1TDLA

Structure of ser130gly shv-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Inhibitor-resistant class A beta-lactamases: consequences of the Ser130-to-Gly mutation seen in Apo and tazobactam structures of the SHV-1 variant
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1tdlA00
4S2OA 5FAOA 3BFEA 4WZ5C 3HLFA 1LI0A 2XD1A 3UPPA 3C7VA 1FR6A 2PBYA 1O07A 2WKHA 3Q7VA 4FD8A 5IHVA 4MBKA 2Y4AA 1I5QA 1CI8A 3UE3A 3O87A 2ZC6B 3IF6B 5U47A 2R9XA 1JWPA 1ZC2A 4E3JA 5F1FA 5FI7A 4PM9A 4DXCA 1IKIA 1CEFA 1LHYA 4U0TA 1K54C 3NY4A 3LY4A 3SH7A 3PBTA 3SS3A 4MBHA 5JYOA 1YLYA 4S2PA 1MWTA 4QJGA 4CJNA 3PTEA 3BECA 2XR0A 3BEBA 3QNBA 2Y2HA 4UA6A 2RCXA 4WEJA 1SKFA 1ONGA 1H5XA 3PBRA 1WYBA 4RX3A 4X68A 3VOYA 1BLHA 3HREA 1BLSA 2H0TA 2OSUA 1XA7A 2JE5A 1IYSA 3GR2A 1GHPA 1E25A 1PW1A 1SCWA 4KZ8A 4XUZA 4C6YA 2WZZA 1L2SA 3BLMA 1ES4A 1XPBA 1XX2A 4S2NA 3G2YA 2DNSA 3RXXA 3FKVA 2JBFA 4OPYA 5FSRA 1MPLA 5TFQA 1ONHA 2HDQA 2X71A 3C4OA 4LCLA 1PI4A 4E6WA 3GMWA 4OPQA 4OQIA 1JTGA 1NYMA 2IWBA 2H0YA 3NDGA 3VP2A 1K6RA 4YINA 2BLSA 4K0XA 4F94A 4HESA 1TVFA 1C3BA 1PI5A 3IF6A 3IH9A 3TSGA 1NYYA 4BL3A 4GB7A 1BLCA 2ZM8A 2ZM0A 3N7WA 1YM1A 1ZG4A 3BLSA 4OONA 3NDEA 3W4OA 4RYEA 2H10A 5EVIB 1PZPA 3LO7A 4OQGA 5A90A 4O7DA 4FCFA 4RA7A 4PM8A 3BM6A 5DTKA 3VFFA 3M6HA 3PAEA 4IVKA 1Z6FA 4BD1A 3CMZA 2DCFA 2IWDA 3E2KA 4BD0A 2WGWB 4EWFA 4RX2A 2EFUA 3G32A 3N6IA 1XP4A 3HLEA 3V50A 1JTDA 4KZBA 1TEMA 3WS0A 3MZEA 4OVDA 4U0XA 5HARA 3GSGA 4IVIA 1K54A 2HDUA 3IXBA 4X56A 5GLAA 3OZHA 3OCLA 3EQUA 3GTCA 3V3SA 5DTSA 4KZ5A 1H8ZA 2J9OA 3BFDA 2EX9A 3DW0A 2XFSA 5TR7A 3W4PA 5FASA 5A91A 4ZDXA 2ZQ8A 4EBPA 3JYIA 4OOLA 2DRWA 4KQRA 1HTZA 3OPRA 1BULA 5FI6A 1YLZA 1L0EA 1RGYA 1YLJA 4GDNA 2OLVA 2XDMA 4YFMA 5CTNA 4Y0TA 2XQZA 3OC2A 4JPMA 2WKIA 3P98A 1MWRA 4OLGA 4MEZA 4S2NC 4X6TA 4LENA 4LV0A 3UN7A 3UO9A 2Y2PA 5CERA 5TGFA 3IHAA 2XD5A 5EVIA 2Q9MA 4IBRA 4P87A 5EVID 4GZBA 4JF6A 5CECA 4DDSA 1JWZA 3CZDA 5HFOA 3C4PA 3ZVTA 4DRTA 3FZCA 3ZG9B 3LY3A 3GV9A 1VM1A 3O88A 2WGIA 2EX6A 3C5AA 1I2SA 5A92A 2WGVA 1KDWA 4WEKA 4C75A 1K55C 2HP5A 3GQZA 4MNRA 4ZJ1A 2QMIA 1FQGA 3G35A 3P09A 1HD8A 3HUMA 2Y2NA 4E6XA 5HAPA 5FAPA 5FI2A 1PWGA 3BRMA 4JXSA 4MBFA 3ISGA 5DF9A 1XA1A 5EUAA 4Y0UA 1CK3A 4WMCA 5FQ9A 4GKUA 4E3OA 4DE3A 4QHCA 3WS5A 4WMCD 2QZ6A 2ZC7A 4E3NA 3WRZA 1K38A 1KE4A 4X69A 2V20A 5F83A 3IWIA 4KZ3A 3ZHHA 2J9PA 3UDXA 3PBSA 2OLUA 3ZG8B 2XK1A 4P6BA 3AGFA 4WELA 1MKIA 2E8IA 4PMAA 4R4SA 2WKEA 3IXDA 1GA9A 3HLWA 1RGZA 5EVLA 1IYQA 3ZG0A 3LEZA 1IELA 3SH8A 4L0LA 4UA9A 3ZDJA 3G4PA 1L0GA 4HBUA 3RJUA 1KE0A 2Y91A 3IWQA 2XLNA 2HP6A 3FKWA 3OPLA 5CHJA 1BT5A 4JKTA 5L2FA 1LI9A 1JVJA 5F82A 4E3LA 1QMFA 3ZVWA 3VSLA 5DVAA 3V39A 3G2ZA 3HLDA 4MLLA 3HLCA 3SS4A 5HL1A 1DJBA 2XFTA 3CG5A 5EECA 2ZQDA 5FQMA 3QHYA 4D2OA 3GVBA 3TG9A 2HPBA 4KG6A 2ZQAA 5HAQA 3ITAA 3IF5A 5BOHA 3PBNA 5GLBA 1IYPA 1W8QA 5EVIC 2WUQA 2EFXA 2I72A 3I7JA 3O86A 3VMAA 3IQAA 3Q82A 5HAIA 1J9MA 1W79A 3MXRA 3G31A 3VP0A 1YMSA 1GHMA 1K55A 1ES3A 2HDSA 4KQQA 4BENA 3VSKA 2ZQ7A 4OLDA 3M6BA 4OH0A 3MFDA 5CRFA 3UDIA 2P74A 3VP3A 1IEMA 3UPOA 1WYCA 2C5WB 4ID4A 5FAQA 4E3MA 5D3OA 5KSHA 3IXHA 5CXWA 4S2KA 2A3UA 2P9VB 1YLPA 2ZC3B 1BTLA 1YMXA 3MKEA 3NI9A 3EQVA 5GHXA 5CGWA 3MZFA 3FWLA 4KG5A 4NETA 4E3IA 4P85A 3G30A 1ES5A 4QD4A 5FDHA 4QY5A 4GOGA 4FH4A 1FSYA 2Y2IA 4ZJ3A 4S2IA 1K25A 3D4FA 3FV7A 1NRFA 2B5RA 2XH9A 1MXOA 3TOIA 4CPKA 3HLGA 5CGSA 3WS2A 4X53A 3PBQA 4RVAA 5DTTA 5AQAA 4EBNA 1CI9A 1KVLA 4H8RA 4LV2A 4R0QA 4Z9QA 3ZG7B 2J8YA 2CC1A 5KSCA 1XGJA 2ZQ9A 3OPHA 2UWXA 1XXMA 5JYPA 5M18A 1ESIA 3Q7ZA 4U3TA 5EPHA 4ZTKA 4GDBA 3MXSA 3WRTA 2Y2KA 3VOZA 5FA7A 1PWDA 3UE0A 1O7EA 1AXBA 1HZOA 2G2WA 5AQBA 1FCOA 2Y2OA 3ZGAB 4A5RA 4BQMA 4DDYA 1NXYA 2IWCA 3BYDA 1Q2PA 4KG2A 4FH2A 4QU3A 4OOMA 3RXWA 3UDFA 3PAGA 1W5DA 1K56A 2EXAA 1ESUA 1LL9A 1K56D 2P9VA 2PU4A 3M2JA 4N1XA 4JF4A 4OQHA 4GD8A 2ZM2A 2Y55A 4ZJ2A 1FCNA 1OMEA 1KE3A 3FYZA 2R9WA 2HDRA 2JCHA 3E2LA 1HVBA 2OV5A 1MBLA 3ITBA 4LV1A 1S6RA 5HW3A 1E4DA 1RP5A 4UA7A 1G6AA 4KZ4A 1TDGA 4QY6A 1IKGA 1K57C 5EOEA 3N8LA 3ZG5A 2XEPA 1WE4A 3WWXA 4BL2A 5E2EA 2ZMAA 2ZJ9A 3S1YA 3A3JA 5DF7A 3UE1A 4BLMA 1S0WA 3PBOA 5M1AA 5GHYA 1ERMA 3DTMA 4DE0A 5CTMA 4QB8A 3BFCA 3MZDA 3S22A 4DF6A 5I94A 1YLWA 4ZBEA 4OP5A 3O3VA 4N9LA 3WS1A 1CEGA 3OCNA 3GRJA 4N92A 3DWZA 2V2FF 4OPRA 5GHZA 4OQ0A 3HVFA 3SH9A 4JBFA 4R4RA 4FSFA 4JXWA 3IT9A 1K4EA 3BFGA 3SS5A 4GD6A 1ERQA 4Y0OA 2ZLYA 3HUNA 4WM9A 5CGXA 5F1GA 2FFYA 1N4OA 2Y2QA 3ZNTA 3UPNA 1ALQA 2VGJA 1MWSA 4XUXA 3A3FA 1KGEA 4WBGA 4JLFA 5EOOA 5FQKA 1BSGA 5G18A 3NIAA 2VGKA 4EBLA 3NC8A 3B3XA 3C7UA 2Y59A 3SOIA 1Q2QA 4WYYA 1FCMA 3N4IA 3BFFA 4UAAA 5CEBA 4BJPA 3IH8A 4C3QA 1YQSA 2GDNA 1LL5A 1L0DA 4B88A 2C6WB 2V1ZA 2ZD8A 3A3IA 4M3KA 5AQ9A 2Q9NA 4KZAA 4R3JA 4JF5A 3S4XA 4ZAMA 2QPNA 3UNWA 1KGFA 4JXGA 4NK3A 1W8YA 4P0MA 4OPZA 1PIOA 1FSWA 2Y2JA 3AGDA 5E43A 5CHMA 2EXBA 1PYYA 5E2HA 1M40A 2EX8A 4OOYA 3HLBA 1H8YA 1G68A 1N9BA 1ES2A 1K4FA 4DE1A 1K57A 3Q07A 2WADA 1XKZA 2ZQCA 4PM6A 4EQIA 4OKPA 1FOFA 2Y2MA 1BZAA 1L0FA 4KZ6A 5E2GA 3VFHA 3VP1A 2J7VA 1W7FA 2G2UA 4HBTA 1ZKJA 5AQ7A 3V3RA 2Y2LA 1GHIA 1YLTA 2WAFA 3ZFZA 4EV4A 5J8XA 2H5SA 1Y54A 4LCMA 1M6KA 3DWKA 4WZ4A 4KZ9A 1I2WA 3V5MA 2Y2GA 4Y7PA 1NY0A 3UY6A 4IEDA 4WZ5A 1EI5A 4S2LA 3HL9A 1SDNA 4R23A 3Q81A 4E3KA 3N8SA 4KZ7A 4B4XA 5GLCA 1U60A 2Z2MB 4S2JA 3IXGA 3G34A 4IBXA 5EE8A 4K0WA 4N1HA 1PW8A 1KDSA 3IHBA 4B4ZA 3NCKA 1BUEA 5GL9A 5FQJA 1VQQA 2EX2A 4PM7A 3A3EA 4DXBA 1EROA 3OPPA 1K6SA 4S2MA 1KVMA 1E3UA 5DF8A 4N9KA 3QNCA 3Q7VB 1E3UD 2ZC5B 3AGEA 3HBRA 3Q1FA 3VP4A 3WS4A 3N8RA 4GN2A 2WYXA 4XXRA 1DY6A 1GCEA 2A49A 4Q8IA 4JXVA 3NBLA 3MBZA 1TDLA 3M2KA 1PZOA 2ZC4B 1SDEA 4KENB 1ZG6A 5M19A 2XF3A 5GLDA 2RL3A 4K91A 1NZOA 4X55A 1MWUA 5A93A 4GNUA 2FFFB 1FR1A 1YT4A 4LV3A 1NJ4A 2XGNA 3ZNYA 2WK0A 1PWCA 4HEFA 4PM5A 1GA0A 2X01A 2JC7A 2BG1A 2WZXA 1KGGA 4PPRA 4UHUA 5KZHA 2HP9A 1QMEA 3ZCZA 4R1GA 4DKIA 2WGWA 1MY8A 2PU2A 3MKFA 3IWOA 1IYOA 3LCEA 1DJAA 5HX9A 3W4QA 5FQQA 1XGIA 4DE2A 1LLBA 3HUOA 3W8KA 2X02A 5KMWA 1SHVA 5E2FA 1BLPA 2Z2LB 3IF6C 1NZUA 1RCJA 5CHUA 4KQOA 4EUZA 1EWZA 5FATA 5FQIA 1JWVA 4OP8A 3A3DA 2WAEA 3CJMA 5CEDA 4R3BA 1DJCA
chains in the Genus database with same CATH superfamily
3BFEA 1P9RA 3C7VA 1FR6A 2PBYA 2V8CA 2ACGA 3UB7A 2VGLM 1XJ4A 1I5QA 1CI8A 3UE3A 3O87A 2ZC6B 2R9XA 3LR5A 5F1FA 5FI7A 4DXCA 3LY4A 2EWVA 1YLYA 4S2PA 4GS9B 3QP1A 4CJNA 3QNBA 4RX3A 3VOYA 1BLSA 2OSUA 4KZ8A 4IUKA 2WZZA 1L2SA 4S2NA 5DKLA 2DNSA 5TFQA 2HDQA 2X71A 4LCLA 5CX7A 2OAQ1 2V8FA 1NYMA 2IWBA 3NDGA 3VP2A 3LI8A 3OLOA 4K0XA 3TE8A 2HJEA 2Z6CA 1TVFA 3IF6A 5C5KA 3N7WA 4OONA 5HWWA 3LO7A 4OQGA 4RA7A 3VFFA 3M6HA 3PAEA 4BD1A 2DCFA 2IWDA 3E2KA 3KX0X 2EFUA 2VLGA 3G32A 3D3OA 3HLEA 1V9YA 2VX8A 1W63M 3IXBA 5GLAA 3EQUA 2J9OA 3W4PA 3F1OB 4X25A 3OPRA 1L0EA 1RGYA 4GDNA 4YFMA 2XQZA 3OC2A 4JPMA 3MF0A 3UO9A 5CERA 2Q9MA 1XJ2A 4DDSA 5HFOA 5HDDA 4ZRRA 3O88A 1I2SA 3B33A 2L4RA 5DKKA 5IU1A 1S4SA 3E0YA 5DF9A 4H6JB 2PR6A 4WMCD 2QZ6A 4E3NA 3WRZA 1KOUA 2O9AA 1N9OA 2J9PA 3UDXA 1MKIA 4EUVA 4PMAA 4G3WA 2WKEA 1TD5A 1RGZA 2M1CA 1MC0A 1L0GA 1PRQA 1KE0A 3IWQA 2PD7A 3UB9A 3FKWA 4GW9A 1BT5A 2VV8A 1LI9A 4E3LA 4KUOA 3HLDA 1X0OA 1UWNX 5FQMA 4BMWA 3QHYA 1N9LA 3TG9A 2HPBA 3ITAA 3IF5A 5EVIC 2WUQA 2EFXA 2I72A 3EEHA 3IQAA 4LFUA 5HAIA 1J9MA 4ME4A 3QP8A 3VSKA 2P74A 1WYCA 4ID4A 2WKQA 5FAQA 1GSXA 3P01A 5KSHA 3NI9A 3MKEA 3K3DA 3EQVA 5GHXA 4NETA 1V9ZA 4WF0A 4LRZE 1ES5A 3MQQA 4FH4A 1FSYA 4ZJ3A 4S2IA 1K25A 5CGSA 4EERA 1YSPA 3MR0A 1LL8A 2CC1A 5KSCA 1DP9A 5G4ZA 5EM0A 5M18A 3Q7ZA 3WRTA 5EPHA 4GDBA 4I3AA 1PWDA 1O7EA 1F5MA 1HZOA 1S1YA 1FCOA 3C2WA 3ZGAB 3FPVA 4A5RA 4KG2A 4FH2A 2ZMFA 1T1AA 3K2NA 2P9VA 1K56D 4EEPA 3LIFA 2ZM2A 3E2LA 1MBLA 1S6RA 4UA7A 3BY8A 2J3WA 4QY6A 1K57C 4AFIA 2XEPA 1N9NA 2ZMAA 1UGUA 2VV7A 4BLMA 5I94A 4DE0A 4Q0JA 1LSXA 4OP5A 4CLCC 3R7WA 4DMZA 1CEGA 2GX5A 4JXWA 1K4EA 3BFGA 3HUNA 3SZTA 2Y2QA 3ZNTA 4CLCB 5EOOA 1BSGA 2A24B 2VGKA 4EBLA 4NXFA 3SOIA 3C7UA 3D9YA 4WYYA 4GLQA 3CPTB 4C3QA 2QWSA 1LL5A 4B88A 3A3IA 1NLZA 5AQ9A 1XFQA 4KZAA 3S4XA 2K7SA 3IS2B 1DRMA 3UNWA 4P0MA 1PIOA 5CHMA 4HI4A 4F3LA 2A2LA 2KLIA 3T1RA 3HLBA 4O01A 1ES2A 1VHMA 1K4FA 3Q07A 2WADA 4NXGA 4CLCE 5E2GA 3VFHA 2I9VA 2J7VA 1LSWA 2KDKA 5FDSA 2Y2LA 2WAFA 3JVUA 5J8XA 4KZ9A 3F1NA 2Y2GA 1NY0A 2W0NA 3N8SA 3LUQA 5DJTA 5GLCA 3U2AA 3IXGA 4MN6A 2WKPA 4K0WA 3IHBA 4B4ZA 2V0UA 3IX4A 5GL9A 1EROA 2GJ3A 3OPPA 4EXOA 1ACFA 4S2MA 3A0SA 3EOIA 4N9KA 1E3UD 3Q1FA 1P9WA 5TBMA 4GN2A 2WYXA 4FUWA 2A49A 4Q8IA 2O0YA 3EEAA 1SDEA 4DN0A 2KOIA 2RL3A 3S7PA 4GNUA 3V67A 1FR1A 4PAUA 3K3CA 4R3AA 2V0WA 2WZXA 3T4TA 2VV6A 2HP9A 2LB5A 4DKIA 1MY8A 3IWOA 1DJAA 3IF6C 4EESA 4D60A 3QP5A 4OP8A 2WAEA 3CJMA 3HLFA 1LI0A 3UPPA 3DTKA 5IHVA 2Y4AA 3IF6B 4G3KA 1IKIA 1CEFA 1LHYA 3NY4A 3SH7A 3PBTA 3SS3A 1T19A 1MWTA 4QJGA 4HH3A 2XR0A 1S66L 4WEJA 1SKFA 4HHDA 3PBRA 4NEED 1GHPA 1PW1A 1XPBA 1XX2A 3G2YA 3PXPA 2JBFA 2FH5A 3NECA 3B42A 1ONHA 1PI4A 4E6WA 2XRNA 3GMWA 1D7EA 4OPQA 3UB6A 2BLSA 4HESA 1C3BA 3IH9A 3TSGA 4BL3A 4GB7A 2ZM8A 1Y28A 1ZG4A 4FCFA 3BM6A 3NHQA 3CMZA 4BD0A 4KZBA 2W1RA 3NOTC 5HARA 4UQIM 3GSGA 3OBFA 4IVIA 3H82A 4BBUA 2HDUA 4X56A 4KZ5A 5HZHA 3BFDA 5TR7A 5TJJA 5FASA 5A91A 4ZDXA 2DRWA 4KQRA 3GDIA 1TS0A 1BULA 5FI6A 1YLJA 5CTNA 3E98A 2VZWA 1MWRA 4OLGA 4LENA 1UWPX 3IHAA 4IBRA 4P87A 5EVID 4GZBA 3BQAA 3CZDA 3ZVTA 3FZCA 2EX6A 3C5AA 4C75A 4II7A 2HP5A 4ZJ1A 3O5YA 5KIZA 3T50A 4JXSA 4WMCA 4MDZA 2V9AA 2B95A 2VK3A 2V20A 3IBJA 4KZ3A 4NKPA 1OTIA 3PBSA 2OLUA 3LR4A 3CUEA 3AGFA 4WELA 3T4LA 5DFXA 3ZG0A 3SH8A 4BWIA 4UA9A 3G4PA 2HP6A 3OPLA 5CHJA 2IA2A 1JVJA 1QMFA 3VSLA 3ZYTA 3HCYA 4PKYA 3CI6A 2Z6DA 2K31A 3GVBA 4KG6A 3TW8A 3PBNA 5EV0A 5GLBA 3T12B 2PR5A 3A0VA 4QPRA 4LLOB 3MXRA 3G31A 3VP0A 1MKMA 2AVXA 2HDSA 1F98A 4MMNA 1IEMA 4E3MA 3IXHA 4S2KA 2A3UA 2P9VB 1BTLA 4P6ZS 3H7WA 5CGWA 4KG5A 4E3IA 1ZHHB 5HDCA 5FDHA 4CLCD 4GOGA 5F5YA 1FILA 2Y8HA 2PHYA 3F1PB 2W3EA 4CPKA 2PD8A 4X53A 3PBQA 5AQAA 1CI9A 1KVLA 4H8RA 2ZQ9A 3UMDA 1ESIA 3T4QA 3R7WB 3MXSA 5I5LA 2Y2KA 2G2WA 3MQ0A 4BQMA 4EETB 4DDYA 3BYDA 3UDFA 1CF0A 1S67L 1K56A 5AVEA 3M2JA 3CLOA 2QKPA 1FCNA 1KE3A 2R9WA 3ITBA 1E4DA 1RP5A 2W1TA 4YOFA 1TDGA 3CWFA 3L9KA 3N8LA 4HOIA 2XA7S 4ETXA 3S1YA 1TF1A 1S0WA 3DTMA 4F3LB 5CTMA 4QB8A 3S22A 3MZDA 4DF6A 1XJ3A 1YLWA 3DWZA 3SH9A 5HD3A 4R4RA 3BY9A 2JKTI 3IT9A 3SS5A 4B93A 4YWZA 4R70A 4WM9A 5F1GA 1D1JA 1ALQA 2VGJA 1MWSA 4JLFA 3NOUC 3NIAA 3NC8A 2Y59A 1FCMA 2HV1A 4WLAA 3F1NB 3KYQA 4HJ4A 1YQSA 2GDNA 1L0DA 2C6WB 4R3JA 5MC7A 4NK3A 1W8YA 1FSWA 3AGDA 5E43A 4KUKA 5E2HA 1M40A 1H8YA 1N9BA 4BBTA 4HH2A 2JKFA 3A0RA 1XKZA 4EQIA 4GHIA 1NWZA 3UB5P 3VP1A 1H0MA 5TBMB 1W7FA 2K2NA 4EEUA 3LI9A 1YLTA 1Y54A 2OAP1 1M6KA 2HGVA 4Y7PA 4IEDA 2VEAA 5F68A 1SDNA 1H3QA 4L9GA 4E3KA 4WUJA 4B4XA 4S2JA 2W3HA 3G34A 3CAXA 4IBXA 3TRCA 2B18A 2EA9A 3R4KA 1VQQA 5J3WA 2PDRA 1HLUP 3MXQA 4Y2FA 2PBDP 1E3UA 4KQDA 4R38A 3QNCA 2M7VA 2ZOHA 3LIDA 2JHEA 4GJ4A 1GCEA 3NBLA 1TDLA 1H8MA 3MSHA 1PFLA 4K91A 4NXBA 1NJ4A 4IUHA 1NLYA 2XGNA 2ZMVA 3ZNYA 1PWCA 5KZHA 3ZCZA 4R1GA 2PU2A 5HX9A 2O9CA 4HY8A 5FQQA 1LLBA 3HUOA 3T4KA 5HL6A 5E2FA 1OT9A 1RCJA 4EUZA 2W3DA 2DMWA 4S2OA 3RH8B 3IBRA 5FAOA 4WZ5C 2XD1A 2WKHA 3Q7VA 4MBKA 1JWPA 1ZC2A 4E3JA 4PM9A 4RQ9A 4U0TA 3MJQA 1SZVA 4IJGA 1S1ZA 4MBHA 3VE4A 3BECA 3KSGA 3BEBA 1OTEA 2RCXA 1ONGA 1H5XA 2UV0E 3E4OA 1WYBA 1GSVA 1BLHA 3HREA 1XA7A 1E25A 1SCWA 3H82B 3G6OA 1ES4A 3RXXA 3FKVA 4OPYA 4Y5FA 1MPLA 2JKRI 4OQIA 1JTGA 5K5BA 2H0YA 5FEFA 2VKSA 3NJAA 4F94A 1G6OA 1P97A 3LR3A 1PI5A 3CHWP 1BLCA 3BLSA 3NDEA 3W4OA 2H10A 1PZPA 5A90A 3U4LP 4O7DA 4PM8A 3C30A 5DTKA 4IVKA 1NRJA 4EQ1A 5HWTA 2WGWB 4EWFA 2VGLS 3N6IA 1XP4A 3V50A 3ULFA 1TEMA 3WS0A 3IX8A 3MZEA 4OVDA 4U0XA 1K54A 4PKYG 3NOPC 3OZHA 3OCLA 1LSVA 3LICA 1OPXA 1H8ZA 2EX9A 2E8JA 2MJ6A 1YLZA 2ZBBA 2OLVA 2XDMA 4Y0TA 3P98A 5HWVA 4I3JA 4S2NC 3W2ZA 4G3VA 5TGFA 5EVIA 2OWHA 1TS8A 4JF6A 1VEUA 1JWZA 4I3IA 1IFQA 1VM1A 5L8MA 5A92A 4WEKA 3P09A 1FQGA 1LT0A 5DJUA 3HUMA 2Y2NA 5HAPA 3DAVA 5FI2A 1PWGA 4MBFA 5L10A 1XA1A 5FQ9A 4Y0UA 1CK3A 2O9BA 4QHCA 3WS5A 2ZC7A 2ZL1A 3ZHHA 3ZG8B 3MS6A 2E8IA 3IXDA 1G5UA 2PYPA 3HLWA 5EVLA 3LEZA 2VJWA 4L0LA 3ZDJA 4K08A 2Y91A 3H7WB 2XLNA 4JKTA 5L2FA 3T4JA 3G2ZA 5HDSA 2CMNA 3SS4A 2XFTA 4UEYA 5EECA 3T4SA 4DJ2A 3LFVA 4D2OA 4Q0HA 5HAQA 5BOHA 3MQOA 5HSQA 1IYPA 3I7JA 3O86A 3Q82A 2D02A 1WA9A 1GHMA 1K55A 1ES3A 2JKGA 4BENA 2D01A 2ZQ7A 4ESPA 4OLDA 4OH0A 3MFDA 5CRFA 3UDIA 3VP3A 3LEQA 2P04A 5D3OA 3GECA 4L9EA 1YMXA 3MZFA 1SKOA 2VA0A 4CLCA 3ICYA 2W1TB 2Y2IA 4O8GA 4Q0IA 3T4OA 2QJ7A 3D4FA 5L09A 1NRFA 1MXOA 3TOIA 3HLGA 3FPWA 1DP6A 4RVAA 5DTTA 4EBNA 4R6LA 4LV2A 3ZG7B 2HZ5A 3OPHA 2UWXA 1XXMA 1XJ6A 5JYPA 2PT7A 4ZTKA 3VOZA 5FA7A 3PYPA 3UE0A 4JGOA 1NXYA 1Q2PA 3RXWA 4OOMA 3MFXA 1W5DA 3PAGA 4N1XA 4JF4A 4OQHA 3UB8A 2Y55A 4ZJ2A 1OJGA 4Y3IA 2HDRA 1ZTUA 4I39A 1K0KA 3QP4A 1G6AA 4Z1WA 1IKGA 5EOEA 4BBVA 3ZG5A 5A8BA 1OT6A 4BL2A 2J80A 5E2EA 3DTEA 5DF7A 3RFBA 3UE1A 5M1AA 5GHYA 3BFCA 4ZBEA 3WS1A 1GSWA 4JGRA 2LB9A 4OPRA 5GHZA 4OQ0A 5HD5A 2XSSA 4GHIB 3QP6A 4GD6A 2HF6A 1STZA 1W63Q 2V1AA 5LBRA 1Y4OA 4Y0OA 2FFYA 5EM1A 4LRYC 3UPNA 2QYBA 3A3FA 5FQKA 5G18A 3B3XA 1CQAA 1YAXA 3BFFA 4UAAA 3LIBA 3S7NA 4JGPA 3MMHA 2ZD8A 3B47A 4B9OA 2Q9NA 4HQAA 4JF5A 2QPNA 1KGFA 2Y2JA 1F9IA 1PNEA 1PYYA 4XT2A 4OOYA 1G68A 4I38A 3PHYA 2ZQCA 4PM6A 1CJFA 4OKPA 4WL9A 1FOFA 2Q0OA 1BZAA 1L0FA 2Y2MA 4KZ6A 4O0PA 2G2UA 4Y17A 4JGQA 1ZKJA 1GHIA 2W3FA 3ZFZA 3KSFA 4LCMA 5L07A 3DWKA 4WZ4A 3V5MA 3UY6A 1VETA 1EI5A 4QWOA 4S2LA 3HL9A 3Q81A 4KZ7A 2YKFA 4N1HA 3NCKA 5FQJA 2EX2A 4PM7A 1S4RA 4LPZA 1KVMA 3Q7VB 3AGEA 3WS4A 3HBRA 3N8RA 2Y79A 1DY6A 4JXVA 2M7UA 2G7UA 5G4YA 3M2KA 1PZOA 2XROA 4KENB 1ZG6A 5A93A 3T1SA 4X55A 1MWUA 4HEFA 4PM5A 2X01A 1DP8A 2JC7A 1KGGA 4HIAA 3MKFA 3LCEA 1T1BA 1XGIA 4DE2A 3EGDC 5IS1A 1SHVA 2Z2LB 5CHUA 1EWZA 3DBAA 5FQIA 1JWVA 2BASA 3A3DA 5CEDA 1A0KA 1IOUA 2OOLA 1O07A 4FD8A 4HP4A 2O99A 2WKRA 5U47A 4HP9A 3FC7A 1K54C 3T1QB 3VOLA 3LR0A 1F2KA 5JYOA 1AWIA 3PTEA 2Y2HA 4UA6A 4ARZA 5AVFA 4X68A 2H0TA 2JE5A 1IYSA 1OTBA 1YPRA 3GR2A 1D06A 4XUZA 3CITA 4C6YA 3BLMA 5FSRA 4L9FA 2GZAA 1TS7A 3C4OA 2W3GA 1T1CA 4FOFA 3S7OA 2NUPC 4LGWA 1K6RA 4YINA 1OJ5A 2J3TC 1NYYA 2P08A 2ZM0A 1YM1A 1OTDA 4RYEA 5EVIB 3VE3A 3FG8A 2L0WA 1VEUB 4GS9A 1Z6FA 3OOVA 4GCZA 5HPFA 4RX2A 1L3LA 1JTDA 2BTFP 2ZOIA 2GNXA 1YSQA 4YNRA 3GTCA 5J4EA 3V3SA 5DTSA 3DW0A 2XFSA 2FZ0A 1JNUA 2ZL1B 1TS6A 2JKTM 2ZQ8A 1FIKA 3JYIA 3HJIA 4OOLA 4EBPA 1HTZA 3BQ8A 2WKIA 3JVVA 4X6TA 4MEZA 4MN7A 3UN7A 4LV0A 2Y2PA 2XD5A 5CECA 3IX3A 3ZQ5A 4DRTA 3C4PA 3ZG9B 3LY3A 4X1LA 3GV9A 2WGIA 2WGVA 1KDWA 1K55C 3GQZA 3KYZA 2PAVP 2QMIA 3G35A 1J3WA 4MNRA 1HD8A 3EGXC 3L7HA 4E6XA 5FAPA 3BRMA 5EFWA 3F1PA 3ISGA 5EUAA 4GKUA 4E3OA 4P6ZM 4DE3A 1K38A 4X69A 1KE4A 5F83A 3F1OA 3IWIA 4NG2A 1XFNA 4MN5A 2XK1A 4P6BA 4R4SA 1GA9A 4UQIS 1IYQA 1IELA 3LYXA 4HBUA 3RJUA 3S7QA 5F82A 3P7NA 1SKOB 3ZVWA 3C8CA 5DVAA 3V39A 4MLLA 3HLCA 5HL1A 1DJBA 3CG5A 2ZQDA 5HPIA 3E4QA 2ZQAA 1W8QA 3UMEA 3VMAA 1ODVA 4H6JA 1W79A 4Y15A 1YMSA 4KQQA 3M6BA 4CQHA 3UPOA 3KSIA 4HJ6A 2C5WB 2V1BA 2XA7M 3EWKA 5CXWA 3NULA 2ZC3B 1YLPA 3FWLA 4P85A 3G30A 4MCWA 4QD4A 3C38A 4QY5A 3CUEC 3T1XA 3FV7A 2B5RA 5J7EA 2XH9A 3WS2A 3E4PA 4R0QA 4Z9QA 1EW0A 2J8YA 1XGJA 4U3TA 3LIAA 4PHTA 1AXBA 5AQBA 2Y2OA 3UE6A 2IWCA 4QU3A 2EXAA 2H28A 3DTIA 1ESUA 1LL9A 2PU4A 4GD8A 1OMEA 3JPUA 3FYZA 4EW7A 2JCHA 4FTXA 1HVBA 2EWWA 2OV5A 4LV1A 5F69A 5HW3A 4KZ4A 2YKHA 1WE4A 3KYEA 3WWXA 2ZJ9A 5AJGA 3A3JA 3PBOA 1ERMA 4DJ3A 2JKRM 4XT2B 3O3VA 1BYWA 4N9LA 1T18A 3OCNA 3GRJA 4N92A 3KSHA 2V2FF 3HVFA 4JBFA 4FSFA 2R78A 5EVEA 5DFYA 3VV4A 3TJZC 1ERQA 2ZLYA 2W27A 5CGXA 1N4OA 4HJ3A 4XUXA 1KGEA 1Z09A 4WBGA 4EU0A 1Q2QA 4I5SA 3N4IA 4IHQA 5CEBA 4BJPA 3IH8A 2V1ZA 1VETB 4M3KA 2JN7A 4M4XA 4ZAMA 2QHKA 4JXGA 4OPZA 2QJ5A 2EXBA 4ETZA 2P7JA 5FEGA 2B02A 2EX8A 5F6AA 4DE1A 1K57A 2PRFA 2NUTC 3QP2A 3RTYA 5IT5A 3SW1A 4Y13A 2HJ9C 4HBTA 1YKDA 5AQ7A 3V3RA 3H9WA 1OTAA 4EV4A 2A24A 2H5SA 3CPTA 1I2WA 1VB6A 4E04A 4WZ5A 2INWA 4R23A 3IS2A 3D72A 3LGOA 1U60A 2Z2MB 5EE8A 1PW8A 1KDSA 1BUEA 2L1MA 3A3EA 4DXBA 1K6SA 5DF8A 4HNBA 2ZC5B 3VP4A 1MZUA 4XXRA 3KO6A 3MBZA 4WN5A 1P0ZA 2ZC4B 5M19A 2XF3A 3HJKA 5GLDA 1NZOA 2FFFB 1YT4A 4LV3A 1G28A 3LIEA 2PYRA 3PR6A 2OWJA 2KX6A 2WK0A 1GA0A 2BG1A 4UHUA 4PPRA 4ARZB 3BJNA 1QMEA 2WGWA 1IYOA 3W4QA 3BWLA 3W8KA 2X02A 5KMWA 1BLPA 3BW6A 4X1MA 1NZUA 2J3TD 5FL3A 4KQOA 4NXEA 4LRXC 5FATA 4R3BA 1DJCA
chains in the Genus database with same CATH topology
4S2OA 5FAOA 3BFEA 4WZ5C 3HLFA 1LI0A 2XD1A 3UPPA 3C7VA 1FR6A 2PBYA 1O07A 2WKHA 3Q7VA 4FD8A 5IHVA 4MBKA 2Y4AA 1I5QA 1CI8A 3UE3A 3O87A 2ZC6B 3IF6B 5U47A 2R9XA 1JWPA 1ZC2A 4E3JA 5F1FA 5FI7A 4PM9A 4DXCA 1IKIA 1CEFA 1LHYA 4U0TA 1K54C 3NY4A 3LY4A 3SH7A 3PBTA 3SS3A 4MBHA 5JYOA 1YLYA 4S2PA 1MWTA 4QJGA 4CJNA 3PTEA 3BECA 2XR0A 3BEBA 3QNBA 2Y2HA 4UA6A 2RCXA 4WEJA 1SKFA 1ONGA 1H5XA 3PBRA 1WYBA 4RX3A 4X68A 3VOYA 1BLHA 3HREA 1BLSA 2H0TA 2OSUA 1XA7A 2JE5A 1IYSA 3GR2A 1GHPA 1E25A 1PW1A 1SCWA 4KZ8A 4XUZA 4C6YA 2WZZA 1L2SA 3BLMA 1ES4A 1XPBA 1XX2A 4S2NA 3G2YA 2DNSA 3RXXA 3FKVA 2JBFA 4OPYA 5FSRA 1MPLA 5TFQA 1ONHA 2HDQA 2X71A 3C4OA 4LCLA 1PI4A 4E6WA 3GMWA 4OPQA 4OQIA 1JTGA 1NYMA 2IWBA 2H0YA 3NDGA 3VP2A 1K6RA 4YINA 2BLSA 4K0XA 4F94A 4HESA 1TVFA 1C3BA 1PI5A 3IF6A 3IH9A 3TSGA 1NYYA 4BL3A 4GB7A 1BLCA 2ZM8A 2ZM0A 3N7WA 1YM1A 1ZG4A 3BLSA 4OONA 3NDEA 3W4OA 4RYEA 2H10A 5EVIB 1PZPA 3LO7A 4OQGA 5A90A 4O7DA 4FCFA 4RA7A 4PM8A 3BM6A 5DTKA 3VFFA 3M6HA 3PAEA 4IVKA 1Z6FA 4BD1A 3CMZA 2DCFA 2IWDA 3E2KA 4BD0A 2WGWB 4EWFA 4RX2A 2EFUA 3G32A 3N6IA 1XP4A 3HLEA 3V50A 1JTDA 4KZBA 1TEMA 3WS0A 3MZEA 4OVDA 4U0XA 5HARA 3GSGA 4IVIA 1K54A 2HDUA 3IXBA 4X56A 5GLAA 3OZHA 3OCLA 3EQUA 3GTCA 3V3SA 5DTSA 4KZ5A 1H8ZA 2J9OA 3BFDA 2EX9A 3DW0A 2XFSA 5TR7A 3W4PA 5FASA 5A91A 4ZDXA 2ZQ8A 4EBPA 3JYIA 4OOLA 2DRWA 4KQRA 1HTZA 3OPRA 1BULA 5FI6A 1YLZA 1L0EA 1RGYA 1YLJA 4GDNA 2OLVA 2XDMA 4YFMA 5CTNA 4Y0TA 2XQZA 3OC2A 4JPMA 2WKIA 3P98A 1MWRA 4OLGA 4MEZA 4S2NC 4X6TA 4LENA 4LV0A 3UN7A 3UO9A 2Y2PA 5CERA 5TGFA 3IHAA 2XD5A 5EVIA 2Q9MA 4IBRA 4P87A 5EVID 4GZBA 4JF6A 5CECA 4DDSA 1JWZA 3CZDA 5HFOA 3C4PA 3ZVTA 4DRTA 3FZCA 3ZG9B 3LY3A 3GV9A 1VM1A 3O88A 2WGIA 2EX6A 3C5AA 1I2SA 5A92A 2WGVA 1KDWA 4WEKA 4C75A 1K55C 2HP5A 3GQZA 4MNRA 4ZJ1A 2QMIA 1FQGA 3G35A 3P09A 1HD8A 3HUMA 2Y2NA 4E6XA 5HAPA 5FAPA 5FI2A 1PWGA 3BRMA 4JXSA 4MBFA 3ISGA 5DF9A 1XA1A 5EUAA 4Y0UA 1CK3A 4WMCA 5FQ9A 4GKUA 4E3OA 4DE3A 4QHCA 3WS5A 4WMCD 2QZ6A 2ZC7A 4E3NA 3WRZA 1K38A 1KE4A 4X69A 2V20A 5F83A 3IWIA 4KZ3A 3ZHHA 2J9PA 3UDXA 3PBSA 2OLUA 3ZG8B 2XK1A 4P6BA 3AGFA 4WELA 1MKIA 2E8IA 4PMAA 4R4SA 2WKEA 3IXDA 1GA9A 3HLWA 1RGZA 5EVLA 1IYQA 3ZG0A 3LEZA 1IELA 3SH8A 4L0LA 4UA9A 3ZDJA 3G4PA 1L0GA 4HBUA 3RJUA 1KE0A 2Y91A 3IWQA 2XLNA 2HP6A 3FKWA 3OPLA 5CHJA 1BT5A 4JKTA 5L2FA 1LI9A 1JVJA 5F82A 4E3LA 1QMFA 3ZVWA 3VSLA 5DVAA 3V39A 3G2ZA 3HLDA 4MLLA 3HLCA 3SS4A 5HL1A 1DJBA 2XFTA 3CG5A 5EECA 2ZQDA 5FQMA 3QHYA 4D2OA 3GVBA 3TG9A 2HPBA 4KG6A 2ZQAA 5HAQA 3ITAA 3IF5A 5BOHA 3PBNA 5GLBA 1IYPA 1W8QA 5EVIC 2WUQA 2EFXA 2I72A 3I7JA 3O86A 3VMAA 3IQAA 3Q82A 5HAIA 1J9MA 1W79A 3MXRA 3G31A 3VP0A 1YMSA 1GHMA 1K55A 1ES3A 2HDSA 4KQQA 4BENA 3VSKA 2ZQ7A 4OLDA 3M6BA 4OH0A 3MFDA 5CRFA 3UDIA 2P74A 3VP3A 1IEMA 3UPOA 1WYCA 2C5WB 4ID4A 5FAQA 4E3MA 5D3OA 5KSHA 3IXHA 5CXWA 4S2KA 2A3UA 2P9VB 1YLPA 2ZC3B 1BTLA 1YMXA 3MKEA 3NI9A 3EQVA 5GHXA 5CGWA 3MZFA 3FWLA 4KG5A 4NETA 4E3IA 4P85A 3G30A 1ES5A 4QD4A 5FDHA 4QY5A 4GOGA 4FH4A 1FSYA 2Y2IA 4ZJ3A 4S2IA 1K25A 3D4FA 3FV7A 1NRFA 2B5RA 2XH9A 1MXOA 3TOIA 4CPKA 3HLGA 5CGSA 3WS2A 4X53A 3PBQA 4RVAA 5DTTA 5AQAA 4EBNA 1CI9A 1KVLA 4H8RA 4LV2A 4R0QA 4Z9QA 3ZG7B 2J8YA 2CC1A 5KSCA 1XGJA 2ZQ9A 3OPHA 2UWXA 1XXMA 5JYPA 5M18A 1ESIA 3Q7ZA 4U3TA 5EPHA 4ZTKA 4GDBA 3MXSA 3WRTA 2Y2KA 3VOZA 5FA7A 1PWDA 3UE0A 1O7EA 1AXBA 1HZOA 2G2WA 5AQBA 1FCOA 2Y2OA 3ZGAB 4A5RA 4BQMA 4DDYA 1NXYA 2IWCA 3BYDA 1Q2PA 4KG2A 4FH2A 4QU3A 4OOMA 3RXWA 3UDFA 3PAGA 1W5DA 1K56A 2EXAA 1ESUA 1LL9A 1K56D 2P9VA 2PU4A 3M2JA 4N1XA 4JF4A 4OQHA 4GD8A 2ZM2A 2Y55A 4ZJ2A 1FCNA 1OMEA 1KE3A 3FYZA 2R9WA 2HDRA 2JCHA 3E2LA 1HVBA 2OV5A 1MBLA 3ITBA 4LV1A 1S6RA 5HW3A 1E4DA 1RP5A 4UA7A 1G6AA 4KZ4A 1TDGA 4QY6A 1IKGA 1K57C 5EOEA 3N8LA 3ZG5A 2XEPA 1WE4A 3WWXA 4BL2A 5E2EA 2ZMAA 2ZJ9A 3S1YA 3A3JA 5DF7A 3UE1A 4BLMA 1S0WA 3PBOA 5M1AA 5GHYA 1ERMA 3DTMA 4DE0A 5CTMA 4QB8A 3BFCA 3MZDA 3S22A 4DF6A 5I94A 1YLWA 4ZBEA 4OP5A 3O3VA 4N9LA 3WS1A 1CEGA 3OCNA 3GRJA 4N92A 3DWZA 2V2FF 4OPRA 5GHZA 4OQ0A 3HVFA 3SH9A 4JBFA 4R4RA 4FSFA 4JXWA 3IT9A 1K4EA 3BFGA 3SS5A 4GD6A 1ERQA 4Y0OA 2ZLYA 3HUNA 4WM9A 5CGXA 5F1GA 2FFYA 1N4OA 2Y2QA 3ZNTA 3UPNA 1ALQA 2VGJA 1MWSA 4XUXA 3A3FA 1KGEA 4WBGA 4JLFA 5EOOA 5FQKA 1BSGA 5G18A 3NIAA 2VGKA 4EBLA 3NC8A 3B3XA 3C7UA 2Y59A 3SOIA 1Q2QA 4WYYA 1FCMA 3N4IA 3BFFA 4UAAA 5CEBA 4BJPA 3IH8A 4C3QA 1YQSA 2GDNA 1LL5A 1L0DA 4B88A 2C6WB 2V1ZA 2ZD8A 3A3IA 4M3KA 5AQ9A 2Q9NA 4KZAA 4R3JA 4JF5A 3S4XA 4ZAMA 2QPNA 3UNWA 1KGFA 4JXGA 4NK3A 1W8YA 4P0MA 4OPZA 1PIOA 1FSWA 2Y2JA 3AGDA 5E43A 5CHMA 2EXBA 1PYYA 5E2HA 1M40A 2EX8A 4OOYA 3HLBA 1H8YA 1G68A 1N9BA 1ES2A 1K4FA 4DE1A 1K57A 3Q07A 2WADA 1XKZA 2ZQCA 4PM6A 4EQIA 4OKPA 1FOFA 2Y2MA 1BZAA 1L0FA 4KZ6A 5E2GA 3VFHA 3VP1A 2J7VA 1W7FA 2G2UA 4HBTA 1ZKJA 5AQ7A 3V3RA 2Y2LA 1GHIA 1YLTA 2WAFA 3ZFZA 4EV4A 5J8XA 2H5SA 1Y54A 4LCMA 1M6KA 3DWKA 4WZ4A 4KZ9A 1I2WA 3V5MA 2Y2GA 4Y7PA 1NY0A 3UY6A 4IEDA 4WZ5A 1EI5A 4S2LA 3HL9A 1SDNA 4R23A 3Q81A 4E3KA 3N8SA 4KZ7A 4B4XA 5GLCA 1U60A 2Z2MB 4S2JA 3IXGA 3G34A 4IBXA 5EE8A 4K0WA 4N1HA 1PW8A 1KDSA 3IHBA 4B4ZA 3NCKA 1BUEA 5GL9A 5FQJA 1VQQA 2EX2A 4PM7A 3A3EA 4DXBA 1EROA 3OPPA 1K6SA 4S2MA 1KVMA 1E3UA 5DF8A 4N9KA 3QNCA 3Q7VB 1E3UD 2ZC5B 3AGEA 3HBRA 3Q1FA 3VP4A 3WS4A 3N8RA 4GN2A 2WYXA 4XXRA 1DY6A 1GCEA 2A49A 4Q8IA 4JXVA 3NBLA 3MBZA 1TDLA 3M2KA 1PZOA 2ZC4B 1SDEA 4KENB 1ZG6A 5M19A 2XF3A 5GLDA 2RL3A 4K91A 1NZOA 4X55A 1MWUA 5A93A 4GNUA 2FFFB 1FR1A 1YT4A 4LV3A 1NJ4A 2XGNA 3ZNYA 2WK0A 1PWCA 4HEFA 4PM5A 1GA0A 2X01A 2JC7A 2BG1A 2WZXA 1KGGA 4PPRA 4UHUA 5KZHA 2HP9A 1QMEA 3ZCZA 4R1GA 4DKIA 2WGWA 1MY8A 2PU2A 3MKFA 3IWOA 1IYOA 3LCEA 1DJAA 5HX9A 3W4QA 5FQQA 1XGIA 4DE2A 1LLBA 3HUOA 3W8KA 2X02A 5KMWA 1SHVA 5E2FA 1BLPA 2Z2LB 3IF6C 1NZUA 1RCJA 5CHUA 4KQOA 4EUZA 1EWZA 5FATA 5FQIA 1JWVA 4OP8A 3A3DA 2WAEA 3CJMA 5CEDA 4R3BA 1DJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2O A;  5FAO A;  3BFE A;  4WZ5 C;  3HLF A;  1LI0 A;  2XD1 A;  3UPP A;  3C7V A;  1FR6 A;  2PBY A;  1O07 A;  2WKH A;  3Q7V A;  4FD8 A;  5IHV A;  4MBK A;  2Y4A A;  1I5Q A;  1CI8 A;  3UE3 A;  3O87 A;  2ZC6 B;  3IF6 B;  5U47 A;  2R9X A;  1JWP A;  1ZC2 A;  4E3J A;  5F1F A;  5FI7 A;  4PM9 A;  4DXC A;  1IKI A;  1CEF A;  1LHY A;  4U0T A;  1K54 C;  3NY4 A;  3LY4 A;  3SH7 A;  3PBT A;  3SS3 A;  4MBH A;  5JYO A;  1YLY A;  4S2P A;  1MWT A;  4QJG A;  4CJN A;  3PTE A;  3BEC A;  2XR0 A;  3BEB A;  3QNB A;  2Y2H A;  4UA6 A;  2RCX A;  4WEJ A;  1SKF A;  1ONG A;  1H5X A;  3PBR A;  1WYB A;  4RX3 A;  4X68 A;  3VOY A;  1BLH A;  3HRE A;  1BLS A;  2H0T A;  2OSU A;  1XA7 A;  2JE5 A;  1IYS A;  3GR2 A;  1GHP A;  1E25 A;  1PW1 A;  1SCW A;  4KZ8 A;  4XUZ A;  4C6Y A;  2WZZ A;  1L2S A;  3BLM A;  1ES4 A;  1XPB A;  1XX2 A;  4S2N A;  3G2Y A;  2DNS A;  3RXX A;  3FKV A;  2JBF A;  4OPY A;  5FSR A;  1MPL A;  5TFQ A;  1ONH A;  2HDQ A;  2X71 A;  3C4O A;  4LCL A;  1PI4 A;  4E6W A;  3GMW A;  4OPQ A;  4OQI A;  1JTG A;  1NYM A;  2IWB A;  2H0Y A;  3NDG A;  3VP2 A;  1K6R A;  4YIN A;  2BLS A;  4K0X A;  4F94 A;  4HES A;  1TVF A;  1C3B A;  1PI5 A;  3IF6 A;  3IH9 A;  3TSG A;  1NYY A;  4BL3 A;  4GB7 A;  1BLC A;  2ZM8 A;  2ZM0 A;  3N7W A;  1YM1 A;  1ZG4 A;  3BLS A;  4OON A;  3NDE A;  3W4O A;  4RYE A;  2H10 A;  5EVI B;  1PZP A;  3LO7 A;  4OQG A;  5A90 A;  4O7D A;  4FCF A;  4RA7 A;  4PM8 A;  3BM6 A;  5DTK A;  3VFF A;  3M6H A;  3PAE A;  4IVK A;  1Z6F A;  4BD1 A;  3CMZ A;  2DCF A;  2IWD A;  3E2K A;  4BD0 A;  2WGW B;  4EWF A;  4RX2 A;  2EFU A;  3G32 A;  3N6I A;  1XP4 A;  3HLE A;  3V50 A;  1JTD A;  4KZB A;  1TEM A;  3WS0 A;  3MZE A;  4OVD A;  4U0X A;  5HAR A;  3GSG A;  4IVI A;  1K54 A;  2HDU A;  3IXB A;  4X56 A;  5GLA A;  3OZH A;  3OCL A;  3EQU A;  3GTC A;  3V3S A;  5DTS A;  4KZ5 A;  1H8Z A;  2J9O A;  3BFD A;  2EX9 A;  3DW0 A;  2XFS A;  5TR7 A;  3W4P A;  5FAS A;  5A91 A;  4ZDX A;  2ZQ8 A;  4EBP A;  3JYI A;  4OOL A;  2DRW A;  4KQR A;  1HTZ A;  3OPR A;  1BUL A;  5FI6 A;  1YLZ A;  1L0E A;  1RGY A;  1YLJ A;  4GDN A;  2OLV A;  2XDM A;  4YFM A;  5CTN A;  4Y0T A;  2XQZ A;  3OC2 A;  4JPM A;  2WKI A;  3P98 A;  1MWR A;  4OLG A;  4MEZ A;  4S2N C;  4X6T A;  4LEN A;  4LV0 A;  3UN7 A;  3UO9 A;  2Y2P A;  5CER A;  5TGF A;  3IHA A;  2XD5 A;  5EVI A;  2Q9M A;  4IBR A;  4P87 A;  5EVI D;  4GZB A;  4JF6 A;  5CEC A;  4DDS A;  1JWZ A;  3CZD A;  5HFO A;  3C4P A;  3ZVT A;  4DRT A;  3FZC A;  3ZG9 B;  3LY3 A;  3GV9 A;  1VM1 A;  3O88 A;  2WGI A;  2EX6 A;  3C5A A;  1I2S A;  5A92 A;  2WGV A;  1KDW A;  4WEK A;  4C75 A;  1K55 C;  2HP5 A;  3GQZ A;  4MNR A;  4ZJ1 A;  2QMI A;  1FQG A;  3G35 A;  3P09 A;  1HD8 A;  3HUM A;  2Y2N A;  4E6X A;  5HAP A;  5FAP A;  5FI2 A;  1PWG A;  3BRM A;  4JXS A;  4MBF A;  3ISG A;  5DF9 A;  1XA1 A;  5EUA A;  4Y0U A;  1CK3 A;  4WMC A;  5FQ9 A;  4GKU A;  4E3O A;  4DE3 A;  4QHC A;  3WS5 A;  4WMC D;  2QZ6 A;  2ZC7 A;  4E3N A;  3WRZ A;  1K38 A;  1KE4 A;  4X69 A;  2V20 A;  5F83 A;  3IWI A;  4KZ3 A;  3ZHH A;  2J9P A;  3UDX A;  3PBS A;  2OLU A;  3ZG8 B;  2XK1 A;  4P6B A;  3AGF A;  4WEL A;  1MKI A;  2E8I A;  4PMA A;  4R4S A;  2WKE A;  3IXD A;  1GA9 A;  3HLW A;  1RGZ A;  5EVL A;  1IYQ A;  3ZG0 A;  3LEZ A;  1IEL A;  3SH8 A;  4L0L A;  4UA9 A;  3ZDJ A;  3G4P A;  1L0G A;  4HBU A;  3RJU A;  1KE0 A;  2Y91 A;  3IWQ A;  2XLN A;  2HP6 A;  3FKW A;  3OPL A;  5CHJ A;  1BT5 A;  4JKT A;  5L2F A;  1LI9 A;  1JVJ A;  5F82 A;  4E3L A;  1QMF A;  3ZVW A;  3VSL A;  5DVA A;  3V39 A;  3G2Z A;  3HLD A;  4MLL A;  3HLC A;  3SS4 A;  5HL1 A;  1DJB A;  2XFT A;  3CG5 A;  5EEC A;  2ZQD A;  5FQM A;  3QHY A;  4D2O A;  3GVB A;  3TG9 A;  2HPB A;  4KG6 A;  2ZQA A;  5HAQ A;  3ITA A;  3IF5 A;  5BOH A;  3PBN A;  5GLB A;  1IYP A;  1W8Q A;  5EVI C;  2WUQ A;  2EFX A;  2I72 A;  3I7J A;  3O86 A;  3VMA A;  3IQA A;  3Q82 A;  5HAI A;  1J9M A;  1W79 A;  3MXR A;  3G31 A;  3VP0 A;  1YMS A;  1GHM A;  1K55 A;  1ES3 A;  2HDS A;  4KQQ A;  4BEN A;  3VSK A;  2ZQ7 A;  4OLD A;  3M6B A;  4OH0 A;  3MFD A;  5CRF A;  3UDI A;  2P74 A;  3VP3 A;  1IEM A;  3UPO A;  1WYC A;  2C5W B;  4ID4 A;  5FAQ A;  4E3M A;  5D3O A;  5KSH A;  3IXH A;  5CXW A;  4S2K A;  2A3U A;  2P9V B;  1YLP A;  2ZC3 B;  1BTL A;  1YMX A;  3MKE A;  3NI9 A;  3EQV A;  5GHX A;  5CGW A;  3MZF A;  3FWL A;  4KG5 A;  4NET A;  4E3I A;  4P85 A;  3G30 A;  1ES5 A;  4QD4 A;  5FDH A;  4QY5 A;  4GOG A;  4FH4 A;  1FSY A;  2Y2I A;  4ZJ3 A;  4S2I A;  1K25 A;  3D4F A;  3FV7 A;  1NRF A;  2B5R A;  2XH9 A;  1MXO A;  3TOI A;  4CPK A;  3HLG A;  5CGS A;  3WS2 A;  4X53 A;  3PBQ A;  4RVA A;  5DTT A;  5AQA A;  4EBN A;  1CI9 A;  1KVL A;  4H8R A;  4LV2 A;  4R0Q A;  4Z9Q A;  3ZG7 B;  2J8Y A;  2CC1 A;  5KSC A;  1XGJ A;  2ZQ9 A;  3OPH A;  2UWX A;  1XXM A;  5JYP A;  5M18 A;  1ESI A;  3Q7Z A;  4U3T A;  5EPH A;  4ZTK A;  4GDB A;  3MXS A;  3WRT A;  2Y2K A;  3VOZ A;  5FA7 A;  1PWD A;  3UE0 A;  1O7E A;  1AXB A;  1HZO A;  2G2W A;  5AQB A;  1FCO A;  2Y2O A;  3ZGA B;  4A5R A;  4BQM A;  4DDY A;  1NXY A;  2IWC A;  3BYD A;  1Q2P A;  4KG2 A;  4FH2 A;  4QU3 A;  4OOM A;  3RXW A;  3UDF A;  3PAG A;  1W5D A;  1K56 A;  2EXA A;  1ESU A;  1LL9 A;  1K56 D;  2P9V A;  2PU4 A;  3M2J A;  4N1X A;  4JF4 A;  4OQH A;  4GD8 A;  2ZM2 A;  2Y55 A;  4ZJ2 A;  1FCN A;  1OME A;  1KE3 A;  3FYZ A;  2R9W A;  2HDR A;  2JCH A;  3E2L A;  1HVB A;  2OV5 A;  1MBL A;  3ITB A;  4LV1 A;  1S6R A;  5HW3 A;  1E4D A;  1RP5 A;  4UA7 A;  1G6A A;  4KZ4 A;  1TDG A;  4QY6 A;  1IKG A;  1K57 C;  5EOE A;  3N8L A;  3ZG5 A;  2XEP A;  1WE4 A;  3WWX A;  4BL2 A;  5E2E A;  2ZMA A;  2ZJ9 A;  3S1Y A;  3A3J A;  5DF7 A;  3UE1 A;  4BLM A;  1S0W A;  3PBO A;  5M1A A;  5GHY A;  1ERM A;  3DTM A;  4DE0 A;  5CTM A;  4QB8 A;  3BFC A;  3MZD A;  3S22 A;  4DF6 A;  5I94 A;  1YLW A;  4ZBE A;  4OP5 A;  3O3V A;  4N9L A;  3WS1 A;  1CEG A;  3OCN A;  3GRJ A;  4N92 A;  3DWZ A;  2V2F F;  4OPR A;  5GHZ A;  4OQ0 A;  3HVF A;  3SH9 A;  4JBF A;  4R4R A;  4FSF A;  4JXW A;  3IT9 A;  1K4E A;  3BFG A;  3SS5 A;  4GD6 A;  1ERQ A;  4Y0O A;  2ZLY A;  3HUN A;  4WM9 A;  5CGX A;  5F1G A;  2FFY A;  1N4O A;  2Y2Q A;  3ZNT A;  3UPN A;  1ALQ A;  2VGJ A;  1MWS A;  4XUX A;  3A3F A;  1KGE A;  4WBG A;  4JLF A;  5EOO A;  5FQK A;  1BSG A;  5G18 A;  3NIA A;  2VGK A;  4EBL A;  3NC8 A;  3B3X A;  3C7U A;  2Y59 A;  3SOI A;  1Q2Q A;  4WYY A;  1FCM A;  3N4I A;  3BFF A;  4UAA A;  5CEB A;  4BJP A;  3IH8 A;  4C3Q A;  1YQS A;  2GDN A;  1LL5 A;  1L0D A;  4B88 A;  2C6W B;  2V1Z A;  2ZD8 A;  3A3I A;  4M3K A;  5AQ9 A;  2Q9N A;  4KZA A;  4R3J A;  4JF5 A;  3S4X A;  4ZAM A;  2QPN A;  3UNW A;  1KGF A;  4JXG A;  4NK3 A;  1W8Y A;  4P0M A;  4OPZ A;  1PIO A;  1FSW A;  2Y2J A;  3AGD A;  5E43 A;  5CHM A;  2EXB A;  1PYY A;  5E2H A;  1M40 A;  2EX8 A;  4OOY A;  3HLB A;  1H8Y A;  1G68 A;  1N9B A;  1ES2 A;  1K4F A;  4DE1 A;  1K57 A;  3Q07 A;  2WAD A;  1XKZ A;  2ZQC A;  4PM6 A;  4EQI A;  4OKP A;  1FOF A;  2Y2M A;  1BZA A;  1L0F A;  4KZ6 A;  5E2G A;  3VFH A;  3VP1 A;  2J7V A;  1W7F A;  2G2U A;  4HBT A;  1ZKJ A;  5AQ7 A;  3V3R A;  2Y2L A;  1GHI A;  1YLT A;  2WAF A;  3ZFZ A;  4EV4 A;  5J8X A;  2H5S A;  1Y54 A;  4LCM A;  1M6K A;  3DWK A;  4WZ4 A;  4KZ9 A;  1I2W A;  3V5M A;  2Y2G A;  4Y7P A;  1NY0 A;  3UY6 A;  4IED A;  4WZ5 A;  1EI5 A;  4S2L A;  3HL9 A;  1SDN A;  4R23 A;  3Q81 A;  4E3K A;  3N8S A;  4KZ7 A;  4B4X A;  5GLC A;  1U60 A;  2Z2M B;  4S2J A;  3IXG A;  3G34 A;  4IBX A;  5EE8 A;  4K0W A;  4N1H A;  1PW8 A;  1KDS A;  3IHB A;  4B4Z A;  3NCK A;  1BUE A;  5GL9 A;  5FQJ A;  1VQQ A;  2EX2 A;  4PM7 A;  3A3E A;  4DXB A;  1ERO A;  3OPP A;  1K6S A;  4S2M A;  1KVM A;  1E3U A;  5DF8 A;  4N9K A;  3QNC A;  3Q7V B;  1E3U D;  2ZC5 B;  3AGE A;  3HBR A;  3Q1F A;  3VP4 A;  3WS4 A;  3N8R A;  4GN2 A;  2WYX A;  4XXR A;  1DY6 A;  1GCE A;  2A49 A;  4Q8I A;  4JXV A;  3NBL A;  3MBZ A;  1TDL A;  3M2K A;  1PZO A;  2ZC4 B;  1SDE A;  4KEN B;  1ZG6 A;  5M19 A;  2XF3 A;  5GLD A;  2RL3 A;  4K91 A;  1NZO A;  4X55 A;  1MWU A;  5A93 A;  4GNU A;  2FFF B;  1FR1 A;  1YT4 A;  4LV3 A;  1NJ4 A;  2XGN A;  3ZNY A;  2WK0 A;  1PWC A;  4HEF A;  4PM5 A;  1GA0 A;  2X01 A;  2JC7 A;  2BG1 A;  2WZX A;  1KGG A;  4PPR A;  4UHU A;  5KZH A;  2HP9 A;  1QME A;  3ZCZ A;  4R1G A;  4DKI A;  2WGW A;  1MY8 A;  2PU2 A;  3MKF A;  3IWO A;  1IYO A;  3LCE A;  1DJA A;  5HX9 A;  3W4Q A;  5FQQ A;  1XGI A;  4DE2 A;  1LLB A;  3HUO A;  3W8K A;  2X02 A;  5KMW A;  1SHV A;  5E2F A;  1BLP A;  2Z2L B;  3IF6 C;  1NZU A;  1RCJ A;  5CHU A;  4KQO A;  4EUZ A;  1EWZ A;  5FAT A;  5FQI A;  1JWV A;  4OP8 A;  3A3D A;  2WAE A;  3CJM A;  5CED A;  4R3B A;  1DJC A; 
#chains in the Genus database with same CATH topology
 3BFE A;  1P9R A;  3C7V A;  1FR6 A;  2PBY A;  2V8C A;  2ACG A;  3UB7 A;  2VGL M;  1XJ4 A;  1I5Q A;  1CI8 A;  3UE3 A;  3O87 A;  2ZC6 B;  2R9X A;  3LR5 A;  5F1F A;  5FI7 A;  4DXC A;  3LY4 A;  2EWV A;  1YLY A;  4S2P A;  4GS9 B;  3QP1 A;  4CJN A;  3QNB A;  4RX3 A;  3VOY A;  1BLS A;  2OSU A;  4KZ8 A;  4IUK A;  2WZZ A;  1L2S A;  4S2N A;  5DKL A;  2DNS A;  5TFQ A;  2HDQ A;  2X71 A;  4LCL A;  5CX7 A;  2OAQ 1;  2V8F A;  1NYM A;  2IWB A;  3NDG A;  3VP2 A;  3LI8 A;  3OLO A;  4K0X A;  3TE8 A;  2HJE A;  2Z6C A;  1TVF A;  3IF6 A;  5C5K A;  3N7W A;  4OON A;  5HWW A;  3LO7 A;  4OQG A;  4RA7 A;  3VFF A;  3M6H A;  3PAE A;  4BD1 A;  2DCF A;  2IWD A;  3E2K A;  3KX0 X;  2EFU A;  2VLG A;  3G32 A;  3D3O A;  3HLE A;  1V9Y A;  2VX8 A;  1W63 M;  3IXB A;  5GLA A;  3EQU A;  2J9O A;  3W4P A;  3F1O B;  4X25 A;  3OPR A;  1L0E A;  1RGY A;  4GDN A;  4YFM A;  2XQZ A;  3OC2 A;  4JPM A;  3MF0 A;  3UO9 A;  5CER A;  2Q9M A;  1XJ2 A;  4DDS A;  5HFO A;  5HDD A;  4ZRR A;  3O88 A;  1I2S A;  3B33 A;  2L4R A;  5DKK A;  5IU1 A;  1S4S A;  3E0Y A;  5DF9 A;  4H6J B;  2PR6 A;  4WMC D;  2QZ6 A;  4E3N A;  3WRZ A;  1KOU A;  2O9A A;  1N9O A;  2J9P A;  3UDX A;  1MKI A;  4EUV A;  4PMA A;  4G3W A;  2WKE A;  1TD5 A;  1RGZ A;  2M1C A;  1MC0 A;  1L0G A;  1PRQ A;  1KE0 A;  3IWQ A;  2PD7 A;  3UB9 A;  3FKW A;  4GW9 A;  1BT5 A;  2VV8 A;  1LI9 A;  4E3L A;  4KUO A;  3HLD A;  1X0O A;  1UWN X;  5FQM A;  4BMW A;  3QHY A;  1N9L A;  3TG9 A;  2HPB A;  3ITA A;  3IF5 A;  5EVI C;  2WUQ A;  2EFX A;  2I72 A;  3EEH A;  3IQA A;  4LFU A;  5HAI A;  1J9M A;  4ME4 A;  3QP8 A;  3VSK A;  2P74 A;  1WYC A;  4ID4 A;  2WKQ A;  5FAQ A;  1GSX A;  3P01 A;  5KSH A;  3NI9 A;  3MKE A;  3K3D A;  3EQV A;  5GHX A;  4NET A;  1V9Z A;  4WF0 A;  4LRZ E;  1ES5 A;  3MQQ A;  4FH4 A;  1FSY A;  4ZJ3 A;  4S2I A;  1K25 A;  5CGS A;  4EER A;  1YSP A;  3MR0 A;  1LL8 A;  2CC1 A;  5KSC A;  1DP9 A;  5G4Z A;  5EM0 A;  5M18 A;  3Q7Z A;  3WRT A;  5EPH A;  4GDB A;  4I3A A;  1PWD A;  1O7E A;  1F5M A;  1HZO A;  1S1Y A;  1FCO A;  3C2W A;  3ZGA B;  3FPV A;  4A5R A;  4KG2 A;  4FH2 A;  2ZMF A;  1T1A A;  3K2N A;  2P9V A;  1K56 D;  4EEP A;  3LIF A;  2ZM2 A;  3E2L A;  1MBL A;  1S6R A;  4UA7 A;  3BY8 A;  2J3W A;  4QY6 A;  1K57 C;  4AFI A;  2XEP A;  1N9N A;  2ZMA A;  1UGU A;  2VV7 A;  4BLM A;  5I94 A;  4DE0 A;  4Q0J A;  1LSX A;  4OP5 A;  4CLC C;  3R7W A;  4DMZ A;  1CEG A;  2GX5 A;  4JXW A;  1K4E A;  3BFG A;  3HUN A;  3SZT A;  2Y2Q A;  3ZNT A;  4CLC B;  5EOO A;  1BSG A;  2A24 B;  2VGK A;  4EBL A;  4NXF A;  3SOI A;  3C7U A;  3D9Y A;  4WYY A;  4GLQ A;  3CPT B;  4C3Q A;  2QWS A;  1LL5 A;  4B88 A;  3A3I A;  1NLZ A;  5AQ9 A;  1XFQ A;  4KZA A;  3S4X A;  2K7S A;  3IS2 B;  1DRM A;  3UNW A;  4P0M A;  1PIO A;  5CHM A;  4HI4 A;  4F3L A;  2A2L A;  2KLI A;  3T1R A;  3HLB A;  4O01 A;  1ES2 A;  1VHM A;  1K4F A;  3Q07 A;  2WAD A;  4NXG A;  4CLC E;  5E2G A;  3VFH A;  2I9V A;  2J7V A;  1LSW A;  2KDK A;  5FDS A;  2Y2L A;  2WAF A;  3JVU A;  5J8X A;  4KZ9 A;  3F1N A;  2Y2G A;  1NY0 A;  2W0N A;  3N8S A;  3LUQ A;  5DJT A;  5GLC A;  3U2A A;  3IXG A;  4MN6 A;  2WKP A;  4K0W A;  3IHB A;  4B4Z A;  2V0U A;  3IX4 A;  5GL9 A;  1ERO A;  2GJ3 A;  3OPP A;  4EXO A;  1ACF A;  4S2M A;  3A0S A;  3EOI A;  4N9K A;  1E3U D;  3Q1F A;  1P9W A;  5TBM A;  4GN2 A;  2WYX A;  4FUW A;  2A49 A;  4Q8I A;  2O0Y A;  3EEA A;  1SDE A;  4DN0 A;  2KOI A;  2RL3 A;  3S7P A;  4GNU A;  3V67 A;  1FR1 A;  4PAU A;  3K3C A;  4R3A A;  2V0W A;  2WZX A;  3T4T A;  2VV6 A;  2HP9 A;  2LB5 A;  4DKI A;  1MY8 A;  3IWO A;  1DJA A;  3IF6 C;  4EES A;  4D60 A;  3QP5 A;  4OP8 A;  2WAE A;  3CJM A;  3HLF A;  1LI0 A;  3UPP A;  3DTK A;  5IHV A;  2Y4A A;  3IF6 B;  4G3K A;  1IKI A;  1CEF A;  1LHY A;  3NY4 A;  3SH7 A;  3PBT A;  3SS3 A;  1T19 A;  1MWT A;  4QJG A;  4HH3 A;  2XR0 A;  1S66 L;  4WEJ A;  1SKF A;  4HHD A;  3PBR A;  4NEE D;  1GHP A;  1PW1 A;  1XPB A;  1XX2 A;  3G2Y A;  3PXP A;  2JBF A;  2FH5 A;  3NEC A;  3B42 A;  1ONH A;  1PI4 A;  4E6W A;  2XRN A;  3GMW A;  1D7E A;  4OPQ A;  3UB6 A;  2BLS A;  4HES A;  1C3B A;  3IH9 A;  3TSG A;  4BL3 A;  4GB7 A;  2ZM8 A;  1Y28 A;  1ZG4 A;  4FCF A;  3BM6 A;  3NHQ A;  3CMZ A;  4BD0 A;  4KZB A;  2W1R A;  3NOT C;  5HAR A;  4UQI M;  3GSG A;  3OBF A;  4IVI A;  3H82 A;  4BBU A;  2HDU A;  4X56 A;  4KZ5 A;  5HZH A;  3BFD A;  5TR7 A;  5TJJ A;  5FAS A;  5A91 A;  4ZDX A;  2DRW A;  4KQR A;  3GDI A;  1TS0 A;  1BUL A;  5FI6 A;  1YLJ A;  5CTN A;  3E98 A;  2VZW A;  1MWR A;  4OLG A;  4LEN A;  1UWP X;  3IHA A;  4IBR A;  4P87 A;  5EVI D;  4GZB A;  3BQA A;  3CZD A;  3ZVT A;  3FZC A;  2EX6 A;  3C5A A;  4C75 A;  4II7 A;  2HP5 A;  4ZJ1 A;  3O5Y A;  5KIZ A;  3T50 A;  4JXS A;  4WMC A;  4MDZ A;  2V9A A;  2B95 A;  2VK3 A;  2V20 A;  3IBJ A;  4KZ3 A;  4NKP A;  1OTI A;  3PBS A;  2OLU A;  3LR4 A;  3CUE A;  3AGF A;  4WEL A;  3T4L A;  5DFX A;  3ZG0 A;  3SH8 A;  4BWI A;  4UA9 A;  3G4P A;  2HP6 A;  3OPL A;  5CHJ A;  2IA2 A;  1JVJ A;  1QMF A;  3VSL A;  3ZYT A;  3HCY A;  4PKY A;  3CI6 A;  2Z6D A;  2K31 A;  3GVB A;  4KG6 A;  3TW8 A;  3PBN A;  5EV0 A;  5GLB A;  3T12 B;  2PR5 A;  3A0V A;  4QPR A;  4LLO B;  3MXR A;  3G31 A;  3VP0 A;  1MKM A;  2AVX A;  2HDS A;  1F98 A;  4MMN A;  1IEM A;  4E3M A;  3IXH A;  4S2K A;  2A3U A;  2P9V B;  1BTL A;  4P6Z S;  3H7W A;  5CGW A;  4KG5 A;  4E3I A;  1ZHH B;  5HDC A;  5FDH A;  4CLC D;  4GOG A;  5F5Y A;  1FIL A;  2Y8H A;  2PHY A;  3F1P B;  2W3E A;  4CPK A;  2PD8 A;  4X53 A;  3PBQ A;  5AQA A;  1CI9 A;  1KVL A;  4H8R A;  2ZQ9 A;  3UMD A;  1ESI A;  3T4Q A;  3R7W B;  3MXS A;  5I5L A;  2Y2K A;  2G2W A;  3MQ0 A;  4BQM A;  4EET B;  4DDY A;  3BYD A;  3UDF A;  1CF0 A;  1S67 L;  1K56 A;  5AVE A;  3M2J A;  3CLO A;  2QKP A;  1FCN A;  1KE3 A;  2R9W A;  3ITB A;  1E4D A;  1RP5 A;  2W1T A;  4YOF A;  1TDG A;  3CWF A;  3L9K A;  3N8L A;  4HOI A;  2XA7 S;  4ETX A;  3S1Y A;  1TF1 A;  1S0W A;  3DTM A;  4F3L B;  5CTM A;  4QB8 A;  3S22 A;  3MZD A;  4DF6 A;  1XJ3 A;  1YLW A;  3DWZ A;  3SH9 A;  5HD3 A;  4R4R A;  3BY9 A;  2JKT I;  3IT9 A;  3SS5 A;  4B93 A;  4YWZ A;  4R70 A;  4WM9 A;  5F1G A;  1D1J A;  1ALQ A;  2VGJ A;  1MWS A;  4JLF A;  3NOU C;  3NIA A;  3NC8 A;  2Y59 A;  1FCM A;  2HV1 A;  4WLA A;  3F1N B;  3KYQ A;  4HJ4 A;  1YQS A;  2GDN A;  1L0D A;  2C6W B;  4R3J A;  5MC7 A;  4NK3 A;  1W8Y A;  1FSW A;  3AGD A;  5E43 A;  4KUK A;  5E2H A;  1M40 A;  1H8Y A;  1N9B A;  4BBT A;  4HH2 A;  2JKF A;  3A0R A;  1XKZ A;  4EQI A;  4GHI A;  1NWZ A;  3UB5 P;  3VP1 A;  1H0M A;  5TBM B;  1W7F A;  2K2N A;  4EEU A;  3LI9 A;  1YLT A;  1Y54 A;  2OAP 1;  1M6K A;  2HGV A;  4Y7P A;  4IED A;  2VEA A;  5F68 A;  1SDN A;  1H3Q A;  4L9G A;  4E3K A;  4WUJ A;  4B4X A;  4S2J A;  2W3H A;  3G34 A;  3CAX A;  4IBX A;  3TRC A;  2B18 A;  2EA9 A;  3R4K A;  1VQQ A;  5J3W A;  2PDR A;  1HLU P;  3MXQ A;  4Y2F A;  2PBD P;  1E3U A;  4KQD A;  4R38 A;  3QNC A;  2M7V A;  2ZOH A;  3LID A;  2JHE A;  4GJ4 A;  1GCE A;  3NBL A;  1TDL A;  1H8M A;  3MSH A;  1PFL A;  4K91 A;  4NXB A;  1NJ4 A;  4IUH A;  1NLY A;  2XGN A;  2ZMV A;  3ZNY A;  1PWC A;  5KZH A;  3ZCZ A;  4R1G A;  2PU2 A;  5HX9 A;  2O9C A;  4HY8 A;  5FQQ A;  1LLB A;  3HUO A;  3T4K A;  5HL6 A;  5E2F A;  1OT9 A;  1RCJ A;  4EUZ A;  2W3D A;  2DMW A;  4S2O A;  3RH8 B;  3IBR A;  5FAO A;  4WZ5 C;  2XD1 A;  2WKH A;  3Q7V A;  4MBK A;  1JWP A;  1ZC2 A;  4E3J A;  4PM9 A;  4RQ9 A;  4U0T A;  3MJQ A;  1SZV A;  4IJG A;  1S1Z A;  4MBH A;  3VE4 A;  3BEC A;  3KSG A;  3BEB A;  1OTE A;  2RCX A;  1ONG A;  1H5X A;  2UV0 E;  3E4O A;  1WYB A;  1GSV A;  1BLH A;  3HRE A;  1XA7 A;  1E25 A;  1SCW A;  3H82 B;  3G6O A;  1ES4 A;  3RXX A;  3FKV A;  4OPY A;  4Y5F A;  1MPL A;  2JKR I;  4OQI A;  1JTG A;  5K5B A;  2H0Y A;  5FEF A;  2VKS A;  3NJA A;  4F94 A;  1G6O A;  1P97 A;  3LR3 A;  1PI5 A;  3CHW P;  1BLC A;  3BLS A;  3NDE A;  3W4O A;  2H10 A;  1PZP A;  5A90 A;  3U4L P;  4O7D A;  4PM8 A;  3C30 A;  5DTK A;  4IVK A;  1NRJ A;  4EQ1 A;  5HWT A;  2WGW B;  4EWF A;  2VGL S;  3N6I A;  1XP4 A;  3V50 A;  3ULF A;  1TEM A;  3WS0 A;  3IX8 A;  3MZE A;  4OVD A;  4U0X A;  1K54 A;  4PKY G;  3NOP C;  3OZH A;  3OCL A;  1LSV A;  3LIC A;  1OPX A;  1H8Z A;  2EX9 A;  2E8J A;  2MJ6 A;  1YLZ A;  2ZBB A;  2OLV A;  2XDM A;  4Y0T A;  3P98 A;  5HWV A;  4I3J A;  4S2N C;  3W2Z A;  4G3V A;  5TGF A;  5EVI A;  2OWH A;  1TS8 A;  4JF6 A;  1VEU A;  1JWZ A;  4I3I A;  1IFQ A;  1VM1 A;  5L8M A;  5A92 A;  4WEK A;  3P09 A;  1FQG A;  1LT0 A;  5DJU A;  3HUM A;  2Y2N A;  5HAP A;  3DAV A;  5FI2 A;  1PWG A;  4MBF A;  5L10 A;  1XA1 A;  5FQ9 A;  4Y0U A;  1CK3 A;  2O9B A;  4QHC A;  3WS5 A;  2ZC7 A;  2ZL1 A;  3ZHH A;  3ZG8 B;  3MS6 A;  2E8I A;  3IXD A;  1G5U A;  2PYP A;  3HLW A;  5EVL A;  3LEZ A;  2VJW A;  4L0L A;  3ZDJ A;  4K08 A;  2Y91 A;  3H7W B;  2XLN A;  4JKT A;  5L2F A;  3T4J A;  3G2Z A;  5HDS A;  2CMN A;  3SS4 A;  2XFT A;  4UEY A;  5EEC A;  3T4S A;  4DJ2 A;  3LFV A;  4D2O A;  4Q0H A;  5HAQ A;  5BOH A;  3MQO A;  5HSQ A;  1IYP A;  3I7J A;  3O86 A;  3Q82 A;  2D02 A;  1WA9 A;  1GHM A;  1K55 A;  1ES3 A;  2JKG A;  4BEN A;  2D01 A;  2ZQ7 A;  4ESP A;  4OLD A;  4OH0 A;  3MFD A;  5CRF A;  3UDI A;  3VP3 A;  3LEQ A;  2P04 A;  5D3O A;  3GEC A;  4L9E A;  1YMX A;  3MZF A;  1SKO A;  2VA0 A;  4CLC A;  3ICY A;  2W1T B;  2Y2I A;  4O8G A;  4Q0I A;  3T4O A;  2QJ7 A;  3D4F A;  5L09 A;  1NRF A;  1MXO A;  3TOI A;  3HLG A;  3FPW A;  1DP6 A;  4RVA A;  5DTT A;  4EBN A;  4R6L A;  4LV2 A;  3ZG7 B;  2HZ5 A;  3OPH A;  2UWX A;  1XXM A;  1XJ6 A;  5JYP A;  2PT7 A;  4ZTK A;  3VOZ A;  5FA7 A;  3PYP A;  3UE0 A;  4JGO A;  1NXY A;  1Q2P A;  3RXW A;  4OOM A;  3MFX A;  1W5D A;  3PAG A;  4N1X A;  4JF4 A;  4OQH A;  3UB8 A;  2Y55 A;  4ZJ2 A;  1OJG A;  4Y3I A;  2HDR A;  1ZTU A;  4I39 A;  1K0K A;  3QP4 A;  1G6A A;  4Z1W A;  1IKG A;  5EOE A;  4BBV A;  3ZG5 A;  5A8B A;  1OT6 A;  4BL2 A;  2J80 A;  5E2E A;  3DTE A;  5DF7 A;  3RFB A;  3UE1 A;  5M1A A;  5GHY A;  3BFC A;  4ZBE A;  3WS1 A;  1GSW A;  4JGR A;  2LB9 A;  4OPR A;  5GHZ A;  4OQ0 A;  5HD5 A;  2XSS A;  4GHI B;  3QP6 A;  4GD6 A;  2HF6 A;  1STZ A;  1W63 Q;  2V1A A;  5LBR A;  1Y4O A;  4Y0O A;  2FFY A;  5EM1 A;  4LRY C;  3UPN A;  2QYB A;  3A3F A;  5FQK A;  5G18 A;  3B3X A;  1CQA A;  1YAX A;  3BFF A;  4UAA A;  3LIB A;  3S7N A;  4JGP A;  3MMH A;  2ZD8 A;  3B47 A;  4B9O A;  2Q9N A;  4HQA A;  4JF5 A;  2QPN A;  1KGF A;  2Y2J A;  1F9I A;  1PNE A;  1PYY A;  4XT2 A;  4OOY A;  1G68 A;  4I38 A;  3PHY A;  2ZQC A;  4PM6 A;  1CJF A;  4OKP A;  4WL9 A;  1FOF A;  2Q0O A;  1BZA A;  1L0F A;  2Y2M A;  4KZ6 A;  4O0P A;  2G2U A;  4Y17 A;  4JGQ A;  1ZKJ A;  1GHI A;  2W3F A;  3ZFZ A;  3KSF A;  4LCM A;  5L07 A;  3DWK A;  4WZ4 A;  3V5M A;  3UY6 A;  1VET A;  1EI5 A;  4QWO A;  4S2L A;  3HL9 A;  3Q81 A;  4KZ7 A;  2YKF A;  4N1H A;  3NCK A;  5FQJ A;  2EX2 A;  4PM7 A;  1S4R A;  4LPZ A;  1KVM A;  3Q7V B;  3AGE A;  3WS4 A;  3HBR A;  3N8R A;  2Y79 A;  1DY6 A;  4JXV A;  2M7U A;  2G7U A;  5G4Y A;  3M2K A;  1PZO A;  2XRO A;  4KEN B;  1ZG6 A;  5A93 A;  3T1S A;  4X55 A;  1MWU A;  4HEF A;  4PM5 A;  2X01 A;  1DP8 A;  2JC7 A;  1KGG A;  4HIA A;  3MKF A;  3LCE A;  1T1B A;  1XGI A;  4DE2 A;  3EGD C;  5IS1 A;  1SHV A;  2Z2L B;  5CHU A;  1EWZ A;  3DBA A;  5FQI A;  1JWV A;  2BAS A;  3A3D A;  5CED A;  1A0K A;  1IOU A;  2OOL A;  1O07 A;  4FD8 A;  4HP4 A;  2O99 A;  2WKR A;  5U47 A;  4HP9 A;  3FC7 A;  1K54 C;  3T1Q B;  3VOL A;  3LR0 A;  1F2K A;  5JYO A;  1AWI A;  3PTE A;  2Y2H A;  4UA6 A;  4ARZ A;  5AVF A;  4X68 A;  2H0T A;  2JE5 A;  1IYS A;  1OTB A;  1YPR A;  3GR2 A;  1D06 A;  4XUZ A;  3CIT A;  4C6Y A;  3BLM A;  5FSR A;  4L9F A;  2GZA A;  1TS7 A;  3C4O A;  2W3G A;  1T1C A;  4FOF A;  3S7O A;  2NUP C;  4LGW A;  1K6R A;  4YIN A;  1OJ5 A;  2J3T C;  1NYY A;  2P08 A;  2ZM0 A;  1YM1 A;  1OTD A;  4RYE A;  5EVI B;  3VE3 A;  3FG8 A;  2L0W A;  1VEU B;  4GS9 A;  1Z6F A;  3OOV A;  4GCZ A;  5HPF A;  4RX2 A;  1L3L A;  1JTD A;  2BTF P;  2ZOI A;  2GNX A;  1YSQ A;  4YNR A;  3GTC A;  5J4E A;  3V3S A;  5DTS A;  3DW0 A;  2XFS A;  2FZ0 A;  1JNU A;  2ZL1 B;  1TS6 A;  2JKT M;  2ZQ8 A;  1FIK A;  3JYI A;  3HJI A;  4OOL A;  4EBP A;  1HTZ A;  3BQ8 A;  2WKI A;  3JVV A;  4X6T A;  4MEZ A;  4MN7 A;  3UN7 A;  4LV0 A;  2Y2P A;  2XD5 A;  5CEC A;  3IX3 A;  3ZQ5 A;  4DRT A;  3C4P A;  3ZG9 B;  3LY3 A;  4X1L A;  3GV9 A;  2WGI A;  2WGV A;  1KDW A;  1K55 C;  3GQZ A;  3KYZ A;  2PAV P;  2QMI A;  3G35 A;  1J3W A;  4MNR A;  1HD8 A;  3EGX C;  3L7H A;  4E6X A;  5FAP A;  3BRM A;  5EFW A;  3F1P A;  3ISG A;  5EUA A;  4GKU A;  4E3O A;  4P6Z M;  4DE3 A;  1K38 A;  4X69 A;  1KE4 A;  5F83 A;  3F1O A;  3IWI A;  4NG2 A;  1XFN A;  4MN5 A;  2XK1 A;  4P6B A;  4R4S A;  1GA9 A;  4UQI S;  1IYQ A;  1IEL A;  3LYX A;  4HBU A;  3RJU A;  3S7Q A;  5F82 A;  3P7N A;  1SKO B;  3ZVW A;  3C8C A;  5DVA A;  3V39 A;  4MLL A;  3HLC A;  5HL1 A;  1DJB A;  3CG5 A;  2ZQD A;  5HPI A;  3E4Q A;  2ZQA A;  1W8Q A;  3UME A;  3VMA A;  1ODV A;  4H6J A;  1W79 A;  4Y15 A;  1YMS A;  4KQQ A;  3M6B A;  4CQH A;  3UPO A;  3KSI A;  4HJ6 A;  2C5W B;  2V1B A;  2XA7 M;  3EWK A;  5CXW A;  3NUL A;  2ZC3 B;  1YLP A;  3FWL A;  4P85 A;  3G30 A;  4MCW A;  4QD4 A;  3C38 A;  4QY5 A;  3CUE C;  3T1X A;  3FV7 A;  2B5R A;  5J7E A;  2XH9 A;  3WS2 A;  3E4P A;  4R0Q A;  4Z9Q A;  1EW0 A;  2J8Y A;  1XGJ A;  4U3T A;  3LIA A;  4PHT A;  1AXB A;  5AQB A;  2Y2O A;  3UE6 A;  2IWC A;  4QU3 A;  2EXA A;  2H28 A;  3DTI A;  1ESU A;  1LL9 A;  2PU4 A;  4GD8 A;  1OME A;  3JPU A;  3FYZ A;  4EW7 A;  2JCH A;  4FTX A;  1HVB A;  2EWW A;  2OV5 A;  4LV1 A;  5F69 A;  5HW3 A;  4KZ4 A;  2YKH A;  1WE4 A;  3KYE A;  3WWX A;  2ZJ9 A;  5AJG A;  3A3J A;  3PBO A;  1ERM A;  4DJ3 A;  2JKR M;  4XT2 B;  3O3V A;  1BYW A;  4N9L A;  1T18 A;  3OCN A;  3GRJ A;  4N92 A;  3KSH A;  2V2F F;  3HVF A;  4JBF A;  4FSF A;  2R78 A;  5EVE A;  5DFY A;  3VV4 A;  3TJZ C;  1ERQ A;  2ZLY A;  2W27 A;  5CGX A;  1N4O A;  4HJ3 A;  4XUX A;  1KGE A;  1Z09 A;  4WBG A;  4EU0 A;  1Q2Q A;  4I5S A;  3N4I A;  4IHQ A;  5CEB A;  4BJP A;  3IH8 A;  2V1Z A;  1VET B;  4M3K A;  2JN7 A;  4M4X A;  4ZAM A;  2QHK A;  4JXG A;  4OPZ A;  2QJ5 A;  2EXB A;  4ETZ A;  2P7J A;  5FEG A;  2B02 A;  2EX8 A;  5F6A A;  4DE1 A;  1K57 A;  2PRF A;  2NUT C;  3QP2 A;  3RTY A;  5IT5 A;  3SW1 A;  4Y13 A;  2HJ9 C;  4HBT A;  1YKD A;  5AQ7 A;  3V3R A;  3H9W A;  1OTA A;  4EV4 A;  2A24 A;  2H5S A;  3CPT A;  1I2W A;  1VB6 A;  4E04 A;  4WZ5 A;  2INW A;  4R23 A;  3IS2 A;  3D72 A;  3LGO A;  1U60 A;  2Z2M B;  5EE8 A;  1PW8 A;  1KDS A;  1BUE A;  2L1M A;  3A3E A;  4DXB A;  1K6S A;  5DF8 A;  4HNB A;  2ZC5 B;  3VP4 A;  1MZU A;  4XXR A;  3KO6 A;  3MBZ A;  4WN5 A;  1P0Z A;  2ZC4 B;  5M19 A;  2XF3 A;  3HJK A;  5GLD A;  1NZO A;  2FFF B;  1YT4 A;  4LV3 A;  1G28 A;  3LIE A;  2PYR A;  3PR6 A;  2OWJ A;  2KX6 A;  2WK0 A;  1GA0 A;  2BG1 A;  4UHU A;  4PPR A;  4ARZ B;  3BJN A;  1QME A;  2WGW A;  1IYO A;  3W4Q A;  3BWL A;  3W8K A;  2X02 A;  5KMW A;  1BLP A;  3BW6 A;  4X1M A;  1NZU A;  2J3T D;  5FL3 A;  4KQO A;  4NXE A;  4LRX C;  5FAT A;  4R3B A;  1DJC A; 
#chains in the Genus database with same CATH homology
 4S2O A;  5FAO A;  3BFE A;  4WZ5 C;  3HLF A;  1LI0 A;  2XD1 A;  3UPP A;  3C7V A;  1FR6 A;  2PBY A;  1O07 A;  2WKH A;  3Q7V A;  4FD8 A;  5IHV A;  4MBK A;  2Y4A A;  1I5Q A;  1CI8 A;  3UE3 A;  3O87 A;  2ZC6 B;  3IF6 B;  5U47 A;  2R9X A;  1JWP A;  1ZC2 A;  4E3J A;  5F1F A;  5FI7 A;  4PM9 A;  4DXC A;  1IKI A;  1CEF A;  1LHY A;  4U0T A;  1K54 C;  3NY4 A;  3LY4 A;  3SH7 A;  3PBT A;  3SS3 A;  4MBH A;  5JYO A;  1YLY A;  4S2P A;  1MWT A;  4QJG A;  4CJN A;  3PTE A;  3BEC A;  2XR0 A;  3BEB A;  3QNB A;  2Y2H A;  4UA6 A;  2RCX A;  4WEJ A;  1SKF A;  1ONG A;  1H5X A;  3PBR A;  1WYB A;  4RX3 A;  4X68 A;  3VOY A;  1BLH A;  3HRE A;  1BLS A;  2H0T A;  2OSU A;  1XA7 A;  2JE5 A;  1IYS A;  3GR2 A;  1GHP A;  1E25 A;  1PW1 A;  1SCW A;  4KZ8 A;  4XUZ A;  4C6Y A;  2WZZ A;  1L2S A;  3BLM A;  1ES4 A;  1XPB A;  1XX2 A;  4S2N A;  3G2Y A;  2DNS A;  3RXX A;  3FKV A;  2JBF A;  4OPY A;  5FSR A;  1MPL A;  5TFQ A;  1ONH A;  2HDQ A;  2X71 A;  3C4O A;  4LCL A;  1PI4 A;  4E6W A;  3GMW A;  4OPQ A;  4OQI A;  1JTG A;  1NYM A;  2IWB A;  2H0Y A;  3NDG A;  3VP2 A;  1K6R A;  4YIN A;  2BLS A;  4K0X A;  4F94 A;  4HES A;  1TVF A;  1C3B A;  1PI5 A;  3IF6 A;  3IH9 A;  3TSG A;  1NYY A;  4BL3 A;  4GB7 A;  1BLC A;  2ZM8 A;  2ZM0 A;  3N7W A;  1YM1 A;  1ZG4 A;  3BLS A;  4OON A;  3NDE A;  3W4O A;  4RYE A;  2H10 A;  5EVI B;  1PZP A;  3LO7 A;  4OQG A;  5A90 A;  4O7D A;  4FCF A;  4RA7 A;  4PM8 A;  3BM6 A;  5DTK A;  3VFF A;  3M6H A;  3PAE A;  4IVK A;  1Z6F A;  4BD1 A;  3CMZ A;  2DCF A;  2IWD A;  3E2K A;  4BD0 A;  2WGW B;  4EWF A;  4RX2 A;  2EFU A;  3G32 A;  3N6I A;  1XP4 A;  3HLE A;  3V50 A;  1JTD A;  4KZB A;  1TEM A;  3WS0 A;  3MZE A;  4OVD A;  4U0X A;  5HAR A;  3GSG A;  4IVI A;  1K54 A;  2HDU A;  3IXB A;  4X56 A;  5GLA A;  3OZH A;  3OCL A;  3EQU A;  3GTC A;  3V3S A;  5DTS A;  4KZ5 A;  1H8Z A;  2J9O A;  3BFD A;  2EX9 A;  3DW0 A;  2XFS A;  5TR7 A;  3W4P A;  5FAS A;  5A91 A;  4ZDX A;  2ZQ8 A;  4EBP A;  3JYI A;  4OOL A;  2DRW A;  4KQR A;  1HTZ A;  3OPR A;  1BUL A;  5FI6 A;  1YLZ A;  1L0E A;  1RGY A;  1YLJ A;  4GDN A;  2OLV A;  2XDM A;  4YFM A;  5CTN A;  4Y0T A;  2XQZ A;  3OC2 A;  4JPM A;  2WKI A;  3P98 A;  1MWR A;  4OLG A;  4MEZ A;  4S2N C;  4X6T A;  4LEN A;  4LV0 A;  3UN7 A;  3UO9 A;  2Y2P A;  5CER A;  5TGF A;  3IHA A;  2XD5 A;  5EVI A;  2Q9M A;  4IBR A;  4P87 A;  5EVI D;  4GZB A;  4JF6 A;  5CEC A;  4DDS A;  1JWZ A;  3CZD A;  5HFO A;  3C4P A;  3ZVT A;  4DRT A;  3FZC A;  3ZG9 B;  3LY3 A;  3GV9 A;  1VM1 A;  3O88 A;  2WGI A;  2EX6 A;  3C5A A;  1I2S A;  5A92 A;  2WGV A;  1KDW A;  4WEK A;  4C75 A;  1K55 C;  2HP5 A;  3GQZ A;  4MNR A;  4ZJ1 A;  2QMI A;  1FQG A;  3G35 A;  3P09 A;  1HD8 A;  3HUM A;  2Y2N A;  4E6X A;  5HAP A;  5FAP A;  5FI2 A;  1PWG A;  3BRM A;  4JXS A;  4MBF A;  3ISG A;  5DF9 A;  1XA1 A;  5EUA A;  4Y0U A;  1CK3 A;  4WMC A;  5FQ9 A;  4GKU A;  4E3O A;  4DE3 A;  4QHC A;  3WS5 A;  4WMC D;  2QZ6 A;  2ZC7 A;  4E3N A;  3WRZ A;  1K38 A;  1KE4 A;  4X69 A;  2V20 A;  5F83 A;  3IWI A;  4KZ3 A;  3ZHH A;  2J9P A;  3UDX A;  3PBS A;  2OLU A;  3ZG8 B;  2XK1 A;  4P6B A;  3AGF A;  4WEL A;  1MKI A;  2E8I A;  4PMA A;  4R4S A;  2WKE A;  3IXD A;  1GA9 A;  3HLW A;  1RGZ A;  5EVL A;  1IYQ A;  3ZG0 A;  3LEZ A;  1IEL A;  3SH8 A;  4L0L A;  4UA9 A;  3ZDJ A;  3G4P A;  1L0G A;  4HBU A;  3RJU A;  1KE0 A;  2Y91 A;  3IWQ A;  2XLN A;  2HP6 A;  3FKW A;  3OPL A;  5CHJ A;  1BT5 A;  4JKT A;  5L2F A;  1LI9 A;  1JVJ A;  5F82 A;  4E3L A;  1QMF A;  3ZVW A;  3VSL A;  5DVA A;  3V39 A;  3G2Z A;  3HLD A;  4MLL A;  3HLC A;  3SS4 A;  5HL1 A;  1DJB A;  2XFT A;  3CG5 A;  5EEC A;  2ZQD A;  5FQM A;  3QHY A;  4D2O A;  3GVB A;  3TG9 A;  2HPB A;  4KG6 A;  2ZQA A;  5HAQ A;  3ITA A;  3IF5 A;  5BOH A;  3PBN A;  5GLB A;  1IYP A;  1W8Q A;  5EVI C;  2WUQ A;  2EFX A;  2I72 A;  3I7J A;  3O86 A;  3VMA A;  3IQA A;  3Q82 A;  5HAI A;  1J9M A;  1W79 A;  3MXR A;  3G31 A;  3VP0 A;  1YMS A;  1GHM A;  1K55 A;  1ES3 A;  2HDS A;  4KQQ A;  4BEN A;  3VSK A;  2ZQ7 A;  4OLD A;  3M6B A;  4OH0 A;  3MFD A;  5CRF A;  3UDI A;  2P74 A;  3VP3 A;  1IEM A;  3UPO A;  1WYC A;  2C5W B;  4ID4 A;  5FAQ A;  4E3M A;  5D3O A;  5KSH A;  3IXH A;  5CXW A;  4S2K A;  2A3U A;  2P9V B;  1YLP A;  2ZC3 B;  1BTL A;  1YMX A;  3MKE A;  3NI9 A;  3EQV A;  5GHX A;  5CGW A;  3MZF A;  3FWL A;  4KG5 A;  4NET A;  4E3I A;  4P85 A;  3G30 A;  1ES5 A;  4QD4 A;  5FDH A;  4QY5 A;  4GOG A;  4FH4 A;  1FSY A;  2Y2I A;  4ZJ3 A;  4S2I A;  1K25 A;  3D4F A;  3FV7 A;  1NRF A;  2B5R A;  2XH9 A;  1MXO A;  3TOI A;  4CPK A;  3HLG A;  5CGS A;  3WS2 A;  4X53 A;  3PBQ A;  4RVA A;  5DTT A;  5AQA A;  4EBN A;  1CI9 A;  1KVL A;  4H8R A;  4LV2 A;  4R0Q A;  4Z9Q A;  3ZG7 B;  2J8Y A;  2CC1 A;  5KSC A;  1XGJ A;  2ZQ9 A;  3OPH A;  2UWX A;  1XXM A;  5JYP A;  5M18 A;  1ESI A;  3Q7Z A;  4U3T A;  5EPH A;  4ZTK A;  4GDB A;  3MXS A;  3WRT A;  2Y2K A;  3VOZ A;  5FA7 A;  1PWD A;  3UE0 A;  1O7E A;  1AXB A;  1HZO A;  2G2W A;  5AQB A;  1FCO A;  2Y2O A;  3ZGA B;  4A5R A;  4BQM A;  4DDY A;  1NXY A;  2IWC A;  3BYD A;  1Q2P A;  4KG2 A;  4FH2 A;  4QU3 A;  4OOM A;  3RXW A;  3UDF A;  3PAG A;  1W5D A;  1K56 A;  2EXA A;  1ESU A;  1LL9 A;  1K56 D;  2P9V A;  2PU4 A;  3M2J A;  4N1X A;  4JF4 A;  4OQH A;  4GD8 A;  2ZM2 A;  2Y55 A;  4ZJ2 A;  1FCN A;  1OME A;  1KE3 A;  3FYZ A;  2R9W A;  2HDR A;  2JCH A;  3E2L A;  1HVB A;  2OV5 A;  1MBL A;  3ITB A;  4LV1 A;  1S6R A;  5HW3 A;  1E4D A;  1RP5 A;  4UA7 A;  1G6A A;  4KZ4 A;  1TDG A;  4QY6 A;  1IKG A;  1K57 C;  5EOE A;  3N8L A;  3ZG5 A;  2XEP A;  1WE4 A;  3WWX A;  4BL2 A;  5E2E A;  2ZMA A;  2ZJ9 A;  3S1Y A;  3A3J A;  5DF7 A;  3UE1 A;  4BLM A;  1S0W A;  3PBO A;  5M1A A;  5GHY A;  1ERM A;  3DTM A;  4DE0 A;  5CTM A;  4QB8 A;  3BFC A;  3MZD A;  3S22 A;  4DF6 A;  5I94 A;  1YLW A;  4ZBE A;  4OP5 A;  3O3V A;  4N9L A;  3WS1 A;  1CEG A;  3OCN A;  3GRJ A;  4N92 A;  3DWZ A;  2V2F F;  4OPR A;  5GHZ A;  4OQ0 A;  3HVF A;  3SH9 A;  4JBF A;  4R4R A;  4FSF A;  4JXW A;  3IT9 A;  1K4E A;  3BFG A;  3SS5 A;  4GD6 A;  1ERQ A;  4Y0O A;  2ZLY A;  3HUN A;  4WM9 A;  5CGX A;  5F1G A;  2FFY A;  1N4O A;  2Y2Q A;  3ZNT A;  3UPN A;  1ALQ A;  2VGJ A;  1MWS A;  4XUX A;  3A3F A;  1KGE A;  4WBG A;  4JLF A;  5EOO A;  5FQK A;  1BSG A;  5G18 A;  3NIA A;  2VGK A;  4EBL A;  3NC8 A;  3B3X A;  3C7U A;  2Y59 A;  3SOI A;  1Q2Q A;  4WYY A;  1FCM A;  3N4I A;  3BFF A;  4UAA A;  5CEB A;  4BJP A;  3IH8 A;  4C3Q A;  1YQS A;  2GDN A;  1LL5 A;  1L0D A;  4B88 A;  2C6W B;  2V1Z A;  2ZD8 A;  3A3I A;  4M3K A;  5AQ9 A;  2Q9N A;  4KZA A;  4R3J A;  4JF5 A;  3S4X A;  4ZAM A;  2QPN A;  3UNW A;  1KGF A;  4JXG A;  4NK3 A;  1W8Y A;  4P0M A;  4OPZ A;  1PIO A;  1FSW A;  2Y2J A;  3AGD A;  5E43 A;  5CHM A;  2EXB A;  1PYY A;  5E2H A;  1M40 A;  2EX8 A;  4OOY A;  3HLB A;  1H8Y A;  1G68 A;  1N9B A;  1ES2 A;  1K4F A;  4DE1 A;  1K57 A;  3Q07 A;  2WAD A;  1XKZ A;  2ZQC A;  4PM6 A;  4EQI A;  4OKP A;  1FOF A;  2Y2M A;  1BZA A;  1L0F A;  4KZ6 A;  5E2G A;  3VFH A;  3VP1 A;  2J7V A;  1W7F A;  2G2U A;  4HBT A;  1ZKJ A;  5AQ7 A;  3V3R A;  2Y2L A;  1GHI A;  1YLT A;  2WAF A;  3ZFZ A;  4EV4 A;  5J8X A;  2H5S A;  1Y54 A;  4LCM A;  1M6K A;  3DWK A;  4WZ4 A;  4KZ9 A;  1I2W A;  3V5M A;  2Y2G A;  4Y7P A;  1NY0 A;  3UY6 A;  4IED A;  4WZ5 A;  1EI5 A;  4S2L A;  3HL9 A;  1SDN A;  4R23 A;  3Q81 A;  4E3K A;  3N8S A;  4KZ7 A;  4B4X A;  5GLC A;  1U60 A;  2Z2M B;  4S2J A;  3IXG A;  3G34 A;  4IBX A;  5EE8 A;  4K0W A;  4N1H A;  1PW8 A;  1KDS A;  3IHB A;  4B4Z A;  3NCK A;  1BUE A;  5GL9 A;  5FQJ A;  1VQQ A;  2EX2 A;  4PM7 A;  3A3E A;  4DXB A;  1ERO A;  3OPP A;  1K6S A;  4S2M A;  1KVM A;  1E3U A;  5DF8 A;  4N9K A;  3QNC A;  3Q7V B;  1E3U D;  2ZC5 B;  3AGE A;  3HBR A;  3Q1F A;  3VP4 A;  3WS4 A;  3N8R A;  4GN2 A;  2WYX A;  4XXR A;  1DY6 A;  1GCE A;  2A49 A;  4Q8I A;  4JXV A;  3NBL A;  3MBZ A;  1TDL A;  3M2K A;  1PZO A;  2ZC4 B;  1SDE A;  4KEN B;  1ZG6 A;  5M19 A;  2XF3 A;  5GLD A;  2RL3 A;  4K91 A;  1NZO A;  4X55 A;  1MWU A;  5A93 A;  4GNU A;  2FFF B;  1FR1 A;  1YT4 A;  4LV3 A;  1NJ4 A;  2XGN A;  3ZNY A;  2WK0 A;  1PWC A;  4HEF A;  4PM5 A;  1GA0 A;  2X01 A;  2JC7 A;  2BG1 A;  2WZX A;  1KGG A;  4PPR A;  4UHU A;  5KZH A;  2HP9 A;  1QME A;  3ZCZ A;  4R1G A;  4DKI A;  2WGW A;  1MY8 A;  2PU2 A;  3MKF A;  3IWO A;  1IYO A;  3LCE A;  1DJA A;  5HX9 A;  3W4Q A;  5FQQ A;  1XGI A;  4DE2 A;  1LLB A;  3HUO A;  3W8K A;  2X02 A;  5KMW A;  1SHV A;  5E2F A;  1BLP A;  2Z2L B;  3IF6 C;  1NZU A;  1RCJ A;  5CHU A;  4KQO A;  4EUZ A;  1EWZ A;  5FAT A;  5FQI A;  1JWV A;  4OP8 A;  3A3D A;  2WAE A;  3CJM A;  5CED A;  4R3B A;  1DJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...