1TDLA

Structure of ser130gly shv-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor-resistant class A beta-lactamases: consequences of the Ser130-to-Gly mutation seen in Apo and tazobactam structures of the SHV-1 variant
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1tdlA00
3ZFZA 1IYQA 1LI9A 4GDBA 4JPMA 5FQIA 3HVFA 1JTGA 2ZC4B 1FCOA 4Q8IA 2Y55A 3BRMA 3ZNTA 1N9BA 4FSFA 1YLJA 1K55C 3GSGA 3C7UA 1J9MA 3N8RA 3M2JA 1C3BA 4EBPA 4LV0A 5G18A 3GV9A 2XFTA 4JF4A 1KVMA 3TSGA 3UE0A 5KZHA 3HLDA 1GA0A 1CEFA 4BD0A 1BLHA 3P98A 3HLGA 2ZQ8A 3IWQA 3G34A 5EVID 4LV2A 2WZXA 2HDRA 1S6RA 3V39A 1H8ZA 5FI2A 3QNCA 4HEFA 1TDLA 3SS5A 3MKEA 3IF6A 3VP1A 1Q2PA 3NY4A 3ZVWA 5U47A 3BECA 4PM8A 3HREA 2H0TA 2PBYA 4S2NC 3IT9A 4WELA 5FQ9A 2X01A 3VSLA 4BD1A 2VGKA 4OPYA 3IF5A 4X68A 2FFYA 1XXMA 1L0DA 2ZJ9A 4O7DA 4EBNA 2RL3A 4GB7A 1KDSA 2R9WA 1YLPA 2QMIA 4PM6A 5FQQA 4PM5A 4ZTKA 5HAPA 5HAQA 1K25A 2WAEA 4IBRA 3GVBA 2PU2A 5HX9A 4FH2A 1TVFA 5FAQA 1MWTA 3S22A 3BFCA 3WS5A 1XGIA 3IWOA 3PAGA 4QJGA 1QMFA 1KE4A 4OONA 1MPLA 5FDHA 3ZG9B 4BLMA 3VSKA 4IVKA 3PBNA 4U0XA 1EWZA 3Q07A 2Y2LA 3LEZA 1EROA 2IWDA 3DWZA 4E3OA 4X55A 4R0QA 2Y59A 1FSYA 2R9XA 4KQOA 1NY0A 4KQQA 4S2NA 4WZ5A 5GHXA 4IEDA 2XH9A 2HDSA 1O7EA 4DE2A 3N6IA 4OLDA 2QZ6A 1LL9A 1LL5A 1XKZA 3A3FA 4YINA 4KZ4A 2XGNA 1SDEA 4OQIA 3HLCA 2IWCA 2EX6A 3G30A 2UWXA 3A3EA 1JTDA 1PZOA 4FH4A 4KG2A 3Q1FA 1YQSA 5GLAA 1BT5A 1HZOA 3OPPA 2ZC7A 1DY6A 2XEPA 3N7WA 2WYXA 3A3DA 3QHYA 5GL9A 3HLEA 2J7VA 5AQ9A 4E3IA 3UNWA 1PWDA 2J9PA 3HLBA 1FCNA 5IHVA 4ZDXA 4L0LA 1KGFA 4JLFA 3OCNA 1QMEA 4BL2A 3HLWA 2XF3A 4C6YA 4LV3A 2XR0A 1XA7A 4IBXA 1ERMA 4ZBEA 4MBHA 3PBRA 4R23A 1ALQA 3WS1A 4RX3A 3DTMA 3AGEA 2Y2HA 2H5SA 4OQGA 3VP2A 1RCJA 3N8SA 4P0MA 3DW0A 1IELA 3NBLA 4DE3A 5CTMA 1CI8A 3UDXA 2G2UA 2HP5A 2OV5A 1L0GA 3UPNA 4E3NA 1PWGA 5CERA 3IQAA 3MKFA 1NJ4A 1PYYA 4UAAA 4KG5A 5F82A 4RYEA 5FQMA 1I2SA 5CEBA 5A92A 1K56D 2ZQDA 4MBKA 3PBOA 2P9VB 4Y0OA 5D3OA 3BM6A 1ZG4A 1G6AA 4WM9A 3WRTA 1LI0A 1VQQA 1GHIA 4K0WA 1L0FA 4N9KA 1PW1A 1RGZA 3RXXA 3JYIA 1KE0A 1O07A 3M6HA 1RP5A 1G68A 2C5WB 1M6KA 1NXYA 3M6BA 4CPKA 4P85A 5CHMA 4OP8A 4E3KA 5CXWA 1E3UD 3IF6C 3Q7VA 1DJCA 2WK0A 5CHUA 5M1AA 1PI4A 4LENA 1NZOA 5EUAA 3ZNYA 1NYMA 3LCEA 5JYPA 5FA7A 3FYZA 1K4FA 1KVLA 3OZHA 5FASA 4DXBA 2ZC3B 4B4ZA 4D2OA 3S1YA 4S2KA 2JE5A 1WE4A 2WKHA 3UN7A 3SOIA 3IHBA 4R1GA 2B5RA 4FCFA 1IYSA 4ZJ3A 3BFFA 4JXWA 5EVLA 1XA1A 2EX2A 5DF8A 5DF9A 3WRZA 3W4OA 3W8KA 4EWFA 2J9OA 3OPLA 4S2OA 3NCKA 3NI9A 1WYBA 4OPQA 5CTNA 4A5RA 5E2GA 2WADA 1FR6A 4WBGA 3BFDA 4JBFA 3VP4A 5CGSA 1KGEA 5FQKA 3OCLA 1K55A 4S2IA 3ZHHA 4DXCA 1XX2A 5FSRA 3NDEA 4LCMA 5EVIA 2H0YA 1MXOA 5CGWA 2WGVA 2XD5A 2ZLYA 2X02A 3Q7VB 3ISGA 3UDIA 5GLDA 1JWZA 4P87A 4PM7A 5HAIA 1PIOA 3UO9A 4X69A 3UY6A 3MFDA 1YT4A 1Z6FA 4OLGA 4KQRA 5FAOA 2ZM0A 2V1ZA 5FAPA 2ZM8A 3O87A 3A3JA 1KE3A 1E25A 3I7JA 1K6RA 4S2MA 2XK1A 4OP5A 4Z9QA 4DE1A 3WS0A 2WKEA 5EE8A 2EXAA 4EUZA 3Q81A 1U60A 5TR7A 1ESIA 3DWKA 1YMSA 2XQZA 4DKIA 3G2YA 4LCLA 5HL1A 1MWRA 4HBTA 3MXRA 1W7FA 2FFFB 4OQ0A 4R3BA 1ES2A 4OOYA 3ZG8B 2ZC5B 2ZMAA 4N1HA 4JXGA 1K38A 4NK3A 2I72A 2HDUA 4N9LA 3V3RA 3SH8A 4X6TA 1CEGA 3IH8A 1W79A 1YLZA 4K91A 4XXRA 1KGGA 2EFUA 2V2FF 3SH7A 1ONHA 2ZQ9A 2Y2PA 4Y0TA 1BLPA 3CG5A 3ZG0A 1XGJA 5F1FA 2J8YA 4MBFA 3ZG7B 5TGFA 5A91A 1FR1A 4OKPA 3ZG5A 2DCFA 4HESA 5A93A 2HP6A 4U0TA 3UE3A 5F83A 3LY3A 4JXVA 3FKVA 3HUNA 4Y7PA 5AQ7A 4WMCD 3MZDA 2WKIA 3ZCZA 3VFFA 1GA9A 1RGYA 2H10A 1MKIA 4C3QA 2Z2LB 1CI9A 1TEMA 3SH9A 3FKWA 2WUQA 1JWVA 5E2HA 4QB8A 3A3IA 3OC2A 3ITBA 3HL9A 4BJPA 4OQHA 3UDFA 2XD1A 4KZ3A 5KMWA 1K4EA 4OVDA 3ITAA 1VM1A 1SCWA 3UE1A 3OPRA 1SHVA 1K54A 2E8IA 4XUZA 2A49A 1Q2QA 5GLCA 3TG9A 2Y2IA 3GQZA 1L2SA 4KZ9A 1DJBA 2V20A 5DF7A 1HD8A 3CZDA 2C6WB 3FV7A 3CMZA 3PTEA 2Y2NA 4ID4A 4N1XA 5EECA 3IWIA 1DJAA 1IEMA 4ZJ1A 4QY5A 3CJMA 4WZ4A 1YMXA 3HLFA 1M40A 1XPBA 3G31A 3NC8A 3G4PA 3SS3A 3WWXA 4UA6A 5AQAA 1K6SA 4S2PA 3UPOA 3C7VA 2ZQ7A 3FZCA 4JF6A 4P6BA 4QHCA 1HVBA 3UPPA 2A3UA 3NIAA 4WYYA 1W8QA 2EFXA 4N92A 1SKFA 4KENB 4GDNA 2OLUA 4JKTA 1LHYA 4RVAA 1NZUA 3GMWA 4R3JA 2ZQAA 4BL3A 2VGJA 4GZBA 3SS4A 1AXBA 5DTKA 4OPRA 3Q82A 2XLNA 3MZFA 4WMCA 5AQBA 4QU3A 2RCXA 2WGIA 5E2FA 4UHUA 3QNBA 1ES5A 3Q7ZA 1BSGA 1I5QA 4JXSA 4E6XA 1FOFA 5E2EA 4QY6A 4JF5A 1N4OA 5GHZA 1IYOA 3BFGA 2WGWB 3E2LA 3O86A 4UA7A 1K57C 4OOMA 3PAEA 4FD8A 3G2ZA 5DTTA 4EBLA 2Y91A 2XFSA 4E6WA 3FWLA 1K57A 4GOGA 4EV4A 5CECA 1JVJA 5M19A 1MY8A 4KZ6A 3D4FA 5M18A 2ZM2A 1E3UA 1IKIA 1ES3A 4XUXA 1BULA 3BLSA 3E2KA 5EPHA 4ZAMA 2HDQA 4OOLA 4PM9A 4YFMA 5J8XA 4B88A 3O3VA 3BEBA 4U3TA 1HTZA 2BG1A 4BENA 3O88A 3M2KA 1PWCA 3IHAA 4EQIA 1YLWA 2JC7A 1YM1A 3OPHA 1PI5A 4S2LA 4GKUA 1S0WA 2WAFA 2WGWA 5JYOA 4IVIA 1Y54A 3LY4A 4E3JA 4HBUA 2EX9A 1MBLA 1SDNA 3VFHA 5HARA 4GN2A 1YLTA 2P74A 4WEJA 4KZBA 3ZVTA 4RA7A 3IXBA 5HFOA 3V5MA 3P09A 3GTCA 1W8YA 3HUOA 1EI5A 4X56A 2Y4AA 2OSUA 2EXBA 3IH9A 2IWBA 1K54C 3IXDA 3HBRA 4GD6A 4LV1A 3C4PA 4KZ7A 3EQVA 1IYPA 1NRFA 1ONGA 1TDGA 4WZ5C 3VMAA 5HW3A 3W4QA 5I94A 4WEKA 4OH0A 3MZEA 4KZ8A 5CRFA 3S4XA 4C75A 5FI7A 4E3LA 5L2FA 5F1GA 1BLSA 1ESUA 1W5DA 3IXGA 2CC1A 3AGDA 1H8YA 3BLMA 3EQUA 4MLLA 3BFEA 2X71A 1H5XA 4DDYA 5TFQA 3BYDA 4Y0UA 2Q9NA 5GHYA 4OPZA 3C5AA 4K0XA 4KZAA 5BOHA 3PBSA 1PZPA 3LO7A 1NYYA 1GHPA 2Y2QA 3VOZA 5EOOA 4DF6A 2GDNA 4R4RA 4DE0A 4E3MA 4S2JA 1E4DA 1ES4A 3ZGAB 4X53A 4M3KA 5FI6A 3WS4A 4RX2A 3VOYA 4GD8A 1LLBA 1GCEA 1WYCA 2ZQCA 4PPRA 2Y2OA 1ZKJA 3W4PA 1BUEA 2DNSA 4NETA 5KSHA 2Y2KA 5DTSA 2WZZA 1L0EA 3GRJA 3MXSA 3N8LA 3IXHA 5CGXA 1K56A 4F94A 2G2WA 1KDWA 3V50A 1IKGA 3G32A 4QD4A 2HPBA 1FQGA 4CJNA 4DDSA 1GHMA 2EX8A 4ZJ2A 3ZDJA 2PU4A 3V3SA 3GR2A 2JBFA 3C4OA 2Y2GA 1I2WA 2QPNA 4MEZA 1FSWA 4BQMA 2XDMA 1BTLA 1CK3A 3G35A 4KZ5A 5KSCA 4B4XA 3B3XA 2Z2MB 1MWSA 1OMEA 5GLBA 3AGFA 3VP0A 2BLSA 3RJUA 2DRWA 4MNRA 5EOEA 1ZG6A 4DRTA 1XP4A 3MBZA 2P9VA 5CEDA 3RXWA 5FATA 3PBTA 4UA9A 1YLYA 4KG6A 2Y2MA 3N4IA 3NDGA 2Y2JA 3PBQA 5CHJA 3TOIA 2Q9MA 5EVIC 5DVAA 1BLCA 5EVIB 1ZC2A 1BZAA 1FCMA 3VP3A 4R4SA 2OLVA 2ZC6B 2ZD8A 5FQJA 3WS2A 4GNUA 1MWUA 1ERQA 4PMAA 5E43A 1JWPA 3HUMA 2HP9A 2JCHA 4H8RA 5A90A 1PW8A 3IF6B
chains in the Genus database with same CATH superfamily
2KLIA 3ZFZA 1IYQA 3CUEA 4JPMA 3HVFA 2OAQ1 2Y55A 3S7PA 1N9BA 4FSFA 2W3HA 4Q0JA 3K3DA 1J9MA 4CLCD 3BWLA 5G18A 3MQ0A 5KZHA 4NXFA 4BD0A 2ZQ8A 5EVID 4LV2A 2PBDP 4WUJA 4HEFA 3MKEA 3IF6A 3VP1A 3NY4A 5HL6A 4AFIA 4PM8A 3LR5A 3A0RA 3IT9A 4WELA 2X01A 3VSLA 2HGVA 3CPTA 2YKFA 2R9WA 4PM5A 4BBTA 5HAQA 1K25A 2GJ3A 4IBRA 4CLCC 5FAQA 5HSQA 4QJGA 1QMFA 4OONA 1MPLA 4NXEA 2WKQA 3LIDA 3Q07A 1S66L 3LEZA 1EROA 2IWDA 3DWZA 4JGRA 4KQQA 1EW0A 1ODVA 4IEDA 3BY8A 4I39A 3HLCA 2EX6A 3A3EA 4KG2A 2Y8HA 5GLAA 3OPPA 3CPTB 2VX8A 1H0MA 3A3DA 2J7VA 1UGUA 4E3IA 3T4LA 2J9PA 4F3LA 4KUKA 5AVFA 4WLAA 2KOIA 3OCNA 3PR6A 4K08A 4IBXA 2JHEA 3WS1A 3VP2A 1GSWA 3NBLA 4Q0HA 3UDXA 2OV5A 1L0GA 1PWGA 4WF0A 3IQAA 3LFVA 5HDCA 2A24B 3SZTA 1I2SA 5D3OA 1ZG4A 4WM9A 3G6OA 1GHIA 4HNBA 1L0FA 1O07A 3M6HA 1OTAA 3KSGA 1G68A 1OTEA 3M6BA 3LR0A 3KO6A 3Q7VA 1PI4A 5J4EA 2VKSA 4DXBA 2ZC3B 3S1YA 2WKHA 1LL8A 2XSSA 3LGOA 5DJTA 2BASA 4R1GA 1KOUA 2V1AA 2PAVP 4S2OA 4A5RA 3NI9A 5CTNA 2CMNA 1FR6A 4R3AA 3VP4A 5CGSA 1KGEA 3OCLA 3ZHHA 4I5SA 1F2KA 3NDEA 5IU1A 3H7WA 4GS9B 2ZLYA 4HJ3A 3Q7VB 3VE4A 1JWZA 4P87A 4PM7A 4MN5A 1PIOA 3PHYA 3TJZC 4OLGA 5FAOA 3KYZA 5IS1A 2PHYA 1KE3A 3QP2A 1H3QA 3PYPA 1U60A 2XQZA 4LCLA 1YPRA 5HL1A 3KYQA 5F69A 4HI4A 3T50A 1XJ3A 4LFUA 2ZC5B 2HDUA 3SH8A 4X6TA 3C30A 1P97A 2LB9A 3SH7A 3T4TA 2W0NA 4Y0TA 1BLPA 3CG5A 3ZG0A 1XGJA 5F1FA 3FPWA 5TGFA 3LIFA 5F68A 3ZG5A 2DCFA 5F83A 4JXVA 5AQ7A 4WMCD 2W1TA 2V0UA 1RGYA 1S67L 1TEMA 3FKWA 2XA7M 3OC2A 3HL9A 2XD1A 5HDSA 2JKRI 1K54A 3JVVA 2WKRA 3DBAA 3CZDA 2C6WB 3FV7A 3PTEA 2Y2NA 2V8CA 4EESA 1DJAA 2OWHA 3P01A 3CJMA 1YMXA 3HLFA 3G31A 3NC8A 3SS3A 3UPOA 3IBRA 3FZCA 4QHCA 1HVBA 3UPPA 4N92A 3UB7A 1W63M 4JKTA 2JKRM 5FEGA 1S4RA 3E4OA 4MN6A 4OPRA 2O0YA 2XLNA 2WKPA 2RCXA 4QU3A 4JXSA 1BSGA 1I5QA 4E6XA 2EWWA 1Y4OA 4LPZA 1IYOA 3BFGA 3O86A 4UA7A 3IX3A 1ZTUA 4OOMA 3FG8A 4FD8A 3NOPC 1JVJA 1S1ZA 4KZ6A 1N9OA 2GX5A 3E2KA 5EPHA 5DFXA 4ARZA 5J8XA 4BENA 3VV4A 2ZL1A 3IHAA 1PI5A 3H82A 2WAFA 3UE6A 4HBUA 3KSFA 2PRFA 3IXBA 4EQ1A 3TW8A 1W8YA 5HWWA 3MMHA 4KZ7A 4WZ5C 1TDGA 1FILA 3NHQA 3W4QA 4WEKA 4KQDA 3IXGA 3EQUA 1T1AA 3H82B 3KSHA 1OTIA 3C5AA 4K0XA 4KZAA 3T1SA 3T12B 1K0KA 5EOOA 4R4RA 4WN5A 5FI6A 3QP4A 3DTEA 4PPRA 5EM0A 5KSHA 3EEAA 4IHQA 2Y2KA 2WZZA 5KIZA 3TE8A 2G2WA 2VV8A 4QD4A 3C38A 3UB6A 4CJNA 1BYWA 2O9BA 4MEZA 2Y2GA 2B95A 4BQMA 1FSWA 5FEFA 2XDMA 1BTLA 1XJ6A 2OOLA 3G35A 4KZ5A 3B3XA 4ESPA 1MWSA 1OMEA 3VP0A 3RJUA 4MNRA 1XP4A 5CEDA 2J3WA 5FDSA 4I3AA 4HJ6A 3UB8A 1OPXA 5EVIC 2Q9MA 1PFLA 4NG2A 1LT0A 1ZC2A 1BZAA 1FCMA 2ZC6B 1OTBA 5FQJA 1N9NA 3WS2A 3HUMA 2J80A 2HP9A 2ZL1B 3A0VA 3BQ8A 4Q8IA 4PKYG 1JTGA 2ZC4B 1K55C 4EBPA 4LV0A 3F1PB 3GV9A 2XFTA 1KVMA 3TSGA 3UE0A 1GA0A 1BLHA 3G34A 4YOFA 3BY9A 2VGLM 2HDRA 1S6RA 3V39A 1H8ZA 3SS5A 1Q2PA 3ZVWA 5U47A 4MN7A 2HV1A 3ULFA 3HREA 5DJUA 2H0TA 2PBYA 1FIKA 5FQ9A 3T4OA 4OPYA 4X68A 4EUVA 4O7DA 4YNRA 2RL3A 4GB7A 4X1LA 3T4JA 4PM6A 5FQQA 4ZTKA 5FL3A 5L8MA 3GVBA 2PU2A 4UEYA 5HX9A 4P6ZS 3BFCA 3WS5A 3PAGA 4HOIA 4DN0A 4EXOA 3VSKA 4IVKA 1EWZA 3DTKA 2V8FA 4YWZA 2R9XA 5GHXA 3PXPA 1NY0A 1T1BA 4H6JA 3T4KA 4WZ5A 4DE2A 3N6IA 3GECA 4OLDA 4O8GA 1ACFA 1XKZA 2XGNA 3G30A 1PZOA 1DP9A 1S1YA 1HZOA 1DY6A 3B47A 3LIEA 5F5YA 3E4PA 4ZDXA 5AVEA 2K7SA 1KGFA 4JLFA 1TS6A 1SZVA 4C6YA 4LV3A 1XA7A 1ERMA 4ZBEA 3PBRA 1ALQA 3DTMA 2ZMVA 2Y2HA 2H5SA 2P08A 3N8SA 3DW0A 1IELA 5CTMA 5DKKA 4M4XA 2QYBA 3KX0X 3IS2B 4UAAA 4RYEA 5FQMA 1G6OA 4MBKA 4Y0OA 2P9VB 3BW6A 3P7NA 5EFWA 5L09A 1VQQA 4K0WA 1RGZA 2HZ5A 3JYIA 1RP5A 4OP8A 5CXWA 3T1XA 3MSHA 4LENA 4MDZA 3LCEA 1K4FA 3EWKA 2JE5A 3IHBA 4FCFA 1IYSA 4JXWA 2EX2A 4EEPA 3OPLA 1WYBA 5HZHA 5E2GA 1XJ4A 4PHTA 1GSVA 1XX2A 3H7WB 4B9OA 5CGWA 2XD5A 2INWA 5GLDA 5HAIA 3MFDA 2DMWA 4KQRA 3SW1A 2QKPA 2ZM8A 3U4LP 3L7HA 2EXAA 3S7QA 2FZ0A 1ESIA 2QJ5A 1MWRA 3MXRA 2FFFB 1ES2A 4NK3A 3LIAA 3IH8A 3H9WA 2EFUA 2V2FF 1ONHA 2ZQ9A 3E4QA 4MBFA 1FR1A 4HESA 3UE3A 1GA9A 2H10A 3RFBA 2Z2LB 1DRMA 3SH9A 1JWVA 1LSXA 3LIBA 3T1RA 4OQHA 4KZ3A 1K4EA 4OVDA 2J3TC 4HJ4A 1P9WA 3ICYA 1Q2QA 2VGLS 3TG9A 2Y2IA 1OTDA 4KZ9A 4IUHA 4XT2B 2V20A 1HD8A 1SKOA 2QWSA 3MQOA 4R38A 1XFNA 1IEMA 3C2WA 4ZJ1A 3CAXA 2VK3A 4WZ4A 3C7VA 4P6BA 3QP1A 3B33A 1JNUA 2OLUA 2ZQAA 4BL3A 2UV0E 3NECA 2E8JA 5DTKA 3MZFA 4WMCA 4FUWA 2WGIA 4F3LB 1FOFA 4XT2A 5E2EA 4Y15A 5GHZA 2WGWB 3E2LA 3D3OA 2Z6DA 2W3FA 1H8MA 3G2ZA 1L3LA 2Y91A 4E6WA 1K57A 4EV4A 4ETXA 2ZM2A 2K31A 1BULA 5EV0A 4ZAMA 3FPVA 4OOLA 3O3VA 3BEBA 4U3TA 3M2KA 3UB9A 2JC7A 3OPHA 2O99A 5JYOA 4IVIA 3LY4A 3MFXA 1MBLA 1SDNA 3D9YA 5HARA 4GN2A 3ZVTA 3F1NB 5HFOA 2W1RA 3P09A 4CLCE 3HUOA 1EI5A 4X56A 5F6AA 1T18A 1TS8A 3HBRA 4LV1A 3C4PA 3VMAA 1IYPA 1NRFA 1ONGA 4OH0A 3S4XA 1OJ5A 5HWVA 4BBVA 4C75A 2PR5A 5FI7A 1BLSA 3QP5A 2W3DA 3NJAA 2X71A 1H5XA 5EM1A 4DDYA 5TFQA 3LR4A 5K5BA 1PZPA 1NYYA 1GHPA 4Q0IA 4GCZA 2JKGA 4DE0A 4E3MA 3MJQA 1ES4A 4KUOA 4RX2A 1LLBA 2DNSA 4NETA 5CGXA 2H28A 1IKGA 3R4KA 2HPBA 2EX8A 4HH3A 3K2NA 3V3SA 1CK3A 3ZYTA 3KYEA 5GLBA 1J3WA 2DRWA 5HPFA 5MC7A 3PBTA 4UQIS 1YLYA 3NDGA 4LRXC 3IS2A 4O0PA 3TOIA 1S4SA 1BLCA 3F1OA 3UMEA 4R4SA 2OLVA 1JWPA 3D72A 2JKFA 4II7A 1PW8A 3IF6B 3CLOA 1LI9A 5FQIA 1FCOA 3E0YA 1F9IA 2W27A 5HPIA 3HLDA 2VV6A 4I3IA 1LSVA 1CEFA 2PD7A 2EWVA 5FI2A 5C5KA 4BD1A 4LLOB 2VGKA 3DAVA 2FFYA 1XXMA 1L0DA 4RQ9A 4EBNA 1KDSA 1YLPA 2QMIA 1V9YA 4BBUA 5HAPA 2XROA 3GDIA 2WAEA 2B02A 1TVFA 2VJWA 1XGIA 3IWOA 4MCWA 1G5UA 1KE4A 5FDHA 4PAUA 4U0XA 2Y2LA 2VZWA 4E3OA 2PT7A 4X55A 5HWTA 4G3VA 1CF0A 2HDSA 1O7EA 2KDKA 2EA9A 2QZ6A 1ZHHB 1LL5A 4KZ4A 1SDEA 2UWXA 4GS9A 4Z1WA 2XEPA 3N7WA 2WYXA 1T1CA 3LYXA 5GL9A 3HLEA 4QPRA 4R70A 1FCNA 5IHVA 4L0LA 4Y5FA 2O9CA 3HLWA 3K3CA 4HP9A 3CUEC 4RX3A 1DP6A 3AGEA 4OQGA 1RCJA 3A0SA 4P0MA 4DE3A 1D06A 1MC0A 2G2UA 3UPNA 1VHMA 3LICA 1NJ4A 3CHWP 4P6ZM 1IOUA 4JGQA 5F82A 5CEBA 5A92A 1K56D 3PBOA 4HHDA 4N9KA 1PW1A 1KE0A 2C5WB 1NXYA 4ME4A 3EGDC 4CPKA 4E3KA 1E3UD 1DJCA 5M1AA 3HJKA 5AJGA 5JYPA 3FYZA 5IT5A 5G4ZA 3OZHA 2A24A 4B4ZA 4D2OA 4S2KA 3RH8B 3UN7A 1HLUP 4ZJ3A 4NXBA 1XA1A 5DF8A 5DF9A 1G28A 3W8KA 2JKTM 2J9OA 1NRJA 3NCKA 2WADA 3R7WB 4NKPA 4S2IA 5FSRA 2I9VA 5EVIA 3W2ZA 1MXOA 3ISGA 3UDIA 4X69A 3MXQA 1VEUB 1YT4A 4UQIM 4EERA 3A3JA 3I7JA 4Z9QA 1E25A 1K6RA 2QJ7A 2XK1A 2VEAA 4DJ3A 4DE1A 2WKEA 5TR7A 2VA0A 3DWKA 2W3GA 1YMSA 4L9FA 4DKIA 4HBTA 1W7FA 4Y2FA 1VETA 4HQAA 4OQ0A 4R3BA 2L4RA 4OOYA 3ZG8B 4N1HA 1A0KA 1OJGA 4JXGA 1K38A 2I72A 4E04A 3T4SA 1W79A 1YLZA 4ARZB 1KGGA 2V1BA 2Y2PA 4EU0A 2J8YA 1Y28A 3ZG7B 4OKPA 2HP6A 4U0TA 3LY3A 3EGXC 3MZDA 2WKIA 3FC7A 4C3QA 2WUQA 5E2HA 2KX6A 3ITBA 3UDFA 5KMWA 2FH5A 3ITAA 1SCWA 3OPRA 1SHVA 2ACGA 2A49A 1WA9A 5GLCA 3GQZA 5DKLA 1DJBA 1OT9A 4IJGA 4ID4A 3IWIA 1YAXA 4QY5A 1M40A 1XPBA 4UA6A 2L1MA 5LBRA 3F1OB 2ZQ7A 2HJ9C 4JF6A 3LEQA 2A3UA 3NIAA 1W8QA 1NWZA 3NULA 2EFXA 1SKFA 4KENB 4X25A 4GDNA 1D7EA 3O5YA 2VGJA 4GZBA 1UWNX 5E2FA 4UHUA 3QNBA 1STZA 1VEUA 3CI6A 1N4OA 1NLYA 1K57C 2OWJA 3PAEA 4B93A 3FWLA 4GHIA 4GOGA 5CECA 5M19A 5M18A 1E3UA 1IKIA 4XUXA 3BLSA 2HDQA 2D01A 2BG1A 4EQIA 1YM1A 3OOVA 4S2LA 1MKMA 2EX9A 3VFHA 4FTXA 4WEJA 4KZBA 2IA2A 2M1CA 3V5MA 3GTCA 2L0WA 2HF6A 4WL9A 5DFYA 2EXBA 1YKDA 1GSXA 3L9KA 4LGWA 3VOLA 1K54C 4GD6A 2MJ6A 3QP6A 2VLGA 5HDDA 3MZEA 3V67A 5L2FA 1ESUA 1W5DA 2GZAA 5HD3A 2GNXA 3EOIA 3BFEA 4Y0UA 4OPZA 4L9GA 5BOHA 5I5LA 2Y2QA 3VOZA 2GDNA 4S2JA 1E4DA 3UB5P 4X53A 3WS4A 1X0OA 4GD8A 1GCEA 3NOUC 2ZQCA 2Y2OA 2ZMFA 3W4PA 1BUEA 1VB6A 3MF0A 5DTSA 1YSQA 3N8LA 4H6JB 3V50A 2W1TB 1FQGA 3U2AA 3GR2A 3C4OA 2QPNA 5EVEA 4ETZA 2ZOIA 4B4XA 2V0WA 5EOEA 4DRTA 2LB5A 3RXWA 5FATA 4KG6A 4GW9A 2V9AA 2Q0OA 4QWOA 5CHJA 5DVAA 1XFQA 5EVIB 4GNUA 1Z09A 1YSPA 5E43A 1TS7A 2PDRA 2JCHA 4FOFA 4GDBA 3BRMA 3ZNTA 4GJ4A 1YLJA 3GSGA 3N8RA 3C7UA 2B18A 3C8CA 3M2JA 1C3BA 2W3EA 2ZBBA 4JF4A 3MQQA 3P98A 3HLGA 3IWQA 1OT6A 3S7NA 2WZXA 3QNCA 1TDLA 5TBMA 4HIAA 3BECA 3T4QA 4S2NC 2QHKA 3IF5A 4MMNA 2ZJ9A 3BJNA 4D60A 3MR0A 5L07A 2P04A 4FH2A 1MWTA 3S22A 1LSWA 3ZG9B 1VETB 4BLMA 3PBNA 4R0QA 2Y59A 1FSYA 4KQOA 5J3WA 1N9LA 4S2NA 2XH9A 1LL9A 3A3FA 5TJJA 5TBMB 4YINA 1CJFA 4OQIA 2IWCA 3S7OA 1JTDA 4FH4A 3Q1FA 1YQSA 1BT5A 2ZC7A 3CITA 3QHYA 3LR3A 5AQ9A 3UNWA 1PWDA 3HLBA 1SKOB 4I3JA 1QMEA 4BL2A 1P0ZA 2XF3A 1TF1A 1DP8A 2XR0A 4MBHA 5CX7A 4R23A 3CWFA 4HY8A 2JKTI 1CI8A 2XA7S 1F98A 2HP5A 4E3NA 1P9RA 5CERA 4CQHA 3MKFA 1PYYA 4KG5A 2ZQDA 2P7JA 3BM6A 1G6AA 3WRTA 1LI0A 3RXXA 1F5MA 1UWPX 1M6KA 4P85A 5CHMA 4LRYC 2PYPA 3IF6C 2WK0A 5CHUA 1NZOA 5EUAA 3ZNYA 1NYMA 5FA7A 1KVLA 5FASA 3HJIA 1WE4A 3SOIA 2A2LA 2B5RA 2M7VA 3BFFA 5EVLA 2NUPC 1XJ2A 3W4OA 3WRZA 4EWFA 4OPQA 4WBGA 3BFDA 4JBFA 5FQKA 1K55A 4DXCA 3UMDA 4EETB 4LCMA 3F1NA 2H0YA 2WGVA 3JVUA 4IUKA 2X02A 2G7UA 5L10A 4Y13A 2OAP1 2BTFP 3UO9A 3UY6A 1Z6FA 2ZM0A 2V1ZA 2M7UA 3OBFA 5FAPA 3O87A 4S2MA 4G3KA 4OP5A 3WS0A 2HJEA 3ZQ5A 3B42A 5EE8A 4EUZA 3Q81A 2PD8A 4Y17A 3QP8A 3G2YA 3IBJA 2PYRA 4BMWA 2ZOHA 2ZMAA 4N9LA 3V3RA 1CEGA 1V9ZA 4K91A 4XXRA 5A91A 2R78A 5A93A 1AWIA 1D1JA 3FKVA 3HUNA 4Y7PA 1NLZA 4LRZE 3ZCZA 3VFFA 2D02A 1MKIA 1CI9A 1TS0A 4QB8A 3A3IA 4BJPA 3OLOA 1VM1A 3UE1A 2E8IA 4XUZA 4DMZA 3IX4A 1L2SA 5DF7A 1MZUA 3CMZA 4N1XA 5EECA 2O9AA 4CLCB 4L9EA 3LI9A 3G4PA 3WWXA 5AQAA 1K6SA 4S2PA 2J3TD 4WYYA 4RVAA 1LHYA 1NZUA 3GMWA 4HH2A 4R3JA 5HD5A 4EW7A 4CLCA 2K2NA 3SS4A 1AXBA 3Q82A 5AQBA 3EEHA 1ES5A 3Q7ZA 3DTIA 3TRCA 4I38A 4QY6A 4JF5A 1IFQA 4G3WA 3LI8A 3HCYA 2NUTC 3F1PA 4PKYA 2PR6A 5DTTA 4EBLA 2XFSA 3R7WA 1MY8A 3D4FA 1ES3A 4YFMA 4PM9A 4B88A 4NXGA 1HTZA 2JN7A 3O88A 1PWCA 1YLWA 1T19A 4GKUA 4GLQA 1S0WA 2WGWA 1Y54A 4E3JA 4X1MA 1YLTA 2P74A 4RA7A 4HP4A 3T1QB 4NEED 2Y4AA 1TD5A 2OSUA 2YKHA 3IH9A 2IWBA 3IXDA 3KSIA 3EQVA 3LUQA 5HW3A 5I94A 1PNEA 2VV7A 4KZ8A 5CRFA 2Z6CA 4R6LA 4O01A 4E3LA 5F1GA 4EEUA 2CC1A 3JPUA 3VE3A 3AGDA 1H8YA 3BLMA 4MLLA 3BYDA 5GHYA 2Q9NA 3PBSA 3LO7A 1CQAA 4GHIB 5J7EA 4DF6A 3ZGAB 3RTYA 4M3KA 3VOYA 1WYCA 4Y3IA 1ZKJA 3BQAA 4JGPA 1L0EA 3GRJA 3MXSA 3IXHA 1K56A 4F94A 4ZRRA 1KDWA 3G32A 3IX8A 4DDSA 1GHMA 4ZJ2A 3ZDJA 2PU4A 3E98A 3NOTC 1W63Q 2JBFA 1I2WA 5KSCA 2Z2MB 3AGFA 2BLSA 3MS6A 1ZG6A 3MBZA 2P9VA 4UA9A 4BWIA 2Y2MA 3N4IA 2Y2JA 2XRNA 3PBQA 2AVXA 1PRQA 4JGOA 5G4YA 3VP3A 2Y79A 2ZD8A 5A8BA 4PMAA 1MWUA 1ERQA 4DJ2A 4H8RA 5A90A
chains in the Genus database with same CATH topology
3ZFZA 1IYQA 1LI9A 4GDBA 4JPMA 5FQIA 3HVFA 1JTGA 2ZC4B 1FCOA 4Q8IA 2Y55A 3BRMA 3ZNTA 1N9BA 4FSFA 1YLJA 1K55C 3GSGA 3C7UA 1J9MA 3N8RA 3M2JA 1C3BA 4EBPA 4LV0A 5G18A 3GV9A 2XFTA 4JF4A 1KVMA 3TSGA 3UE0A 5KZHA 3HLDA 1GA0A 1CEFA 4BD0A 1BLHA 3P98A 3HLGA 2ZQ8A 3IWQA 3G34A 5EVID 4LV2A 2WZXA 2HDRA 1S6RA 3V39A 1H8ZA 5FI2A 3QNCA 4HEFA 1TDLA 3SS5A 3MKEA 3IF6A 3VP1A 1Q2PA 3NY4A 3ZVWA 5U47A 3BECA 4PM8A 3HREA 2H0TA 2PBYA 4S2NC 3IT9A 4WELA 5FQ9A 2X01A 3VSLA 4BD1A 2VGKA 4OPYA 3IF5A 4X68A 2FFYA 1XXMA 1L0DA 2ZJ9A 4O7DA 4EBNA 2RL3A 4GB7A 1KDSA 2R9WA 1YLPA 2QMIA 4PM6A 5FQQA 4PM5A 4ZTKA 5HAPA 5HAQA 1K25A 2WAEA 4IBRA 3GVBA 2PU2A 5HX9A 4FH2A 1TVFA 5FAQA 1MWTA 3S22A 3BFCA 3WS5A 1XGIA 3IWOA 3PAGA 4QJGA 1QMFA 1KE4A 4OONA 1MPLA 5FDHA 3ZG9B 4BLMA 3VSKA 4IVKA 3PBNA 4U0XA 1EWZA 3Q07A 2Y2LA 3LEZA 1EROA 2IWDA 3DWZA 4E3OA 4X55A 4R0QA 2Y59A 1FSYA 2R9XA 4KQOA 1NY0A 4KQQA 4S2NA 4WZ5A 5GHXA 4IEDA 2XH9A 2HDSA 1O7EA 4DE2A 3N6IA 4OLDA 2QZ6A 1LL9A 1LL5A 1XKZA 3A3FA 4YINA 4KZ4A 2XGNA 1SDEA 4OQIA 3HLCA 2IWCA 2EX6A 3G30A 2UWXA 3A3EA 1JTDA 1PZOA 4FH4A 4KG2A 3Q1FA 1YQSA 5GLAA 1BT5A 1HZOA 3OPPA 2ZC7A 1DY6A 2XEPA 3N7WA 2WYXA 3A3DA 3QHYA 5GL9A 3HLEA 2J7VA 5AQ9A 4E3IA 3UNWA 1PWDA 2J9PA 3HLBA 1FCNA 5IHVA 4ZDXA 4L0LA 1KGFA 4JLFA 3OCNA 1QMEA 4BL2A 3HLWA 2XF3A 4C6YA 4LV3A 2XR0A 1XA7A 4IBXA 1ERMA 4ZBEA 4MBHA 3PBRA 4R23A 1ALQA 3WS1A 4RX3A 3DTMA 3AGEA 2Y2HA 2H5SA 4OQGA 3VP2A 1RCJA 3N8SA 4P0MA 3DW0A 1IELA 3NBLA 4DE3A 5CTMA 1CI8A 3UDXA 2G2UA 2HP5A 2OV5A 1L0GA 3UPNA 4E3NA 1PWGA 5CERA 3IQAA 3MKFA 1NJ4A 1PYYA 4UAAA 4KG5A 5F82A 4RYEA 5FQMA 1I2SA 5CEBA 5A92A 1K56D 2ZQDA 4MBKA 3PBOA 2P9VB 4Y0OA 5D3OA 3BM6A 1ZG4A 1G6AA 4WM9A 3WRTA 1LI0A 1VQQA 1GHIA 4K0WA 1L0FA 4N9KA 1PW1A 1RGZA 3RXXA 3JYIA 1KE0A 1O07A 3M6HA 1RP5A 1G68A 2C5WB 1M6KA 1NXYA 3M6BA 4CPKA 4P85A 5CHMA 4OP8A 4E3KA 5CXWA 1E3UD 3IF6C 3Q7VA 1DJCA 2WK0A 5CHUA 5M1AA 1PI4A 4LENA 1NZOA 5EUAA 3ZNYA 1NYMA 3LCEA 5JYPA 5FA7A 3FYZA 1K4FA 1KVLA 3OZHA 5FASA 4DXBA 2ZC3B 4B4ZA 4D2OA 3S1YA 4S2KA 2JE5A 1WE4A 2WKHA 3UN7A 3SOIA 3IHBA 4R1GA 2B5RA 4FCFA 1IYSA 4ZJ3A 3BFFA 4JXWA 5EVLA 1XA1A 2EX2A 5DF8A 5DF9A 3WRZA 3W4OA 3W8KA 4EWFA 2J9OA 3OPLA 4S2OA 3NCKA 3NI9A 1WYBA 4OPQA 5CTNA 4A5RA 5E2GA 2WADA 1FR6A 4WBGA 3BFDA 4JBFA 3VP4A 5CGSA 1KGEA 5FQKA 3OCLA 1K55A 4S2IA 3ZHHA 4DXCA 1XX2A 5FSRA 3NDEA 4LCMA 5EVIA 2H0YA 1MXOA 5CGWA 2WGVA 2XD5A 2ZLYA 2X02A 3Q7VB 3ISGA 3UDIA 5GLDA 1JWZA 4P87A 4PM7A 5HAIA 1PIOA 3UO9A 4X69A 3UY6A 3MFDA 1YT4A 1Z6FA 4OLGA 4KQRA 5FAOA 2ZM0A 2V1ZA 5FAPA 2ZM8A 3O87A 3A3JA 1KE3A 1E25A 3I7JA 1K6RA 4S2MA 2XK1A 4OP5A 4Z9QA 4DE1A 3WS0A 2WKEA 5EE8A 2EXAA 4EUZA 3Q81A 1U60A 5TR7A 1ESIA 3DWKA 1YMSA 2XQZA 4DKIA 3G2YA 4LCLA 5HL1A 1MWRA 4HBTA 3MXRA 1W7FA 2FFFB 4OQ0A 4R3BA 1ES2A 4OOYA 3ZG8B 2ZC5B 2ZMAA 4N1HA 4JXGA 1K38A 4NK3A 2I72A 2HDUA 4N9LA 3V3RA 3SH8A 4X6TA 1CEGA 3IH8A 1W79A 1YLZA 4K91A 4XXRA 1KGGA 2EFUA 2V2FF 3SH7A 1ONHA 2ZQ9A 2Y2PA 4Y0TA 1BLPA 3CG5A 3ZG0A 1XGJA 5F1FA 2J8YA 4MBFA 3ZG7B 5TGFA 5A91A 1FR1A 4OKPA 3ZG5A 2DCFA 4HESA 5A93A 2HP6A 4U0TA 3UE3A 5F83A 3LY3A 4JXVA 3FKVA 3HUNA 4Y7PA 5AQ7A 4WMCD 3MZDA 2WKIA 3ZCZA 3VFFA 1GA9A 1RGYA 2H10A 1MKIA 4C3QA 2Z2LB 1CI9A 1TEMA 3SH9A 3FKWA 2WUQA 1JWVA 5E2HA 4QB8A 3A3IA 3OC2A 3ITBA 3HL9A 4BJPA 4OQHA 3UDFA 2XD1A 4KZ3A 5KMWA 1K4EA 4OVDA 3ITAA 1VM1A 1SCWA 3UE1A 3OPRA 1SHVA 1K54A 2E8IA 4XUZA 2A49A 1Q2QA 5GLCA 3TG9A 2Y2IA 3GQZA 1L2SA 4KZ9A 1DJBA 2V20A 5DF7A 1HD8A 3CZDA 2C6WB 3FV7A 3CMZA 3PTEA 2Y2NA 4ID4A 4N1XA 5EECA 3IWIA 1DJAA 1IEMA 4ZJ1A 4QY5A 3CJMA 4WZ4A 1YMXA 3HLFA 1M40A 1XPBA 3G31A 3NC8A 3G4PA 3SS3A 3WWXA 4UA6A 5AQAA 1K6SA 4S2PA 3UPOA 3C7VA 2ZQ7A 3FZCA 4JF6A 4P6BA 4QHCA 1HVBA 3UPPA 2A3UA 3NIAA 4WYYA 1W8QA 2EFXA 4N92A 1SKFA 4KENB 4GDNA 2OLUA 4JKTA 1LHYA 4RVAA 1NZUA 3GMWA 4R3JA 2ZQAA 4BL3A 2VGJA 4GZBA 3SS4A 1AXBA 5DTKA 4OPRA 3Q82A 2XLNA 3MZFA 4WMCA 5AQBA 4QU3A 2RCXA 2WGIA 5E2FA 4UHUA 3QNBA 1ES5A 3Q7ZA 1BSGA 1I5QA 4JXSA 4E6XA 1FOFA 5E2EA 4QY6A 4JF5A 1N4OA 5GHZA 1IYOA 3BFGA 2WGWB 3E2LA 3O86A 4UA7A 1K57C 4OOMA 3PAEA 4FD8A 3G2ZA 5DTTA 4EBLA 2Y91A 2XFSA 4E6WA 3FWLA 1K57A 4GOGA 4EV4A 5CECA 1JVJA 5M19A 1MY8A 4KZ6A 3D4FA 5M18A 2ZM2A 1E3UA 1IKIA 1ES3A 4XUXA 1BULA 3BLSA 3E2KA 5EPHA 4ZAMA 2HDQA 4OOLA 4PM9A 4YFMA 5J8XA 4B88A 3O3VA 3BEBA 4U3TA 1HTZA 2BG1A 4BENA 3O88A 3M2KA 1PWCA 3IHAA 4EQIA 1YLWA 2JC7A 1YM1A 3OPHA 1PI5A 4S2LA 4GKUA 1S0WA 2WAFA 2WGWA 5JYOA 4IVIA 1Y54A 3LY4A 4E3JA 4HBUA 2EX9A 1MBLA 1SDNA 3VFHA 5HARA 4GN2A 1YLTA 2P74A 4WEJA 4KZBA 3ZVTA 4RA7A 3IXBA 5HFOA 3V5MA 3P09A 3GTCA 1W8YA 3HUOA 1EI5A 4X56A 2Y4AA 2OSUA 2EXBA 3IH9A 2IWBA 1K54C 3IXDA 3HBRA 4GD6A 4LV1A 3C4PA 4KZ7A 3EQVA 1IYPA 1NRFA 1ONGA 1TDGA 4WZ5C 3VMAA 5HW3A 3W4QA 5I94A 4WEKA 4OH0A 3MZEA 4KZ8A 5CRFA 3S4XA 4C75A 5FI7A 4E3LA 5L2FA 5F1GA 1BLSA 1ESUA 1W5DA 3IXGA 2CC1A 3AGDA 1H8YA 3BLMA 3EQUA 4MLLA 3BFEA 2X71A 1H5XA 4DDYA 5TFQA 3BYDA 4Y0UA 2Q9NA 5GHYA 4OPZA 3C5AA 4K0XA 4KZAA 5BOHA 3PBSA 1PZPA 3LO7A 1NYYA 1GHPA 2Y2QA 3VOZA 5EOOA 4DF6A 2GDNA 4R4RA 4DE0A 4E3MA 4S2JA 1E4DA 1ES4A 3ZGAB 4X53A 4M3KA 5FI6A 3WS4A 4RX2A 3VOYA 4GD8A 1LLBA 1GCEA 1WYCA 2ZQCA 4PPRA 2Y2OA 1ZKJA 3W4PA 1BUEA 2DNSA 4NETA 5KSHA 2Y2KA 5DTSA 2WZZA 1L0EA 3GRJA 3MXSA 3N8LA 3IXHA 5CGXA 1K56A 4F94A 2G2WA 1KDWA 3V50A 1IKGA 3G32A 4QD4A 2HPBA 1FQGA 4CJNA 4DDSA 1GHMA 2EX8A 4ZJ2A 3ZDJA 2PU4A 3V3SA 3GR2A 2JBFA 3C4OA 2Y2GA 1I2WA 2QPNA 4MEZA 1FSWA 4BQMA 2XDMA 1BTLA 1CK3A 3G35A 4KZ5A 5KSCA 4B4XA 3B3XA 2Z2MB 1MWSA 1OMEA 5GLBA 3AGFA 3VP0A 2BLSA 3RJUA 2DRWA 4MNRA 5EOEA 1ZG6A 4DRTA 1XP4A 3MBZA 2P9VA 5CEDA 3RXWA 5FATA 3PBTA 4UA9A 1YLYA 4KG6A 2Y2MA 3N4IA 3NDGA 2Y2JA 3PBQA 5CHJA 3TOIA 2Q9MA 5EVIC 5DVAA 1BLCA 5EVIB 1ZC2A 1BZAA 1FCMA 3VP3A 4R4SA 2OLVA 2ZC6B 2ZD8A 5FQJA 3WS2A 4GNUA 1MWUA 1ERQA 4PMAA 5E43A 1JWPA 3HUMA 2HP9A 2JCHA 4H8RA 5A90A 1PW8A 3IF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZFZ A;  1IYQ A;  1LI9 A;  4GDB A;  4JPM A;  5FQI A;  3HVF A;  1JTG A;  2ZC4 B;  1FCO A;  4Q8I A;  2Y55 A;  3BRM A;  3ZNT A;  1N9B A;  4FSF A;  1YLJ A;  1K55 C;  3GSG A;  3C7U A;  1J9M A;  3N8R A;  3M2J A;  1C3B A;  4EBP A;  4LV0 A;  5G18 A;  3GV9 A;  2XFT A;  4JF4 A;  1KVM A;  3TSG A;  3UE0 A;  5KZH A;  3HLD A;  1GA0 A;  1CEF A;  4BD0 A;  1BLH A;  3P98 A;  3HLG A;  2ZQ8 A;  3IWQ A;  3G34 A;  5EVI D;  4LV2 A;  2WZX A;  2HDR A;  1S6R A;  3V39 A;  1H8Z A;  5FI2 A;  3QNC A;  4HEF A;  1TDL A;  3SS5 A;  3MKE A;  3IF6 A;  3VP1 A;  1Q2P A;  3NY4 A;  3ZVW A;  5U47 A;  3BEC A;  4PM8 A;  3HRE A;  2H0T A;  2PBY A;  4S2N C;  3IT9 A;  4WEL A;  5FQ9 A;  2X01 A;  3VSL A;  4BD1 A;  2VGK A;  4OPY A;  3IF5 A;  4X68 A;  2FFY A;  1XXM A;  1L0D A;  2ZJ9 A;  4O7D A;  4EBN A;  2RL3 A;  4GB7 A;  1KDS A;  2R9W A;  1YLP A;  2QMI A;  4PM6 A;  5FQQ A;  4PM5 A;  4ZTK A;  5HAP A;  5HAQ A;  1K25 A;  2WAE A;  4IBR A;  3GVB A;  2PU2 A;  5HX9 A;  4FH2 A;  1TVF A;  5FAQ A;  1MWT A;  3S22 A;  3BFC A;  3WS5 A;  1XGI A;  3IWO A;  3PAG A;  4QJG A;  1QMF A;  1KE4 A;  4OON A;  1MPL A;  5FDH A;  3ZG9 B;  4BLM A;  3VSK A;  4IVK A;  3PBN A;  4U0X A;  1EWZ A;  3Q07 A;  2Y2L A;  3LEZ A;  1ERO A;  2IWD A;  3DWZ A;  4E3O A;  4X55 A;  4R0Q A;  2Y59 A;  1FSY A;  2R9X A;  4KQO A;  1NY0 A;  4KQQ A;  4S2N A;  4WZ5 A;  5GHX A;  4IED A;  2XH9 A;  2HDS A;  1O7E A;  4DE2 A;  3N6I A;  4OLD A;  2QZ6 A;  1LL9 A;  1LL5 A;  1XKZ A;  3A3F A;  4YIN A;  4KZ4 A;  2XGN A;  1SDE A;  4OQI A;  3HLC A;  2IWC A;  2EX6 A;  3G30 A;  2UWX A;  3A3E A;  1JTD A;  1PZO A;  4FH4 A;  4KG2 A;  3Q1F A;  1YQS A;  5GLA A;  1BT5 A;  1HZO A;  3OPP A;  2ZC7 A;  1DY6 A;  2XEP A;  3N7W A;  2WYX A;  3A3D A;  3QHY A;  5GL9 A;  3HLE A;  2J7V A;  5AQ9 A;  4E3I A;  3UNW A;  1PWD A;  2J9P A;  3HLB A;  1FCN A;  5IHV A;  4ZDX A;  4L0L A;  1KGF A;  4JLF A;  3OCN A;  1QME A;  4BL2 A;  3HLW A;  2XF3 A;  4C6Y A;  4LV3 A;  2XR0 A;  1XA7 A;  4IBX A;  1ERM A;  4ZBE A;  4MBH A;  3PBR A;  4R23 A;  1ALQ A;  3WS1 A;  4RX3 A;  3DTM A;  3AGE A;  2Y2H A;  2H5S A;  4OQG A;  3VP2 A;  1RCJ A;  3N8S A;  4P0M A;  3DW0 A;  1IEL A;  3NBL A;  4DE3 A;  5CTM A;  1CI8 A;  3UDX A;  2G2U A;  2HP5 A;  2OV5 A;  1L0G A;  3UPN A;  4E3N A;  1PWG A;  5CER A;  3IQA A;  3MKF A;  1NJ4 A;  1PYY A;  4UAA A;  4KG5 A;  5F82 A;  4RYE A;  5FQM A;  1I2S A;  5CEB A;  5A92 A;  1K56 D;  2ZQD A;  4MBK A;  3PBO A;  2P9V B;  4Y0O A;  5D3O A;  3BM6 A;  1ZG4 A;  1G6A A;  4WM9 A;  3WRT A;  1LI0 A;  1VQQ A;  1GHI A;  4K0W A;  1L0F A;  4N9K A;  1PW1 A;  1RGZ A;  3RXX A;  3JYI A;  1KE0 A;  1O07 A;  3M6H A;  1RP5 A;  1G68 A;  2C5W B;  1M6K A;  1NXY A;  3M6B A;  4CPK A;  4P85 A;  5CHM A;  4OP8 A;  4E3K A;  5CXW A;  1E3U D;  3IF6 C;  3Q7V A;  1DJC A;  2WK0 A;  5CHU A;  5M1A A;  1PI4 A;  4LEN A;  1NZO A;  5EUA A;  3ZNY A;  1NYM A;  3LCE A;  5JYP A;  5FA7 A;  3FYZ A;  1K4F A;  1KVL A;  3OZH A;  5FAS A;  4DXB A;  2ZC3 B;  4B4Z A;  4D2O A;  3S1Y A;  4S2K A;  2JE5 A;  1WE4 A;  2WKH A;  3UN7 A;  3SOI A;  3IHB A;  4R1G A;  2B5R A;  4FCF A;  1IYS A;  4ZJ3 A;  3BFF A;  4JXW A;  5EVL A;  1XA1 A;  2EX2 A;  5DF8 A;  5DF9 A;  3WRZ A;  3W4O A;  3W8K A;  4EWF A;  2J9O A;  3OPL A;  4S2O A;  3NCK A;  3NI9 A;  1WYB A;  4OPQ A;  5CTN A;  4A5R A;  5E2G A;  2WAD A;  1FR6 A;  4WBG A;  3BFD A;  4JBF A;  3VP4 A;  5CGS A;  1KGE A;  5FQK A;  3OCL A;  1K55 A;  4S2I A;  3ZHH A;  4DXC A;  1XX2 A;  5FSR A;  3NDE A;  4LCM A;  5EVI A;  2H0Y A;  1MXO A;  5CGW A;  2WGV A;  2XD5 A;  2ZLY A;  2X02 A;  3Q7V B;  3ISG A;  3UDI A;  5GLD A;  1JWZ A;  4P87 A;  4PM7 A;  5HAI A;  1PIO A;  3UO9 A;  4X69 A;  3UY6 A;  3MFD A;  1YT4 A;  1Z6F A;  4OLG A;  4KQR A;  5FAO A;  2ZM0 A;  2V1Z A;  5FAP A;  2ZM8 A;  3O87 A;  3A3J A;  1KE3 A;  1E25 A;  3I7J A;  1K6R A;  4S2M A;  2XK1 A;  4OP5 A;  4Z9Q A;  4DE1 A;  3WS0 A;  2WKE A;  5EE8 A;  2EXA A;  4EUZ A;  3Q81 A;  1U60 A;  5TR7 A;  1ESI A;  3DWK A;  1YMS A;  2XQZ A;  4DKI A;  3G2Y A;  4LCL A;  5HL1 A;  1MWR A;  4HBT A;  3MXR A;  1W7F A;  2FFF B;  4OQ0 A;  4R3B A;  1ES2 A;  4OOY A;  3ZG8 B;  2ZC5 B;  2ZMA A;  4N1H A;  4JXG A;  1K38 A;  4NK3 A;  2I72 A;  2HDU A;  4N9L A;  3V3R A;  3SH8 A;  4X6T A;  1CEG A;  3IH8 A;  1W79 A;  1YLZ A;  4K91 A;  4XXR A;  1KGG A;  2EFU A;  2V2F F;  3SH7 A;  1ONH A;  2ZQ9 A;  2Y2P A;  4Y0T A;  1BLP A;  3CG5 A;  3ZG0 A;  1XGJ A;  5F1F A;  2J8Y A;  4MBF A;  3ZG7 B;  5TGF A;  5A91 A;  1FR1 A;  4OKP A;  3ZG5 A;  2DCF A;  4HES A;  5A93 A;  2HP6 A;  4U0T A;  3UE3 A;  5F83 A;  3LY3 A;  4JXV A;  3FKV A;  3HUN A;  4Y7P A;  5AQ7 A;  4WMC D;  3MZD A;  2WKI A;  3ZCZ A;  3VFF A;  1GA9 A;  1RGY A;  2H10 A;  1MKI A;  4C3Q A;  2Z2L B;  1CI9 A;  1TEM A;  3SH9 A;  3FKW A;  2WUQ A;  1JWV A;  5E2H A;  4QB8 A;  3A3I A;  3OC2 A;  3ITB A;  3HL9 A;  4BJP A;  4OQH A;  3UDF A;  2XD1 A;  4KZ3 A;  5KMW A;  1K4E A;  4OVD A;  3ITA A;  1VM1 A;  1SCW A;  3UE1 A;  3OPR A;  1SHV A;  1K54 A;  2E8I A;  4XUZ A;  2A49 A;  1Q2Q A;  5GLC A;  3TG9 A;  2Y2I A;  3GQZ A;  1L2S A;  4KZ9 A;  1DJB A;  2V20 A;  5DF7 A;  1HD8 A;  3CZD A;  2C6W B;  3FV7 A;  3CMZ A;  3PTE A;  2Y2N A;  4ID4 A;  4N1X A;  5EEC A;  3IWI A;  1DJA A;  1IEM A;  4ZJ1 A;  4QY5 A;  3CJM A;  4WZ4 A;  1YMX A;  3HLF A;  1M40 A;  1XPB A;  3G31 A;  3NC8 A;  3G4P A;  3SS3 A;  3WWX A;  4UA6 A;  5AQA A;  1K6S A;  4S2P A;  3UPO A;  3C7V A;  2ZQ7 A;  3FZC A;  4JF6 A;  4P6B A;  4QHC A;  1HVB A;  3UPP A;  2A3U A;  3NIA A;  4WYY A;  1W8Q A;  2EFX A;  4N92 A;  1SKF A;  4KEN B;  4GDN A;  2OLU A;  4JKT A;  1LHY A;  4RVA A;  1NZU A;  3GMW A;  4R3J A;  2ZQA A;  4BL3 A;  2VGJ A;  4GZB A;  3SS4 A;  1AXB A;  5DTK A;  4OPR A;  3Q82 A;  2XLN A;  3MZF A;  4WMC A;  5AQB A;  4QU3 A;  2RCX A;  2WGI A;  5E2F A;  4UHU A;  3QNB A;  1ES5 A;  3Q7Z A;  1BSG A;  1I5Q A;  4JXS A;  4E6X A;  1FOF A;  5E2E A;  4QY6 A;  4JF5 A;  1N4O A;  5GHZ A;  1IYO A;  3BFG A;  2WGW B;  3E2L A;  3O86 A;  4UA7 A;  1K57 C;  4OOM A;  3PAE A;  4FD8 A;  3G2Z A;  5DTT A;  4EBL A;  2Y91 A;  2XFS A;  4E6W A;  3FWL A;  1K57 A;  4GOG A;  4EV4 A;  5CEC A;  1JVJ A;  5M19 A;  1MY8 A;  4KZ6 A;  3D4F A;  5M18 A;  2ZM2 A;  1E3U A;  1IKI A;  1ES3 A;  4XUX A;  1BUL A;  3BLS A;  3E2K A;  5EPH A;  4ZAM A;  2HDQ A;  4OOL A;  4PM9 A;  4YFM A;  5J8X A;  4B88 A;  3O3V A;  3BEB A;  4U3T A;  1HTZ A;  2BG1 A;  4BEN A;  3O88 A;  3M2K A;  1PWC A;  3IHA A;  4EQI A;  1YLW A;  2JC7 A;  1YM1 A;  3OPH A;  1PI5 A;  4S2L A;  4GKU A;  1S0W A;  2WAF A;  2WGW A;  5JYO A;  4IVI A;  1Y54 A;  3LY4 A;  4E3J A;  4HBU A;  2EX9 A;  1MBL A;  1SDN A;  3VFH A;  5HAR A;  4GN2 A;  1YLT A;  2P74 A;  4WEJ A;  4KZB A;  3ZVT A;  4RA7 A;  3IXB A;  5HFO A;  3V5M A;  3P09 A;  3GTC A;  1W8Y A;  3HUO A;  1EI5 A;  4X56 A;  2Y4A A;  2OSU A;  2EXB A;  3IH9 A;  2IWB A;  1K54 C;  3IXD A;  3HBR A;  4GD6 A;  4LV1 A;  3C4P A;  4KZ7 A;  3EQV A;  1IYP A;  1NRF A;  1ONG A;  1TDG A;  4WZ5 C;  3VMA A;  5HW3 A;  3W4Q A;  5I94 A;  4WEK A;  4OH0 A;  3MZE A;  4KZ8 A;  5CRF A;  3S4X A;  4C75 A;  5FI7 A;  4E3L A;  5L2F A;  5F1G A;  1BLS A;  1ESU A;  1W5D A;  3IXG A;  2CC1 A;  3AGD A;  1H8Y A;  3BLM A;  3EQU A;  4MLL A;  3BFE A;  2X71 A;  1H5X A;  4DDY A;  5TFQ A;  3BYD A;  4Y0U A;  2Q9N A;  5GHY A;  4OPZ A;  3C5A A;  4K0X A;  4KZA A;  5BOH A;  3PBS A;  1PZP A;  3LO7 A;  1NYY A;  1GHP A;  2Y2Q A;  3VOZ A;  5EOO A;  4DF6 A;  2GDN A;  4R4R A;  4DE0 A;  4E3M A;  4S2J A;  1E4D A;  1ES4 A;  3ZGA B;  4X53 A;  4M3K A;  5FI6 A;  3WS4 A;  4RX2 A;  3VOY A;  4GD8 A;  1LLB A;  1GCE A;  1WYC A;  2ZQC A;  4PPR A;  2Y2O A;  1ZKJ A;  3W4P A;  1BUE A;  2DNS A;  4NET A;  5KSH A;  2Y2K A;  5DTS A;  2WZZ A;  1L0E A;  3GRJ A;  3MXS A;  3N8L A;  3IXH A;  5CGX A;  1K56 A;  4F94 A;  2G2W A;  1KDW A;  3V50 A;  1IKG A;  3G32 A;  4QD4 A;  2HPB A;  1FQG A;  4CJN A;  4DDS A;  1GHM A;  2EX8 A;  4ZJ2 A;  3ZDJ A;  2PU4 A;  3V3S A;  3GR2 A;  2JBF A;  3C4O A;  2Y2G A;  1I2W A;  2QPN A;  4MEZ A;  1FSW A;  4BQM A;  2XDM A;  1BTL A;  1CK3 A;  3G35 A;  4KZ5 A;  5KSC A;  4B4X A;  3B3X A;  2Z2M B;  1MWS A;  1OME A;  5GLB A;  3AGF A;  3VP0 A;  2BLS A;  3RJU A;  2DRW A;  4MNR A;  5EOE A;  1ZG6 A;  4DRT A;  1XP4 A;  3MBZ A;  2P9V A;  5CED A;  3RXW A;  5FAT A;  3PBT A;  4UA9 A;  1YLY A;  4KG6 A;  2Y2M A;  3N4I A;  3NDG A;  2Y2J A;  3PBQ A;  5CHJ A;  3TOI A;  2Q9M A;  5EVI C;  5DVA A;  1BLC A;  5EVI B;  1ZC2 A;  1BZA A;  1FCM A;  3VP3 A;  4R4S A;  2OLV A;  2ZC6 B;  2ZD8 A;  5FQJ A;  3WS2 A;  4GNU A;  1MWU A;  1ERQ A;  4PMA A;  5E43 A;  1JWP A;  3HUM A;  2HP9 A;  2JCH A;  4H8R A;  5A90 A;  1PW8 A;  3IF6 B; 
#chains in the Genus database with same CATH topology
 2KLI A;  3ZFZ A;  1IYQ A;  3CUE A;  4JPM A;  3HVF A;  2OAQ 1;  2Y55 A;  3S7P A;  1N9B A;  4FSF A;  2W3H A;  4Q0J A;  3K3D A;  1J9M A;  4CLC D;  3BWL A;  5G18 A;  3MQ0 A;  5KZH A;  4NXF A;  4BD0 A;  2ZQ8 A;  5EVI D;  4LV2 A;  2PBD P;  4WUJ A;  4HEF A;  3MKE A;  3IF6 A;  3VP1 A;  3NY4 A;  5HL6 A;  4AFI A;  4PM8 A;  3LR5 A;  3A0R A;  3IT9 A;  4WEL A;  2X01 A;  3VSL A;  2HGV A;  3CPT A;  2YKF A;  2R9W A;  4PM5 A;  4BBT A;  5HAQ A;  1K25 A;  2GJ3 A;  4IBR A;  4CLC C;  5FAQ A;  5HSQ A;  4QJG A;  1QMF A;  4OON A;  1MPL A;  4NXE A;  2WKQ A;  3LID A;  3Q07 A;  1S66 L;  3LEZ A;  1ERO A;  2IWD A;  3DWZ A;  4JGR A;  4KQQ A;  1EW0 A;  1ODV A;  4IED A;  3BY8 A;  4I39 A;  3HLC A;  2EX6 A;  3A3E A;  4KG2 A;  2Y8H A;  5GLA A;  3OPP A;  3CPT B;  2VX8 A;  1H0M A;  3A3D A;  2J7V A;  1UGU A;  4E3I A;  3T4L A;  2J9P A;  4F3L A;  4KUK A;  5AVF A;  4WLA A;  2KOI A;  3OCN A;  3PR6 A;  4K08 A;  4IBX A;  2JHE A;  3WS1 A;  3VP2 A;  1GSW A;  3NBL A;  4Q0H A;  3UDX A;  2OV5 A;  1L0G A;  1PWG A;  4WF0 A;  3IQA A;  3LFV A;  5HDC A;  2A24 B;  3SZT A;  1I2S A;  5D3O A;  1ZG4 A;  4WM9 A;  3G6O A;  1GHI A;  4HNB A;  1L0F A;  1O07 A;  3M6H A;  1OTA A;  3KSG A;  1G68 A;  1OTE A;  3M6B A;  3LR0 A;  3KO6 A;  3Q7V A;  1PI4 A;  5J4E A;  2VKS A;  4DXB A;  2ZC3 B;  3S1Y A;  2WKH A;  1LL8 A;  2XSS A;  3LGO A;  5DJT A;  2BAS A;  4R1G A;  1KOU A;  2V1A A;  2PAV P;  4S2O A;  4A5R A;  3NI9 A;  5CTN A;  2CMN A;  1FR6 A;  4R3A A;  3VP4 A;  5CGS A;  1KGE A;  3OCL A;  3ZHH A;  4I5S A;  1F2K A;  3NDE A;  5IU1 A;  3H7W A;  4GS9 B;  2ZLY A;  4HJ3 A;  3Q7V B;  3VE4 A;  1JWZ A;  4P87 A;  4PM7 A;  4MN5 A;  1PIO A;  3PHY A;  3TJZ C;  4OLG A;  5FAO A;  3KYZ A;  5IS1 A;  2PHY A;  1KE3 A;  3QP2 A;  1H3Q A;  3PYP A;  1U60 A;  2XQZ A;  4LCL A;  1YPR A;  5HL1 A;  3KYQ A;  5F69 A;  4HI4 A;  3T50 A;  1XJ3 A;  4LFU A;  2ZC5 B;  2HDU A;  3SH8 A;  4X6T A;  3C30 A;  1P97 A;  2LB9 A;  3SH7 A;  3T4T A;  2W0N A;  4Y0T A;  1BLP A;  3CG5 A;  3ZG0 A;  1XGJ A;  5F1F A;  3FPW A;  5TGF A;  3LIF A;  5F68 A;  3ZG5 A;  2DCF A;  5F83 A;  4JXV A;  5AQ7 A;  4WMC D;  2W1T A;  2V0U A;  1RGY A;  1S67 L;  1TEM A;  3FKW A;  2XA7 M;  3OC2 A;  3HL9 A;  2XD1 A;  5HDS A;  2JKR I;  1K54 A;  3JVV A;  2WKR A;  3DBA A;  3CZD A;  2C6W B;  3FV7 A;  3PTE A;  2Y2N A;  2V8C A;  4EES A;  1DJA A;  2OWH A;  3P01 A;  3CJM A;  1YMX A;  3HLF A;  3G31 A;  3NC8 A;  3SS3 A;  3UPO A;  3IBR A;  3FZC A;  4QHC A;  1HVB A;  3UPP A;  4N92 A;  3UB7 A;  1W63 M;  4JKT A;  2JKR M;  5FEG A;  1S4R A;  3E4O A;  4MN6 A;  4OPR A;  2O0Y A;  2XLN A;  2WKP A;  2RCX A;  4QU3 A;  4JXS A;  1BSG A;  1I5Q A;  4E6X A;  2EWW A;  1Y4O A;  4LPZ A;  1IYO A;  3BFG A;  3O86 A;  4UA7 A;  3IX3 A;  1ZTU A;  4OOM A;  3FG8 A;  4FD8 A;  3NOP C;  1JVJ A;  1S1Z A;  4KZ6 A;  1N9O A;  2GX5 A;  3E2K A;  5EPH A;  5DFX A;  4ARZ A;  5J8X A;  4BEN A;  3VV4 A;  2ZL1 A;  3IHA A;  1PI5 A;  3H82 A;  2WAF A;  3UE6 A;  4HBU A;  3KSF A;  2PRF A;  3IXB A;  4EQ1 A;  3TW8 A;  1W8Y A;  5HWW A;  3MMH A;  4KZ7 A;  4WZ5 C;  1TDG A;  1FIL A;  3NHQ A;  3W4Q A;  4WEK A;  4KQD A;  3IXG A;  3EQU A;  1T1A A;  3H82 B;  3KSH A;  1OTI A;  3C5A A;  4K0X A;  4KZA A;  3T1S A;  3T12 B;  1K0K A;  5EOO A;  4R4R A;  4WN5 A;  5FI6 A;  3QP4 A;  3DTE A;  4PPR A;  5EM0 A;  5KSH A;  3EEA A;  4IHQ A;  2Y2K A;  2WZZ A;  5KIZ A;  3TE8 A;  2G2W A;  2VV8 A;  4QD4 A;  3C38 A;  3UB6 A;  4CJN A;  1BYW A;  2O9B A;  4MEZ A;  2Y2G A;  2B95 A;  4BQM A;  1FSW A;  5FEF A;  2XDM A;  1BTL A;  1XJ6 A;  2OOL A;  3G35 A;  4KZ5 A;  3B3X A;  4ESP A;  1MWS A;  1OME A;  3VP0 A;  3RJU A;  4MNR A;  1XP4 A;  5CED A;  2J3W A;  5FDS A;  4I3A A;  4HJ6 A;  3UB8 A;  1OPX A;  5EVI C;  2Q9M A;  1PFL A;  4NG2 A;  1LT0 A;  1ZC2 A;  1BZA A;  1FCM A;  2ZC6 B;  1OTB A;  5FQJ A;  1N9N A;  3WS2 A;  3HUM A;  2J80 A;  2HP9 A;  2ZL1 B;  3A0V A;  3BQ8 A;  4Q8I A;  4PKY G;  1JTG A;  2ZC4 B;  1K55 C;  4EBP A;  4LV0 A;  3F1P B;  3GV9 A;  2XFT A;  1KVM A;  3TSG A;  3UE0 A;  1GA0 A;  1BLH A;  3G34 A;  4YOF A;  3BY9 A;  2VGL M;  2HDR A;  1S6R A;  3V39 A;  1H8Z A;  3SS5 A;  1Q2P A;  3ZVW A;  5U47 A;  4MN7 A;  2HV1 A;  3ULF A;  3HRE A;  5DJU A;  2H0T A;  2PBY A;  1FIK A;  5FQ9 A;  3T4O A;  4OPY A;  4X68 A;  4EUV A;  4O7D A;  4YNR A;  2RL3 A;  4GB7 A;  4X1L A;  3T4J A;  4PM6 A;  5FQQ A;  4ZTK A;  5FL3 A;  5L8M A;  3GVB A;  2PU2 A;  4UEY A;  5HX9 A;  4P6Z S;  3BFC A;  3WS5 A;  3PAG A;  4HOI A;  4DN0 A;  4EXO A;  3VSK A;  4IVK A;  1EWZ A;  3DTK A;  2V8F A;  4YWZ A;  2R9X A;  5GHX A;  3PXP A;  1NY0 A;  1T1B A;  4H6J A;  3T4K A;  4WZ5 A;  4DE2 A;  3N6I A;  3GEC A;  4OLD A;  4O8G A;  1ACF A;  1XKZ A;  2XGN A;  3G30 A;  1PZO A;  1DP9 A;  1S1Y A;  1HZO A;  1DY6 A;  3B47 A;  3LIE A;  5F5Y A;  3E4P A;  4ZDX A;  5AVE A;  2K7S A;  1KGF A;  4JLF A;  1TS6 A;  1SZV A;  4C6Y A;  4LV3 A;  1XA7 A;  1ERM A;  4ZBE A;  3PBR A;  1ALQ A;  3DTM A;  2ZMV A;  2Y2H A;  2H5S A;  2P08 A;  3N8S A;  3DW0 A;  1IEL A;  5CTM A;  5DKK A;  4M4X A;  2QYB A;  3KX0 X;  3IS2 B;  4UAA A;  4RYE A;  5FQM A;  1G6O A;  4MBK A;  4Y0O A;  2P9V B;  3BW6 A;  3P7N A;  5EFW A;  5L09 A;  1VQQ A;  4K0W A;  1RGZ A;  2HZ5 A;  3JYI A;  1RP5 A;  4OP8 A;  5CXW A;  3T1X A;  3MSH A;  4LEN A;  4MDZ A;  3LCE A;  1K4F A;  3EWK A;  2JE5 A;  3IHB A;  4FCF A;  1IYS A;  4JXW A;  2EX2 A;  4EEP A;  3OPL A;  1WYB A;  5HZH A;  5E2G A;  1XJ4 A;  4PHT A;  1GSV A;  1XX2 A;  3H7W B;  4B9O A;  5CGW A;  2XD5 A;  2INW A;  5GLD A;  5HAI A;  3MFD A;  2DMW A;  4KQR A;  3SW1 A;  2QKP A;  2ZM8 A;  3U4L P;  3L7H A;  2EXA A;  3S7Q A;  2FZ0 A;  1ESI A;  2QJ5 A;  1MWR A;  3MXR A;  2FFF B;  1ES2 A;  4NK3 A;  3LIA A;  3IH8 A;  3H9W A;  2EFU A;  2V2F F;  1ONH A;  2ZQ9 A;  3E4Q A;  4MBF A;  1FR1 A;  4HES A;  3UE3 A;  1GA9 A;  2H10 A;  3RFB A;  2Z2L B;  1DRM A;  3SH9 A;  1JWV A;  1LSX A;  3LIB A;  3T1R A;  4OQH A;  4KZ3 A;  1K4E A;  4OVD A;  2J3T C;  4HJ4 A;  1P9W A;  3ICY A;  1Q2Q A;  2VGL S;  3TG9 A;  2Y2I A;  1OTD A;  4KZ9 A;  4IUH A;  4XT2 B;  2V20 A;  1HD8 A;  1SKO A;  2QWS A;  3MQO A;  4R38 A;  1XFN A;  1IEM A;  3C2W A;  4ZJ1 A;  3CAX A;  2VK3 A;  4WZ4 A;  3C7V A;  4P6B A;  3QP1 A;  3B33 A;  1JNU A;  2OLU A;  2ZQA A;  4BL3 A;  2UV0 E;  3NEC A;  2E8J A;  5DTK A;  3MZF A;  4WMC A;  4FUW A;  2WGI A;  4F3L B;  1FOF A;  4XT2 A;  5E2E A;  4Y15 A;  5GHZ A;  2WGW B;  3E2L A;  3D3O A;  2Z6D A;  2W3F A;  1H8M A;  3G2Z A;  1L3L A;  2Y91 A;  4E6W A;  1K57 A;  4EV4 A;  4ETX A;  2ZM2 A;  2K31 A;  1BUL A;  5EV0 A;  4ZAM A;  3FPV A;  4OOL A;  3O3V A;  3BEB A;  4U3T A;  3M2K A;  3UB9 A;  2JC7 A;  3OPH A;  2O99 A;  5JYO A;  4IVI A;  3LY4 A;  3MFX A;  1MBL A;  1SDN A;  3D9Y A;  5HAR A;  4GN2 A;  3ZVT A;  3F1N B;  5HFO A;  2W1R A;  3P09 A;  4CLC E;  3HUO A;  1EI5 A;  4X56 A;  5F6A A;  1T18 A;  1TS8 A;  3HBR A;  4LV1 A;  3C4P A;  3VMA A;  1IYP A;  1NRF A;  1ONG A;  4OH0 A;  3S4X A;  1OJ5 A;  5HWV A;  4BBV A;  4C75 A;  2PR5 A;  5FI7 A;  1BLS A;  3QP5 A;  2W3D A;  3NJA A;  2X71 A;  1H5X A;  5EM1 A;  4DDY A;  5TFQ A;  3LR4 A;  5K5B A;  1PZP A;  1NYY A;  1GHP A;  4Q0I A;  4GCZ A;  2JKG A;  4DE0 A;  4E3M A;  3MJQ A;  1ES4 A;  4KUO A;  4RX2 A;  1LLB A;  2DNS A;  4NET A;  5CGX A;  2H28 A;  1IKG A;  3R4K A;  2HPB A;  2EX8 A;  4HH3 A;  3K2N A;  3V3S A;  1CK3 A;  3ZYT A;  3KYE A;  5GLB A;  1J3W A;  2DRW A;  5HPF A;  5MC7 A;  3PBT A;  4UQI S;  1YLY A;  3NDG A;  4LRX C;  3IS2 A;  4O0P A;  3TOI A;  1S4S A;  1BLC A;  3F1O A;  3UME A;  4R4S A;  2OLV A;  1JWP A;  3D72 A;  2JKF A;  4II7 A;  1PW8 A;  3IF6 B;  3CLO A;  1LI9 A;  5FQI A;  1FCO A;  3E0Y A;  1F9I A;  2W27 A;  5HPI A;  3HLD A;  2VV6 A;  4I3I A;  1LSV A;  1CEF A;  2PD7 A;  2EWV A;  5FI2 A;  5C5K A;  4BD1 A;  4LLO B;  2VGK A;  3DAV A;  2FFY A;  1XXM A;  1L0D A;  4RQ9 A;  4EBN A;  1KDS A;  1YLP A;  2QMI A;  1V9Y A;  4BBU A;  5HAP A;  2XRO A;  3GDI A;  2WAE A;  2B02 A;  1TVF A;  2VJW A;  1XGI A;  3IWO A;  4MCW A;  1G5U A;  1KE4 A;  5FDH A;  4PAU A;  4U0X A;  2Y2L A;  2VZW A;  4E3O A;  2PT7 A;  4X55 A;  5HWT A;  4G3V A;  1CF0 A;  2HDS A;  1O7E A;  2KDK A;  2EA9 A;  2QZ6 A;  1ZHH B;  1LL5 A;  4KZ4 A;  1SDE A;  2UWX A;  4GS9 A;  4Z1W A;  2XEP A;  3N7W A;  2WYX A;  1T1C A;  3LYX A;  5GL9 A;  3HLE A;  4QPR A;  4R70 A;  1FCN A;  5IHV A;  4L0L A;  4Y5F A;  2O9C A;  3HLW A;  3K3C A;  4HP9 A;  3CUE C;  4RX3 A;  1DP6 A;  3AGE A;  4OQG A;  1RCJ A;  3A0S A;  4P0M A;  4DE3 A;  1D06 A;  1MC0 A;  2G2U A;  3UPN A;  1VHM A;  3LIC A;  1NJ4 A;  3CHW P;  4P6Z M;  1IOU A;  4JGQ A;  5F82 A;  5CEB A;  5A92 A;  1K56 D;  3PBO A;  4HHD A;  4N9K A;  1PW1 A;  1KE0 A;  2C5W B;  1NXY A;  4ME4 A;  3EGD C;  4CPK A;  4E3K A;  1E3U D;  1DJC A;  5M1A A;  3HJK A;  5AJG A;  5JYP A;  3FYZ A;  5IT5 A;  5G4Z A;  3OZH A;  2A24 A;  4B4Z A;  4D2O A;  4S2K A;  3RH8 B;  3UN7 A;  1HLU P;  4ZJ3 A;  4NXB A;  1XA1 A;  5DF8 A;  5DF9 A;  1G28 A;  3W8K A;  2JKT M;  2J9O A;  1NRJ A;  3NCK A;  2WAD A;  3R7W B;  4NKP A;  4S2I A;  5FSR A;  2I9V A;  5EVI A;  3W2Z A;  1MXO A;  3ISG A;  3UDI A;  4X69 A;  3MXQ A;  1VEU B;  1YT4 A;  4UQI M;  4EER A;  3A3J A;  3I7J A;  4Z9Q A;  1E25 A;  1K6R A;  2QJ7 A;  2XK1 A;  2VEA A;  4DJ3 A;  4DE1 A;  2WKE A;  5TR7 A;  2VA0 A;  3DWK A;  2W3G A;  1YMS A;  4L9F A;  4DKI A;  4HBT A;  1W7F A;  4Y2F A;  1VET A;  4HQA A;  4OQ0 A;  4R3B A;  2L4R A;  4OOY A;  3ZG8 B;  4N1H A;  1A0K A;  1OJG A;  4JXG A;  1K38 A;  2I72 A;  4E04 A;  3T4S A;  1W79 A;  1YLZ A;  4ARZ B;  1KGG A;  2V1B A;  2Y2P A;  4EU0 A;  2J8Y A;  1Y28 A;  3ZG7 B;  4OKP A;  2HP6 A;  4U0T A;  3LY3 A;  3EGX C;  3MZD A;  2WKI A;  3FC7 A;  4C3Q A;  2WUQ A;  5E2H A;  2KX6 A;  3ITB A;  3UDF A;  5KMW A;  2FH5 A;  3ITA A;  1SCW A;  3OPR A;  1SHV A;  2ACG A;  2A49 A;  1WA9 A;  5GLC A;  3GQZ A;  5DKL A;  1DJB A;  1OT9 A;  4IJG A;  4ID4 A;  3IWI A;  1YAX A;  4QY5 A;  1M40 A;  1XPB A;  4UA6 A;  2L1M A;  5LBR A;  3F1O B;  2ZQ7 A;  2HJ9 C;  4JF6 A;  3LEQ A;  2A3U A;  3NIA A;  1W8Q A;  1NWZ A;  3NUL A;  2EFX A;  1SKF A;  4KEN B;  4X25 A;  4GDN A;  1D7E A;  3O5Y A;  2VGJ A;  4GZB A;  1UWN X;  5E2F A;  4UHU A;  3QNB A;  1STZ A;  1VEU A;  3CI6 A;  1N4O A;  1NLY A;  1K57 C;  2OWJ A;  3PAE A;  4B93 A;  3FWL A;  4GHI A;  4GOG A;  5CEC A;  5M19 A;  5M18 A;  1E3U A;  1IKI A;  4XUX A;  3BLS A;  2HDQ A;  2D01 A;  2BG1 A;  4EQI A;  1YM1 A;  3OOV A;  4S2L A;  1MKM A;  2EX9 A;  3VFH A;  4FTX A;  4WEJ A;  4KZB A;  2IA2 A;  2M1C A;  3V5M A;  3GTC A;  2L0W A;  2HF6 A;  4WL9 A;  5DFY A;  2EXB A;  1YKD A;  1GSX A;  3L9K A;  4LGW A;  3VOL A;  1K54 C;  4GD6 A;  2MJ6 A;  3QP6 A;  2VLG A;  5HDD A;  3MZE A;  3V67 A;  5L2F A;  1ESU A;  1W5D A;  2GZA A;  5HD3 A;  2GNX A;  3EOI A;  3BFE A;  4Y0U A;  4OPZ A;  4L9G A;  5BOH A;  5I5L A;  2Y2Q A;  3VOZ A;  2GDN A;  4S2J A;  1E4D A;  3UB5 P;  4X53 A;  3WS4 A;  1X0O A;  4GD8 A;  1GCE A;  3NOU C;  2ZQC A;  2Y2O A;  2ZMF A;  3W4P A;  1BUE A;  1VB6 A;  3MF0 A;  5DTS A;  1YSQ A;  3N8L A;  4H6J B;  3V50 A;  2W1T B;  1FQG A;  3U2A A;  3GR2 A;  3C4O A;  2QPN A;  5EVE A;  4ETZ A;  2ZOI A;  4B4X A;  2V0W A;  5EOE A;  4DRT A;  2LB5 A;  3RXW A;  5FAT A;  4KG6 A;  4GW9 A;  2V9A A;  2Q0O A;  4QWO A;  5CHJ A;  5DVA A;  1XFQ A;  5EVI B;  4GNU A;  1Z09 A;  1YSP A;  5E43 A;  1TS7 A;  2PDR A;  2JCH A;  4FOF A;  4GDB A;  3BRM A;  3ZNT A;  4GJ4 A;  1YLJ A;  3GSG A;  3N8R A;  3C7U A;  2B18 A;  3C8C A;  3M2J A;  1C3B A;  2W3E A;  2ZBB A;  4JF4 A;  3MQQ A;  3P98 A;  3HLG A;  3IWQ A;  1OT6 A;  3S7N A;  2WZX A;  3QNC A;  1TDL A;  5TBM A;  4HIA A;  3BEC A;  3T4Q A;  4S2N C;  2QHK A;  3IF5 A;  4MMN A;  2ZJ9 A;  3BJN A;  4D60 A;  3MR0 A;  5L07 A;  2P04 A;  4FH2 A;  1MWT A;  3S22 A;  1LSW A;  3ZG9 B;  1VET B;  4BLM A;  3PBN A;  4R0Q A;  2Y59 A;  1FSY A;  4KQO A;  5J3W A;  1N9L A;  4S2N A;  2XH9 A;  1LL9 A;  3A3F A;  5TJJ A;  5TBM B;  4YIN A;  1CJF A;  4OQI A;  2IWC A;  3S7O A;  1JTD A;  4FH4 A;  3Q1F A;  1YQS A;  1BT5 A;  2ZC7 A;  3CIT A;  3QHY A;  3LR3 A;  5AQ9 A;  3UNW A;  1PWD A;  3HLB A;  1SKO B;  4I3J A;  1QME A;  4BL2 A;  1P0Z A;  2XF3 A;  1TF1 A;  1DP8 A;  2XR0 A;  4MBH A;  5CX7 A;  4R23 A;  3CWF A;  4HY8 A;  2JKT I;  1CI8 A;  2XA7 S;  1F98 A;  2HP5 A;  4E3N A;  1P9R A;  5CER A;  4CQH A;  3MKF A;  1PYY A;  4KG5 A;  2ZQD A;  2P7J A;  3BM6 A;  1G6A A;  3WRT A;  1LI0 A;  3RXX A;  1F5M A;  1UWP X;  1M6K A;  4P85 A;  5CHM A;  4LRY C;  2PYP A;  3IF6 C;  2WK0 A;  5CHU A;  1NZO A;  5EUA A;  3ZNY A;  1NYM A;  5FA7 A;  1KVL A;  5FAS A;  3HJI A;  1WE4 A;  3SOI A;  2A2L A;  2B5R A;  2M7V A;  3BFF A;  5EVL A;  2NUP C;  1XJ2 A;  3W4O A;  3WRZ A;  4EWF A;  4OPQ A;  4WBG A;  3BFD A;  4JBF A;  5FQK A;  1K55 A;  4DXC A;  3UMD A;  4EET B;  4LCM A;  3F1N A;  2H0Y A;  2WGV A;  3JVU A;  4IUK A;  2X02 A;  2G7U A;  5L10 A;  4Y13 A;  2OAP 1;  2BTF P;  3UO9 A;  3UY6 A;  1Z6F A;  2ZM0 A;  2V1Z A;  2M7U A;  3OBF A;  5FAP A;  3O87 A;  4S2M A;  4G3K A;  4OP5 A;  3WS0 A;  2HJE A;  3ZQ5 A;  3B42 A;  5EE8 A;  4EUZ A;  3Q81 A;  2PD8 A;  4Y17 A;  3QP8 A;  3G2Y A;  3IBJ A;  2PYR A;  4BMW A;  2ZOH A;  2ZMA A;  4N9L A;  3V3R A;  1CEG A;  1V9Z A;  4K91 A;  4XXR A;  5A91 A;  2R78 A;  5A93 A;  1AWI A;  1D1J A;  3FKV A;  3HUN A;  4Y7P A;  1NLZ A;  4LRZ E;  3ZCZ A;  3VFF A;  2D02 A;  1MKI A;  1CI9 A;  1TS0 A;  4QB8 A;  3A3I A;  4BJP A;  3OLO A;  1VM1 A;  3UE1 A;  2E8I A;  4XUZ A;  4DMZ A;  3IX4 A;  1L2S A;  5DF7 A;  1MZU A;  3CMZ A;  4N1X A;  5EEC A;  2O9A A;  4CLC B;  4L9E A;  3LI9 A;  3G4P A;  3WWX A;  5AQA A;  1K6S A;  4S2P A;  2J3T D;  4WYY A;  4RVA A;  1LHY A;  1NZU A;  3GMW A;  4HH2 A;  4R3J A;  5HD5 A;  4EW7 A;  4CLC A;  2K2N A;  3SS4 A;  1AXB A;  3Q82 A;  5AQB A;  3EEH A;  1ES5 A;  3Q7Z A;  3DTI A;  3TRC A;  4I38 A;  4QY6 A;  4JF5 A;  1IFQ A;  4G3W A;  3LI8 A;  3HCY A;  2NUT C;  3F1P A;  4PKY A;  2PR6 A;  5DTT A;  4EBL A;  2XFS A;  3R7W A;  1MY8 A;  3D4F A;  1ES3 A;  4YFM A;  4PM9 A;  4B88 A;  4NXG A;  1HTZ A;  2JN7 A;  3O88 A;  1PWC A;  1YLW A;  1T19 A;  4GKU A;  4GLQ A;  1S0W A;  2WGW A;  1Y54 A;  4E3J A;  4X1M A;  1YLT A;  2P74 A;  4RA7 A;  4HP4 A;  3T1Q B;  4NEE D;  2Y4A A;  1TD5 A;  2OSU A;  2YKH A;  3IH9 A;  2IWB A;  3IXD A;  3KSI A;  3EQV A;  3LUQ A;  5HW3 A;  5I94 A;  1PNE A;  2VV7 A;  4KZ8 A;  5CRF A;  2Z6C A;  4R6L A;  4O01 A;  4E3L A;  5F1G A;  4EEU A;  2CC1 A;  3JPU A;  3VE3 A;  3AGD A;  1H8Y A;  3BLM A;  4MLL A;  3BYD A;  5GHY A;  2Q9N A;  3PBS A;  3LO7 A;  1CQA A;  4GHI B;  5J7E A;  4DF6 A;  3ZGA B;  3RTY A;  4M3K A;  3VOY A;  1WYC A;  4Y3I A;  1ZKJ A;  3BQA A;  4JGP A;  1L0E A;  3GRJ A;  3MXS A;  3IXH A;  1K56 A;  4F94 A;  4ZRR A;  1KDW A;  3G32 A;  3IX8 A;  4DDS A;  1GHM A;  4ZJ2 A;  3ZDJ A;  2PU4 A;  3E98 A;  3NOT C;  1W63 Q;  2JBF A;  1I2W A;  5KSC A;  2Z2M B;  3AGF A;  2BLS A;  3MS6 A;  1ZG6 A;  3MBZ A;  2P9V A;  4UA9 A;  4BWI A;  2Y2M A;  3N4I A;  2Y2J A;  2XRN A;  3PBQ A;  2AVX A;  1PRQ A;  4JGO A;  5G4Y A;  3VP3 A;  2Y79 A;  2ZD8 A;  5A8B A;  4PMA A;  1MWU A;  1ERQ A;  4DJ2 A;  4H8R A;  5A90 A; 
#chains in the Genus database with same CATH homology
 3ZFZ A;  1IYQ A;  1LI9 A;  4GDB A;  4JPM A;  5FQI A;  3HVF A;  1JTG A;  2ZC4 B;  1FCO A;  4Q8I A;  2Y55 A;  3BRM A;  3ZNT A;  1N9B A;  4FSF A;  1YLJ A;  1K55 C;  3GSG A;  3C7U A;  1J9M A;  3N8R A;  3M2J A;  1C3B A;  4EBP A;  4LV0 A;  5G18 A;  3GV9 A;  2XFT A;  4JF4 A;  1KVM A;  3TSG A;  3UE0 A;  5KZH A;  3HLD A;  1GA0 A;  1CEF A;  4BD0 A;  1BLH A;  3P98 A;  3HLG A;  2ZQ8 A;  3IWQ A;  3G34 A;  5EVI D;  4LV2 A;  2WZX A;  2HDR A;  1S6R A;  3V39 A;  1H8Z A;  5FI2 A;  3QNC A;  4HEF A;  1TDL A;  3SS5 A;  3MKE A;  3IF6 A;  3VP1 A;  1Q2P A;  3NY4 A;  3ZVW A;  5U47 A;  3BEC A;  4PM8 A;  3HRE A;  2H0T A;  2PBY A;  4S2N C;  3IT9 A;  4WEL A;  5FQ9 A;  2X01 A;  3VSL A;  4BD1 A;  2VGK A;  4OPY A;  3IF5 A;  4X68 A;  2FFY A;  1XXM A;  1L0D A;  2ZJ9 A;  4O7D A;  4EBN A;  2RL3 A;  4GB7 A;  1KDS A;  2R9W A;  1YLP A;  2QMI A;  4PM6 A;  5FQQ A;  4PM5 A;  4ZTK A;  5HAP A;  5HAQ A;  1K25 A;  2WAE A;  4IBR A;  3GVB A;  2PU2 A;  5HX9 A;  4FH2 A;  1TVF A;  5FAQ A;  1MWT A;  3S22 A;  3BFC A;  3WS5 A;  1XGI A;  3IWO A;  3PAG A;  4QJG A;  1QMF A;  1KE4 A;  4OON A;  1MPL A;  5FDH A;  3ZG9 B;  4BLM A;  3VSK A;  4IVK A;  3PBN A;  4U0X A;  1EWZ A;  3Q07 A;  2Y2L A;  3LEZ A;  1ERO A;  2IWD A;  3DWZ A;  4E3O A;  4X55 A;  4R0Q A;  2Y59 A;  1FSY A;  2R9X A;  4KQO A;  1NY0 A;  4KQQ A;  4S2N A;  4WZ5 A;  5GHX A;  4IED A;  2XH9 A;  2HDS A;  1O7E A;  4DE2 A;  3N6I A;  4OLD A;  2QZ6 A;  1LL9 A;  1LL5 A;  1XKZ A;  3A3F A;  4YIN A;  4KZ4 A;  2XGN A;  1SDE A;  4OQI A;  3HLC A;  2IWC A;  2EX6 A;  3G30 A;  2UWX A;  3A3E A;  1JTD A;  1PZO A;  4FH4 A;  4KG2 A;  3Q1F A;  1YQS A;  5GLA A;  1BT5 A;  1HZO A;  3OPP A;  2ZC7 A;  1DY6 A;  2XEP A;  3N7W A;  2WYX A;  3A3D A;  3QHY A;  5GL9 A;  3HLE A;  2J7V A;  5AQ9 A;  4E3I A;  3UNW A;  1PWD A;  2J9P A;  3HLB A;  1FCN A;  5IHV A;  4ZDX A;  4L0L A;  1KGF A;  4JLF A;  3OCN A;  1QME A;  4BL2 A;  3HLW A;  2XF3 A;  4C6Y A;  4LV3 A;  2XR0 A;  1XA7 A;  4IBX A;  1ERM A;  4ZBE A;  4MBH A;  3PBR A;  4R23 A;  1ALQ A;  3WS1 A;  4RX3 A;  3DTM A;  3AGE A;  2Y2H A;  2H5S A;  4OQG A;  3VP2 A;  1RCJ A;  3N8S A;  4P0M A;  3DW0 A;  1IEL A;  3NBL A;  4DE3 A;  5CTM A;  1CI8 A;  3UDX A;  2G2U A;  2HP5 A;  2OV5 A;  1L0G A;  3UPN A;  4E3N A;  1PWG A;  5CER A;  3IQA A;  3MKF A;  1NJ4 A;  1PYY A;  4UAA A;  4KG5 A;  5F82 A;  4RYE A;  5FQM A;  1I2S A;  5CEB A;  5A92 A;  1K56 D;  2ZQD A;  4MBK A;  3PBO A;  2P9V B;  4Y0O A;  5D3O A;  3BM6 A;  1ZG4 A;  1G6A A;  4WM9 A;  3WRT A;  1LI0 A;  1VQQ A;  1GHI A;  4K0W A;  1L0F A;  4N9K A;  1PW1 A;  1RGZ A;  3RXX A;  3JYI A;  1KE0 A;  1O07 A;  3M6H A;  1RP5 A;  1G68 A;  2C5W B;  1M6K A;  1NXY A;  3M6B A;  4CPK A;  4P85 A;  5CHM A;  4OP8 A;  4E3K A;  5CXW A;  1E3U D;  3IF6 C;  3Q7V A;  1DJC A;  2WK0 A;  5CHU A;  5M1A A;  1PI4 A;  4LEN A;  1NZO A;  5EUA A;  3ZNY A;  1NYM A;  3LCE A;  5JYP A;  5FA7 A;  3FYZ A;  1K4F A;  1KVL A;  3OZH A;  5FAS A;  4DXB A;  2ZC3 B;  4B4Z A;  4D2O A;  3S1Y A;  4S2K A;  2JE5 A;  1WE4 A;  2WKH A;  3UN7 A;  3SOI A;  3IHB A;  4R1G A;  2B5R A;  4FCF A;  1IYS A;  4ZJ3 A;  3BFF A;  4JXW A;  5EVL A;  1XA1 A;  2EX2 A;  5DF8 A;  5DF9 A;  3WRZ A;  3W4O A;  3W8K A;  4EWF A;  2J9O A;  3OPL A;  4S2O A;  3NCK A;  3NI9 A;  1WYB A;  4OPQ A;  5CTN A;  4A5R A;  5E2G A;  2WAD A;  1FR6 A;  4WBG A;  3BFD A;  4JBF A;  3VP4 A;  5CGS A;  1KGE A;  5FQK A;  3OCL A;  1K55 A;  4S2I A;  3ZHH A;  4DXC A;  1XX2 A;  5FSR A;  3NDE A;  4LCM A;  5EVI A;  2H0Y A;  1MXO A;  5CGW A;  2WGV A;  2XD5 A;  2ZLY A;  2X02 A;  3Q7V B;  3ISG A;  3UDI A;  5GLD A;  1JWZ A;  4P87 A;  4PM7 A;  5HAI A;  1PIO A;  3UO9 A;  4X69 A;  3UY6 A;  3MFD A;  1YT4 A;  1Z6F A;  4OLG A;  4KQR A;  5FAO A;  2ZM0 A;  2V1Z A;  5FAP A;  2ZM8 A;  3O87 A;  3A3J A;  1KE3 A;  1E25 A;  3I7J A;  1K6R A;  4S2M A;  2XK1 A;  4OP5 A;  4Z9Q A;  4DE1 A;  3WS0 A;  2WKE A;  5EE8 A;  2EXA A;  4EUZ A;  3Q81 A;  1U60 A;  5TR7 A;  1ESI A;  3DWK A;  1YMS A;  2XQZ A;  4DKI A;  3G2Y A;  4LCL A;  5HL1 A;  1MWR A;  4HBT A;  3MXR A;  1W7F A;  2FFF B;  4OQ0 A;  4R3B A;  1ES2 A;  4OOY A;  3ZG8 B;  2ZC5 B;  2ZMA A;  4N1H A;  4JXG A;  1K38 A;  4NK3 A;  2I72 A;  2HDU A;  4N9L A;  3V3R A;  3SH8 A;  4X6T A;  1CEG A;  3IH8 A;  1W79 A;  1YLZ A;  4K91 A;  4XXR A;  1KGG A;  2EFU A;  2V2F F;  3SH7 A;  1ONH A;  2ZQ9 A;  2Y2P A;  4Y0T A;  1BLP A;  3CG5 A;  3ZG0 A;  1XGJ A;  5F1F A;  2J8Y A;  4MBF A;  3ZG7 B;  5TGF A;  5A91 A;  1FR1 A;  4OKP A;  3ZG5 A;  2DCF A;  4HES A;  5A93 A;  2HP6 A;  4U0T A;  3UE3 A;  5F83 A;  3LY3 A;  4JXV A;  3FKV A;  3HUN A;  4Y7P A;  5AQ7 A;  4WMC D;  3MZD A;  2WKI A;  3ZCZ A;  3VFF A;  1GA9 A;  1RGY A;  2H10 A;  1MKI A;  4C3Q A;  2Z2L B;  1CI9 A;  1TEM A;  3SH9 A;  3FKW A;  2WUQ A;  1JWV A;  5E2H A;  4QB8 A;  3A3I A;  3OC2 A;  3ITB A;  3HL9 A;  4BJP A;  4OQH A;  3UDF A;  2XD1 A;  4KZ3 A;  5KMW A;  1K4E A;  4OVD A;  3ITA A;  1VM1 A;  1SCW A;  3UE1 A;  3OPR A;  1SHV A;  1K54 A;  2E8I A;  4XUZ A;  2A49 A;  1Q2Q A;  5GLC A;  3TG9 A;  2Y2I A;  3GQZ A;  1L2S A;  4KZ9 A;  1DJB A;  2V20 A;  5DF7 A;  1HD8 A;  3CZD A;  2C6W B;  3FV7 A;  3CMZ A;  3PTE A;  2Y2N A;  4ID4 A;  4N1X A;  5EEC A;  3IWI A;  1DJA A;  1IEM A;  4ZJ1 A;  4QY5 A;  3CJM A;  4WZ4 A;  1YMX A;  3HLF A;  1M40 A;  1XPB A;  3G31 A;  3NC8 A;  3G4P A;  3SS3 A;  3WWX A;  4UA6 A;  5AQA A;  1K6S A;  4S2P A;  3UPO A;  3C7V A;  2ZQ7 A;  3FZC A;  4JF6 A;  4P6B A;  4QHC A;  1HVB A;  3UPP A;  2A3U A;  3NIA A;  4WYY A;  1W8Q A;  2EFX A;  4N92 A;  1SKF A;  4KEN B;  4GDN A;  2OLU A;  4JKT A;  1LHY A;  4RVA A;  1NZU A;  3GMW A;  4R3J A;  2ZQA A;  4BL3 A;  2VGJ A;  4GZB A;  3SS4 A;  1AXB A;  5DTK A;  4OPR A;  3Q82 A;  2XLN A;  3MZF A;  4WMC A;  5AQB A;  4QU3 A;  2RCX A;  2WGI A;  5E2F A;  4UHU A;  3QNB A;  1ES5 A;  3Q7Z A;  1BSG A;  1I5Q A;  4JXS A;  4E6X A;  1FOF A;  5E2E A;  4QY6 A;  4JF5 A;  1N4O A;  5GHZ A;  1IYO A;  3BFG A;  2WGW B;  3E2L A;  3O86 A;  4UA7 A;  1K57 C;  4OOM A;  3PAE A;  4FD8 A;  3G2Z A;  5DTT A;  4EBL A;  2Y91 A;  2XFS A;  4E6W A;  3FWL A;  1K57 A;  4GOG A;  4EV4 A;  5CEC A;  1JVJ A;  5M19 A;  1MY8 A;  4KZ6 A;  3D4F A;  5M18 A;  2ZM2 A;  1E3U A;  1IKI A;  1ES3 A;  4XUX A;  1BUL A;  3BLS A;  3E2K A;  5EPH A;  4ZAM A;  2HDQ A;  4OOL A;  4PM9 A;  4YFM A;  5J8X A;  4B88 A;  3O3V A;  3BEB A;  4U3T A;  1HTZ A;  2BG1 A;  4BEN A;  3O88 A;  3M2K A;  1PWC A;  3IHA A;  4EQI A;  1YLW A;  2JC7 A;  1YM1 A;  3OPH A;  1PI5 A;  4S2L A;  4GKU A;  1S0W A;  2WAF A;  2WGW A;  5JYO A;  4IVI A;  1Y54 A;  3LY4 A;  4E3J A;  4HBU A;  2EX9 A;  1MBL A;  1SDN A;  3VFH A;  5HAR A;  4GN2 A;  1YLT A;  2P74 A;  4WEJ A;  4KZB A;  3ZVT A;  4RA7 A;  3IXB A;  5HFO A;  3V5M A;  3P09 A;  3GTC A;  1W8Y A;  3HUO A;  1EI5 A;  4X56 A;  2Y4A A;  2OSU A;  2EXB A;  3IH9 A;  2IWB A;  1K54 C;  3IXD A;  3HBR A;  4GD6 A;  4LV1 A;  3C4P A;  4KZ7 A;  3EQV A;  1IYP A;  1NRF A;  1ONG A;  1TDG A;  4WZ5 C;  3VMA A;  5HW3 A;  3W4Q A;  5I94 A;  4WEK A;  4OH0 A;  3MZE A;  4KZ8 A;  5CRF A;  3S4X A;  4C75 A;  5FI7 A;  4E3L A;  5L2F A;  5F1G A;  1BLS A;  1ESU A;  1W5D A;  3IXG A;  2CC1 A;  3AGD A;  1H8Y A;  3BLM A;  3EQU A;  4MLL A;  3BFE A;  2X71 A;  1H5X A;  4DDY A;  5TFQ A;  3BYD A;  4Y0U A;  2Q9N A;  5GHY A;  4OPZ A;  3C5A A;  4K0X A;  4KZA A;  5BOH A;  3PBS A;  1PZP A;  3LO7 A;  1NYY A;  1GHP A;  2Y2Q A;  3VOZ A;  5EOO A;  4DF6 A;  2GDN A;  4R4R A;  4DE0 A;  4E3M A;  4S2J A;  1E4D A;  1ES4 A;  3ZGA B;  4X53 A;  4M3K A;  5FI6 A;  3WS4 A;  4RX2 A;  3VOY A;  4GD8 A;  1LLB A;  1GCE A;  1WYC A;  2ZQC A;  4PPR A;  2Y2O A;  1ZKJ A;  3W4P A;  1BUE A;  2DNS A;  4NET A;  5KSH A;  2Y2K A;  5DTS A;  2WZZ A;  1L0E A;  3GRJ A;  3MXS A;  3N8L A;  3IXH A;  5CGX A;  1K56 A;  4F94 A;  2G2W A;  1KDW A;  3V50 A;  1IKG A;  3G32 A;  4QD4 A;  2HPB A;  1FQG A;  4CJN A;  4DDS A;  1GHM A;  2EX8 A;  4ZJ2 A;  3ZDJ A;  2PU4 A;  3V3S A;  3GR2 A;  2JBF A;  3C4O A;  2Y2G A;  1I2W A;  2QPN A;  4MEZ A;  1FSW A;  4BQM A;  2XDM A;  1BTL A;  1CK3 A;  3G35 A;  4KZ5 A;  5KSC A;  4B4X A;  3B3X A;  2Z2M B;  1MWS A;  1OME A;  5GLB A;  3AGF A;  3VP0 A;  2BLS A;  3RJU A;  2DRW A;  4MNR A;  5EOE A;  1ZG6 A;  4DRT A;  1XP4 A;  3MBZ A;  2P9V A;  5CED A;  3RXW A;  5FAT A;  3PBT A;  4UA9 A;  1YLY A;  4KG6 A;  2Y2M A;  3N4I A;  3NDG A;  2Y2J A;  3PBQ A;  5CHJ A;  3TOI A;  2Q9M A;  5EVI C;  5DVA A;  1BLC A;  5EVI B;  1ZC2 A;  1BZA A;  1FCM A;  3VP3 A;  4R4S A;  2OLV A;  2ZC6 B;  2ZD8 A;  5FQJ A;  3WS2 A;  4GNU A;  1MWU A;  1ERQ A;  4PMA A;  5E43 A;  1JWP A;  3HUM A;  2HP9 A;  2JCH A;  4H8R A;  5A90 A;  1PW8 A;  3IF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...