNA 2Y2MA 5FQQA 3G31A 5FASA 4QJGA 3IF6A 3VSLA 4PM8A 3M6BA 2V20A 4QY5A 1KVMA 2ZM2A 2I72A 2HP9A 3LO7A 3NIAA 4K0XA 5I94A 4EBPA 2PU2A 4GKUA 1Q2QA 4N92A 4OP8A 5FI2A 3HLFA 1KE4A 5BOHA 5GLCA 2Y2PA 1C3BA 1BT5A 4R0QA 2PBYA 3LY3A 3CMZA 3HL9A 5JYOA 4MBHA 4OPZA 3IHAA 4NK3A 2XD1A 3A3IA 4A5RA 4WZ4A 4BL3A 3N8RA 4N9KA 1I2SA 5E2FA 3VP2A 3AGFA
chains in the Genus database with same CATH superfamily
3N4IA 1W5DA 3CZDA 3E0YA 3UPPA 2Y8HA 3NECA 4B4XA 3MMHA 4BLMA 2Y59A 2J8YA 4FSFA 4ESPA 2O99A 4HBUA 4OKPA 1YLTA 1NRFA 1I5QA 2XEPA 1T1AA 2PD7A 3PBQA 4IVKA 5HAQA 4ETXA 3O3VA 4ZJ3A 3RH8B 4DE0A 2KLIA 2PR5A 2PU4A 4WELA 1W7FA 1V9YA 3WRZA 4EUZA 1HLUP 5DF8A 3EGXC 2EFUA 1FCOA 4QPRA 4EERA 3IX3A 3C4OA 5F1FA 2V8FA 4RQ9A 1YSQA 5F5YA 2ZOIA 2FZ0A 3A0RA 5L10A 1TEMA 1OJGA 1FR6A 1K25A 2INWA 4EQ1A 4E6XA 5HD3A 3LGOA 4JBFA 3IXBA 3WS4A 5HDCA 4F3LB 5HL1A 2V1AA 3PR6A 4JXWA 2XR0A 1XJ4A 3UB8A 2WUQA 3CG5A 5FQIA 3VSKA 1G68A 5GLBA 3P01A 4EV4A 4PAUA 4KENB 1XGJA 1S6RA 2R78A 1F9IA 1BLPA 5CX7A 4KQOA 5HPFA 3C5AA 4UEYA 1PZOA 1T1BA 2HZ5A 3A3JA 4DJ3A 5HAPA 1YM1A 1Y54A 5J3WA 3HUMA 2XD5A 4PMAA 3BJNA 1GSXA 4R70A 3ZNYA 3LR4A 3DTKA 3LIAA 4WZ5A 3ULFA 4B88A 1W63M 2CC1A 2RCXA 4OQGA 2EX8A 4LV3A 5DKLA 3BW6A 3UB7A 3HLWA 5HARA 3IHBA 3CLOA 3N6IA 1QMEA 4GNUA 4GW9A 2OOLA 2WKIA 3G4PA 3T1XA 3B33A 3H82B 4NETA 2A2LA 2V1BA 4ZJ1A 4OVDA 3IH9A 3BFEA 3PAGA 2LB9A 4XXRA 4HJ3A 2A3UA 2VV8A 1VEUA 1OPXA 2FFYA 2WAFA 1OJ5A 3SS4A 5A93A 4OOLA 1FR1A 3FPWA 5EOOA 2PDRA 3IXGA 3LIBA 4ZTKA 2A49A 4KG6A 1G5UA 2JKRI 1H3QA 1BUEA 1STZA 3C30A 4Q8IA 5CECA 4BBUA 3C4PA 3MFDA 2QWSA 3CITA 2X02A 5JYPA 3ZVWA 5AQ9A 2UV0E 1QMFA 2EFXA 1MY8A 2EA9A 5FL3A 4QHCA 4PM7A 3JYIA 3H82A 2PR6A 5L09A 1I2WA 2X71A 1XA7A 1GSWA 3VOLA 4NXEA 5AJGA 3MZDA 2P9VB 5AVEA 3T1QB 5HX9A 4NEED 1PWGA 1LL9A 4CLCB 4KZ9A 2ZM0A 5TGFA 2VA0A 2PYPA 4C3QA 4O01A 3DAVA 3H7WB 4R3BA 1KGFA 1P0ZA 2FFFB 3L9KA 2VGJA 3HLCA 2Q0OA 3NULA 2ZBBA 2CMNA 2JKTM 4JGQA 4XUZA 1O7EA 4PM9A 1K4EA 3GMWA 3HUOA 3CUEA 4Y17A 2XF3A 4N9LA 3ZG9B 1JWZA 5HAIA 2XQZA 1LL5A 4MMNA 2O9CA 4X69A 1NWZA 5TFQA 1XFQA 1RGYA 3E4OA 1E4DA 3SH9A 3U2AA 3ZG0A 1Y4OA 3Q7VA 4DDYA 2YKHA 1RCJA 3T1SA 1GCEA 3HLEA 3UPNA 3IWOA 5DTSA 4P6ZS 5TR7A 2Y2KA 4FH2A 1D06A 3DBAA 2J3WA 1MWSA 4HJ4A 4LV2A 1TS6A 3IX4A 3BFGA 3N8SA 2K2NA 4FCFA 4X1LA 4H6JA 4HBTA 3PBOA 5EM1A 3HJIA 1PWDA 4DDSA 1YLYA 2C6WB 3LR5A 5J8XA 2Z2MB 2XFSA 4WUJA 4P87A 5KMWA 1OTAA 2JHEA 1VEUB 4DMZA 1BZAA 3KYQA 2YKFA 3DTIA 4HOIA 2VX8A 3QNCA 5DFXA 1OMEA 4UA7A 3T1RA 5CRFA 2WGIA 1XPBA 1YQSA 3G2YA 1P9WA 5FQJA 3UB5P 5M19A 3UMDA 5E2HA 4EXOA 3P7NA 2OV5A 4FTXA 3F1NB 3FKVA 1ES3A 1ERQA 3ITAA 4JXGA 3A3FA 4S2KA 5HW3A 3AGFA 1YLZA 4MBFA 1NJ4A 4WEJA 3RTYA 1DP6A 3S22A 4OPYA 4K0WA 4BD0A 3DWKA 4MN5A 4HEFA 3NJAA 4DXCA 3O86A 3IX8A 2WGVA 2ZQCA 2A24A 2ZOHA 5FASA 5G4ZA 3IF6A 3QP8A 1KVMA 2I72A 3T4LA 4EBPA 2PU2A 1TD5A 3MJQA 1Q2QA 5GLCA 2Y2PA 2PBYA 3LY3A 4MBHA 4BL3A 4WZ4A 3UB9A 1I2SA 3VP2A 4UQIS 3V5MA 3KYEA 2XA7M 4IEDA 1SZVA 1YLJA 3V39A 5FATA 1MWRA 2VV7A 2JKRM 1CEFA 4ZDXA 3B42A 4KZ8A 4X6TA 5M18A 5FAPA 4HH3A 4LRXC 4O0PA 1DJAA 3G30A 3K3CA 3KYZA 4WN5A 4GZBA 3PHYA 3P09A 4GCZA 4LCLA 4OQHA 1JTGA 4GD8A 3LIDA 3HBRA 3FG8A 4G3WA 5EFWA 3LFVA 4WM9A 3PYPA 2W3HA 2NUPC 1ZG6A 2XDMA 2ZMAA 4MN7A 1DJBA 2ZC5B 5CHUA 4GB7A 5HDDA 3V67A 4GN2A 4P6BA 1FCMA 1FSWA 3OOVA 1HZOA 4LENA 2G2UA 4KUKA 1NXYA 3SH7A 3WS0A 3MQQA 4WZ5C 4OOYA 2M7UA 5EUAA 3R7WB 3T4QA 3VP1A 3CPTB 2OWJA 2Y2IA 4PM5A 4R38A 4PKYG 1DRMA 1ZHHB 4H8RA 3UE0A 3G35A 2V1ZA 5AVFA 5F69A 1MXOA 4OQ0A 2HP6A 4BL2A 2HPBA 3ZQ5A 5FAOA 1D1JA 1W8YA 1PI4A 4GHIA 3UDIA 1ERMA 1IFQA 2XRNA 4S2LA 3PBRA 4M4XA 5EPHA 4KZBA 1N9OA 2JE5A 5DF9A 1SDNA 1XFNA 3BY9A 2Q9MA 2O9AA 3IQAA 2HJEA 1N9BA 3N7WA 1L3LA 2WADA 5J7EA 3HUNA 1PI5A 3SOIA 4Y5FA 5CXWA 3L7HA 1W79A 3IXDA 3VP0A 2A24B 3MF0A 3Q1FA 5EECA 5EM0A 3IF6B 2WYXA 1SCWA 2JC7A 2Y55A 3ZDJA 4ARZA 2LB5A 3BFDA 4KZAA 1OTIA 2KDKA 2WKQA 2H5SA 5IU1A 3OCLA 3PTEA 1MWUA 4NXGA 3UY6A 1BLHA 5CTMA 1SKOA 1VM1A 3HREA 2VGLS 3LICA 1F98A 2ZQAA 1LI9A 1LSWA 2PD8A 4OH0A 1JWVA 4DF6A 1UWPX 4EBNA 2XK1A 4MLLA 4IJGA 4NXFA 4DE1A 1GHPA 3KO6A 2KX6A 4UA6A 4R3JA 2Y4AA 3WRTA 1MPLA 4JGRA 4R23A 3IS2A 4I3IA 1IKGA 4LCMA 3CUEC 5F82A 3LY4A 1ODVA 1BLCA 3BEBA 3F1PA 5HDSA 5FEGA 4Y0UA 1D7EA 3V3RA 3T4SA 1S4RA 5MC7A 3MR0A 1AXBA 3NDGA 2B5RA 5M1AA 5GL9A 3QP6A 1N9LA 2VLGA 3TSGA 4BD1A 1NLZA 1MBLA 2K7SA 4GLQA 3GQZA 1N4OA 2O9BA 2WK0A 3T4OA 3M2JA 4FOFA 2OAQ1 4ID4A 3OBFA 2OSUA 4HNBA 1K0KA 2ACGA 3MFXA 3IXHA 1IKIA 3MSHA 4Y3IA 1KVLA 2HP5A 3Q7ZA 5FI6A 2UWXA 4L0LA 4OP5A 4YFMA 2H0TA 2L1MA 2Z6CA 4NXBA 5CGWA 2WAEA 4KUOA 1NY0A 1FOFA 3W4PA 1RGZA 4K08A 2HDUA 2ZL1A 4XT2B 2OAP1 2D02A 2Z6DA 2WGWA 4ZRRA 3B3XA 1S0WA 3F1OB 3WWXA 5EOEA 2JN7A 2Y2NA 4E3IA 5K5BA 1YPRA 3OZHA 5EVID 1T18A 3NBLA 1G6OA 5DJTA 5G18A 3ZCZA 4ARZB 2J3TD 5CTNA 2HDRA 1VETA 4GDNA 1PWCA 3LCEA 3TJZC 5A91A 4DRTA 5A90A 1CF0A 3G6OA 1IYSA 3BFFA 1MKIA 5AQAA 4Y0TA 1ESUA 4IBXA 3PBNA 2P04A 3FZCA 3CHWP 1SKFA 5IHVA 1OTEA 5TJJA 1DY6A 2HDQA 4L9FA 5F6AA 1ZKJA 3VP3A 2J3TC 2I9VA 3IF6C 2EX2A 3UMEA 3A0VA 1XP4A 1SDEA 1K56D 3O87A 3IWIA 4UA9A 1KGGA 4HIAA 4GS9A 3N8LA 3EEAA 1ONHA 3EWKA 4MN6A 1H8YA 5FDSA 2ZMFA 4I3AA 5L2FA 4X55A 2W1RA 3LR3A 4Z9QA 3NDEA 4WYYA 3RJUA 1P9RA 4QY6A 1IEMA 4LGWA 4PPRA 3F1PB 3DWZA 2W27A 5CEBA 4R1GA 2HV1A 4Z1WA 3QP5A 1IELA 3WS5A 4S2PA 4OONA 2WKEA 3S7NA 2PYRA 2V9AA 1GA0A 1LLBA 4HH2A 3O5YA 1PNEA 1J3WA 3IH8A 3DW0A 5F83A 1T19A 2Y91A 4X1MA 1VB6A 2WZXA 4OPQA 3MKFA 3C7UA 3EEHA 2PRFA 5FQQA 3G31A 3S7OA 4PM8A 3M6BA 5EV0A 2ZM2A 3QP4A 2HP9A 4K0XA 4YNRA 1ACFA 5FI2A 3HLFA 1KE4A 2VV6A 2JKGA 1XJ6A 3CMZA 3HL9A 4QWOA 4OPZA 3IHAA 4NK3A 4A5RA 3N8RA 3LEQA 2ZL1B 1LL8A 2M7VA 4NG2A 4KZ6A 4X25A 3UB6A 2Y2LA 2ZD8A 3HJKA 5EVLA 2IWCA 3ITBA 4D60A 3LUQA 1IYPA 4JLFA 3M2KA 4EQIA 1L0FA 1AWIA 1E25A 4EBLA 2X01A 4JF5A 2WKRA 4IUHA 4BENA 2OLVA 2BG1A 3C8CA 2D01A 4LPZA 1EWZA 4R4SA 4WMCD 1KGEA 1FQGA 1GHMA 1WYCA 1TDGA 3KX0X 1K6RA 2Y2JA 2ZJ9A 2HGVA 1LSXA 3SW1A 5E2GA 2EWVA 3Q07A 4EESA 3UE3A 1YLPA 4PHTA 3TOIA 3UO9A 4PKYA 4FD8A 3W8KA 3BQ8A 5HWVA 2Y79A 2WZZA 2Y2GA 4E3NA 3VOYA 2PT7A 1F2KA 1WE4A 3MXRA 4DKIA 3PBSA 2ZQ8A 1G28A 3OPLA 3MS6A 4C6YA 5LBRA 3SH8A 3EOIA 1VQQA 1PZPA 3AGEA 3ZFZA 2JKFA 3BLSA 3BY8A 4GD6A 3T50A 2RL3A 1S66L 4L9EA 3W2ZA 5EVIA 3IT9A 3VOZA 3E2KA 2W3FA 3OCNA 4KZ5A 3E4QA 2OLUA 3HLBA 1KE3A 4ZJ2A 1YMXA 4QB8A 2JCHA 3ZNTA 2ZC3B 4CPKA 4JGPA 5CEDA 3ZG5A 3UE1A 5DF7A 1O07A 2HF6A 3FV7A 3G32A 3GVBA 4O8GA 3GTCA 2EX6A 1KE0A 5HFOA 4Y15A 3V50A 3MKEA 1CJFA 2BASA 3OPPA 3BECA 2V0UA 4JPMA 1ONGA 1LI0A 3KSFA 5I5LA 4DE2A 3Q7VB 4X68A 3IWQA 1K56A 5FEFA 1YMSA 5GLAA 3EGDC 3FPVA 2PHYA 1T1CA 1JTDA 2DMWA 3I7JA 3TW8A 1HTZA 1M40A 5FQMA 4IBRA 3GRJA 3MXSA 3BRMA 4H6JB 1S4SA 3NOUC 3PXPA 4ZAMA 2EX9A 5HL6A 3LI8A 3P98A 1HVBA 1S1YA 2EXBA 1J9MA 2GZAA 4S2MA 4JXSA 4GDBA 4IVIA 4E3KA 4CJNA 4IHQA 4LLOB 1NYYA 3VMAA 2R9XA 1YKDA 4F3LA 5KSCA 2ZQ9A 1K6SA 4JF6A 2BLSA 1SHVA 5FQ9A 3CAXA 3BM6A 4DE3A 2ZM8A 1LHYA 2XSSA 2ZC7A 4Y13A 5A92A 1WA9A 4P6ZM 1K57A 3ZGAB 1FIKA 3CJMA 3OLOA 4G3VA 1TDLA 5GLDA 4B93A 1OTBA 1XA1A 2PAVP 1L0DA 1YAXA 3Q81A 1JWPA 4JGOA 3S7QA 1PRQA 5DJUA 3MXQA 5EVIB 4PM6A 4U0TA 3B47A 3K3DA 1Z6FA 4R3AA 3ZVTA 1W8QA 4I39A 4WMCA 3C2WA 4N1HA 1TS7A 4OQIA 3RXWA 3GDIA 4MNRA 2J80A 2EWWA 3LR0A 3GV9A 2Y2OA 4WBGA 4FUWA 1S67L 5FA7A 2PBDP 1BULA 1MKMA 4EEUA 1G6AA 4HESA 4HY8A 1CI9A 2Y2HA 2JKTI 4Q0HA 2OWHA 1PFLA 2W1TA 3UPOA 1M6KA 2Y2QA 3EQUA 5DVAA 3T12B 3D4FA 1EI5A 4UAAA 1K55A 1Y28A 3C38A 4BQMA 4DXBA 4EWFA 1KDWA 3NI9A 4M3KA 5EVEA 2G2WA 3KSHA 2BTFP 4KZ4A 1XXMA 5KIZA 3HCYA 3NY4A 1JNUA 4JKTA 1H8ZA 1Z09A 2H0YA 2HDSA 2O0YA 2QJ7A 1TVFA 4XUXA 2QHKA 1KDSA 5AQBA 3QHYA 2P9VA 2QPNA 3HVFA 3FC7A 4UQIM 3QP2A 1BYWA 4CLCA 3ZYTA 1L0EA 3VE4A 4KG2A 1XJ3A 2QMIA 3H7WA 3UDXA 5FI7A 1K54A 2EXAA 4N1XA 5J4EA 3UNWA 5HWWA 1MC0A 1YT4A 3CI6A 4D2OA 5E2EA 4LRYC 4GHIB 4RVAA 3D72A 2W3GA 1X0OA 3BYDA 2QYBA 4BBTA 2ZC4B 5L8MA 1FCNA 3ICYA 3VSLA 3GECA 4QY5A 5I94A 3NIAA 2B95A 2K31A 1OT6A 4GKUA 4N92A 4OP8A 5BOHA 3SZTA 2E8JA 1C3BA 1DP8A 1TF1A 3QP1A 1BT5A 4R0QA 2VKSA 5JYOA 2XD1A 2W3DA 5E2FA 5FQKA 5GHXA 5CGSA 4S2OA 1E3UD 2QJ5A 4YINA 4QD4A 1GHIA 1A0KA 3V3SA 2IWBA 2J9PA 3T4KA 1MWTA 4II7A 5FAQA 5CHMA 3RXXA 3CWFA 4WLAA 1EW0A 1H8MA 3GSGA 4P0MA 5AQ7A 1SKOB 4RX2A 5HPIA 4EW7A 3ZHHA 5EVIC 2M1CA 1ZG4A 4S2NA 1UWNX 4Q0IA 2W1TB 3NC8A 5GHZA 4YOFA 4KG5A 4RA7A 4DN0A 2B02A 5KSHA 3JVVA 4OLGA 4ZBEA 2P74A 4DJ2A 3KSIA 1UGUA 3C7VA 4BJPA 4I38A 1NLYA 2H10A 3UDFA 3BLMA 3IS2B 4YWZA 3SS5A 4X53A 1BTLA 3E98A 2GNXA 4HHDA 1BLSA 2XA7S 3F1NA 3TRCA 1XGIA 3BQAA 4E3MA 5CERA 4BWIA 1LT0A 2V8CA 2J9OA 2G7UA 4RYEA 1FSYA 3E4PA 2P7JA 4E6WA 3WS2A 4EUVA 3OPHA 3JPUA 2MJ6A 3MZFA 4WF0A 3E2LA 3MQOA 4JF4A 3BWLA 2VGLM 3VFFA 1ESIA 1ZC2A 3T4JA 4OLDA 4QU3A 4MEZA 4CQHA 5E43A 3FYZA 4MDZA 4HQAA 5IT5A 3NCKA 2C5WB 2ZQ7A 4JXVA 2W0NA 4NKPA 4WL9A 3S1YA 4KQRA 1DJCA 1YLWA 4P85A 3IBRA 2E8IA 4E3OA 3BFCA 3VFHA 4LFUA 4Y2FA 4RX3A 1PYYA 4LV1A 1ES5A 4Y7PA 3SS3A 2V2FF 2WGWB 3G2ZA 3ZG8B 3LI9A 3VP4A 3LIFA 3JVUA 4GOGA 5C5KA 1ES2A 1K57C 5EE8A 3LYXA 2ZLYA 2VGKA 3GR2A 1K38A 4FH4A 1VETB 4S2IA 1Q2PA 1ALQA 1L0GA 1U60A 1TS0A 4AFIA 5F1GA 2ZC6B 3D9YA 1MZUA 1EROA 1NZUA 5DTKA 3QNBA 4ME4A 3U4LP 4CLCE 3MQ0A 4E3LA 2XH9A 4HI4A 1L2SA 2P08A 3D3OA 1OTDA 1NRJA 2DRWA 5DKKA 3Q82A 5FSRA 1GSVA 2WKHA 2JBFA 3R4KA 4X56A 3R7WA 4EETB 2NUTC 3VV4A 3CPTA 1N9NA 1VHMA 4IUKA 2HJ9C 4HP4A 4GS9B 2V0WA 3A0SA 2IWDA 3TG9A 4HP9A 3ZG7B 2W3EA 2Z2LB 3MBZA 1CQAA 1CI8A 3RFBA 2QZ6A 1BSGA 2WKPA 1V9ZA 4I3JA 1XJ2A 1NZOA 3AGDA 1H0MA 2DNSA 2VZWA 1E3UA 1PW8A 3OPRA 5TBMA 2GX5A 1K55C 1OT9A 1IOUA 1W63Q 3VE3A 5GHYA 1XX2A 3G34A 1IYOA 3LEZA 1JVJA 1F5MA 4O7DA 3NOTC 1GA9A 4CLCD 3PBTA 4U0XA 1CEGA 4C75A 2ZQDA 3ISGA 1ZTUA 2XFTA 3H9WA 3MZEA 2GJ3A 1PIOA 4ETZA 2Q9NA 2IA2A 3NOPC 4OOMA 2L4RA 1P97A 2R9WA 1ES4A 2FH5A 4LRZE 2KOIA 4S2JA 3FWLA 5IS1A 2XGNA 4MCWA 4CLCC 2ZMVA 3IF5A 3T4TA 4KQDA 4BBVA 3DTMA 4OPRA 1RP5A 1DP9A 4WEKA 2J7VA 3OC2A 3TE8A 1K54C 4Y0OA 2H28A 1HD8A 4B4ZA 1NYMA 3W4OA 4BMWA 3KSGA 5FDHA 2VK3A 5L07A 3EQVA 4E3JA 3HLGA 4KQQA 5CGXA 2AVXA 4U3TA 1LSVA 4UHUA 5U47A 4B9OA 4F94A 5G4YA 3HLDA 1KOUA 3S4XA 3PAEA 5A8BA 1WYBA 5DTTA 3S7PA 1S1ZA 3WS1A 3FKWA 2XLNA 4GJ4A 4LV0A 5DFYA 3O88A 2VJWA 1H5XA 4EU0A 1PW1A 3A3DA 5KZHA 4R6LA 2DCFA 2GDNA 4I5SA 5HZHA 4KZ3A 5HSQA 1YSPA 3LIEA 1XKZA 2L0WA 4MBKA 1CK3A 3A3EA 1FILA 1K4FA 3UN7A 1TS8A 5CHJA 4KZ7A 4K91A 2XROA 5HD5A 4S2NC 4HJ6A 4R4RA 3M6HA 3IBJA 5HWTA 5F68A 1IYQA 3DTEA 4G3KA 3NHQA 5TBMB 3W4QA 4XT2A 2Y2MA 3K2NA 4QJGA 3UE6A 2V20A 3LO7A 4Q0JA 2QKPA 4EEPA 4L9GA 2B18A 3F1OA 2VEAA 3A3IA 4E04A 4N9KA 5D3OA
chains in the Genus database with same CATH topology
3N4IA 4KZ6A 5FQKA 5GHXA 1W5DA 5CGSA 3CZDA 4IEDA 4S2OA 3UPPA 1E3UD 4B4XA 1YLJA 4YINA 3V39A 5FATA 2Y2LA 4BLMA 1MWRA 2ZD8A 2Y59A 2J8YA 4FSFA 4QD4A 5EVLA 1GHIA 1CEFA 4HBUA 2IWCA 3ITBA 4OKPA 4ZDXA 3V3SA 4KZ8A 4X6TA 2IWBA 3V5MA 1IYPA 1NRFA 1YLTA 2J9PA 1I5QA 4JLFA 5M18A 1MWTA 3M2KA 4EQIA 2XEPA 1L0FA 5FAPA 3PBQA 5FAQA 4IVKA 1E25A 5CHMA 5HAQA 3RXXA 1DJAA 3G30A 4EBLA 3O3VA 2X01A 3GSGA 4JF5A 4GZBA 3P09A 4ZJ3A 4LCLA 4P0MA 5AQ7A 4OQHA 4RX2A 4BENA 2OLVA 2BG1A 1JTGA 4DE0A 4GD8A 3ZHHA 5EVIC 2PU4A 4WELA 1W7FA 1ZG4A 3HBRA 1EWZA 3WRZA 4R4SA 4S2NA 4WMCD 1KGEA 4EUZA 5DF8A 3NC8A 5GHZA 4KG5A 4RA7A 4WM9A 2EFUA 1FQGA 1FCOA 1GHMA 1WYCA 1TDGA 1ZG6A 2XDMA 2ZMAA 1DJBA 1K6RA 2Y2JA 2ZC5B 5KSHA 2ZJ9A 4OLGA 4ZBEA 2P74A 4GB7A 5CHUA 3C4OA 5F1FA 5E2GA 3C7VA 4GN2A 4BJPA 4P6BA 3Q07A 1FCMA 1FSWA 3UE3A 1YLPA 3TOIA 3UO9A 2H10A 3UDFA 3BLMA 1HZOA 4LENA 4FD8A 3SS5A 2G2UA 1TEMA 3W8KA 4X53A 1FR6A 1K25A 1NXYA 3SH7A 3WS0A 2WZZA 1BTLA 2Y2GA 4E3NA 4WZ5C 1BLSA 4E6XA 1XGIA 3VOYA 4E3MA 1WE4A 4OOYA 3MXRA 4JBFA 4DKIA 5EUAA 3IXBA 3VP1A 3PBSA 3WS4A 2ZQ8A 2Y2IA 3OPLA 4PM5A 5HL1A 4JXWA 5CERA 4C6YA 2XR0A 4H8RA 3UE0A 3G35A 2V1ZA 3SH8A 3ZFZA 1VQQA 1PZPA 3AGEA 2J9OA 2WUQA 3BLSA 3CG5A 5FQIA 3VSKA 1G68A 5GLBA 4RYEA 4EV4A 1FSYA 4E6WA 1MXOA 4GD6A 3WS2A 2RL3A 4OQ0A 3OPHA 4KENB 2HP6A 1XGJA 5EVIA 1S6RA 3MZFA 3E2LA 4BL2A 2HPBA 1BLPA 3IT9A 5FAOA 4JF4A 4KQOA 3VOZA 3VFFA 1W8YA 3C5AA 1ESIA 1PI4A 3E2KA 1PZOA 3UDIA 3OCNA 4KZ5A 1ERMA 3A3JA 1ZC2A 2OLUA 3HLBA 3PBRA 1YM1A 4OLDA 1Y54A 4MEZA 4QU3A 4S2LA 1KE3A 4ZJ2A 5EPHA 4KZBA 1YMXA 5E43A 2JE5A 5DF9A 3FYZA 3HUMA 2XD5A 3NCKA 1SDNA 4PMAA 4QB8A 2JCHA 3ZNTA 2C5WB 2ZQ7A 4JXVA 2ZC3B 2Q9MA 4CPKA 3IQAA 5CEDA 3ZG5A 1N9BA 3N7WA 3S1YA 4KQRA 3UE1A 2WADA 3HUNA 1O07A 1DJCA 1PI5A 5DF7A 3SOIA 5CXWA 1YLWA 3FV7A 3ZNYA 1W79A 3IXDA 4P85A 3VP0A 3G32A 2E8IA 4E3OA 3BFCA 3GVBA 3VFHA 3GTCA 4WZ5A 3Q1FA 5EECA 2EX6A 4B88A 3IF6B 1KE0A 5HFOA 2CC1A 4RX3A 1PYYA 4LV1A 2RCXA 2WYXA 3MKEA 1ES5A 1SCWA 2EX8A 2JC7A 4OQGA 4LV3A 4Y7PA 3SS3A 2V2FF 2Y55A 3HLWA 3OPPA 3IHBA 2WGWB 3BECA 3G2ZA 4JPMA 5HARA 3ZDJA 3ZG8B 3BFDA 1ONGA 4KZAA 1LI0A 3N6IA 1QMEA 4DE2A 3Q7VB 4X68A 2H5SA 4GNUA 3IWQA 2WKIA 3OCLA 3PTEA 1K56A 1MWUA 3VP4A 3UY6A 1BLHA 3G4PA 5CTMA 1YMSA 4GOGA 5GLAA 5D3OA 4NETA 1VM1A 3HREA 4ZJ1A 4OVDA 1JTDA 3IH9A 1ES2A 3I7JA 3BFEA 3PAGA 1K57C 2ZQAA 5EE8A 1LI9A 2ZLYA 1HTZA 4XXRA 1M40A 5FQMA 2VGKA 2A3UA 3GR2A 1K38A 4IBRA 3GRJA 2FFYA 4FH4A 1JWVA 2WAFA 4OH0A 1Q2PA 4S2IA 1ALQA 4DF6A 3MXSA 3SS4A 1L0GA 5A93A 3BRMA 1U60A 4OOLA 4EBNA 5F1GA 2XK1A 2ZC6B 4MLLA 1EROA 4ZAMA 1FR1A 1NZUA 5DTKA 5EOOA 2EX9A 3QNBA 3IXGA 4DE1A 4ZTKA 1GHPA 2A49A 4KG6A 4UA6A 4E3LA 2XH9A 4R3JA 1BUEA 3P98A 4Q8IA 1HVBA 1L2SA 2Y4AA 1MPLA 3WRTA 5CECA 2EXBA 1J9MA 4R23A 1IKGA 3C4PA 4LCMA 3MFDA 3V50A 4S2MA 4JXSA 2X02A 5JYPA 2DRWA 5F82A 3Q82A 5FSRA 3ZVWA 3LY4A 4GDBA 5AQ9A 4IVIA 1BLCA 1QMFA 4E3KA 2EFXA 2WKHA 2JBFA 4CJNA 4X56A 1MY8A 3BEBA 1NYYA 3VMAA 4QHCA 4Y0UA 2R9XA 4PM7A 3V3RA 3JYIA 5KSCA 2ZQ9A 1K6SA 1AXBA 3NDGA 4JF6A 2B5RA 5M1AA 2IWDA 1I2WA 2BLSA 2X71A 1SHVA 5GL9A 1XA7A 5FQ9A 3TG9A 3BM6A 5HAPA 3ZG7B 3MZDA 4DE3A 2P9VB 2Z2LB 2ZM8A 3MBZA 1LHYA 3TSGA 4BD1A 1CI8A 2ZC7A 5HX9A 1MBLA 3GQZA 1N4OA 1PWGA 2QZ6A 1BSGA 2WK0A 1LL9A 5A92A 4KZ9A 3ZGAB 1K57A 2ZM0A 3CJMA 5TGFA 3M2JA 1TDLA 5GLDA 1NZOA 4ID4A 4C3QA 2OSUA 3AGDA 1XA1A 2DNSA 1E3UA 1L0DA 1PW8A 3IXHA 3OPRA 3Q81A 1IKIA 4R3BA 1JWPA 1K55C 1KGFA 2FFFB 1KVLA 2HP5A 2VGJA 3HLCA 3Q7ZA 5FI6A 2UWXA 4L0LA 4OP5A 5EVIB 4YFMA 2H0TA 4PM6A 1XX2A 4U0TA 5GHYA 3G34A 1Z6FA 4XUZA 1IYOA 3LEZA 1O7EA 1JVJA 4PM9A 5CGWA 2WAEA 1K4EA 3GMWA 4O7DA 3HUOA 3ZVTA 1GA9A 2XF3A 3PBTA 4N9LA 1NY0A 1FOFA 4U0XA 1CEGA 3W4PA 4C75A 2ZQDA 1RGZA 3ZG9B 1JWZA 1W8QA 2HDUA 3ISGA 4WMCA 5HAIA 4N1HA 2XQZA 1LL5A 4OQIA 3RXWA 2XFTA 4MNRA 3MZEA 1PIOA 4X69A 5TFQA 2WGWA 2Q9NA 3B3XA 1RGYA 1S0WA 1E4DA 3GV9A 2Y2OA 5EOEA 3SH9A 3WWXA 3ZG0A 2Y2NA 4E3IA 4OOMA 4WBGA 2R9WA 3OZHA 3Q7VA 5EVID 4DDYA 5FA7A 1ES4A 1RCJA 1GCEA 1BULA 3HLEA 3NBLA 3UPNA 3IWOA 4S2JA 5DTSA 1G6AA 4HESA 3FWLA 2XGNA 1CI9A 5G18A 5TR7A 2Y2KA 2Y2HA 4FH2A 1MWSA 3ZCZA 3IF5A 4LV2A 5CTNA 2HDRA 3UPOA 1M6KA 3DTMA 2Y2QA 4OPRA 4GDNA 1RP5A 3BFGA 3EQUA 3N8SA 5DVAA 4FCFA 4HBTA 1PWCA 3LCEA 3PBOA 4WEKA 3D4FA 1EI5A 2J7VA 3OC2A 4UAAA 5A91A 4DRTA 5A90A 1PWDA 1K54C 1K55A 4Y0OA 4DDSA 1HD8A 4B4ZA 1YLYA 1NYMA 3W4OA 4BQMA 2C6WB 1IYSA 5FDHA 4DXBA 3BFFA 1MKIA 4EWFA 1KDWA 5J8XA 2Z2MB 2XFSA 5AQAA 4P87A 4Y0TA 1ESUA 4IBXA 3PBNA 5KMWA 3NI9A 3EQVA 4M3KA 3FZCA 4E3JA 1SKFA 3HLGA 2G2WA 4KQQA 5IHVA 1BZAA 5CGXA 1DY6A 2HDQA 4U3TA 4UHUA 4KZ4A 1XXMA 5U47A 1ZKJA 3QNCA 3VP3A 3NY4A 3IF6C 2EX2A 1OMEA 4F94A 3HLDA 1XP4A 1SDEA 4UA7A 3S4XA 4JKTA 1K56D 3O87A 1H8ZA 3IWIA 2WGIA 3PAEA 1KGGA 4UA9A 2H0YA 1WYBA 2HDSA 1XPBA 5CRFA 1YQSA 3G2YA 3N8LA 1ONHA 5DTTA 5FQJA 1TVFA 4XUXA 3FKWA 3WS1A 5M19A 1H8YA 5E2HA 5L2FA 2XLNA 4LV0A 1KDSA 5AQBA 3QHYA 3O88A 4X55A 2P9VA 2OV5A 2QPNA 3NDEA 4WYYA 4Z9QA 3HVFA 3RJUA 3FKVA 1ES3A 1ERQA 3ITAA 4QY6A 1H5XA 1IEMA 4PPRA 3DWZA 4JXGA 1PW1A 5CEBA 3A3DA 5KZHA 4R1GA 3A3FA 2DCFA 4S2KA 2GDNA 1L0EA 5HW3A 1YLZA 4KG2A 4MBFA 1NJ4A 1IELA 4WEJA 4KZ3A 3WS5A 4S2PA 2QMIA 1XKZA 3UDXA 4OONA 3S22A 5FI7A 1K54A 4MBKA 2WKEA 2EXAA 4N1XA 1CK3A 3A3EA 4OPYA 3UNWA 1GA0A 1LLBA 1K4FA 4K0WA 4BD0A 3UN7A 3IH8A 3DWKA 3DW0A 5CHJA 4KZ7A 1YT4A 4HEFA 4K91A 5F83A 4S2NC 4D2OA 5E2EA 2Y91A 4R4RA 3M6HA 4RVAA 4DXCA 2WZXA 4OPQA 3O86A 3MKFA 3BYDA 1IYQA 3C7UA 2WGVA 2ZQCA 2ZC4B 3W4QA 1FCNA 2Y2MA 5FQQA 3G31A 5FASA 4QJGA 3IF6A 3VSLA 4PM8A 3M6BA 2V20A 4QY5A 1KVMA 2ZM2A 2I72A 2HP9A 3LO7A 3NIAA 4K0XA 5I94A 4EBPA 2PU2A 4GKUA 1Q2QA 4N92A 4OP8A 5FI2A 3HLFA 1KE4A 5BOHA 5GLCA 2Y2PA 1C3BA 1BT5A 4R0QA 2PBYA 3LY3A 3CMZA 3HL9A 5JYOA 4MBHA 4OPZA 3IHAA 4NK3A 2XD1A 3A3IA 4A5RA 4WZ4A 4BL3A 3N8RA 4N9KA 1I2SA 5E2FA 3VP2A 3AGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4I A;  4KZ6 A;  5FQK A;  5GHX A;  1W5D A;  5CGS A;  3CZD A;  4IED A;  4S2O A;  3UPP A;  1E3U D;  4B4X A;  1YLJ A;  4YIN A;  3V39 A;  5FAT A;  2Y2L A;  4BLM A;  1MWR A;  2ZD8 A;  2Y59 A;  2J8Y A;  4FSF A;  4QD4 A;  5EVL A;  1GHI A;  1CEF A;  4HBU A;  2IWC A;  3ITB A;  4OKP A;  4ZDX A;  3V3S A;  4KZ8 A;  4X6T A;  2IWB A;  3V5M A;  1IYP A;  1NRF A;  1YLT A;  2J9P A;  1I5Q A;  4JLF A;  5M18 A;  1MWT A;  3M2K A;  4EQI A;  2XEP A;  1L0F A;  5FAP A;  3PBQ A;  5FAQ A;  4IVK A;  1E25 A;  5CHM A;  5HAQ A;  3RXX A;  1DJA A;  3G30 A;  4EBL A;  3O3V A;  2X01 A;  3GSG A;  4JF5 A;  4GZB A;  3P09 A;  4ZJ3 A;  4LCL A;  4P0M A;  5AQ7 A;  4OQH A;  4RX2 A;  4BEN A;  2OLV A;  2BG1 A;  1JTG A;  4DE0 A;  4GD8 A;  3ZHH A;  5EVI C;  2PU4 A;  4WEL A;  1W7F A;  1ZG4 A;  3HBR A;  1EWZ A;  3WRZ A;  4R4S A;  4S2N A;  4WMC D;  1KGE A;  4EUZ A;  5DF8 A;  3NC8 A;  5GHZ A;  4KG5 A;  4RA7 A;  4WM9 A;  2EFU A;  1FQG A;  1FCO A;  1GHM A;  1WYC A;  1TDG A;  1ZG6 A;  2XDM A;  2ZMA A;  1DJB A;  1K6R A;  2Y2J A;  2ZC5 B;  5KSH A;  2ZJ9 A;  4OLG A;  4ZBE A;  2P74 A;  4GB7 A;  5CHU A;  3C4O A;  5F1F A;  5E2G A;  3C7V A;  4GN2 A;  4BJP A;  4P6B A;  3Q07 A;  1FCM A;  1FSW A;  3UE3 A;  1YLP A;  3TOI A;  3UO9 A;  2H10 A;  3UDF A;  3BLM A;  1HZO A;  4LEN A;  4FD8 A;  3SS5 A;  2G2U A;  1TEM A;  3W8K A;  4X53 A;  1FR6 A;  1K25 A;  1NXY A;  3SH7 A;  3WS0 A;  2WZZ A;  1BTL A;  2Y2G A;  4E3N A;  4WZ5 C;  1BLS A;  4E6X A;  1XGI A;  3VOY A;  4E3M A;  1WE4 A;  4OOY A;  3MXR A;  4JBF A;  4DKI A;  5EUA A;  3IXB A;  3VP1 A;  3PBS A;  3WS4 A;  2ZQ8 A;  2Y2I A;  3OPL A;  4PM5 A;  5HL1 A;  4JXW A;  5CER A;  4C6Y A;  2XR0 A;  4H8R A;  3UE0 A;  3G35 A;  2V1Z A;  3SH8 A;  3ZFZ A;  1VQQ A;  1PZP A;  3AGE A;  2J9O A;  2WUQ A;  3BLS A;  3CG5 A;  5FQI A;  3VSK A;  1G68 A;  5GLB A;  4RYE A;  4EV4 A;  1FSY A;  4E6W A;  1MXO A;  4GD6 A;  3WS2 A;  2RL3 A;  4OQ0 A;  3OPH A;  4KEN B;  2HP6 A;  1XGJ A;  5EVI A;  1S6R A;  3MZF A;  3E2L A;  4BL2 A;  2HPB A;  1BLP A;  3IT9 A;  5FAO A;  4JF4 A;  4KQO A;  3VOZ A;  3VFF A;  1W8Y A;  3C5A A;  1ESI A;  1PI4 A;  3E2K A;  1PZO A;  3UDI A;  3OCN A;  4KZ5 A;  1ERM A;  3A3J A;  1ZC2 A;  2OLU A;  3HLB A;  3PBR A;  1YM1 A;  4OLD A;  1Y54 A;  4MEZ A;  4QU3 A;  4S2L A;  1KE3 A;  4ZJ2 A;  5EPH A;  4KZB A;  1YMX A;  5E43 A;  2JE5 A;  5DF9 A;  3FYZ A;  3HUM A;  2XD5 A;  3NCK A;  1SDN A;  4PMA A;  4QB8 A;  2JCH A;  3ZNT A;  2C5W B;  2ZQ7 A;  4JXV A;  2ZC3 B;  2Q9M A;  4CPK A;  3IQA A;  5CED A;  3ZG5 A;  1N9B A;  3N7W A;  3S1Y A;  4KQR A;  3UE1 A;  2WAD A;  3HUN A;  1O07 A;  1DJC A;  1PI5 A;  5DF7 A;  3SOI A;  5CXW A;  1YLW A;  3FV7 A;  3ZNY A;  1W79 A;  3IXD A;  4P85 A;  3VP0 A;  3G32 A;  2E8I A;  4E3O A;  3BFC A;  3GVB A;  3VFH A;  3GTC A;  4WZ5 A;  3Q1F A;  5EEC A;  2EX6 A;  4B88 A;  3IF6 B;  1KE0 A;  5HFO A;  2CC1 A;  4RX3 A;  1PYY A;  4LV1 A;  2RCX A;  2WYX A;  3MKE A;  1ES5 A;  1SCW A;  2EX8 A;  2JC7 A;  4OQG A;  4LV3 A;  4Y7P A;  3SS3 A;  2V2F F;  2Y55 A;  3HLW A;  3OPP A;  3IHB A;  2WGW B;  3BEC A;  3G2Z A;  4JPM A;  5HAR A;  3ZDJ A;  3ZG8 B;  3BFD A;  1ONG A;  4KZA A;  1LI0 A;  3N6I A;  1QME A;  4DE2 A;  3Q7V B;  4X68 A;  2H5S A;  4GNU A;  3IWQ A;  2WKI A;  3OCL A;  3PTE A;  1K56 A;  1MWU A;  3VP4 A;  3UY6 A;  1BLH A;  3G4P A;  5CTM A;  1YMS A;  4GOG A;  5GLA A;  5D3O A;  4NET A;  1VM1 A;  3HRE A;  4ZJ1 A;  4OVD A;  1JTD A;  3IH9 A;  1ES2 A;  3I7J A;  3BFE A;  3PAG A;  1K57 C;  2ZQA A;  5EE8 A;  1LI9 A;  2ZLY A;  1HTZ A;  4XXR A;  1M40 A;  5FQM A;  2VGK A;  2A3U A;  3GR2 A;  1K38 A;  4IBR A;  3GRJ A;  2FFY A;  4FH4 A;  1JWV A;  2WAF A;  4OH0 A;  1Q2P A;  4S2I A;  1ALQ A;  4DF6 A;  3MXS A;  3SS4 A;  1L0G A;  5A93 A;  3BRM A;  1U60 A;  4OOL A;  4EBN A;  5F1G A;  2XK1 A;  2ZC6 B;  4MLL A;  1ERO A;  4ZAM A;  1FR1 A;  1NZU A;  5DTK A;  5EOO A;  2EX9 A;  3QNB A;  3IXG A;  4DE1 A;  4ZTK A;  1GHP A;  2A49 A;  4KG6 A;  4UA6 A;  4E3L A;  2XH9 A;  4R3J A;  1BUE A;  3P98 A;  4Q8I A;  1HVB A;  1L2S A;  2Y4A A;  1MPL A;  3WRT A;  5CEC A;  2EXB A;  1J9M A;  4R23 A;  1IKG A;  3C4P A;  4LCM A;  3MFD A;  3V50 A;  4S2M A;  4JXS A;  2X02 A;  5JYP A;  2DRW A;  5F82 A;  3Q82 A;  5FSR A;  3ZVW A;  3LY4 A;  4GDB A;  5AQ9 A;  4IVI A;  1BLC A;  1QMF A;  4E3K A;  2EFX A;  2WKH A;  2JBF A;  4CJN A;  4X56 A;  1MY8 A;  3BEB A;  1NYY A;  3VMA A;  4QHC A;  4Y0U A;  2R9X A;  4PM7 A;  3V3R A;  3JYI A;  5KSC A;  2ZQ9 A;  1K6S A;  1AXB A;  3NDG A;  4JF6 A;  2B5R A;  5M1A A;  2IWD A;  1I2W A;  2BLS A;  2X71 A;  1SHV A;  5GL9 A;  1XA7 A;  5FQ9 A;  3TG9 A;  3BM6 A;  5HAP A;  3ZG7 B;  3MZD A;  4DE3 A;  2P9V B;  2Z2L B;  2ZM8 A;  3MBZ A;  1LHY A;  3TSG A;  4BD1 A;  1CI8 A;  2ZC7 A;  5HX9 A;  1MBL A;  3GQZ A;  1N4O A;  1PWG A;  2QZ6 A;  1BSG A;  2WK0 A;  1LL9 A;  5A92 A;  4KZ9 A;  3ZGA B;  1K57 A;  2ZM0 A;  3CJM A;  5TGF A;  3M2J A;  1TDL A;  5GLD A;  1NZO A;  4ID4 A;  4C3Q A;  2OSU A;  3AGD A;  1XA1 A;  2DNS A;  1E3U A;  1L0D A;  1PW8 A;  3IXH A;  3OPR A;  3Q81 A;  1IKI A;  4R3B A;  1JWP A;  1K55 C;  1KGF A;  2FFF B;  1KVL A;  2HP5 A;  2VGJ A;  3HLC A;  3Q7Z A;  5FI6 A;  2UWX A;  4L0L A;  4OP5 A;  5EVI B;  4YFM A;  2H0T A;  4PM6 A;  1XX2 A;  4U0T A;  5GHY A;  3G34 A;  1Z6F A;  4XUZ A;  1IYO A;  3LEZ A;  1O7E A;  1JVJ A;  4PM9 A;  5CGW A;  2WAE A;  1K4E A;  3GMW A;  4O7D A;  3HUO A;  3ZVT A;  1GA9 A;  2XF3 A;  3PBT A;  4N9L A;  1NY0 A;  1FOF A;  4U0X A;  1CEG A;  3W4P A;  4C75 A;  2ZQD A;  1RGZ A;  3ZG9 B;  1JWZ A;  1W8Q A;  2HDU A;  3ISG A;  4WMC A;  5HAI A;  4N1H A;  2XQZ A;  1LL5 A;  4OQI A;  3RXW A;  2XFT A;  4MNR A;  3MZE A;  1PIO A;  4X69 A;  5TFQ A;  2WGW A;  2Q9N A;  3B3X A;  1RGY A;  1S0W A;  1E4D A;  3GV9 A;  2Y2O A;  5EOE A;  3SH9 A;  3WWX A;  3ZG0 A;  2Y2N A;  4E3I A;  4OOM A;  4WBG A;  2R9W A;  3OZH A;  3Q7V A;  5EVI D;  4DDY A;  5FA7 A;  1ES4 A;  1RCJ A;  1GCE A;  1BUL A;  3HLE A;  3NBL A;  3UPN A;  3IWO A;  4S2J A;  5DTS A;  1G6A A;  4HES A;  3FWL A;  2XGN A;  1CI9 A;  5G18 A;  5TR7 A;  2Y2K A;  2Y2H A;  4FH2 A;  1MWS A;  3ZCZ A;  3IF5 A;  4LV2 A;  5CTN A;  2HDR A;  3UPO A;  1M6K A;  3DTM A;  2Y2Q A;  4OPR A;  4GDN A;  1RP5 A;  3BFG A;  3EQU A;  3N8S A;  5DVA A;  4FCF A;  4HBT A;  1PWC A;  3LCE A;  3PBO A;  4WEK A;  3D4F A;  1EI5 A;  2J7V A;  3OC2 A;  4UAA A;  5A91 A;  4DRT A;  5A90 A;  1PWD A;  1K54 C;  1K55 A;  4Y0O A;  4DDS A;  1HD8 A;  4B4Z A;  1YLY A;  1NYM A;  3W4O A;  4BQM A;  2C6W B;  1IYS A;  5FDH A;  4DXB A;  3BFF A;  1MKI A;  4EWF A;  1KDW A;  5J8X A;  2Z2M B;  2XFS A;  5AQA A;  4P87 A;  4Y0T A;  1ESU A;  4IBX A;  3PBN A;  5KMW A;  3NI9 A;  3EQV A;  4M3K A;  3FZC A;  4E3J A;  1SKF A;  3HLG A;  2G2W A;  4KQQ A;  5IHV A;  1BZA A;  5CGX A;  1DY6 A;  2HDQ A;  4U3T A;  4UHU A;  4KZ4 A;  1XXM A;  5U47 A;  1ZKJ A;  3QNC A;  3VP3 A;  3NY4 A;  3IF6 C;  2EX2 A;  1OME A;  4F94 A;  3HLD A;  1XP4 A;  1SDE A;  4UA7 A;  3S4X A;  4JKT A;  1K56 D;  3O87 A;  1H8Z A;  3IWI A;  2WGI A;  3PAE A;  1KGG A;  4UA9 A;  2H0Y A;  1WYB A;  2HDS A;  1XPB A;  5CRF A;  1YQS A;  3G2Y A;  3N8L A;  1ONH A;  5DTT A;  5FQJ A;  1TVF A;  4XUX A;  3FKW A;  3WS1 A;  5M19 A;  1H8Y A;  5E2H A;  5L2F A;  2XLN A;  4LV0 A;  1KDS A;  5AQB A;  3QHY A;  3O88 A;  4X55 A;  2P9V A;  2OV5 A;  2QPN A;  3NDE A;  4WYY A;  4Z9Q A;  3HVF A;  3RJU A;  3FKV A;  1ES3 A;  1ERQ A;  3ITA A;  4QY6 A;  1H5X A;  1IEM A;  4PPR A;  3DWZ A;  4JXG A;  1PW1 A;  5CEB A;  3A3D A;  5KZH A;  4R1G A;  3A3F A;  2DCF A;  4S2K A;  2GDN A;  1L0E A;  5HW3 A;  1YLZ A;  4KG2 A;  4MBF A;  1NJ4 A;  1IEL A;  4WEJ A;  4KZ3 A;  3WS5 A;  4S2P A;  2QMI A;  1XKZ A;  3UDX A;  4OON A;  3S22 A;  5FI7 A;  1K54 A;  4MBK A;  2WKE A;  2EXA A;  4N1X A;  1CK3 A;  3A3E A;  4OPY A;  3UNW A;  1GA0 A;  1LLB A;  1K4F A;  4K0W A;  4BD0 A;  3UN7 A;  3IH8 A;  3DWK A;  3DW0 A;  5CHJ A;  4KZ7 A;  1YT4 A;  4HEF A;  4K91 A;  5F83 A;  4S2N C;  4D2O A;  5E2E A;  2Y91 A;  4R4R A;  3M6H A;  4RVA A;  4DXC A;  2WZX A;  4OPQ A;  3O86 A;  3MKF A;  3BYD A;  1IYQ A;  3C7U A;  2WGV A;  2ZQC A;  2ZC4 B;  3W4Q A;  1FCN A;  2Y2M A;  5FQQ A;  3G31 A;  5FAS A;  4QJG A;  3IF6 A;  3VSL A;  4PM8 A;  3M6B A;  2V20 A;  4QY5 A;  1KVM A;  2ZM2 A;  2I72 A;  2HP9 A;  3LO7 A;  3NIA A;  4K0X A;  5I94 A;  4EBP A;  2PU2 A;  4GKU A;  1Q2Q A;  4N92 A;  4OP8 A;  5FI2 A;  3HLF A;  1KE4 A;  5BOH A;  5GLC A;  2Y2P A;  1C3B A;  1BT5 A;  4R0Q A;  2PBY A;  3LY3 A;  3CMZ A;  3HL9 A;  5JYO A;  4MBH A;  4OPZ A;  3IHA A;  4NK3 A;  2XD1 A;  3A3I A;  4A5R A;  4WZ4 A;  4BL3 A;  3N8R A;  4N9K A;  1I2S A;  5E2F A;  3VP2 A;  3AGF A; 
#chains in the Genus database with same CATH topology
 3N4I A;  1W5D A;  3CZD A;  3E0Y A;  3UPP A;  2Y8H A;  3NEC A;  4B4X A;  3MMH A;  4BLM A;  2Y59 A;  2J8Y A;  4FSF A;  4ESP A;  2O99 A;  4HBU A;  4OKP A;  1YLT A;  1NRF A;  1I5Q A;  2XEP A;  1T1A A;  2PD7 A;  3PBQ A;  4IVK A;  5HAQ A;  4ETX A;  3O3V A;  4ZJ3 A;  3RH8 B;  4DE0 A;  2KLI A;  2PR5 A;  2PU4 A;  4WEL A;  1W7F A;  1V9Y A;  3WRZ A;  4EUZ A;  1HLU P;  5DF8 A;  3EGX C;  2EFU A;  1FCO A;  4QPR A;  4EER A;  3IX3 A;  3C4O A;  5F1F A;  2V8F A;  4RQ9 A;  1YSQ A;  5F5Y A;  2ZOI A;  2FZ0 A;  3A0R A;  5L10 A;  1TEM A;  1OJG A;  1FR6 A;  1K25 A;  2INW A;  4EQ1 A;  4E6X A;  5HD3 A;  3LGO A;  4JBF A;  3IXB A;  3WS4 A;  5HDC A;  4F3L B;  5HL1 A;  2V1A A;  3PR6 A;  4JXW A;  2XR0 A;  1XJ4 A;  3UB8 A;  2WUQ A;  3CG5 A;  5FQI A;  3VSK A;  1G68 A;  5GLB A;  3P01 A;  4EV4 A;  4PAU A;  4KEN B;  1XGJ A;  1S6R A;  2R78 A;  1F9I A;  1BLP A;  5CX7 A;  4KQO A;  5HPF A;  3C5A A;  4UEY A;  1PZO A;  1T1B A;  2HZ5 A;  3A3J A;  4DJ3 A;  5HAP A;  1YM1 A;  1Y54 A;  5J3W A;  3HUM A;  2XD5 A;  4PMA A;  3BJN A;  1GSX A;  4R70 A;  3ZNY A;  3LR4 A;  3DTK A;  3LIA A;  4WZ5 A;  3ULF A;  4B88 A;  1W63 M;  2CC1 A;  2RCX A;  4OQG A;  2EX8 A;  4LV3 A;  5DKL A;  3BW6 A;  3UB7 A;  3HLW A;  5HAR A;  3IHB A;  3CLO A;  3N6I A;  1QME A;  4GNU A;  4GW9 A;  2OOL A;  2WKI A;  3G4P A;  3T1X A;  3B33 A;  3H82 B;  4NET A;  2A2L A;  2V1B A;  4ZJ1 A;  4OVD A;  3IH9 A;  3BFE A;  3PAG A;  2LB9 A;  4XXR A;  4HJ3 A;  2A3U A;  2VV8 A;  1VEU A;  1OPX A;  2FFY A;  2WAF A;  1OJ5 A;  3SS4 A;  5A93 A;  4OOL A;  1FR1 A;  3FPW A;  5EOO A;  2PDR A;  3IXG A;  3LIB A;  4ZTK A;  2A49 A;  4KG6 A;  1G5U A;  2JKR I;  1H3Q A;  1BUE A;  1STZ A;  3C30 A;  4Q8I A;  5CEC A;  4BBU A;  3C4P A;  3MFD A;  2QWS A;  3CIT A;  2X02 A;  5JYP A;  3ZVW A;  5AQ9 A;  2UV0 E;  1QMF A;  2EFX A;  1MY8 A;  2EA9 A;  5FL3 A;  4QHC A;  4PM7 A;  3JYI A;  3H82 A;  2PR6 A;  5L09 A;  1I2W A;  2X71 A;  1XA7 A;  1GSW A;  3VOL A;  4NXE A;  5AJG A;  3MZD A;  2P9V B;  5AVE A;  3T1Q B;  5HX9 A;  4NEE D;  1PWG A;  1LL9 A;  4CLC B;  4KZ9 A;  2ZM0 A;  5TGF A;  2VA0 A;  2PYP A;  4C3Q A;  4O01 A;  3DAV A;  3H7W B;  4R3B A;  1KGF A;  1P0Z A;  2FFF B;  3L9K A;  2VGJ A;  3HLC A;  2Q0O A;  3NUL A;  2ZBB A;  2CMN A;  2JKT M;  4JGQ A;  4XUZ A;  1O7E A;  4PM9 A;  1K4E A;  3GMW A;  3HUO A;  3CUE A;  4Y17 A;  2XF3 A;  4N9L A;  3ZG9 B;  1JWZ A;  5HAI A;  2XQZ A;  1LL5 A;  4MMN A;  2O9C A;  4X69 A;  1NWZ A;  5TFQ A;  1XFQ A;  1RGY A;  3E4O A;  1E4D A;  3SH9 A;  3U2A A;  3ZG0 A;  1Y4O A;  3Q7V A;  4DDY A;  2YKH A;  1RCJ A;  3T1S A;  1GCE A;  3HLE A;  3UPN A;  3IWO A;  5DTS A;  4P6Z S;  5TR7 A;  2Y2K A;  4FH2 A;  1D06 A;  3DBA A;  2J3W A;  1MWS A;  4HJ4 A;  4LV2 A;  1TS6 A;  3IX4 A;  3BFG A;  3N8S A;  2K2N A;  4FCF A;  4X1L A;  4H6J A;  4HBT A;  3PBO A;  5EM1 A;  3HJI A;  1PWD A;  4DDS A;  1YLY A;  2C6W B;  3LR5 A;  5J8X A;  2Z2M B;  2XFS A;  4WUJ A;  4P87 A;  5KMW A;  1OTA A;  2JHE A;  1VEU B;  4DMZ A;  1BZA A;  3KYQ A;  2YKF A;  3DTI A;  4HOI A;  2VX8 A;  3QNC A;  5DFX A;  1OME A;  4UA7 A;  3T1R A;  5CRF A;  2WGI A;  1XPB A;  1YQS A;  3G2Y A;  1P9W A;  5FQJ A;  3UB5 P;  5M19 A;  3UMD A;  5E2H A;  4EXO A;  3P7N A;  2OV5 A;  4FTX A;  3F1N B;  3FKV A;  1ES3 A;  1ERQ A;  3ITA A;  4JXG A;  3A3F A;  4S2K A;  5HW3 A;  3AGF A;  1YLZ A;  4MBF A;  1NJ4 A;  4WEJ A;  3RTY A;  1DP6 A;  3S22 A;  4OPY A;  4K0W A;  4BD0 A;  3DWK A;  4MN5 A;  4HEF A;  3NJA A;  4DXC A;  3O86 A;  3IX8 A;  2WGV A;  2ZQC A;  2A24 A;  2ZOH A;  5FAS A;  5G4Z A;  3IF6 A;  3QP8 A;  1KVM A;  2I72 A;  3T4L A;  4EBP A;  2PU2 A;  1TD5 A;  3MJQ A;  1Q2Q A;  5GLC A;  2Y2P A;  2PBY A;  3LY3 A;  4MBH A;  4BL3 A;  4WZ4 A;  3UB9 A;  1I2S A;  3VP2 A;  4UQI S;  3V5M A;  3KYE A;  2XA7 M;  4IED A;  1SZV A;  1YLJ A;  3V39 A;  5FAT A;  1MWR A;  2VV7 A;  2JKR M;  1CEF A;  4ZDX A;  3B42 A;  4KZ8 A;  4X6T A;  5M18 A;  5FAP A;  4HH3 A;  4LRX C;  4O0P A;  1DJA A;  3G30 A;  3K3C A;  3KYZ A;  4WN5 A;  4GZB A;  3PHY A;  3P09 A;  4GCZ A;  4LCL A;  4OQH A;  1JTG A;  4GD8 A;  3LID A;  3HBR A;  3FG8 A;  4G3W A;  5EFW A;  3LFV A;  4WM9 A;  3PYP A;  2W3H A;  2NUP C;  1ZG6 A;  2XDM A;  2ZMA A;  4MN7 A;  1DJB A;  2ZC5 B;  5CHU A;  4GB7 A;  5HDD A;  3V67 A;  4GN2 A;  4P6B A;  1FCM A;  1FSW A;  3OOV A;  1HZO A;  4LEN A;  2G2U A;  4KUK A;  1NXY A;  3SH7 A;  3WS0 A;  3MQQ A;  4WZ5 C;  4OOY A;  2M7U A;  5EUA A;  3R7W B;  3T4Q A;  3VP1 A;  3CPT B;  2OWJ A;  2Y2I A;  4PM5 A;  4R38 A;  4PKY G;  1DRM A;  1ZHH B;  4H8R A;  3UE0 A;  3G35 A;  2V1Z A;  5AVF A;  5F69 A;  1MXO A;  4OQ0 A;  2HP6 A;  4BL2 A;  2HPB A;  3ZQ5 A;  5FAO A;  1D1J A;  1W8Y A;  1PI4 A;  4GHI A;  3UDI A;  1ERM A;  1IFQ A;  2XRN A;  4S2L A;  3PBR A;  4M4X A;  5EPH A;  4KZB A;  1N9O A;  2JE5 A;  5DF9 A;  1SDN A;  1XFN A;  3BY9 A;  2Q9M A;  2O9A A;  3IQA A;  2HJE A;  1N9B A;  3N7W A;  1L3L A;  2WAD A;  5J7E A;  3HUN A;  1PI5 A;  3SOI A;  4Y5F A;  5CXW A;  3L7H A;  1W79 A;  3IXD A;  3VP0 A;  2A24 B;  3MF0 A;  3Q1F A;  5EEC A;  5EM0 A;  3IF6 B;  2WYX A;  1SCW A;  2JC7 A;  2Y55 A;  3ZDJ A;  4ARZ A;  2LB5 A;  3BFD A;  4KZA A;  1OTI A;  2KDK A;  2WKQ A;  2H5S A;  5IU1 A;  3OCL A;  3PTE A;  1MWU A;  4NXG A;  3UY6 A;  1BLH A;  5CTM A;  1SKO A;  1VM1 A;  3HRE A;  2VGL S;  3LIC A;  1F98 A;  2ZQA A;  1LI9 A;  1LSW A;  2PD8 A;  4OH0 A;  1JWV A;  4DF6 A;  1UWP X;  4EBN A;  2XK1 A;  4MLL A;  4IJG A;  4NXF A;  4DE1 A;  1GHP A;  3KO6 A;  2KX6 A;  4UA6 A;  4R3J A;  2Y4A A;  3WRT A;  1MPL A;  4JGR A;  4R23 A;  3IS2 A;  4I3I A;  1IKG A;  4LCM A;  3CUE C;  5F82 A;  3LY4 A;  1ODV A;  1BLC A;  3BEB A;  3F1P A;  5HDS A;  5FEG A;  4Y0U A;  1D7E A;  3V3R A;  3T4S A;  1S4R A;  5MC7 A;  3MR0 A;  1AXB A;  3NDG A;  2B5R A;  5M1A A;  5GL9 A;  3QP6 A;  1N9L A;  2VLG A;  3TSG A;  4BD1 A;  1NLZ A;  1MBL A;  2K7S A;  4GLQ A;  3GQZ A;  1N4O A;  2O9B A;  2WK0 A;  3T4O A;  3M2J A;  4FOF A;  2OAQ 1;  4ID4 A;  3OBF A;  2OSU A;  4HNB A;  1K0K A;  2ACG A;  3MFX A;  3IXH A;  1IKI A;  3MSH A;  4Y3I A;  1KVL A;  2HP5 A;  3Q7Z A;  5FI6 A;  2UWX A;  4L0L A;  4OP5 A;  4YFM A;  2H0T A;  2L1M A;  2Z6C A;  4NXB A;  5CGW A;  2WAE A;  4KUO A;  1NY0 A;  1FOF A;  3W4P A;  1RGZ A;  4K08 A;  2HDU A;  2ZL1 A;  4XT2 B;  2OAP 1;  2D02 A;  2Z6D A;  2WGW A;  4ZRR A;  3B3X A;  1S0W A;  3F1O B;  3WWX A;  5EOE A;  2JN7 A;  2Y2N A;  4E3I A;  5K5B A;  1YPR A;  3OZH A;  5EVI D;  1T18 A;  3NBL A;  1G6O A;  5DJT A;  5G18 A;  3ZCZ A;  4ARZ B;  2J3T D;  5CTN A;  2HDR A;  1VET A;  4GDN A;  1PWC A;  3LCE A;  3TJZ C;  5A91 A;  4DRT A;  5A90 A;  1CF0 A;  3G6O A;  1IYS A;  3BFF A;  1MKI A;  5AQA A;  4Y0T A;  1ESU A;  4IBX A;  3PBN A;  2P04 A;  3FZC A;  3CHW P;  1SKF A;  5IHV A;  1OTE A;  5TJJ A;  1DY6 A;  2HDQ A;  4L9F A;  5F6A A;  1ZKJ A;  3VP3 A;  2J3T C;  2I9V A;  3IF6 C;  2EX2 A;  3UME A;  3A0V A;  1XP4 A;  1SDE A;  1K56 D;  3O87 A;  3IWI A;  4UA9 A;  1KGG A;  4HIA A;  4GS9 A;  3N8L A;  3EEA A;  1ONH A;  3EWK A;  4MN6 A;  1H8Y A;  5FDS A;  2ZMF A;  4I3A A;  5L2F A;  4X55 A;  2W1R A;  3LR3 A;  4Z9Q A;  3NDE A;  4WYY A;  3RJU A;  1P9R A;  4QY6 A;  1IEM A;  4LGW A;  4PPR A;  3F1P B;  3DWZ A;  2W27 A;  5CEB A;  4R1G A;  2HV1 A;  4Z1W A;  3QP5 A;  1IEL A;  3WS5 A;  4S2P A;  4OON A;  2WKE A;  3S7N A;  2PYR A;  2V9A A;  1GA0 A;  1LLB A;  4HH2 A;  3O5Y A;  1PNE A;  1J3W A;  3IH8 A;  3DW0 A;  5F83 A;  1T19 A;  2Y91 A;  4X1M A;  1VB6 A;  2WZX A;  4OPQ A;  3MKF A;  3C7U A;  3EEH A;  2PRF A;  5FQQ A;  3G31 A;  3S7O A;  4PM8 A;  3M6B A;  5EV0 A;  2ZM2 A;  3QP4 A;  2HP9 A;  4K0X A;  4YNR A;  1ACF A;  5FI2 A;  3HLF A;  1KE4 A;  2VV6 A;  2JKG A;  1XJ6 A;  3CMZ A;  3HL9 A;  4QWO A;  4OPZ A;  3IHA A;  4NK3 A;  4A5R A;  3N8R A;  3LEQ A;  2ZL1 B;  1LL8 A;  2M7V A;  4NG2 A;  4KZ6 A;  4X25 A;  3UB6 A;  2Y2L A;  2ZD8 A;  3HJK A;  5EVL A;  2IWC A;  3ITB A;  4D60 A;  3LUQ A;  1IYP A;  4JLF A;  3M2K A;  4EQI A;  1L0F A;  1AWI A;  1E25 A;  4EBL A;  2X01 A;  4JF5 A;  2WKR A;  4IUH A;  4BEN A;  2OLV A;  2BG1 A;  3C8C A;  2D01 A;  4LPZ A;  1EWZ A;  4R4S A;  4WMC D;  1KGE A;  1FQG A;  1GHM A;  1WYC A;  1TDG A;  3KX0 X;  1K6R A;  2Y2J A;  2ZJ9 A;  2HGV A;  1LSX A;  3SW1 A;  5E2G A;  2EWV A;  3Q07 A;  4EES A;  3UE3 A;  1YLP A;  4PHT A;  3TOI A;  3UO9 A;  4PKY A;  4FD8 A;  3W8K A;  3BQ8 A;  5HWV A;  2Y79 A;  2WZZ A;  2Y2G A;  4E3N A;  3VOY A;  2PT7 A;  1F2K A;  1WE4 A;  3MXR A;  4DKI A;  3PBS A;  2ZQ8 A;  1G28 A;  3OPL A;  3MS6 A;  4C6Y A;  5LBR A;  3SH8 A;  3EOI A;  1VQQ A;  1PZP A;  3AGE A;  3ZFZ A;  2JKF A;  3BLS A;  3BY8 A;  4GD6 A;  3T50 A;  2RL3 A;  1S66 L;  4L9E A;  3W2Z A;  5EVI A;  3IT9 A;  3VOZ A;  3E2K A;  2W3F A;  3OCN A;  4KZ5 A;  3E4Q A;  2OLU A;  3HLB A;  1KE3 A;  4ZJ2 A;  1YMX A;  4QB8 A;  2JCH A;  3ZNT A;  2ZC3 B;  4CPK A;  4JGP A;  5CED A;  3ZG5 A;  3UE1 A;  5DF7 A;  1O07 A;  2HF6 A;  3FV7 A;  3G32 A;  3GVB A;  4O8G A;  3GTC A;  2EX6 A;  1KE0 A;  5HFO A;  4Y15 A;  3V50 A;  3MKE A;  1CJF A;  2BAS A;  3OPP A;  3BEC A;  2V0U A;  4JPM A;  1ONG A;  1LI0 A;  3KSF A;  5I5L A;  4DE2 A;  3Q7V B;  4X68 A;  3IWQ A;  1K56 A;  5FEF A;  1YMS A;  5GLA A;  3EGD C;  3FPV A;  2PHY A;  1T1C A;  1JTD A;  2DMW A;  3I7J A;  3TW8 A;  1HTZ A;  1M40 A;  5FQM A;  4IBR A;  3GRJ A;  3MXS A;  3BRM A;  4H6J B;  1S4S A;  3NOU C;  3PXP A;  4ZAM A;  2EX9 A;  5HL6 A;  3LI8 A;  3P98 A;  1HVB A;  1S1Y A;  2EXB A;  1J9M A;  2GZA A;  4S2M A;  4JXS A;  4GDB A;  4IVI A;  4E3K A;  4CJN A;  4IHQ A;  4LLO B;  1NYY A;  3VMA A;  2R9X A;  1YKD A;  4F3L A;  5KSC A;  2ZQ9 A;  1K6S A;  4JF6 A;  2BLS A;  1SHV A;  5FQ9 A;  3CAX A;  3BM6 A;  4DE3 A;  2ZM8 A;  1LHY A;  2XSS A;  2ZC7 A;  4Y13 A;  5A92 A;  1WA9 A;  4P6Z M;  1K57 A;  3ZGA B;  1FIK A;  3CJM A;  3OLO A;  4G3V A;  1TDL A;  5GLD A;  4B93 A;  1OTB A;  1XA1 A;  2PAV P;  1L0D A;  1YAX A;  3Q81 A;  1JWP A;  4JGO A;  3S7Q A;  1PRQ A;  5DJU A;  3MXQ A;  5EVI B;  4PM6 A;  4U0T A;  3B47 A;  3K3D A;  1Z6F A;  4R3A A;  3ZVT A;  1W8Q A;  4I39 A;  4WMC A;  3C2W A;  4N1H A;  1TS7 A;  4OQI A;  3RXW A;  3GDI A;  4MNR A;  2J80 A;  2EWW A;  3LR0 A;  3GV9 A;  2Y2O A;  4WBG A;  4FUW A;  1S67 L;  5FA7 A;  2PBD P;  1BUL A;  1MKM A;  4EEU A;  1G6A A;  4HES A;  4HY8 A;  1CI9 A;  2Y2H A;  2JKT I;  4Q0H A;  2OWH A;  1PFL A;  2W1T A;  3UPO A;  1M6K A;  2Y2Q A;  3EQU A;  5DVA A;  3T12 B;  3D4F A;  1EI5 A;  4UAA A;  1K55 A;  1Y28 A;  3C38 A;  4BQM A;  4DXB A;  4EWF A;  1KDW A;  3NI9 A;  4M3K A;  5EVE A;  2G2W A;  3KSH A;  2BTF P;  4KZ4 A;  1XXM A;  5KIZ A;  3HCY A;  3NY4 A;  1JNU A;  4JKT A;  1H8Z A;  1Z09 A;  2H0Y A;  2HDS A;  2O0Y A;  2QJ7 A;  1TVF A;  4XUX A;  2QHK A;  1KDS A;  5AQB A;  3QHY A;  2P9V A;  2QPN A;  3HVF A;  3FC7 A;  4UQI M;  3QP2 A;  1BYW A;  4CLC A;  3ZYT A;  1L0E A;  3VE4 A;  4KG2 A;  1XJ3 A;  2QMI A;  3H7W A;  3UDX A;  5FI7 A;  1K54 A;  2EXA A;  4N1X A;  5J4E A;  3UNW A;  5HWW A;  1MC0 A;  1YT4 A;  3CI6 A;  4D2O A;  5E2E A;  4LRY C;  4GHI B;  4RVA A;  3D72 A;  2W3G A;  1X0O A;  3BYD A;  2QYB A;  4BBT A;  2ZC4 B;  5L8M A;  1FCN A;  3ICY A;  3VSL A;  3GEC A;  4QY5 A;  5I94 A;  3NIA A;  2B95 A;  2K31 A;  1OT6 A;  4GKU A;  4N92 A;  4OP8 A;  5BOH A;  3SZT A;  2E8J A;  1C3B A;  1DP8 A;  1TF1 A;  3QP1 A;  1BT5 A;  4R0Q A;  2VKS A;  5JYO A;  2XD1 A;  2W3D A;  5E2F A;  5FQK A;  5GHX A;  5CGS A;  4S2O A;  1E3U D;  2QJ5 A;  4YIN A;  4QD4 A;  1GHI A;  1A0K A;  3V3S A;  2IWB A;  2J9P A;  3T4K A;  1MWT A;  4II7 A;  5FAQ A;  5CHM A;  3RXX A;  3CWF A;  4WLA A;  1EW0 A;  1H8M A;  3GSG A;  4P0M A;  5AQ7 A;  1SKO B;  4RX2 A;  5HPI A;  4EW7 A;  3ZHH A;  5EVI C;  2M1C A;  1ZG4 A;  4S2N A;  1UWN X;  4Q0I A;  2W1T B;  3NC8 A;  5GHZ A;  4YOF A;  4KG5 A;  4RA7 A;  4DN0 A;  2B02 A;  5KSH A;  3JVV A;  4OLG A;  4ZBE A;  2P74 A;  4DJ2 A;  3KSI A;  1UGU A;  3C7V A;  4BJP A;  4I38 A;  1NLY A;  2H10 A;  3UDF A;  3BLM A;  3IS2 B;  4YWZ A;  3SS5 A;  4X53 A;  1BTL A;  3E98 A;  2GNX A;  4HHD A;  1BLS A;  2XA7 S;  3F1N A;  3TRC A;  1XGI A;  3BQA A;  4E3M A;  5CER A;  4BWI A;  1LT0 A;  2V8C A;  2J9O A;  2G7U A;  4RYE A;  1FSY A;  3E4P A;  2P7J A;  4E6W A;  3WS2 A;  4EUV A;  3OPH A;  3JPU A;  2MJ6 A;  3MZF A;  4WF0 A;  3E2L A;  3MQO A;  4JF4 A;  3BWL A;  2VGL M;  3VFF A;  1ESI A;  1ZC2 A;  3T4J A;  4OLD A;  4QU3 A;  4MEZ A;  4CQH A;  5E43 A;  3FYZ A;  4MDZ A;  4HQA A;  5IT5 A;  3NCK A;  2C5W B;  2ZQ7 A;  4JXV A;  2W0N A;  4NKP A;  4WL9 A;  3S1Y A;  4KQR A;  1DJC A;  1YLW A;  4P85 A;  3IBR A;  2E8I A;  4E3O A;  3BFC A;  3VFH A;  4LFU A;  4Y2F A;  4RX3 A;  1PYY A;  4LV1 A;  1ES5 A;  4Y7P A;  3SS3 A;  2V2F F;  2WGW B;  3G2Z A;  3ZG8 B;  3LI9 A;  3VP4 A;  3LIF A;  3JVU A;  4GOG A;  5C5K A;  1ES2 A;  1K57 C;  5EE8 A;  3LYX A;  2ZLY A;  2VGK A;  3GR2 A;  1K38 A;  4FH4 A;  1VET B;  4S2I A;  1Q2P A;  1ALQ A;  1L0G A;  1U60 A;  1TS0 A;  4AFI A;  5F1G A;  2ZC6 B;  3D9Y A;  1MZU A;  1ERO A;  1NZU A;  5DTK A;  3QNB A;  4ME4 A;  3U4L P;  4CLC E;  3MQ0 A;  4E3L A;  2XH9 A;  4HI4 A;  1L2S A;  2P08 A;  3D3O A;  1OTD A;  1NRJ A;  2DRW A;  5DKK A;  3Q82 A;  5FSR A;  1GSV A;  2WKH A;  2JBF A;  3R4K A;  4X56 A;  3R7W A;  4EET B;  2NUT C;  3VV4 A;  3CPT A;  1N9N A;  1VHM A;  4IUK A;  2HJ9 C;  4HP4 A;  4GS9 B;  2V0W A;  3A0S A;  2IWD A;  3TG9 A;  4HP9 A;  3ZG7 B;  2W3E A;  2Z2L B;  3MBZ A;  1CQA A;  1CI8 A;  3RFB A;  2QZ6 A;  1BSG A;  2WKP A;  1V9Z A;  4I3J A;  1XJ2 A;  1NZO A;  3AGD A;  1H0M A;  2DNS A;  2VZW A;  1E3U A;  1PW8 A;  3OPR A;  5TBM A;  2GX5 A;  1K55 C;  1OT9 A;  1IOU A;  1W63 Q;  3VE3 A;  5GHY A;  1XX2 A;  3G34 A;  1IYO A;  3LEZ A;  1JVJ A;  1F5M A;  4O7D A;  3NOT C;  1GA9 A;  4CLC D;  3PBT A;  4U0X A;  1CEG A;  4C75 A;  2ZQD A;  3ISG A;  1ZTU A;  2XFT A;  3H9W A;  3MZE A;  2GJ3 A;  1PIO A;  4ETZ A;  2Q9N A;  2IA2 A;  3NOP C;  4OOM A;  2L4R A;  1P97 A;  2R9W A;  1ES4 A;  2FH5 A;  4LRZ E;  2KOI A;  4S2J A;  3FWL A;  5IS1 A;  2XGN A;  4MCW A;  4CLC C;  2ZMV A;  3IF5 A;  3T4T A;  4KQD A;  4BBV A;  3DTM A;  4OPR A;  1RP5 A;  1DP9 A;  4WEK A;  2J7V A;  3OC2 A;  3TE8 A;  1K54 C;  4Y0O A;  2H28 A;  1HD8 A;  4B4Z A;  1NYM A;  3W4O A;  4BMW A;  3KSG A;  5FDH A;  2VK3 A;  5L07 A;  3EQV A;  4E3J A;  3HLG A;  4KQQ A;  5CGX A;  2AVX A;  4U3T A;  1LSV A;  4UHU A;  5U47 A;  4B9O A;  4F94 A;  5G4Y A;  3HLD A;  1KOU A;  3S4X A;  3PAE A;  5A8B A;  1WYB A;  5DTT A;  3S7P A;  1S1Z A;  3WS1 A;  3FKW A;  2XLN A;  4GJ4 A;  4LV0 A;  5DFY A;  3O88 A;  2VJW A;  1H5X A;  4EU0 A;  1PW1 A;  3A3D A;  5KZH A;  4R6L A;  2DCF A;  2GDN A;  4I5S A;  5HZH A;  4KZ3 A;  5HSQ A;  1YSP A;  3LIE A;  1XKZ A;  2L0W A;  4MBK A;  1CK3 A;  3A3E A;  1FIL A;  1K4F A;  3UN7 A;  1TS8 A;  5CHJ A;  4KZ7 A;  4K91 A;  2XRO A;  5HD5 A;  4S2N C;  4HJ6 A;  4R4R A;  3M6H A;  3IBJ A;  5HWT A;  5F68 A;  1IYQ A;  3DTE A;  4G3K A;  3NHQ A;  5TBM B;  3W4Q A;  4XT2 A;  2Y2M A;  3K2N A;  4QJG A;  3UE6 A;  2V20 A;  3LO7 A;  4Q0J A;  2QKP A;  4EEP A;  4L9G A;  2B18 A;  3F1O A;  2VEA A;  3A3I A;  4E04 A;  4N9K A;  5D3O A; 
#chains in the Genus database with same CATH homology
 3N4I A;  4KZ6 A;  5FQK A;  5GHX A;  1W5D A;  5CGS A;  3CZD A;  4IED A;  4S2O A;  3UPP A;  1E3U D;  4B4X A;  1YLJ A;  4YIN A;  3V39 A;  5FAT A;  2Y2L A;  4BLM A;  1MWR A;  2ZD8 A;  2Y59 A;  2J8Y A;  4FSF A;  4QD4 A;  5EVL A;  1GHI A;  1CEF A;  4HBU A;  2IWC A;  3ITB A;  4OKP A;  4ZDX A;  3V3S A;  4KZ8 A;  4X6T A;  2IWB A;  3V5M A;  1IYP A;  1NRF A;  1YLT A;  2J9P A;  1I5Q A;  4JLF A;  5M18 A;  1MWT A;  3M2K A;  4EQI A;  2XEP A;  1L0F A;  5FAP A;  3PBQ A;  5FAQ A;  4IVK A;  1E25 A;  5CHM A;  5HAQ A;  3RXX A;  1DJA A;  3G30 A;  4EBL A;  3O3V A;  2X01 A;  3GSG A;  4JF5 A;  4GZB A;  3P09 A;  4ZJ3 A;  4LCL A;  4P0M A;  5AQ7 A;  4OQH A;  4RX2 A;  4BEN A;  2OLV A;  2BG1 A;  1JTG A;  4DE0 A;  4GD8 A;  3ZHH A;  5EVI C;  2PU4 A;  4WEL A;  1W7F A;  1ZG4 A;  3HBR A;  1EWZ A;  3WRZ A;  4R4S A;  4S2N A;  4WMC D;  1KGE A;  4EUZ A;  5DF8 A;  3NC8 A;  5GHZ A;  4KG5 A;  4RA7 A;  4WM9 A;  2EFU A;  1FQG A;  1FCO A;  1GHM A;  1WYC A;  1TDG A;  1ZG6 A;  2XDM A;  2ZMA A;  1DJB A;  1K6R A;  2Y2J A;  2ZC5 B;  5KSH A;  2ZJ9 A;  4OLG A;  4ZBE A;  2P74 A;  4GB7 A;  5CHU A;  3C4O A;  5F1F A;  5E2G A;  3C7V A;  4GN2 A;  4BJP A;  4P6B A;  3Q07 A;  1FCM A;  1FSW A;  3UE3 A;  1YLP A;  3TOI A;  3UO9 A;  2H10 A;  3UDF A;  3BLM A;  1HZO A;  4LEN A;  4FD8 A;  3SS5 A;  2G2U A;  1TEM A;  3W8K A;  4X53 A;  1FR6 A;  1K25 A;  1NXY A;  3SH7 A;  3WS0 A;  2WZZ A;  1BTL A;  2Y2G A;  4E3N A;  4WZ5 C;  1BLS A;  4E6X A;  1XGI A;  3VOY A;  4E3M A;  1WE4 A;  4OOY A;  3MXR A;  4JBF A;  4DKI A;  5EUA A;  3IXB A;  3VP1 A;  3PBS A;  3WS4 A;  2ZQ8 A;  2Y2I A;  3OPL A;  4PM5 A;  5HL1 A;  4JXW A;  5CER A;  4C6Y A;  2XR0 A;  4H8R A;  3UE0 A;  3G35 A;  2V1Z A;  3SH8 A;  3ZFZ A;  1VQQ A;  1PZP A;  3AGE A;  2J9O A;  2WUQ A;  3BLS A;  3CG5 A;  5FQI A;  3VSK A;  1G68 A;  5GLB A;  4RYE A;  4EV4 A;  1FSY A;  4E6W A;  1MXO A;  4GD6 A;  3WS2 A;  2RL3 A;  4OQ0 A;  3OPH A;  4KEN B;  2HP6 A;  1XGJ A;  5EVI A;  1S6R A;  3MZF A;  3E2L A;  4BL2 A;  2HPB A;  1BLP A;  3IT9 A;  5FAO A;  4JF4 A;  4KQO A;  3VOZ A;  3VFF A;  1W8Y A;  3C5A A;  1ESI A;  1PI4 A;  3E2K A;  1PZO A;  3UDI A;  3OCN A;  4KZ5 A;  1ERM A;  3A3J A;  1ZC2 A;  2OLU A;  3HLB A;  3PBR A;  1YM1 A;  4OLD A;  1Y54 A;  4MEZ A;  4QU3 A;  4S2L A;  1KE3 A;  4ZJ2 A;  5EPH A;  4KZB A;  1YMX A;  5E43 A;  2JE5 A;  5DF9 A;  3FYZ A;  3HUM A;  2XD5 A;  3NCK A;  1SDN A;  4PMA A;  4QB8 A;  2JCH A;  3ZNT A;  2C5W B;  2ZQ7 A;  4JXV A;  2ZC3 B;  2Q9M A;  4CPK A;  3IQA A;  5CED A;  3ZG5 A;  1N9B A;  3N7W A;  3S1Y A;  4KQR A;  3UE1 A;  2WAD A;  3HUN A;  1O07 A;  1DJC A;  1PI5 A;  5DF7 A;  3SOI A;  5CXW A;  1YLW A;  3FV7 A;  3ZNY A;  1W79 A;  3IXD A;  4P85 A;  3VP0 A;  3G32 A;  2E8I A;  4E3O A;  3BFC A;  3GVB A;  3VFH A;  3GTC A;  4WZ5 A;  3Q1F A;  5EEC A;  2EX6 A;  4B88 A;  3IF6 B;  1KE0 A;  5HFO A;  2CC1 A;  4RX3 A;  1PYY A;  4LV1 A;  2RCX A;  2WYX A;  3MKE A;  1ES5 A;  1SCW A;  2EX8 A;  2JC7 A;  4OQG A;  4LV3 A;  4Y7P A;  3SS3 A;  2V2F F;  2Y55 A;  3HLW A;  3OPP A;  3IHB A;  2WGW B;  3BEC A;  3G2Z A;  4JPM A;  5HAR A;  3ZDJ A;  3ZG8 B;  3BFD A;  1ONG A;  4KZA A;  1LI0 A;  3N6I A;  1QME A;  4DE2 A;  3Q7V B;  4X68 A;  2H5S A;  4GNU A;  3IWQ A;  2WKI A;  3OCL A;  3PTE A;  1K56 A;  1MWU A;  3VP4 A;  3UY6 A;  1BLH A;  3G4P A;  5CTM A;  1YMS A;  4GOG A;  5GLA A;  5D3O A;  4NET A;  1VM1 A;  3HRE A;  4ZJ1 A;  4OVD A;  1JTD A;  3IH9 A;  1ES2 A;  3I7J A;  3BFE A;  3PAG A;  1K57 C;  2ZQA A;  5EE8 A;  1LI9 A;  2ZLY A;  1HTZ A;  4XXR A;  1M40 A;  5FQM A;  2VGK A;  2A3U A;  3GR2 A;  1K38 A;  4IBR A;  3GRJ A;  2FFY A;  4FH4 A;  1JWV A;  2WAF A;  4OH0 A;  1Q2P A;  4S2I A;  1ALQ A;  4DF6 A;  3MXS A;  3SS4 A;  1L0G A;  5A93 A;  3BRM A;  1U60 A;  4OOL A;  4EBN A;  5F1G A;  2XK1 A;  2ZC6 B;  4MLL A;  1ERO A;  4ZAM A;  1FR1 A;  1NZU A;  5DTK A;  5EOO A;  2EX9 A;  3QNB A;  3IXG A;  4DE1 A;  4ZTK A;  1GHP A;  2A49 A;  4KG6 A;  4UA6 A;  4E3L A;  2XH9 A;  4R3J A;  1BUE A;  3P98 A;  4Q8I A;  1HVB A;  1L2S A;  2Y4A A;  1MPL A;  3WRT A;  5CEC A;  2EXB A;  1J9M A;  4R23 A;  1IKG A;  3C4P A;  4LCM A;  3MFD A;  3V50 A;  4S2M A;  4JXS A;  2X02 A;  5JYP A;  2DRW A;  5F82 A;  3Q82 A;  5FSR A;  3ZVW A;  3LY4 A;  4GDB A;  5AQ9 A;  4IVI A;  1BLC A;  1QMF A;  4E3K A;  2EFX A;  2WKH A;  2JBF A;  4CJN A;  4X56 A;  1MY8 A;  3BEB A;  1NYY A;  3VMA A;  4QHC A;  4Y0U A;  2R9X A;  4PM7 A;  3V3R A;  3JYI A;  5KSC A;  2ZQ9 A;  1K6S A;  1AXB A;  3NDG A;  4JF6 A;  2B5R A;  5M1A A;  2IWD A;  1I2W A;  2BLS A;  2X71 A;  1SHV A;  5GL9 A;  1XA7 A;  5FQ9 A;  3TG9 A;  3BM6 A;  5HAP A;  3ZG7 B;  3MZD A;  4DE3 A;  2P9V B;  2Z2L B;  2ZM8 A;  3MBZ A;  1LHY A;  3TSG A;  4BD1 A;  1CI8 A;  2ZC7 A;  5HX9 A;  1MBL A;  3GQZ A;  1N4O A;  1PWG A;  2QZ6 A;  1BSG A;  2WK0 A;  1LL9 A;  5A92 A;  4KZ9 A;  3ZGA B;  1K57 A;  2ZM0 A;  3CJM A;  5TGF A;  3M2J A;  1TDL A;  5GLD A;  1NZO A;  4ID4 A;  4C3Q A;  2OSU A;  3AGD A;  1XA1 A;  2DNS A;  1E3U A;  1L0D A;  1PW8 A;  3IXH A;  3OPR A;  3Q81 A;  1IKI A;  4R3B A;  1JWP A;  1K55 C;  1KGF A;  2FFF B;  1KVL A;  2HP5 A;  2VGJ A;  3HLC A;  3Q7Z A;  5FI6 A;  2UWX A;  4L0L A;  4OP5 A;  5EVI B;  4YFM A;  2H0T A;  4PM6 A;  1XX2 A;  4U0T A;  5GHY A;  3G34 A;  1Z6F A;  4XUZ A;  1IYO A;  3LEZ A;  1O7E A;  1JVJ A;  4PM9 A;  5CGW A;  2WAE A;  1K4E A;  3GMW A;  4O7D A;  3HUO A;  3ZVT A;  1GA9 A;  2XF3 A;  3PBT A;  4N9L A;  1NY0 A;  1FOF A;  4U0X A;  1CEG A;  3W4P A;  4C75 A;  2ZQD A;  1RGZ A;  3ZG9 B;  1JWZ A;  1W8Q A;  2HDU A;  3ISG A;  4WMC A;  5HAI A;  4N1H A;  2XQZ A;  1LL5 A;  4OQI A;  3RXW A;  2XFT A;  4MNR A;  3MZE A;  1PIO A;  4X69 A;  5TFQ A;  2WGW A;  2Q9N A;  3B3X A;  1RGY A;  1S0W A;  1E4D A;  3GV9 A;  2Y2O A;  5EOE A;  3SH9 A;  3WWX A;  3ZG0 A;  2Y2N A;  4E3I A;  4OOM A;  4WBG A;  2R9W A;  3OZH A;  3Q7V A;  5EVI D;  4DDY A;  5FA7 A;  1ES4 A;  1RCJ A;  1GCE A;  1BUL A;  3HLE A;  3NBL A;  3UPN A;  3IWO A;  4S2J A;  5DTS A;  1G6A A;  4HES A;  3FWL A;  2XGN A;  1CI9 A;  5G18 A;  5TR7 A;  2Y2K A;  2Y2H A;  4FH2 A;  1MWS A;  3ZCZ A;  3IF5 A;  4LV2 A;  5CTN A;  2HDR A;  3UPO A;  1M6K A;  3DTM A;  2Y2Q A;  4OPR A;  4GDN A;  1RP5 A;  3BFG A;  3EQU A;  3N8S A;  5DVA A;  4FCF A;  4HBT A;  1PWC A;  3LCE A;  3PBO A;  4WEK A;  3D4F A;  1EI5 A;  2J7V A;  3OC2 A;  4UAA A;  5A91 A;  4DRT A;  5A90 A;  1PWD A;  1K54 C;  1K55 A;  4Y0O A;  4DDS A;  1HD8 A;  4B4Z A;  1YLY A;  1NYM A;  3W4O A;  4BQM A;  2C6W B;  1IYS A;  5FDH A;  4DXB A;  3BFF A;  1MKI A;  4EWF A;  1KDW A;  5J8X A;  2Z2M B;  2XFS A;  5AQA A;  4P87 A;  4Y0T A;  1ESU A;  4IBX A;  3PBN A;  5KMW A;  3NI9 A;  3EQV A;  4M3K A;  3FZC A;  4E3J A;  1SKF A;  3HLG A;  2G2W A;  4KQQ A;  5IHV A;  1BZA A;  5CGX A;  1DY6 A;  2HDQ A;  4U3T A;  4UHU A;  4KZ4 A;  1XXM A;  5U47 A;  1ZKJ A;  3QNC A;  3VP3 A;  3NY4 A;  3IF6 C;  2EX2 A;  1OME A;  4F94 A;  3HLD A;  1XP4 A;  1SDE A;  4UA7 A;  3S4X A;  4JKT A;  1K56 D;  3O87 A;  1H8Z A;  3IWI A;  2WGI A;  3PAE A;  1KGG A;  4UA9 A;  2H0Y A;  1WYB A;  2HDS A;  1XPB A;  5CRF A;  1YQS A;  3G2Y A;  3N8L A;  1ONH A;  5DTT A;  5FQJ A;  1TVF A;  4XUX A;  3FKW A;  3WS1 A;  5M19 A;  1H8Y A;  5E2H A;  5L2F A;  2XLN A;  4LV0 A;  1KDS A;  5AQB A;  3QHY A;  3O88 A;  4X55 A;  2P9V A;  2OV5 A;  2QPN A;  3NDE A;  4WYY A;  4Z9Q A;  3HVF A;  3RJU A;  3FKV A;  1ES3 A;  1ERQ A;  3ITA A;  4QY6 A;  1H5X A;  1IEM A;  4PPR A;  3DWZ A;  4JXG A;  1PW1 A;  5CEB A;  3A3D A;  5KZH A;  4R1G A;  3A3F A;  2DCF A;  4S2K A;  2GDN A;  1L0E A;  5HW3 A;  1YLZ A;  4KG2 A;  4MBF A;  1NJ4 A;  1IEL A;  4WEJ A;  4KZ3 A;  3WS5 A;  4S2P A;  2QMI A;  1XKZ A;  3UDX A;  4OON A;  3S22 A;  5FI7 A;  1K54 A;  4MBK A;  2WKE A;  2EXA A;  4N1X A;  1CK3 A;  3A3E A;  4OPY A;  3UNW A;  1GA0 A;  1LLB A;  1K4F A;  4K0W A;  4BD0 A;  3UN7 A;  3IH8 A;  3DWK A;  3DW0 A;  5CHJ A;  4KZ7 A;  1YT4 A;  4HEF A;  4K91 A;  5F83 A;  4S2N C;  4D2O A;  5E2E A;  2Y91 A;  4R4R A;  3M6H A;  4RVA A;  4DXC A;  2WZX A;  4OPQ A;  3O86 A;  3MKF A;  3BYD A;  1IYQ A;  3C7U A;  2WGV A;  2ZQC A;  2ZC4 B;  3W4Q A;  1FCN A;  2Y2M A;  5FQQ A;  3G31 A;  5FAS A;  4QJG A;  3IF6 A;  3VSL A;  4PM8 A;  3M6B A;  2V20 A;  4QY5 A;  1KVM A;  2ZM2 A;  2I72 A;  2HP9 A;  3LO7 A;  3NIA A;  4K0X A;  5I94 A;  4EBP A;  2PU2 A;  4GKU A;  1Q2Q A;  4N92 A;  4OP8 A;  5FI2 A;  3HLF A;  1KE4 A;  5BOH A;  5GLC A;  2Y2P A;  1C3B A;  1BT5 A;  4R0Q A;  2PBY A;  3LY3 A;  3CMZ A;  3HL9 A;  5JYO A;  4MBH A;  4OPZ A;  3IHA A;  4NK3 A;  2XD1 A;  3A3I A;  4A5R A;  4WZ4 A;  4BL3 A;  3N8R A;  4N9K A;  1I2S A;  5E2F A;  3VP2 A;  3AGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...