1TDLA

Structure of ser130gly shv-1 beta-lactamase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMGDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Inhibitor-resistant class A beta-lactamases: consequences of the Ser130-to-Gly mutation seen in Apo and tazobactam structures of the SHV-1 variant
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 97
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1tdlA00
4KZ4A 3V3SA 1IKIA 2QPNA 2EXBA 3IF6B 3IXHA 4KQRA 4OQIA 1MWUA 1M40A 4X53A 5FA7A 1W8QA 3IWOA 5CGSA 5FSRA 2PU2A 4K0XA 4S2MA 4WZ5C 4RYEA 3ZGAB 3BFFA 4U3TA 3ZNYA 2EFXA 1I2SA 3FYZA 2JBFA 3HLFA 3PBNA 4WBGA 5HAQA 4JXSA 4R0QA 3VOYA 4QD4A 2WK0A 4PM9A 1OMEA 1XP4A 5TR7A 1IELA 4QJGA 2XH9A 1LLBA 5HL1A 5A90A 5CECA 1FR6A 4PM7A 5EE8A 4BD0A 1KE3A 1PWDA 4PMAA 5DF7A 3GTCA 3GSGA 3G2YA 2EX9A 5GLAA 3WS4A 5CERA 4B4ZA 1IYOA 3Q07A 2JCHA 2Y2NA 2H5SA 4S2NC 3M2JA 1CI9A 3O88A 1FCNA 4OONA 3HLGA 3Q82A 1PZOA 3HBRA 3DW0A 2C6WB 3G31A 3WWXA 1MXOA 3C4PA 1K54C 4WZ5A 5E2EA 1RP5A 1MBLA 5FQKA 3MXRA 1XPBA 2XEPA 4MBKA 4Y0OA 5L2FA 3UDXA 3LEZA 2PBYA 2WUQA 1EI5A 2XD5A 4JXGA 4N1HA 2HDQA 1EROA 2H0YA 4R4RA 1L0DA 3C7UA 1ALQA 4QY6A 1L0GA 2OLUA 2V20A 3HREA 5EOEA 1K57A 3MKEA 4ZBEA 5M1AA 1L0EA 1IEMA 3LY3A 4IEDA 4WMCD 1BZAA 3NIAA 5FATA 1FOFA 2Z2MB 4X68A 1RGZA 2FFYA 3IH9A 2XD1A 3FWLA 4HBUA 1GA0A 1PZPA 4S2NA 4BL3A 4PM5A 1CI8A 4KG5A 4N9LA 2IWDA 3SS3A 5CHUA 4JF6A 1W7FA 3ZHHA 4UA7A 5GLDA 3SH7A 1QMFA 3PBOA 4IVKA 4WEKA 5EECA 1E25A 3BFDA 1K54A 1ZC2A 2Y2JA 3DWZA 2Y2IA 4C3QA 3QNBA 5EVIC 3VP3A 3PBQA 4UAAA 4OP5A 2ZC7A 4X69A 1JWVA 3UO9A 1LI9A 3E2KA 2A49A 3Q81A 4WM9A 1VQQA 2HDUA 2X01A 2Q9NA 1O07A 1FCMA 1L2SA 4OLDA 2E8IA 1NY0A 1NZUA 4H8RA 4LV3A 1LL5A 2Y55A 1YLTA 1VM1A 4OKPA 4U0XA 4LV2A 1KGEA 3TSGA 3ZG5A 1MWTA 4P85A 3AGFA 1GHMA 2ZD8A 5HW3A 2Y2LA 5A92A 4OPRA 1IKGA 5GHZA 3SH9A 2HDSA 2HDRA 3N8SA 4KZBA 1QMEA 3ZG8B 4OH0A 5F1FA 1JWZA 5KMWA 1U60A 2V2FF 3ZDJA 2EXAA 3W4OA 5CTNA 4E3NA 1Q2PA 2HP9A 2CC1A 5FQIA 4BD1A 3HVFA 3HUNA 4X55A 3OCNA 5EVIA 1NXYA 4N9KA 2EFUA 4FSFA 1YT4A 3I7JA 3UNWA 1ES4A 4NETA 3GMWA 4LENA 5CHJA 2XK1A 5TFQA 2R9XA 4OVDA 1IYQA 4MEZA 1IYPA 3UDIA 4PPRA 4ZJ1A 2BG1A 3M6BA 3O86A 4EQIA 1BLPA 4DXCA 1K4FA 2WAEA 3ISGA 1ZG4A 3MZFA 4KZ8A 4WELA 4OOLA 2XF3A 4BL2A 1SHVA 4GDNA 4E3IA 3CG5A 1XGIA 1ES3A 4P87A 3GQZA 5FI2A 5M19A 3G4PA 3VP4A 3N6IA 3UN7A 4R4SA 4CPKA 5JYOA 2UWXA 4Y0TA 3GR2A 3IXDA 4DRTA 5KSHA 4PM8A 1N9BA 4A5RA 4S2KA 5FASA 3JYIA 1WE4A 2Y2GA 1ESUA 5HFOA 3S1YA 5JYPA 5E2GA 2P9VA 3IQAA 1MWSA 3VSKA 2ZC6B 3OPLA 1PW1A 3MXSA 2Y2OA 1K4EA 2WGWA 3N8LA 4ZJ3A 5EPHA 4X6TA 4ID4A 4DKIA 4GNUA 5HARA 1K55A 3NBLA 3VOZA 1KGFA 3QNCA 1ZKJA 1TVFA 5D3OA 4DXBA 2BLSA 2EX6A 1E4DA 5G18A 5E2FA 1C3BA 3BYDA 5U47A 1ES2A 1MWRA 3NY4A 3NCKA 3G32A 5GHXA 2HP5A 3LY4A 3PTEA 1BLSA 4FCFA 4S2JA 5F82A 4UA9A 4KZ9A 2ZQ9A 5KZHA 4MBFA 4GDBA 5EUAA 4KZ5A 2J8YA 3MZEA 5IHVA 4OPQA 4OLGA 1JTDA 3C4OA 3Q7VB 4OQGA 4Y0UA 1XGJA 3HLEA 3IXGA 3CMZA 1GHPA 5FI6A 4R3BA 4E3OA 3IWQA 4LV0A 1LI0A 2Y2QA 4DE3A 2ZQCA 5EOOA 5CXWA 4MLLA 2ZM8A 5FQ9A 5BOHA 4EV4A 3NDGA 4ZTKA 4B88A 3V3RA 1JVJA 4OP8A 4BENA 3IF6C 1E3UA 5GLCA 2FFFB 4MNRA 4KZ3A 4ZAMA 5CEBA 3BLMA 1MKIA 4FH4A 1K56A 5FAOA 4EWFA 1GHIA 4DF6A 1BULA 3VMAA 3M2KA 1ERQA 3OPPA 2H10A 2J9OA 1G68A 4JKTA 5CTMA 4DDYA 2DNSA 3BFCA 1YMSA 4E3JA 3SOIA 3HUOA 3W4PA 3A3FA 3S22A 3VFFA 1BLCA 3EQVA 1YLJA 3GVBA 1ZG6A 2Y4AA 4E6WA 2ZJ9A 5J8XA 3TOIA 3WRTA 4EBPA 5CGWA 2WGIA 3G34A 1XKZA 2HPBA 3SS4A 3G2ZA 4GB7A 2JC7A 3BRMA 2IWCA 3GV9A 4P6BA 4ZDXA 2WKEA 1FSYA 2QMIA 4JF4A 1FCOA 5CEDA 1K25A 2WGWB 1WYCA 4D2OA 3DTMA 3OC2A 5DTTA 4B4XA 3N8RA 1LHYA 1I2WA 3W8KA 4BJPA 4XUXA 3W4QA 2XFSA 3A3JA 3ITAA 3O87A 4FH2A 1KGGA 5CHMA 1PI4A 4RX2A 5AQBA 4UA6A 1SDEA 5FDHA 5FQMA 3MZDA 3EQUA 2I72A 4FD8A 4L0LA 1YLWA 3ZG0A 3B3XA 5EVID 3GRJA 2RL3A 1FSWA 4YINA 3ZFZA 5FQJA 2ZC4B 1YLPA 3P98A 5FQQA 2PU4A 1KVMA 1S6RA 1PWCA 2R9WA 5FAQA 1BSGA 1HVBA 3RXXA 1Y54A 3HLBA 3VP2A 1FQGA 2WAFA 1PI5A 3HLWA 5DF8A 3HLDA 4S2LA 4KQOA 3ZVWA 3DWKA 5I94A 3OZHA 4OPZA 4E3MA 4KG6A 2Y59A 3SS5A 3NDEA 1G6AA 2WADA 1HZOA 3HUMA 4GOGA 4LCMA 2Z2LB 3IHBA 2ZC5B 3S4XA 1GA9A 2H0TA 2ZM2A 3V39A 2Y2PA 1HD8A 1GCEA 1BLHA 4JXVA 1PIOA 1RCJA 1YLZA 5DF9A 3WS1A 5CGXA 4EBNA 1XA1A 4NK3A 1K6SA 4JXWA 1KE0A 5CRFA 2DRWA 1Q2QA 4F94A 3G35A 5DVAA 4DE1A 1L0FA 1ES5A 1RGYA 2X02A 4RX3A 4Q8IA 1WYBA 1KVLA 2A3UA 3BECA 5AQ9A 2WZXA 3UPOA 4KENB 2J9PA 5HAIA 2G2UA 4WYYA 5FAPA 4OOYA 5F83A 3AGDA 3ZG9B 2ZM0A 4JLFA 2WGVA 1FR1A 3UDFA 4GD6A 1W8YA 1N4OA 1O7EA 2ZQ8A 1EWZA 1H5XA 4LCLA 4S2IA 1NZOA 2B5RA 2Y2KA 4S2OA 2G2WA 2HP6A 2Y91A 5TGFA 1BT5A 3BEBA 4HBTA 5E2HA 4DDSA 1YM1A 2WYXA 2P74A 3VP1A 2QZ6A 3FZCA 4XUZA 3A3EA 2OSUA 1K6RA 5HAPA 1W79A 2ZQ7A 1K57C 3RJUA 1NYYA 3E2LA 3MKFA 3LO7A 3PBTA 3Q7ZA 5EVIB 3IHAA 5AQ7A 3VFHA 1TDGA 3UPPA 4X56A 2XDMA 3ZG7B 5M18A 2X71A 3N7WA 2OLVA 4ZJ2A 1DJCA 5HX9A 1DY6A 4MBHA 3OPHA 1M6KA 4Z9QA 4R1GA 1W5DA 1E3UD 4KZ7A 3BM6A 3VSLA 1AXBA 4N1XA 4OOMA 2OV5A 1YMXA 3MBZA 3N4IA 4JF5A 4BLMA 4E6XA 3Q1FA 3WS5A 1PW8A 1K56D 3ZNTA 4U0TA 1YLYA 3M6HA 1IYSA 2VGJA 3HLCA 1ERMA 2WKIA 4UHUA 3WS2A 3OPRA 4KQQA 4DE2A 3CZDA 3OCLA 1JTGA 3MFDA 1CEFA 5F1GA 3C7VA 5FI7A 3IT9A 4KG2A 2RCXA 4RA7A 4Y7PA 4YFMA 4WMCA 1SCWA 1J9MA 3C5AA 3RXWA 4R3JA 1XA7A 4GN2A 4M3KA 4CJNA 3UE3A 3WRZA 3IH8A 4OPYA 1CEGA 3G30A 4PM6A 3IF6A 3UE1A 2P9VB 2XLNA 1SKFA 3VP0A 4QU3A 1SDNA 3BFGA 4LV1A 4GD8A 4K91A 3ZVTA 3IF5A 2IWBA 1PWGA 1I5QA 4EUZA 2C5WB 2Y2MA 4DE0A 3BFEA 3NI9A 1CK3A 1KDWA 5GL9A 3LCEA 2EX8A 4E3KA 1DJAA 1ONHA 1S0WA 2JE5A 3QHYA 4XXRA 4K0WA 5GHYA 3FKVA 1MY8A 2ZC3B 4KZAA 5AQAA 3PAEA 5E43A 3V50A 1Z6FA 2XFTA 4HEFA 3BLSA 2DCFA 5KSCA 3IXBA 1MPLA 1ONGA 1ESIA 4S2PA 3HL9A 1TDLA 2ZMAA 3PBRA 3ITBA 4QHCA 3TG9A 1DJBA 4EBLA 4N92A 2WZZA 4IBRA 1LL9A 1YQSA 3ZCZA 3PBSA 3UE0A 5A93A 3NC8A 1KDSA 2Q9MA 4IBXA 2J7VA 4RVAA 2XGNA 1BUEA 4OQ0A 1BTLA 1H8ZA 3V5MA 1NYMA 3Q7VA 2XR0A 2EX2A 1TEMA 3UY6A 1JWPA 1H8YA 4QB8A 1XXMA 4C6YA 3CJMA 4GKUA 1NRFA 4WZ4A 3A3IA 2XQZA 5DTKA 2ZLYA 3IWIA 5GLBA 4JBFA 3PAGA 2GDNA 4E3LA 1K38A 1KE4A 1NJ4A 2VGKA 5EVLA 2Y2HA 4KZ6A 5DTSA 1PYYA 3FV7A 3P09A 3UPNA 3AGEA 4R23A 2ZQAA 3D4FA 4QY5A 4WEJA 1HTZA 1XX2A 2V1ZA 3O3VA 1K55C 4GZBA 3A3DA 3FKWA 4O7DA 4BQMA 5A91A 3SH8A 3WS0A 2WKHA 4JPMA 2ZQDA 4P0MA 4IVIA 4OQHA 4C75A 4HESA
chains in the Genus database with same CATH superfamily
3LI8A 1IKIA 4D2OA 1KOUA 3IWOA 5CGSA 2PU2A 1FILA 4S2MA 4WZ5C 3ZGAB 3BFFA 4U3TA 2R78A 2PR6A 3R4KA 4JXSA 5TBMA 4QD4A 1OMEA 1XP4A 4HY8A 1IELA 4QJGA 3HCYA 5HL1A 3TJZC 5A90A 2LB9A 1FR6A 3BQ8A 4BD0A 2EX9A 4KUKA 5CERA 4B4ZA 4HI4A 4DJ2A 3LI9A 2JCHA 2VEAA 2Y2NA 2H5SA 1CI9A 5L09A 4OONA 4LRZE 3HBRA 3WWXA 3C4PA 4WZ5A 1YAXA 1XPBA 3CHWP 4Y0OA 2XD5A 2HDQA 1EROA 1ALQA 2HGVA 3CPTB 5EFWA 3MKEA 4ZBEA 1L0EA 4IEDA 3KSIA 3NIAA 3QP8A 1T1AA 2O9CA 4HP4A 2FFYA 4BL3A 2XD1A 4HBUA 4PM5A 4KG5A 3SS3A 3KYZA 3CLOA 3ZHHA 4ARZA 5GLDA 3SH7A 4WEKA 5EECA 1E25A 3DWZA 5L8MA 1STZA 4UAAA 1LI9A 3B47A 3LIFA 2HDUA 1FCMA 2E8IA 5TBMB 2Z6CA 3R7WA 1KGEA 3ZG5A 1MWTA 5A92A 1IKGA 2HDSA 3N8SA 5F1FA 3ZDJA 3W4OA 1Q2PA 5FQIA 5HPFA 3RH8B 3OCNA 2EFUA 3I7JA 3UNWA 4NETA 5CHJA 5TFQA 4KQDA 2EA9A 4MEZA 3UDIA 4ZJ1A 2P08A 1BLPA 4DXCA 2AVXA 4R70A 3NOTC 4BL2A 3QP6A 2PAVP 4HJ4A 3S7OA 4P87A 3GQZA 5FI2A 2NUTC 5I5LA 4R4SA 2UWXA 1S1ZA 4NXEA 2YKFA 3GR2A 2K31A 5KSHA 4PM8A 3DBAA 3JYIA 1WE4A 2Y2GA 5EM1A 5JYPA 4MN6A 1S67L 2ZMVA 1MWSA 5EV0A 1NWZA 2ZC6B 4Y13A 2Y2OA 4ZJ3A 5EPHA 4ID4A 2GJ3A 5HARA 3NBLA 3H9WA 1KGFA 2EX6A 2B95A 1NRJA 1MWRA 3NY4A 1BLSA 5F82A 3FC7A 1VETA 3Q7VB 1GHPA 5FI6A 5DJTA 2D02A 2Y2QA 5CXWA 5HWWA 2ZM8A 5FQ9A 2VJWA 3V3RA 3LYXA 4ZAMA 1MKIA 1DP6A 1K56A 4DF6A 2J9OA 1G68A 4G3KA 2DNSA 4E3JA 4EU0A 3HUOA 3S22A 1XJ6A 1YLJA 4E6WA 2GNXA 3WRTA 3E4PA 3T50A 3G34A 3A0SA 2IWCA 1S4RA 1FSYA 2W3HA 1WYCA 3DTMA 3OC2A 5DTTA 4B4XA 4BJPA 5CHMA 4BBUA 1SDEA 5FDHA 3MZDA 2I72A 4FD8A 1PRQA 4YINA 1FSWA 3S7PA 2V1AA 1S6RA 2R9WA 1Y28A 3RXXA 1Y54A 3HLBA 1VEUA 2PT7A 2NUPC 5J7EA 2WAFA 4BBTA 3HLDA 3VE4A 3OZHA 1OJ5A 4Y5FA 5IU1A 1HZOA 1GA9A 2ZM2A 2O9BA 1JNUA 1PIOA 1YLZA 5DF9A 1NLYA 1XA1A 1L0FA 2XRNA 2X02A 2A3UA 3QP4A 4FOFA 4WYYA 5F83A 4OOYA 4JLFA 1FR1A 4ME4A 1G6OA 2B18A 5FEGA 3T4OA 2Y2KA 2OAP1 3NECA 4S2OA 2G2WA 2Y91A 5DJUA 5E2HA 4DDSA 1YM1A 1P97A 3VP1A 3DTIA 5HAPA 3MSHA 2VV8A 5EVIB 3T1XA 1DJCA 4FUWA 1DY6A 5HZHA 3OPHA 2HJEA 1VEUB 4R1GA 2KX6A 4KZ7A 3BM6A 1L3LA 2EWVA 3O5YA 3PR6A 1PW8A 2JKTI 4UHUA 3WS2A 2WKQA 3MFDA 3IT9A 4CLCD 4WMCA 4X1LA 2Q0OA 3RXWA 1XA7A 4EERA 4GN2A 4Q0IA 1N9LA 3WRZA 3LICA 4CLCE 4PM6A 3UE1A 1LSWA 5F5YA 1SKFA 3VP0A 4LV1A 3T4TA 2C5WB 3HJIA 1KDWA 5GL9A 3ZYTA 4HQAA 1VHMA 1DJAA 1HLUP 3LR0A 2J3WA 2QJ5A 1MY8A 4KZAA 4Y17A 5AQAA 2J80A 4LLOB 5E43A 3V50A 1Z6FA 4HEFA 2DCFA 2L1MA 1MZUA 3RTYA 4Y2FA 2Y79A 3NC8A 5AJGA 5DKKA 1NYMA 2LB5A 2XR0A 1TEMA 1XXMA 5DTKA 2PD7A 3PAGA 2GDNA 1K38A 2V8FA 3AGEA 3E4OA 4QY5A 4JGQA 2V1ZA 1K55C 1G5UA 4B9OA 4UEYA 4HESA 2EXBA 4HH2A 4OQIA 3IXHA 1CF0A 4QWOA 5FSRA 4IUHA 3QP2A 3LR4A 2QHKA 2EFXA 1I2SA 3HLFA 3PBNA 2BASA 4R0QA 2WK0A 4R6LA 2XH9A 1LLBA 5CECA 3KYEA 4NEED 1PWDA 5DF7A 3GTCA 5HDCA 3G2YA 4L9EA 3WS4A 1IYOA 4JGOA 1YSQA 1LL8A 1FCNA 4LFUA 1S4SA 1A0KA 1AWIA 5E2EA 4WLAA 4CLCC 1MBLA 2XEPA 4GHIA 4R4RA 1K57A 4MN7A 3LY3A 1FOFA 1RGZA 1GA0A 1CI8A 3NULA 1PNEA 5CHUA 1W7FA 1XJ2A 3OOVA 4H6JA 1ZC2A 3VP3A 2ZC7A 3BW6A 2UV0E 3UO9A 1DP8A 2A49A 1H8MA 1NY0A 1NZUA 4R38A 2Y55A 1YLTA 4P85A 3AGFA 2ZD8A 5TJJA 2L0WA 2W1TB 1QMEA 3BQAA 1K0KA 1JWZA 1U60A 2V2FF 5CTNA 2HP9A 2CC1A 4X55A 3V67A 5F68A 1NXYA 4N9KA 4FSFA 1ES4A 4OVDA 1IYPA 3M6BA 3O86A 1K4FA 2WAEA 4F3LA 4KZ8A 4WELA 2KOIA 3FPWA 2P7JA 3EWKA 1V9ZA 3UB9A 1ES3A 4EEUA 2V0WA 2XSSA 3N6IA 4CPKA 3C30A 3VOLA 3A0VA 3H82B 2VA0A 1ESUA 1W63Q 3CUEC 5HFOA 3LIBA 5E2GA 2A24A 3IQAA 1SZVA 3VSKA 1PW1A 1K4EA 5D3OA 4DXBA 1XJ4A 5U47A 2H28A 3NCKA 3G32A 3NOPC 3PTEA 4S2JA 4FCFA 4KZ9A 2ZQ9A 4GDBA 5EUAA 5IHVA 1MC0A 4OPQA 1JTDA 4R3BA 3IWQA 4LV0A 3CUEA 4PAUA 4NXBA 4EV4A 3OBFA 3LGOA 3MF0A 1JVJA 4OP8A 3IF6C 3MFXA 4MNRA 1TF1A 3BLMA 2JKTM 4EWFA 1GHIA 4UQIM 5CTMA 3JPUA 3BFCA 1YMSA 3K3CA 2I9VA 2W3GA 3VFFA 4GLQA 5J8XA 2JHEA 1XKZA 4LGWA 4I39A 3SS4A 1T19A 4GB7A 3GV9A 4P6BA 2HJ9C 2QMIA 5CEDA 1K25A 1SKOA 1I2WA 1IOUA 4XUXA 2XFSA 3ITAA 1XJ3A 2ACGA 3QP1A 3ZG0A 5L10A 1N9NA 5EVID 2RL3A 2VX8A 5FQQA 1PWCA 4DJ3A 5FAQA 1IFQA 3F1NA 1PI5A 3HLWA 5DF8A 4S2LA 5I94A 3SW1A 4E3MA 4KG6A 3UB6A 2VV6A 3F1OA 4GOGA 2PBDP 3IHBA 1XFNA 4ARZB 5CGXA 3BWLA 3G6OA 4NK3A 4JXWA 1KE0A 2DRWA 4F94A 3G35A 2JKGA 1UWNX 3LEQA 1ES5A 1RGYA 4Q8IA 5HSQA 3D72A 3EGXC 4K08A 4HH3A 2ZM0A 4MDZA 3R7WB 3T4KA 2J3TD 5IT5A 1H5XA 2V1BA 1NZOA 1SKOB 2A2LA 3KX0X 1BT5A 3DTKA 3BEBA 4HBTA 2OSUA 1K6RA 2ZQ7A 3E2LA 3MKFA 3LO7A 3Q7ZA 3IHAA 1YSPA 3L7HA 3VFHA 2XDMA 2X71A 1OT9A 5HD5A 4EETB 1W5DA 1E3UD 3LIDA 4N1XA 1VB6A 3MBZA 3N4IA 4BLMA 3ZNTA 4U0TA 3M6HA 3HLCA 1ERMA 2WKIA 3UB7A 2W3FA 3MS6A 4KQQA 1ZTUA 1CEFA 5F1GA 3C7VA 4RA7A 1S1YA 4NKPA 4B93A 2OAQ1 3IH8A 4OPYA 1CEGA 4QU3A 3BFGA 2VK3A 3IF5A 4EUZA 4YWZA 5FL3A 2WKRA 4I5SA 4P6ZM 1S0WA 4Y15A 3HJKA 3F1PA 5GHYA 1FIKA 1LSVA 1VETB 2XFTA 3IXBA 1ESIA 3PBRA 4WF0A 2L4RA 4I3AA 1DJBA 4N92A 3NHQA 4IBRA 1LL9A 3ZCZA 2CMNA 2Q9MA 2XGNA 1BUEA 4DMZA 4BWIA 3V5MA 2B02A 3T4JA 1H8YA 4C6YA 3JVUA 3UB5P 3A3IA 3IWIA 1F9IA 2K7SA 5J4EA 3MQOA 1KE4A 1UGUA 5DTSA 1PYYA 3FV7A 2KDKA 3P09A 3UPNA 3D4FA 1D1JA 4WEJA 1HTZA 4NXFA 5HWTA 4FTXA 4JPMA 4P0MA 4HJ3A 2QKPA 3V3SA 2QPNA 4X53A 2HF6A 3H7WA 1MWUA 2JKFA 1W8QA 4PHTA 4O0PA 4HOIA 4RYEA 4HHDA 4PM9A 4MCWA 5TR7A 4EQ1A 2V8CA 4PM7A 3GSGA 2HZ5A 5GLAA 3EEHA 4S2NC 2BTFP 3O88A 3NOUC 3HLGA 3Q82A 1PZOA 4UQIS 3LIEA 3DAVA 1K54C 1RP5A 3MXRA 4X25A 4MBKA 5L2FA 3LEZA 4N1HA 2H0YA 1L0DA 4QY6A 1L0GA 4NXGA 4EXOA 3C8CA 2K2NA 5M1AA 2PYRA 2W27A 5A93A 4X68A 3TRCA 4S2NA 2IWDA 4IJGA 4Q0JA 3EEAA 4UA7A 1OTBA 2QJ7A 1GSVA 1QMFA 3NJAA 4I3JA 3BFDA 1K54A 3H7WB 1MKMA 3QNBA 3CAXA 4X69A 5C5KA 4WM9A 1TS8A 2Q9NA 2KLIA 4OLDA 1L2SA 1VM1A 3LR5A 3C38A 4OKPA 1Y4OA 5HW3A 1GHMA 2Y2LA 4OPRA 5DFXA 5GHZA 3SH9A 3P7NA 4Z1WA 2HDRA 4KZBA 3ZG8B 4OH0A 2EXAA 4E3NA 1XFQA 3HVFA 1P9RA 2YKHA 1OJGA 3IS2A 1YT4A 2XK1A 3KYQA 2VGLM 1TS0A 4PPRA 2BG1A 1OTEA 3MZFA 4GW9A 1UWPX 3A0RA 2XF3A 3LIAA 1SHVA 4E3IA 3CG5A 4X1MA 1OTDA 4KUOA 2W1RA 5FDSA 5M19A 3G4PA 2GX5A 3VP4A 3UN7A 5JYOA 4DRTA 1N9BA 3T1QB 4S2KA 3MMHA 2Z6DA 2P9VA 3N8LA 3MXSA 4DKIA 4X6TA 4GNUA 1K55A 3VE3A 3VOZA 3QNCA 1ZKJA 1TVFA 3P01A 2BLSA 1E4DA 5E2FA 1C3BA 1ES2A 3S7NA 1CQAA 5GHXA 3LY4A 2EWWA 5KZHA 4MBFA 2J8YA 4LRXC 5IS1A 4OLGA 3C4OA 4Y0UA 4OQGA 1XGJA 3IXGA 3BY9A 2JKRI 1LI0A 4DE3A 2ZQCA 4GS9A 5EOOA 4MLLA 4ZTKA 4B88A 2FFFB 2WKPA 5CEBA 3ICYA 4FH4A 2QWSA 5FAOA 2OWHA 3VMAA 3M2KA 1X0OA 2H10A 1H0MA 3KO6A 3SOIA 3W4PA 3KSGA 3A3FA 4P6ZS 1BLCA 4CLCA 3GVBA 2ZJ9A 3UB8A 3ULFA 2HPBA 1CJFA 5CX7A 2JC7A 2Y8HA 3IX3A 3MR0A 3LR3A 4JGRA 4ZDXA 2WKEA 4I38A 5FEFA 1W63M 1LHYA 3IBRA 3O87A 3MJQA 5AQBA 5FQMA 3EQUA 4L0LA 5FQJA 2V0UA 3P98A 1KVMA 4PKYG 4YOFA 4Y3IA 4GS9B 3VP2A 4GHIB 4KQOA 4OPZA 3SS5A 1GSWA 3NDEA 1G6AA 3T1SA 4LCMA 2ZC5B 3S4XA 2H0TA 3V39A 2Y2PA 4MMNA 3CPTA 3WS1A 1H3QA 4EBNA 3D9YA 5CRFA 4H6JB 2M1CA 1N9OA 4CLCB 4RX3A 3BECA 2VZWA 4HIAA 4DN0A 3UPOA 5FAPA 3AGDA 3U4LP 2WGVA 3UDFA 2ZQ8A 1O7EA 4LCLA 2B5RA 4LPZA 2HP6A 5TGFA 4LRYC 2P74A 3FZCA 4JGPA 4XUZA 1W79A 4MN5A 2GZAA 2W0NA 1TDGA 5M18A 4X56A 3ZG7B 5HX9A 3C2WA 1M6KA 4Z9QA 4F3LB 4IUKA 3VSLA 1AXBA 2OV5A 4E6XA 1YMXA 4JF5A 4AFIA 3Q1FA 1K56D 5HDDA 2VGJA 3OPRA 5HD3A 1JTGA 3MXQA 1OTAA 2ZL1A 3E98A 2RCXA 4Y7PA 4YFMA 1SCWA 1J9MA 4R3JA 2D01A 5EM0A 3U2AA 3UE3A 4G3WA 3G30A 3IF6A 2A24B 2XLNA 4GD8A 4GCZA 3BFEA 2EX8A 3T12B 3OLOA 2VV7A 4E3KA 1ONHA 4XXRA 3QHYA 2ZC3B 2VGLS 3MQQA 2W3EA 1ONGA 3HL9A 2ZMAA 3ZQ5A 1PFLA 4NG2A 3PBSA 4IBXA 2J7VA 4RVAA 4ZRRA 1H8ZA 4IHQA 3Q7VA 4WUJA 1TS6A 2OWJA 4O8GA 4QB8A 3K2NA 3S7QA 3CJMA 4GKUA 1P9WA 1OT6A 4WZ4A 2XQZA 5GLBA 5EVLA 2XA7M 2Y2HA 2M7VA 3UE6A 2ZL1B 4BQMA 4GZBA 2HV1A 3A3DA 3FKWA 5A91A 3SH8A 3WS0A 2WKHA 2ZQDA 3T4QA 4OQHA 4KZ4A 4WL9A 4HP9A 4KQRA 3IF6B 1M40A 5FA7A 5HPIA 4K0XA 2JN7A 3ZNYA 3FYZA 4WBGA 2JBFA 5HAQA 3VOYA 5EE8A 1KE3A 2MJ6A 4PMAA 4EESA 3TW8A 3Q07A 3RFBA 5L07A 3M2JA 3W2ZA 3F1NB 4GJ4A 5AVFA 3DW0A 2C6WB 4ESPA 2JKRM 3G31A 1MXOA 5DKLA 3F1OB 5FQKA 3UDXA 2PBYA 2WUQA 1EI5A 4JXGA 2DMWA 2W3DA 3C7UA 2OLUA 2PYPA 2V20A 3HREA 5EOEA 1IEMA 4WMCD 4HJ6A 2XROA 1BZAA 5FATA 5HL6A 2Z2MB 3T4LA 3IH9A 3FWLA 2ZOHA 1PZPA 2PD8A 4N9LA 4JF6A 3IX4A 4HNBA 3PBOA 4IVKA 2Y2JA 5HDSA 4C3QA 2Y2IA 5EVIC 3PBQA 4OP5A 1JWVA 3E2KA 3Q81A 1VQQA 2X01A 1O07A 4H8RA 4LV3A 1LL5A 4QPRA 3CI6A 4U0XA 4LV2A 4PKYA 3TSGA 4WN5A 4E04A 1S66L 3FPVA 2PHYA 1GSXA 5KMWA 3L9KA 4BD1A 3HUNA 3PXPA 5EVIA 3TE8A 4CQHA 3GMWA 4LENA 2R9XA 1IYQA 4EQIA 1J3WA 3K3DA 3ISGA 1ZG4A 4OOLA 5K5BA 4GDNA 1XGIA 2J3TC 3D3OA 3SZTA 4Y0TA 4II7A 3IXDA 1F2KA 3IBJA 4A5RA 5FASA 4EW7A 2FH5A 3S1YA 3T1RA 2VLGA 4D60A 3KSFA 3F1PB 3OPLA 2WGWA 5G18A 3BYDA 2O99A 1D7EA 1NLZA 2HP5A 4UA9A 2G7UA 3BJNA 4KZ5A 3MZEA 3E4QA 3T4SA 2O9AA 3HLEA 3CMZA 4E3OA 1G28A 2P04A 3JVVA 1OTIA 5F69A 4L9FA 5BOHA 3NDGA 5AVEA 4BENA 1E3UA 5GLCA 4KZ3A 5KIZA 2OOLA 3CWFA 1EW0A 4EEPA 1BULA 3OPPA 4JKTA 1ERQA 4DDYA 4I3IA 2INWA 5EVEA 5LBRA 3EQVA 1ZG6A 2Y4AA 3TOIA 4EBPA 5CGWA 2ZOIA 2WGIA 3EGDC 3G2ZA 4L9GA 3BRMA 2QYBA 3PYPA 4JF4A 1FCOA 3B33A 2WGWB 3GDIA 4RQ9A 4Q0HA 1DP9A 1ACFA 2IA2A 3N8RA 3W8KA 3W4QA 3A3JA 4FH2A 1KGGA 1PI4A 4RX2A 3UMDA 4UA6A 4YNRA 1ODVA 3LFVA 1YLWA 3B3XA 2PRFA 3EOIA 3GRJA 3PHYA 3ZFZA 1BYWA 2ZC4B 1YLPA 1TD5A 2PU4A 2XA7S 1BSGA 1HVBA 3GECA 4ETXA 1ZHHB 1V9YA 1FQGA 3ZVWA 3DWKA 4M4XA 2Y59A 2WADA 3HUMA 2Z2LB 1LSXA 1F98A 1HD8A 1GCEA 1D06A 1BLHA 4JXVA 5MC7A 1RCJA 3UMEA 4O01A 5DFYA 1K6SA 1Q2QA 3DTEA 5DVAA 4DE1A 3IX8A 1WYBA 1KVLA 1P0ZA 5AQ9A 2WZXA 4KENB 2J9PA 5HAIA 2G2UA 3ZG9B 3QP5A 4GD6A 1W8YA 1N4OA 1EWZA 4S2IA 1Z09A 5A8BA 2WYXA 2QZ6A 3A3EA 1K57C 3RJUA 1NYYA 3PBTA 1T1CA 3IS2B 5AQ7A 2E8JA 5J3WA 2W1TA 2ZMFA 3UPPA 3N7WA 2OLVA 4ZJ2A 4MBHA 2O0YA 2PR5A 3KSHA 1T18A 4R3AA 4OOMA 3WS5A 1YLYA 1IYSA 2PDRA 4DE2A 3CZDA 3OCLA 2M7UA 4EUVA 4XT2A 5FI7A 4KG2A 3C5AA 4M3KA 4CJNA 5F6AA 2FZ0A 2P9VB 1SDNA 3VV4A 4K91A 3ZVTA 2IWBA 1PWGA 1I5QA 2Y2MA 1YPRA 5G4YA 4DE0A 3NI9A 1CK3A 3H82A 3LCEA 2V9AA 3CITA 4ETZA 2JE5A 1YKDA 4K0WA 3MQ0A 3FKVA 3PAEA 3FG8A 5KSCA 4BBVA 3BLSA 1T1BA 1MPLA 4S2PA 1TDLA 5G4ZA 3TG9A 3ITBA 4QHCA 1LT0A 4EBLA 1WA9A 2WZZA 1F5MA 3LUQA 1YQSA 3UE0A 1KDSA 5HWVA 2VKSA 4OQ0A 1BTLA 1TS7A 4BMWA 2EX2A 3UY6A 1JWPA 3B42A 1NRFA 2ZLYA 4G3VA 4JBFA 4E3LA 1NJ4A 2VGKA 1DRMA 4KZ6A 3E0YA 4XT2B 4R23A 2ZBBA 2ZQAA 1XX2A 3O3VA 4O7DA 1OPXA 3BY8A 4C75A 4IVIA
chains in the Genus database with same CATH topology
4KZ4A 3V3SA 1IKIA 2QPNA 2EXBA 3IF6B 3IXHA 4KQRA 4OQIA 1MWUA 1M40A 4X53A 5FA7A 1W8QA 3IWOA 5CGSA 5FSRA 2PU2A 4K0XA 4S2MA 4WZ5C 4RYEA 3ZGAB 3BFFA 4U3TA 3ZNYA 2EFXA 1I2SA 3FYZA 2JBFA 3HLFA 3PBNA 4WBGA 5HAQA 4JXSA 4R0QA 3VOYA 4QD4A 2WK0A 4PM9A 1OMEA 1XP4A 5TR7A 1IELA 4QJGA 2XH9A 1LLBA 5HL1A 5A90A 5CECA 1FR6A 4PM7A 5EE8A 4BD0A 1KE3A 1PWDA 4PMAA 5DF7A 3GTCA 3GSGA 3G2YA 2EX9A 5GLAA 3WS4A 5CERA 4B4ZA 1IYOA 3Q07A 2JCHA 2Y2NA 2H5SA 4S2NC 3M2JA 1CI9A 3O88A 1FCNA 4OONA 3HLGA 3Q82A 1PZOA 3HBRA 3DW0A 2C6WB 3G31A 3WWXA 1MXOA 3C4PA 1K54C 4WZ5A 5E2EA 1RP5A 1MBLA 5FQKA 3MXRA 1XPBA 2XEPA 4MBKA 4Y0OA 5L2FA 3UDXA 3LEZA 2PBYA 2WUQA 1EI5A 2XD5A 4JXGA 4N1HA 2HDQA 1EROA 2H0YA 4R4RA 1L0DA 3C7UA 1ALQA 4QY6A 1L0GA 2OLUA 2V20A 3HREA 5EOEA 1K57A 3MKEA 4ZBEA 5M1AA 1L0EA 1IEMA 3LY3A 4IEDA 4WMCD 1BZAA 3NIAA 5FATA 1FOFA 2Z2MB 4X68A 1RGZA 2FFYA 3IH9A 2XD1A 3FWLA 4HBUA 1GA0A 1PZPA 4S2NA 4BL3A 4PM5A 1CI8A 4KG5A 4N9LA 2IWDA 3SS3A 5CHUA 4JF6A 1W7FA 3ZHHA 4UA7A 5GLDA 3SH7A 1QMFA 3PBOA 4IVKA 4WEKA 5EECA 1E25A 3BFDA 1K54A 1ZC2A 2Y2JA 3DWZA 2Y2IA 4C3QA 3QNBA 5EVIC 3VP3A 3PBQA 4UAAA 4OP5A 2ZC7A 4X69A 1JWVA 3UO9A 1LI9A 3E2KA 2A49A 3Q81A 4WM9A 1VQQA 2HDUA 2X01A 2Q9NA 1O07A 1FCMA 1L2SA 4OLDA 2E8IA 1NY0A 1NZUA 4H8RA 4LV3A 1LL5A 2Y55A 1YLTA 1VM1A 4OKPA 4U0XA 4LV2A 1KGEA 3TSGA 3ZG5A 1MWTA 4P85A 3AGFA 1GHMA 2ZD8A 5HW3A 2Y2LA 5A92A 4OPRA 1IKGA 5GHZA 3SH9A 2HDSA 2HDRA 3N8SA 4KZBA 1QMEA 3ZG8B 4OH0A 5F1FA 1JWZA 5KMWA 1U60A 2V2FF 3ZDJA 2EXAA 3W4OA 5CTNA 4E3NA 1Q2PA 2HP9A 2CC1A 5FQIA 4BD1A 3HVFA 3HUNA 4X55A 3OCNA 5EVIA 1NXYA 4N9KA 2EFUA 4FSFA 1YT4A 3I7JA 3UNWA 1ES4A 4NETA 3GMWA 4LENA 5CHJA 2XK1A 5TFQA 2R9XA 4OVDA 1IYQA 4MEZA 1IYPA 3UDIA 4PPRA 4ZJ1A 2BG1A 3M6BA 3O86A 4EQIA 1BLPA 4DXCA 1K4FA 2WAEA 3ISGA 1ZG4A 3MZFA 4KZ8A 4WELA 4OOLA 2XF3A 4BL2A 1SHVA 4GDNA 4E3IA 3CG5A 1XGIA 1ES3A 4P87A 3GQZA 5FI2A 5M19A 3G4PA 3VP4A 3N6IA 3UN7A 4R4SA 4CPKA 5JYOA 2UWXA 4Y0TA 3GR2A 3IXDA 4DRTA 5KSHA 4PM8A 1N9BA 4A5RA 4S2KA 5FASA 3JYIA 1WE4A 2Y2GA 1ESUA 5HFOA 3S1YA 5JYPA 5E2GA 2P9VA 3IQAA 1MWSA 3VSKA 2ZC6B 3OPLA 1PW1A 3MXSA 2Y2OA 1K4EA 2WGWA 3N8LA 4ZJ3A 5EPHA 4X6TA 4ID4A 4DKIA 4GNUA 5HARA 1K55A 3NBLA 3VOZA 1KGFA 3QNCA 1ZKJA 1TVFA 5D3OA 4DXBA 2BLSA 2EX6A 1E4DA 5G18A 5E2FA 1C3BA 3BYDA 5U47A 1ES2A 1MWRA 3NY4A 3NCKA 3G32A 5GHXA 2HP5A 3LY4A 3PTEA 1BLSA 4FCFA 4S2JA 5F82A 4UA9A 4KZ9A 2ZQ9A 5KZHA 4MBFA 4GDBA 5EUAA 4KZ5A 2J8YA 3MZEA 5IHVA 4OPQA 4OLGA 1JTDA 3C4OA 3Q7VB 4OQGA 4Y0UA 1XGJA 3HLEA 3IXGA 3CMZA 1GHPA 5FI6A 4R3BA 4E3OA 3IWQA 4LV0A 1LI0A 2Y2QA 4DE3A 2ZQCA 5EOOA 5CXWA 4MLLA 2ZM8A 5FQ9A 5BOHA 4EV4A 3NDGA 4ZTKA 4B88A 3V3RA 1JVJA 4OP8A 4BENA 3IF6C 1E3UA 5GLCA 2FFFB 4MNRA 4KZ3A 4ZAMA 5CEBA 3BLMA 1MKIA 4FH4A 1K56A 5FAOA 4EWFA 1GHIA 4DF6A 1BULA 3VMAA 3M2KA 1ERQA 3OPPA 2H10A 2J9OA 1G68A 4JKTA 5CTMA 4DDYA 2DNSA 3BFCA 1YMSA 4E3JA 3SOIA 3HUOA 3W4PA 3A3FA 3S22A 3VFFA 1BLCA 3EQVA 1YLJA 3GVBA 1ZG6A 2Y4AA 4E6WA 2ZJ9A 5J8XA 3TOIA 3WRTA 4EBPA 5CGWA 2WGIA 3G34A 1XKZA 2HPBA 3SS4A 3G2ZA 4GB7A 2JC7A 3BRMA 2IWCA 3GV9A 4P6BA 4ZDXA 2WKEA 1FSYA 2QMIA 4JF4A 1FCOA 5CEDA 1K25A 2WGWB 1WYCA 4D2OA 3DTMA 3OC2A 5DTTA 4B4XA 3N8RA 1LHYA 1I2WA 3W8KA 4BJPA 4XUXA 3W4QA 2XFSA 3A3JA 3ITAA 3O87A 4FH2A 1KGGA 5CHMA 1PI4A 4RX2A 5AQBA 4UA6A 1SDEA 5FDHA 5FQMA 3MZDA 3EQUA 2I72A 4FD8A 4L0LA 1YLWA 3ZG0A 3B3XA 5EVID 3GRJA 2RL3A 1FSWA 4YINA 3ZFZA 5FQJA 2ZC4B 1YLPA 3P98A 5FQQA 2PU4A 1KVMA 1S6RA 1PWCA 2R9WA 5FAQA 1BSGA 1HVBA 3RXXA 1Y54A 3HLBA 3VP2A 1FQGA 2WAFA 1PI5A 3HLWA 5DF8A 3HLDA 4S2LA 4KQOA 3ZVWA 3DWKA 5I94A 3OZHA 4OPZA 4E3MA 4KG6A 2Y59A 3SS5A 3NDEA 1G6AA 2WADA 1HZOA 3HUMA 4GOGA 4LCMA 2Z2LB 3IHBA 2ZC5B 3S4XA 1GA9A 2H0TA 2ZM2A 3V39A 2Y2PA 1HD8A 1GCEA 1BLHA 4JXVA 1PIOA 1RCJA 1YLZA 5DF9A 3WS1A 5CGXA 4EBNA 1XA1A 4NK3A 1K6SA 4JXWA 1KE0A 5CRFA 2DRWA 1Q2QA 4F94A 3G35A 5DVAA 4DE1A 1L0FA 1ES5A 1RGYA 2X02A 4RX3A 4Q8IA 1WYBA 1KVLA 2A3UA 3BECA 5AQ9A 2WZXA 3UPOA 4KENB 2J9PA 5HAIA 2G2UA 4WYYA 5FAPA 4OOYA 5F83A 3AGDA 3ZG9B 2ZM0A 4JLFA 2WGVA 1FR1A 3UDFA 4GD6A 1W8YA 1N4OA 1O7EA 2ZQ8A 1EWZA 1H5XA 4LCLA 4S2IA 1NZOA 2B5RA 2Y2KA 4S2OA 2G2WA 2HP6A 2Y91A 5TGFA 1BT5A 3BEBA 4HBTA 5E2HA 4DDSA 1YM1A 2WYXA 2P74A 3VP1A 2QZ6A 3FZCA 4XUZA 3A3EA 2OSUA 1K6RA 5HAPA 1W79A 2ZQ7A 1K57C 3RJUA 1NYYA 3E2LA 3MKFA 3LO7A 3PBTA 3Q7ZA 5EVIB 3IHAA 5AQ7A 3VFHA 1TDGA 3UPPA 4X56A 2XDMA 3ZG7B 5M18A 2X71A 3N7WA 2OLVA 4ZJ2A 1DJCA 5HX9A 1DY6A 4MBHA 3OPHA 1M6KA 4Z9QA 4R1GA 1W5DA 1E3UD 4KZ7A 3BM6A 3VSLA 1AXBA 4N1XA 4OOMA 2OV5A 1YMXA 3MBZA 3N4IA 4JF5A 4BLMA 4E6XA 3Q1FA 3WS5A 1PW8A 1K56D 3ZNTA 4U0TA 1YLYA 3M6HA 1IYSA 2VGJA 3HLCA 1ERMA 2WKIA 4UHUA 3WS2A 3OPRA 4KQQA 4DE2A 3CZDA 3OCLA 1JTGA 3MFDA 1CEFA 5F1GA 3C7VA 5FI7A 3IT9A 4KG2A 2RCXA 4RA7A 4Y7PA 4YFMA 4WMCA 1SCWA 1J9MA 3C5AA 3RXWA 4R3JA 1XA7A 4GN2A 4M3KA 4CJNA 3UE3A 3WRZA 3IH8A 4OPYA 1CEGA 3G30A 4PM6A 3IF6A 3UE1A 2P9VB 2XLNA 1SKFA 3VP0A 4QU3A 1SDNA 3BFGA 4LV1A 4GD8A 4K91A 3ZVTA 3IF5A 2IWBA 1PWGA 1I5QA 4EUZA 2C5WB 2Y2MA 4DE0A 3BFEA 3NI9A 1CK3A 1KDWA 5GL9A 3LCEA 2EX8A 4E3KA 1DJAA 1ONHA 1S0WA 2JE5A 3QHYA 4XXRA 4K0WA 5GHYA 3FKVA 1MY8A 2ZC3B 4KZAA 5AQAA 3PAEA 5E43A 3V50A 1Z6FA 2XFTA 4HEFA 3BLSA 2DCFA 5KSCA 3IXBA 1MPLA 1ONGA 1ESIA 4S2PA 3HL9A 1TDLA 2ZMAA 3PBRA 3ITBA 4QHCA 3TG9A 1DJBA 4EBLA 4N92A 2WZZA 4IBRA 1LL9A 1YQSA 3ZCZA 3PBSA 3UE0A 5A93A 3NC8A 1KDSA 2Q9MA 4IBXA 2J7VA 4RVAA 2XGNA 1BUEA 4OQ0A 1BTLA 1H8ZA 3V5MA 1NYMA 3Q7VA 2XR0A 2EX2A 1TEMA 3UY6A 1JWPA 1H8YA 4QB8A 1XXMA 4C6YA 3CJMA 4GKUA 1NRFA 4WZ4A 3A3IA 2XQZA 5DTKA 2ZLYA 3IWIA 5GLBA 4JBFA 3PAGA 2GDNA 4E3LA 1K38A 1KE4A 1NJ4A 2VGKA 5EVLA 2Y2HA 4KZ6A 5DTSA 1PYYA 3FV7A 3P09A 3UPNA 3AGEA 4R23A 2ZQAA 3D4FA 4QY5A 4WEJA 1HTZA 1XX2A 2V1ZA 3O3VA 1K55C 4GZBA 3A3DA 3FKWA 4O7DA 4BQMA 5A91A 3SH8A 3WS0A 2WKHA 4JPMA 2ZQDA 4P0MA 4IVIA 4OQHA 4C75A 4HESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ4 A;  3V3S A;  1IKI A;  2QPN A;  2EXB A;  3IF6 B;  3IXH A;  4KQR A;  4OQI A;  1MWU A;  1M40 A;  4X53 A;  5FA7 A;  1W8Q A;  3IWO A;  5CGS A;  5FSR A;  2PU2 A;  4K0X A;  4S2M A;  4WZ5 C;  4RYE A;  3ZGA B;  3BFF A;  4U3T A;  3ZNY A;  2EFX A;  1I2S A;  3FYZ A;  2JBF A;  3HLF A;  3PBN A;  4WBG A;  5HAQ A;  4JXS A;  4R0Q A;  3VOY A;  4QD4 A;  2WK0 A;  4PM9 A;  1OME A;  1XP4 A;  5TR7 A;  1IEL A;  4QJG A;  2XH9 A;  1LLB A;  5HL1 A;  5A90 A;  5CEC A;  1FR6 A;  4PM7 A;  5EE8 A;  4BD0 A;  1KE3 A;  1PWD A;  4PMA A;  5DF7 A;  3GTC A;  3GSG A;  3G2Y A;  2EX9 A;  5GLA A;  3WS4 A;  5CER A;  4B4Z A;  1IYO A;  3Q07 A;  2JCH A;  2Y2N A;  2H5S A;  4S2N C;  3M2J A;  1CI9 A;  3O88 A;  1FCN A;  4OON A;  3HLG A;  3Q82 A;  1PZO A;  3HBR A;  3DW0 A;  2C6W B;  3G31 A;  3WWX A;  1MXO A;  3C4P A;  1K54 C;  4WZ5 A;  5E2E A;  1RP5 A;  1MBL A;  5FQK A;  3MXR A;  1XPB A;  2XEP A;  4MBK A;  4Y0O A;  5L2F A;  3UDX A;  3LEZ A;  2PBY A;  2WUQ A;  1EI5 A;  2XD5 A;  4JXG A;  4N1H A;  2HDQ A;  1ERO A;  2H0Y A;  4R4R A;  1L0D A;  3C7U A;  1ALQ A;  4QY6 A;  1L0G A;  2OLU A;  2V20 A;  3HRE A;  5EOE A;  1K57 A;  3MKE A;  4ZBE A;  5M1A A;  1L0E A;  1IEM A;  3LY3 A;  4IED A;  4WMC D;  1BZA A;  3NIA A;  5FAT A;  1FOF A;  2Z2M B;  4X68 A;  1RGZ A;  2FFY A;  3IH9 A;  2XD1 A;  3FWL A;  4HBU A;  1GA0 A;  1PZP A;  4S2N A;  4BL3 A;  4PM5 A;  1CI8 A;  4KG5 A;  4N9L A;  2IWD A;  3SS3 A;  5CHU A;  4JF6 A;  1W7F A;  3ZHH A;  4UA7 A;  5GLD A;  3SH7 A;  1QMF A;  3PBO A;  4IVK A;  4WEK A;  5EEC A;  1E25 A;  3BFD A;  1K54 A;  1ZC2 A;  2Y2J A;  3DWZ A;  2Y2I A;  4C3Q A;  3QNB A;  5EVI C;  3VP3 A;  3PBQ A;  4UAA A;  4OP5 A;  2ZC7 A;  4X69 A;  1JWV A;  3UO9 A;  1LI9 A;  3E2K A;  2A49 A;  3Q81 A;  4WM9 A;  1VQQ A;  2HDU A;  2X01 A;  2Q9N A;  1O07 A;  1FCM A;  1L2S A;  4OLD A;  2E8I A;  1NY0 A;  1NZU A;  4H8R A;  4LV3 A;  1LL5 A;  2Y55 A;  1YLT A;  1VM1 A;  4OKP A;  4U0X A;  4LV2 A;  1KGE A;  3TSG A;  3ZG5 A;  1MWT A;  4P85 A;  3AGF A;  1GHM A;  2ZD8 A;  5HW3 A;  2Y2L A;  5A92 A;  4OPR A;  1IKG A;  5GHZ A;  3SH9 A;  2HDS A;  2HDR A;  3N8S A;  4KZB A;  1QME A;  3ZG8 B;  4OH0 A;  5F1F A;  1JWZ A;  5KMW A;  1U60 A;  2V2F F;  3ZDJ A;  2EXA A;  3W4O A;  5CTN A;  4E3N A;  1Q2P A;  2HP9 A;  2CC1 A;  5FQI A;  4BD1 A;  3HVF A;  3HUN A;  4X55 A;  3OCN A;  5EVI A;  1NXY A;  4N9K A;  2EFU A;  4FSF A;  1YT4 A;  3I7J A;  3UNW A;  1ES4 A;  4NET A;  3GMW A;  4LEN A;  5CHJ A;  2XK1 A;  5TFQ A;  2R9X A;  4OVD A;  1IYQ A;  4MEZ A;  1IYP A;  3UDI A;  4PPR A;  4ZJ1 A;  2BG1 A;  3M6B A;  3O86 A;  4EQI A;  1BLP A;  4DXC A;  1K4F A;  2WAE A;  3ISG A;  1ZG4 A;  3MZF A;  4KZ8 A;  4WEL A;  4OOL A;  2XF3 A;  4BL2 A;  1SHV A;  4GDN A;  4E3I A;  3CG5 A;  1XGI A;  1ES3 A;  4P87 A;  3GQZ A;  5FI2 A;  5M19 A;  3G4P A;  3VP4 A;  3N6I A;  3UN7 A;  4R4S A;  4CPK A;  5JYO A;  2UWX A;  4Y0T A;  3GR2 A;  3IXD A;  4DRT A;  5KSH A;  4PM8 A;  1N9B A;  4A5R A;  4S2K A;  5FAS A;  3JYI A;  1WE4 A;  2Y2G A;  1ESU A;  5HFO A;  3S1Y A;  5JYP A;  5E2G A;  2P9V A;  3IQA A;  1MWS A;  3VSK A;  2ZC6 B;  3OPL A;  1PW1 A;  3MXS A;  2Y2O A;  1K4E A;  2WGW A;  3N8L A;  4ZJ3 A;  5EPH A;  4X6T A;  4ID4 A;  4DKI A;  4GNU A;  5HAR A;  1K55 A;  3NBL A;  3VOZ A;  1KGF A;  3QNC A;  1ZKJ A;  1TVF A;  5D3O A;  4DXB A;  2BLS A;  2EX6 A;  1E4D A;  5G18 A;  5E2F A;  1C3B A;  3BYD A;  5U47 A;  1ES2 A;  1MWR A;  3NY4 A;  3NCK A;  3G32 A;  5GHX A;  2HP5 A;  3LY4 A;  3PTE A;  1BLS A;  4FCF A;  4S2J A;  5F82 A;  4UA9 A;  4KZ9 A;  2ZQ9 A;  5KZH A;  4MBF A;  4GDB A;  5EUA A;  4KZ5 A;  2J8Y A;  3MZE A;  5IHV A;  4OPQ A;  4OLG A;  1JTD A;  3C4O A;  3Q7V B;  4OQG A;  4Y0U A;  1XGJ A;  3HLE A;  3IXG A;  3CMZ A;  1GHP A;  5FI6 A;  4R3B A;  4E3O A;  3IWQ A;  4LV0 A;  1LI0 A;  2Y2Q A;  4DE3 A;  2ZQC A;  5EOO A;  5CXW A;  4MLL A;  2ZM8 A;  5FQ9 A;  5BOH A;  4EV4 A;  3NDG A;  4ZTK A;  4B88 A;  3V3R A;  1JVJ A;  4OP8 A;  4BEN A;  3IF6 C;  1E3U A;  5GLC A;  2FFF B;  4MNR A;  4KZ3 A;  4ZAM A;  5CEB A;  3BLM A;  1MKI A;  4FH4 A;  1K56 A;  5FAO A;  4EWF A;  1GHI A;  4DF6 A;  1BUL A;  3VMA A;  3M2K A;  1ERQ A;  3OPP A;  2H10 A;  2J9O A;  1G68 A;  4JKT A;  5CTM A;  4DDY A;  2DNS A;  3BFC A;  1YMS A;  4E3J A;  3SOI A;  3HUO A;  3W4P A;  3A3F A;  3S22 A;  3VFF A;  1BLC A;  3EQV A;  1YLJ A;  3GVB A;  1ZG6 A;  2Y4A A;  4E6W A;  2ZJ9 A;  5J8X A;  3TOI A;  3WRT A;  4EBP A;  5CGW A;  2WGI A;  3G34 A;  1XKZ A;  2HPB A;  3SS4 A;  3G2Z A;  4GB7 A;  2JC7 A;  3BRM A;  2IWC A;  3GV9 A;  4P6B A;  4ZDX A;  2WKE A;  1FSY A;  2QMI A;  4JF4 A;  1FCO A;  5CED A;  1K25 A;  2WGW B;  1WYC A;  4D2O A;  3DTM A;  3OC2 A;  5DTT A;  4B4X A;  3N8R A;  1LHY A;  1I2W A;  3W8K A;  4BJP A;  4XUX A;  3W4Q A;  2XFS A;  3A3J A;  3ITA A;  3O87 A;  4FH2 A;  1KGG A;  5CHM A;  1PI4 A;  4RX2 A;  5AQB A;  4UA6 A;  1SDE A;  5FDH A;  5FQM A;  3MZD A;  3EQU A;  2I72 A;  4FD8 A;  4L0L A;  1YLW A;  3ZG0 A;  3B3X A;  5EVI D;  3GRJ A;  2RL3 A;  1FSW A;  4YIN A;  3ZFZ A;  5FQJ A;  2ZC4 B;  1YLP A;  3P98 A;  5FQQ A;  2PU4 A;  1KVM A;  1S6R A;  1PWC A;  2R9W A;  5FAQ A;  1BSG A;  1HVB A;  3RXX A;  1Y54 A;  3HLB A;  3VP2 A;  1FQG A;  2WAF A;  1PI5 A;  3HLW A;  5DF8 A;  3HLD A;  4S2L A;  4KQO A;  3ZVW A;  3DWK A;  5I94 A;  3OZH A;  4OPZ A;  4E3M A;  4KG6 A;  2Y59 A;  3SS5 A;  3NDE A;  1G6A A;  2WAD A;  1HZO A;  3HUM A;  4GOG A;  4LCM A;  2Z2L B;  3IHB A;  2ZC5 B;  3S4X A;  1GA9 A;  2H0T A;  2ZM2 A;  3V39 A;  2Y2P A;  1HD8 A;  1GCE A;  1BLH A;  4JXV A;  1PIO A;  1RCJ A;  1YLZ A;  5DF9 A;  3WS1 A;  5CGX A;  4EBN A;  1XA1 A;  4NK3 A;  1K6S A;  4JXW A;  1KE0 A;  5CRF A;  2DRW A;  1Q2Q A;  4F94 A;  3G35 A;  5DVA A;  4DE1 A;  1L0F A;  1ES5 A;  1RGY A;  2X02 A;  4RX3 A;  4Q8I A;  1WYB A;  1KVL A;  2A3U A;  3BEC A;  5AQ9 A;  2WZX A;  3UPO A;  4KEN B;  2J9P A;  5HAI A;  2G2U A;  4WYY A;  5FAP A;  4OOY A;  5F83 A;  3AGD A;  3ZG9 B;  2ZM0 A;  4JLF A;  2WGV A;  1FR1 A;  3UDF A;  4GD6 A;  1W8Y A;  1N4O A;  1O7E A;  2ZQ8 A;  1EWZ A;  1H5X A;  4LCL A;  4S2I A;  1NZO A;  2B5R A;  2Y2K A;  4S2O A;  2G2W A;  2HP6 A;  2Y91 A;  5TGF A;  1BT5 A;  3BEB A;  4HBT A;  5E2H A;  4DDS A;  1YM1 A;  2WYX A;  2P74 A;  3VP1 A;  2QZ6 A;  3FZC A;  4XUZ A;  3A3E A;  2OSU A;  1K6R A;  5HAP A;  1W79 A;  2ZQ7 A;  1K57 C;  3RJU A;  1NYY A;  3E2L A;  3MKF A;  3LO7 A;  3PBT A;  3Q7Z A;  5EVI B;  3IHA A;  5AQ7 A;  3VFH A;  1TDG A;  3UPP A;  4X56 A;  2XDM A;  3ZG7 B;  5M18 A;  2X71 A;  3N7W A;  2OLV A;  4ZJ2 A;  1DJC A;  5HX9 A;  1DY6 A;  4MBH A;  3OPH A;  1M6K A;  4Z9Q A;  4R1G A;  1W5D A;  1E3U D;  4KZ7 A;  3BM6 A;  3VSL A;  1AXB A;  4N1X A;  4OOM A;  2OV5 A;  1YMX A;  3MBZ A;  3N4I A;  4JF5 A;  4BLM A;  4E6X A;  3Q1F A;  3WS5 A;  1PW8 A;  1K56 D;  3ZNT A;  4U0T A;  1YLY A;  3M6H A;  1IYS A;  2VGJ A;  3HLC A;  1ERM A;  2WKI A;  4UHU A;  3WS2 A;  3OPR A;  4KQQ A;  4DE2 A;  3CZD A;  3OCL A;  1JTG A;  3MFD A;  1CEF A;  5F1G A;  3C7V A;  5FI7 A;  3IT9 A;  4KG2 A;  2RCX A;  4RA7 A;  4Y7P A;  4YFM A;  4WMC A;  1SCW A;  1J9M A;  3C5A A;  3RXW A;  4R3J A;  1XA7 A;  4GN2 A;  4M3K A;  4CJN A;  3UE3 A;  3WRZ A;  3IH8 A;  4OPY A;  1CEG A;  3G30 A;  4PM6 A;  3IF6 A;  3UE1 A;  2P9V B;  2XLN A;  1SKF A;  3VP0 A;  4QU3 A;  1SDN A;  3BFG A;  4LV1 A;  4GD8 A;  4K91 A;  3ZVT A;  3IF5 A;  2IWB A;  1PWG A;  1I5Q A;  4EUZ A;  2C5W B;  2Y2M A;  4DE0 A;  3BFE A;  3NI9 A;  1CK3 A;  1KDW A;  5GL9 A;  3LCE A;  2EX8 A;  4E3K A;  1DJA A;  1ONH A;  1S0W A;  2JE5 A;  3QHY A;  4XXR A;  4K0W A;  5GHY A;  3FKV A;  1MY8 A;  2ZC3 B;  4KZA A;  5AQA A;  3PAE A;  5E43 A;  3V50 A;  1Z6F A;  2XFT A;  4HEF A;  3BLS A;  2DCF A;  5KSC A;  3IXB A;  1MPL A;  1ONG A;  1ESI A;  4S2P A;  3HL9 A;  1TDL A;  2ZMA A;  3PBR A;  3ITB A;  4QHC A;  3TG9 A;  1DJB A;  4EBL A;  4N92 A;  2WZZ A;  4IBR A;  1LL9 A;  1YQS A;  3ZCZ A;  3PBS A;  3UE0 A;  5A93 A;  3NC8 A;  1KDS A;  2Q9M A;  4IBX A;  2J7V A;  4RVA A;  2XGN A;  1BUE A;  4OQ0 A;  1BTL A;  1H8Z A;  3V5M A;  1NYM A;  3Q7V A;  2XR0 A;  2EX2 A;  1TEM A;  3UY6 A;  1JWP A;  1H8Y A;  4QB8 A;  1XXM A;  4C6Y A;  3CJM A;  4GKU A;  1NRF A;  4WZ4 A;  3A3I A;  2XQZ A;  5DTK A;  2ZLY A;  3IWI A;  5GLB A;  4JBF A;  3PAG A;  2GDN A;  4E3L A;  1K38 A;  1KE4 A;  1NJ4 A;  2VGK A;  5EVL A;  2Y2H A;  4KZ6 A;  5DTS A;  1PYY A;  3FV7 A;  3P09 A;  3UPN A;  3AGE A;  4R23 A;  2ZQA A;  3D4F A;  4QY5 A;  4WEJ A;  1HTZ A;  1XX2 A;  2V1Z A;  3O3V A;  1K55 C;  4GZB A;  3A3D A;  3FKW A;  4O7D A;  4BQM A;  5A91 A;  3SH8 A;  3WS0 A;  2WKH A;  4JPM A;  2ZQD A;  4P0M A;  4IVI A;  4OQH A;  4C75 A;  4HES A; 
#chains in the Genus database with same CATH topology
 3LI8 A;  1IKI A;  4D2O A;  1KOU A;  3IWO A;  5CGS A;  2PU2 A;  1FIL A;  4S2M A;  4WZ5 C;  3ZGA B;  3BFF A;  4U3T A;  2R78 A;  2PR6 A;  3R4K A;  4JXS A;  5TBM A;  4QD4 A;  1OME A;  1XP4 A;  4HY8 A;  1IEL A;  4QJG A;  3HCY A;  5HL1 A;  3TJZ C;  5A90 A;  2LB9 A;  1FR6 A;  3BQ8 A;  4BD0 A;  2EX9 A;  4KUK A;  5CER A;  4B4Z A;  4HI4 A;  4DJ2 A;  3LI9 A;  2JCH A;  2VEA A;  2Y2N A;  2H5S A;  1CI9 A;  5L09 A;  4OON A;  4LRZ E;  3HBR A;  3WWX A;  3C4P A;  4WZ5 A;  1YAX A;  1XPB A;  3CHW P;  4Y0O A;  2XD5 A;  2HDQ A;  1ERO A;  1ALQ A;  2HGV A;  3CPT B;  5EFW A;  3MKE A;  4ZBE A;  1L0E A;  4IED A;  3KSI A;  3NIA A;  3QP8 A;  1T1A A;  2O9C A;  4HP4 A;  2FFY A;  4BL3 A;  2XD1 A;  4HBU A;  4PM5 A;  4KG5 A;  3SS3 A;  3KYZ A;  3CLO A;  3ZHH A;  4ARZ A;  5GLD A;  3SH7 A;  4WEK A;  5EEC A;  1E25 A;  3DWZ A;  5L8M A;  1STZ A;  4UAA A;  1LI9 A;  3B47 A;  3LIF A;  2HDU A;  1FCM A;  2E8I A;  5TBM B;  2Z6C A;  3R7W A;  1KGE A;  3ZG5 A;  1MWT A;  5A92 A;  1IKG A;  2HDS A;  3N8S A;  5F1F A;  3ZDJ A;  3W4O A;  1Q2P A;  5FQI A;  5HPF A;  3RH8 B;  3OCN A;  2EFU A;  3I7J A;  3UNW A;  4NET A;  5CHJ A;  5TFQ A;  4KQD A;  2EA9 A;  4MEZ A;  3UDI A;  4ZJ1 A;  2P08 A;  1BLP A;  4DXC A;  2AVX A;  4R70 A;  3NOT C;  4BL2 A;  3QP6 A;  2PAV P;  4HJ4 A;  3S7O A;  4P87 A;  3GQZ A;  5FI2 A;  2NUT C;  5I5L A;  4R4S A;  2UWX A;  1S1Z A;  4NXE A;  2YKF A;  3GR2 A;  2K31 A;  5KSH A;  4PM8 A;  3DBA A;  3JYI A;  1WE4 A;  2Y2G A;  5EM1 A;  5JYP A;  4MN6 A;  1S67 L;  2ZMV A;  1MWS A;  5EV0 A;  1NWZ A;  2ZC6 B;  4Y13 A;  2Y2O A;  4ZJ3 A;  5EPH A;  4ID4 A;  2GJ3 A;  5HAR A;  3NBL A;  3H9W A;  1KGF A;  2EX6 A;  2B95 A;  1NRJ A;  1MWR A;  3NY4 A;  1BLS A;  5F82 A;  3FC7 A;  1VET A;  3Q7V B;  1GHP A;  5FI6 A;  5DJT A;  2D02 A;  2Y2Q A;  5CXW A;  5HWW A;  2ZM8 A;  5FQ9 A;  2VJW A;  3V3R A;  3LYX A;  4ZAM A;  1MKI A;  1DP6 A;  1K56 A;  4DF6 A;  2J9O A;  1G68 A;  4G3K A;  2DNS A;  4E3J A;  4EU0 A;  3HUO A;  3S22 A;  1XJ6 A;  1YLJ A;  4E6W A;  2GNX A;  3WRT A;  3E4P A;  3T50 A;  3G34 A;  3A0S A;  2IWC A;  1S4R A;  1FSY A;  2W3H A;  1WYC A;  3DTM A;  3OC2 A;  5DTT A;  4B4X A;  4BJP A;  5CHM A;  4BBU A;  1SDE A;  5FDH A;  3MZD A;  2I72 A;  4FD8 A;  1PRQ A;  4YIN A;  1FSW A;  3S7P A;  2V1A A;  1S6R A;  2R9W A;  1Y28 A;  3RXX A;  1Y54 A;  3HLB A;  1VEU A;  2PT7 A;  2NUP C;  5J7E A;  2WAF A;  4BBT A;  3HLD A;  3VE4 A;  3OZH A;  1OJ5 A;  4Y5F A;  5IU1 A;  1HZO A;  1GA9 A;  2ZM2 A;  2O9B A;  1JNU A;  1PIO A;  1YLZ A;  5DF9 A;  1NLY A;  1XA1 A;  1L0F A;  2XRN A;  2X02 A;  2A3U A;  3QP4 A;  4FOF A;  4WYY A;  5F83 A;  4OOY A;  4JLF A;  1FR1 A;  4ME4 A;  1G6O A;  2B18 A;  5FEG A;  3T4O A;  2Y2K A;  2OAP 1;  3NEC A;  4S2O A;  2G2W A;  2Y91 A;  5DJU A;  5E2H A;  4DDS A;  1YM1 A;  1P97 A;  3VP1 A;  3DTI A;  5HAP A;  3MSH A;  2VV8 A;  5EVI B;  3T1X A;  1DJC A;  4FUW A;  1DY6 A;  5HZH A;  3OPH A;  2HJE A;  1VEU B;  4R1G A;  2KX6 A;  4KZ7 A;  3BM6 A;  1L3L A;  2EWV A;  3O5Y A;  3PR6 A;  1PW8 A;  2JKT I;  4UHU A;  3WS2 A;  2WKQ A;  3MFD A;  3IT9 A;  4CLC D;  4WMC A;  4X1L A;  2Q0O A;  3RXW A;  1XA7 A;  4EER A;  4GN2 A;  4Q0I A;  1N9L A;  3WRZ A;  3LIC A;  4CLC E;  4PM6 A;  3UE1 A;  1LSW A;  5F5Y A;  1SKF A;  3VP0 A;  4LV1 A;  3T4T A;  2C5W B;  3HJI A;  1KDW A;  5GL9 A;  3ZYT A;  4HQA A;  1VHM A;  1DJA A;  1HLU P;  3LR0 A;  2J3W A;  2QJ5 A;  1MY8 A;  4KZA A;  4Y17 A;  5AQA A;  2J80 A;  4LLO B;  5E43 A;  3V50 A;  1Z6F A;  4HEF A;  2DCF A;  2L1M A;  1MZU A;  3RTY A;  4Y2F A;  2Y79 A;  3NC8 A;  5AJG A;  5DKK A;  1NYM A;  2LB5 A;  2XR0 A;  1TEM A;  1XXM A;  5DTK A;  2PD7 A;  3PAG A;  2GDN A;  1K38 A;  2V8F A;  3AGE A;  3E4O A;  4QY5 A;  4JGQ A;  2V1Z A;  1K55 C;  1G5U A;  4B9O A;  4UEY A;  4HES A;  2EXB A;  4HH2 A;  4OQI A;  3IXH A;  1CF0 A;  4QWO A;  5FSR A;  4IUH A;  3QP2 A;  3LR4 A;  2QHK A;  2EFX A;  1I2S A;  3HLF A;  3PBN A;  2BAS A;  4R0Q A;  2WK0 A;  4R6L A;  2XH9 A;  1LLB A;  5CEC A;  3KYE A;  4NEE D;  1PWD A;  5DF7 A;  3GTC A;  5HDC A;  3G2Y A;  4L9E A;  3WS4 A;  1IYO A;  4JGO A;  1YSQ A;  1LL8 A;  1FCN A;  4LFU A;  1S4S A;  1A0K A;  1AWI A;  5E2E A;  4WLA A;  4CLC C;  1MBL A;  2XEP A;  4GHI A;  4R4R A;  1K57 A;  4MN7 A;  3LY3 A;  1FOF A;  1RGZ A;  1GA0 A;  1CI8 A;  3NUL A;  1PNE A;  5CHU A;  1W7F A;  1XJ2 A;  3OOV A;  4H6J A;  1ZC2 A;  3VP3 A;  2ZC7 A;  3BW6 A;  2UV0 E;  3UO9 A;  1DP8 A;  2A49 A;  1H8M A;  1NY0 A;  1NZU A;  4R38 A;  2Y55 A;  1YLT A;  4P85 A;  3AGF A;  2ZD8 A;  5TJJ A;  2L0W A;  2W1T B;  1QME A;  3BQA A;  1K0K A;  1JWZ A;  1U60 A;  2V2F F;  5CTN A;  2HP9 A;  2CC1 A;  4X55 A;  3V67 A;  5F68 A;  1NXY A;  4N9K A;  4FSF A;  1ES4 A;  4OVD A;  1IYP A;  3M6B A;  3O86 A;  1K4F A;  2WAE A;  4F3L A;  4KZ8 A;  4WEL A;  2KOI A;  3FPW A;  2P7J A;  3EWK A;  1V9Z A;  3UB9 A;  1ES3 A;  4EEU A;  2V0W A;  2XSS A;  3N6I A;  4CPK A;  3C30 A;  3VOL A;  3A0V A;  3H82 B;  2VA0 A;  1ESU A;  1W63 Q;  3CUE C;  5HFO A;  3LIB A;  5E2G A;  2A24 A;  3IQA A;  1SZV A;  3VSK A;  1PW1 A;  1K4E A;  5D3O A;  4DXB A;  1XJ4 A;  5U47 A;  2H28 A;  3NCK A;  3G32 A;  3NOP C;  3PTE A;  4S2J A;  4FCF A;  4KZ9 A;  2ZQ9 A;  4GDB A;  5EUA A;  5IHV A;  1MC0 A;  4OPQ A;  1JTD A;  4R3B A;  3IWQ A;  4LV0 A;  3CUE A;  4PAU A;  4NXB A;  4EV4 A;  3OBF A;  3LGO A;  3MF0 A;  1JVJ A;  4OP8 A;  3IF6 C;  3MFX A;  4MNR A;  1TF1 A;  3BLM A;  2JKT M;  4EWF A;  1GHI A;  4UQI M;  5CTM A;  3JPU A;  3BFC A;  1YMS A;  3K3C A;  2I9V A;  2W3G A;  3VFF A;  4GLQ A;  5J8X A;  2JHE A;  1XKZ A;  4LGW A;  4I39 A;  3SS4 A;  1T19 A;  4GB7 A;  3GV9 A;  4P6B A;  2HJ9 C;  2QMI A;  5CED A;  1K25 A;  1SKO A;  1I2W A;  1IOU A;  4XUX A;  2XFS A;  3ITA A;  1XJ3 A;  2ACG A;  3QP1 A;  3ZG0 A;  5L10 A;  1N9N A;  5EVI D;  2RL3 A;  2VX8 A;  5FQQ A;  1PWC A;  4DJ3 A;  5FAQ A;  1IFQ A;  3F1N A;  1PI5 A;  3HLW A;  5DF8 A;  4S2L A;  5I94 A;  3SW1 A;  4E3M A;  4KG6 A;  3UB6 A;  2VV6 A;  3F1O A;  4GOG A;  2PBD P;  3IHB A;  1XFN A;  4ARZ B;  5CGX A;  3BWL A;  3G6O A;  4NK3 A;  4JXW A;  1KE0 A;  2DRW A;  4F94 A;  3G35 A;  2JKG A;  1UWN X;  3LEQ A;  1ES5 A;  1RGY A;  4Q8I A;  5HSQ A;  3D72 A;  3EGX C;  4K08 A;  4HH3 A;  2ZM0 A;  4MDZ A;  3R7W B;  3T4K A;  2J3T D;  5IT5 A;  1H5X A;  2V1B A;  1NZO A;  1SKO B;  2A2L A;  3KX0 X;  1BT5 A;  3DTK A;  3BEB A;  4HBT A;  2OSU A;  1K6R A;  2ZQ7 A;  3E2L A;  3MKF A;  3LO7 A;  3Q7Z A;  3IHA A;  1YSP A;  3L7H A;  3VFH A;  2XDM A;  2X71 A;  1OT9 A;  5HD5 A;  4EET B;  1W5D A;  1E3U D;  3LID A;  4N1X A;  1VB6 A;  3MBZ A;  3N4I A;  4BLM A;  3ZNT A;  4U0T A;  3M6H A;  3HLC A;  1ERM A;  2WKI A;  3UB7 A;  2W3F A;  3MS6 A;  4KQQ A;  1ZTU A;  1CEF A;  5F1G A;  3C7V A;  4RA7 A;  1S1Y A;  4NKP A;  4B93 A;  2OAQ 1;  3IH8 A;  4OPY A;  1CEG A;  4QU3 A;  3BFG A;  2VK3 A;  3IF5 A;  4EUZ A;  4YWZ A;  5FL3 A;  2WKR A;  4I5S A;  4P6Z M;  1S0W A;  4Y15 A;  3HJK A;  3F1P A;  5GHY A;  1FIK A;  1LSV A;  1VET B;  2XFT A;  3IXB A;  1ESI A;  3PBR A;  4WF0 A;  2L4R A;  4I3A A;  1DJB A;  4N92 A;  3NHQ A;  4IBR A;  1LL9 A;  3ZCZ A;  2CMN A;  2Q9M A;  2XGN A;  1BUE A;  4DMZ A;  4BWI A;  3V5M A;  2B02 A;  3T4J A;  1H8Y A;  4C6Y A;  3JVU A;  3UB5 P;  3A3I A;  3IWI A;  1F9I A;  2K7S A;  5J4E A;  3MQO A;  1KE4 A;  1UGU A;  5DTS A;  1PYY A;  3FV7 A;  2KDK A;  3P09 A;  3UPN A;  3D4F A;  1D1J A;  4WEJ A;  1HTZ A;  4NXF A;  5HWT A;  4FTX A;  4JPM A;  4P0M A;  4HJ3 A;  2QKP A;  3V3S A;  2QPN A;  4X53 A;  2HF6 A;  3H7W A;  1MWU A;  2JKF A;  1W8Q A;  4PHT A;  4O0P A;  4HOI A;  4RYE A;  4HHD A;  4PM9 A;  4MCW A;  5TR7 A;  4EQ1 A;  2V8C A;  4PM7 A;  3GSG A;  2HZ5 A;  5GLA A;  3EEH A;  4S2N C;  2BTF P;  3O88 A;  3NOU C;  3HLG A;  3Q82 A;  1PZO A;  4UQI S;  3LIE A;  3DAV A;  1K54 C;  1RP5 A;  3MXR A;  4X25 A;  4MBK A;  5L2F A;  3LEZ A;  4N1H A;  2H0Y A;  1L0D A;  4QY6 A;  1L0G A;  4NXG A;  4EXO A;  3C8C A;  2K2N A;  5M1A A;  2PYR A;  2W27 A;  5A93 A;  4X68 A;  3TRC A;  4S2N A;  2IWD A;  4IJG A;  4Q0J A;  3EEA A;  4UA7 A;  1OTB A;  2QJ7 A;  1GSV A;  1QMF A;  3NJA A;  4I3J A;  3BFD A;  1K54 A;  3H7W B;  1MKM A;  3QNB A;  3CAX A;  4X69 A;  5C5K A;  4WM9 A;  1TS8 A;  2Q9N A;  2KLI A;  4OLD A;  1L2S A;  1VM1 A;  3LR5 A;  3C38 A;  4OKP A;  1Y4O A;  5HW3 A;  1GHM A;  2Y2L A;  4OPR A;  5DFX A;  5GHZ A;  3SH9 A;  3P7N A;  4Z1W A;  2HDR A;  4KZB A;  3ZG8 B;  4OH0 A;  2EXA A;  4E3N A;  1XFQ A;  3HVF A;  1P9R A;  2YKH A;  1OJG A;  3IS2 A;  1YT4 A;  2XK1 A;  3KYQ A;  2VGL M;  1TS0 A;  4PPR A;  2BG1 A;  1OTE A;  3MZF A;  4GW9 A;  1UWP X;  3A0R A;  2XF3 A;  3LIA A;  1SHV A;  4E3I A;  3CG5 A;  4X1M A;  1OTD A;  4KUO A;  2W1R A;  5FDS A;  5M19 A;  3G4P A;  2GX5 A;  3VP4 A;  3UN7 A;  5JYO A;  4DRT A;  1N9B A;  3T1Q B;  4S2K A;  3MMH A;  2Z6D A;  2P9V A;  3N8L A;  3MXS A;  4DKI A;  4X6T A;  4GNU A;  1K55 A;  3VE3 A;  3VOZ A;  3QNC A;  1ZKJ A;  1TVF A;  3P01 A;  2BLS A;  1E4D A;  5E2F A;  1C3B A;  1ES2 A;  3S7N A;  1CQA A;  5GHX A;  3LY4 A;  2EWW A;  5KZH A;  4MBF A;  2J8Y A;  4LRX C;  5IS1 A;  4OLG A;  3C4O A;  4Y0U A;  4OQG A;  1XGJ A;  3IXG A;  3BY9 A;  2JKR I;  1LI0 A;  4DE3 A;  2ZQC A;  4GS9 A;  5EOO A;  4MLL A;  4ZTK A;  4B88 A;  2FFF B;  2WKP A;  5CEB A;  3ICY A;  4FH4 A;  2QWS A;  5FAO A;  2OWH A;  3VMA A;  3M2K A;  1X0O A;  2H10 A;  1H0M A;  3KO6 A;  3SOI A;  3W4P A;  3KSG A;  3A3F A;  4P6Z S;  1BLC A;  4CLC A;  3GVB A;  2ZJ9 A;  3UB8 A;  3ULF A;  2HPB A;  1CJF A;  5CX7 A;  2JC7 A;  2Y8H A;  3IX3 A;  3MR0 A;  3LR3 A;  4JGR A;  4ZDX A;  2WKE A;  4I38 A;  5FEF A;  1W63 M;  1LHY A;  3IBR A;  3O87 A;  3MJQ A;  5AQB A;  5FQM A;  3EQU A;  4L0L A;  5FQJ A;  2V0U A;  3P98 A;  1KVM A;  4PKY G;  4YOF A;  4Y3I A;  4GS9 B;  3VP2 A;  4GHI B;  4KQO A;  4OPZ A;  3SS5 A;  1GSW A;  3NDE A;  1G6A A;  3T1S A;  4LCM A;  2ZC5 B;  3S4X A;  2H0T A;  3V39 A;  2Y2P A;  4MMN A;  3CPT A;  3WS1 A;  1H3Q A;  4EBN A;  3D9Y A;  5CRF A;  4H6J B;  2M1C A;  1N9O A;  4CLC B;  4RX3 A;  3BEC A;  2VZW A;  4HIA A;  4DN0 A;  3UPO A;  5FAP A;  3AGD A;  3U4L P;  2WGV A;  3UDF A;  2ZQ8 A;  1O7E A;  4LCL A;  2B5R A;  4LPZ A;  2HP6 A;  5TGF A;  4LRY C;  2P74 A;  3FZC A;  4JGP A;  4XUZ A;  1W79 A;  4MN5 A;  2GZA A;  2W0N A;  1TDG A;  5M18 A;  4X56 A;  3ZG7 B;  5HX9 A;  3C2W A;  1M6K A;  4Z9Q A;  4F3L B;  4IUK A;  3VSL A;  1AXB A;  2OV5 A;  4E6X A;  1YMX A;  4JF5 A;  4AFI A;  3Q1F A;  1K56 D;  5HDD A;  2VGJ A;  3OPR A;  5HD3 A;  1JTG A;  3MXQ A;  1OTA A;  2ZL1 A;  3E98 A;  2RCX A;  4Y7P A;  4YFM A;  1SCW A;  1J9M A;  4R3J A;  2D01 A;  5EM0 A;  3U2A A;  3UE3 A;  4G3W A;  3G30 A;  3IF6 A;  2A24 B;  2XLN A;  4GD8 A;  4GCZ A;  3BFE A;  2EX8 A;  3T12 B;  3OLO A;  2VV7 A;  4E3K A;  1ONH A;  4XXR A;  3QHY A;  2ZC3 B;  2VGL S;  3MQQ A;  2W3E A;  1ONG A;  3HL9 A;  2ZMA A;  3ZQ5 A;  1PFL A;  4NG2 A;  3PBS A;  4IBX A;  2J7V A;  4RVA A;  4ZRR A;  1H8Z A;  4IHQ A;  3Q7V A;  4WUJ A;  1TS6 A;  2OWJ A;  4O8G A;  4QB8 A;  3K2N A;  3S7Q A;  3CJM A;  4GKU A;  1P9W A;  1OT6 A;  4WZ4 A;  2XQZ A;  5GLB A;  5EVL A;  2XA7 M;  2Y2H A;  2M7V A;  3UE6 A;  2ZL1 B;  4BQM A;  4GZB A;  2HV1 A;  3A3D A;  3FKW A;  5A91 A;  3SH8 A;  3WS0 A;  2WKH A;  2ZQD A;  3T4Q A;  4OQH A;  4KZ4 A;  4WL9 A;  4HP9 A;  4KQR A;  3IF6 B;  1M40 A;  5FA7 A;  5HPI A;  4K0X A;  2JN7 A;  3ZNY A;  3FYZ A;  4WBG A;  2JBF A;  5HAQ A;  3VOY A;  5EE8 A;  1KE3 A;  2MJ6 A;  4PMA A;  4EES A;  3TW8 A;  3Q07 A;  3RFB A;  5L07 A;  3M2J A;  3W2Z A;  3F1N B;  4GJ4 A;  5AVF A;  3DW0 A;  2C6W B;  4ESP A;  2JKR M;  3G31 A;  1MXO A;  5DKL A;  3F1O B;  5FQK A;  3UDX A;  2PBY A;  2WUQ A;  1EI5 A;  4JXG A;  2DMW A;  2W3D A;  3C7U A;  2OLU A;  2PYP A;  2V20 A;  3HRE A;  5EOE A;  1IEM A;  4WMC D;  4HJ6 A;  2XRO A;  1BZA A;  5FAT A;  5HL6 A;  2Z2M B;  3T4L A;  3IH9 A;  3FWL A;  2ZOH A;  1PZP A;  2PD8 A;  4N9L A;  4JF6 A;  3IX4 A;  4HNB A;  3PBO A;  4IVK A;  2Y2J A;  5HDS A;  4C3Q A;  2Y2I A;  5EVI C;  3PBQ A;  4OP5 A;  1JWV A;  3E2K A;  3Q81 A;  1VQQ A;  2X01 A;  1O07 A;  4H8R A;  4LV3 A;  1LL5 A;  4QPR A;  3CI6 A;  4U0X A;  4LV2 A;  4PKY A;  3TSG A;  4WN5 A;  4E04 A;  1S66 L;  3FPV A;  2PHY A;  1GSX A;  5KMW A;  3L9K A;  4BD1 A;  3HUN A;  3PXP A;  5EVI A;  3TE8 A;  4CQH A;  3GMW A;  4LEN A;  2R9X A;  1IYQ A;  4EQI A;  1J3W A;  3K3D A;  3ISG A;  1ZG4 A;  4OOL A;  5K5B A;  4GDN A;  1XGI A;  2J3T C;  3D3O A;  3SZT A;  4Y0T A;  4II7 A;  3IXD A;  1F2K A;  3IBJ A;  4A5R A;  5FAS A;  4EW7 A;  2FH5 A;  3S1Y A;  3T1R A;  2VLG A;  4D60 A;  3KSF A;  3F1P B;  3OPL A;  2WGW A;  5G18 A;  3BYD A;  2O99 A;  1D7E A;  1NLZ A;  2HP5 A;  4UA9 A;  2G7U A;  3BJN A;  4KZ5 A;  3MZE A;  3E4Q A;  3T4S A;  2O9A A;  3HLE A;  3CMZ A;  4E3O A;  1G28 A;  2P04 A;  3JVV A;  1OTI A;  5F69 A;  4L9F A;  5BOH A;  3NDG A;  5AVE A;  4BEN A;  1E3U A;  5GLC A;  4KZ3 A;  5KIZ A;  2OOL A;  3CWF A;  1EW0 A;  4EEP A;  1BUL A;  3OPP A;  4JKT A;  1ERQ A;  4DDY A;  4I3I A;  2INW A;  5EVE A;  5LBR A;  3EQV A;  1ZG6 A;  2Y4A A;  3TOI A;  4EBP A;  5CGW A;  2ZOI A;  2WGI A;  3EGD C;  3G2Z A;  4L9G A;  3BRM A;  2QYB A;  3PYP A;  4JF4 A;  1FCO A;  3B33 A;  2WGW B;  3GDI A;  4RQ9 A;  4Q0H A;  1DP9 A;  1ACF A;  2IA2 A;  3N8R A;  3W8K A;  3W4Q A;  3A3J A;  4FH2 A;  1KGG A;  1PI4 A;  4RX2 A;  3UMD A;  4UA6 A;  4YNR A;  1ODV A;  3LFV A;  1YLW A;  3B3X A;  2PRF A;  3EOI A;  3GRJ A;  3PHY A;  3ZFZ A;  1BYW A;  2ZC4 B;  1YLP A;  1TD5 A;  2PU4 A;  2XA7 S;  1BSG A;  1HVB A;  3GEC A;  4ETX A;  1ZHH B;  1V9Y A;  1FQG A;  3ZVW A;  3DWK A;  4M4X A;  2Y59 A;  2WAD A;  3HUM A;  2Z2L B;  1LSX A;  1F98 A;  1HD8 A;  1GCE A;  1D06 A;  1BLH A;  4JXV A;  5MC7 A;  1RCJ A;  3UME A;  4O01 A;  5DFY A;  1K6S A;  1Q2Q A;  3DTE A;  5DVA A;  4DE1 A;  3IX8 A;  1WYB A;  1KVL A;  1P0Z A;  5AQ9 A;  2WZX A;  4KEN B;  2J9P A;  5HAI A;  2G2U A;  3ZG9 B;  3QP5 A;  4GD6 A;  1W8Y A;  1N4O A;  1EWZ A;  4S2I A;  1Z09 A;  5A8B A;  2WYX A;  2QZ6 A;  3A3E A;  1K57 C;  3RJU A;  1NYY A;  3PBT A;  1T1C A;  3IS2 B;  5AQ7 A;  2E8J A;  5J3W A;  2W1T A;  2ZMF A;  3UPP A;  3N7W A;  2OLV A;  4ZJ2 A;  4MBH A;  2O0Y A;  2PR5 A;  3KSH A;  1T18 A;  4R3A A;  4OOM A;  3WS5 A;  1YLY A;  1IYS A;  2PDR A;  4DE2 A;  3CZD A;  3OCL A;  2M7U A;  4EUV A;  4XT2 A;  5FI7 A;  4KG2 A;  3C5A A;  4M3K A;  4CJN A;  5F6A A;  2FZ0 A;  2P9V B;  1SDN A;  3VV4 A;  4K91 A;  3ZVT A;  2IWB A;  1PWG A;  1I5Q A;  2Y2M A;  1YPR A;  5G4Y A;  4DE0 A;  3NI9 A;  1CK3 A;  3H82 A;  3LCE A;  2V9A A;  3CIT A;  4ETZ A;  2JE5 A;  1YKD A;  4K0W A;  3MQ0 A;  3FKV A;  3PAE A;  3FG8 A;  5KSC A;  4BBV A;  3BLS A;  1T1B A;  1MPL A;  4S2P A;  1TDL A;  5G4Z A;  3TG9 A;  3ITB A;  4QHC A;  1LT0 A;  4EBL A;  1WA9 A;  2WZZ A;  1F5M A;  3LUQ A;  1YQS A;  3UE0 A;  1KDS A;  5HWV A;  2VKS A;  4OQ0 A;  1BTL A;  1TS7 A;  4BMW A;  2EX2 A;  3UY6 A;  1JWP A;  3B42 A;  1NRF A;  2ZLY A;  4G3V A;  4JBF A;  4E3L A;  1NJ4 A;  2VGK A;  1DRM A;  4KZ6 A;  3E0Y A;  4XT2 B;  4R23 A;  2ZBB A;  2ZQA A;  1XX2 A;  3O3V A;  4O7D A;  1OPX A;  3BY8 A;  4C75 A;  4IVI A; 
#chains in the Genus database with same CATH homology
 4KZ4 A;  3V3S A;  1IKI A;  2QPN A;  2EXB A;  3IF6 B;  3IXH A;  4KQR A;  4OQI A;  1MWU A;  1M40 A;  4X53 A;  5FA7 A;  1W8Q A;  3IWO A;  5CGS A;  5FSR A;  2PU2 A;  4K0X A;  4S2M A;  4WZ5 C;  4RYE A;  3ZGA B;  3BFF A;  4U3T A;  3ZNY A;  2EFX A;  1I2S A;  3FYZ A;  2JBF A;  3HLF A;  3PBN A;  4WBG A;  5HAQ A;  4JXS A;  4R0Q A;  3VOY A;  4QD4 A;  2WK0 A;  4PM9 A;  1OME A;  1XP4 A;  5TR7 A;  1IEL A;  4QJG A;  2XH9 A;  1LLB A;  5HL1 A;  5A90 A;  5CEC A;  1FR6 A;  4PM7 A;  5EE8 A;  4BD0 A;  1KE3 A;  1PWD A;  4PMA A;  5DF7 A;  3GTC A;  3GSG A;  3G2Y A;  2EX9 A;  5GLA A;  3WS4 A;  5CER A;  4B4Z A;  1IYO A;  3Q07 A;  2JCH A;  2Y2N A;  2H5S A;  4S2N C;  3M2J A;  1CI9 A;  3O88 A;  1FCN A;  4OON A;  3HLG A;  3Q82 A;  1PZO A;  3HBR A;  3DW0 A;  2C6W B;  3G31 A;  3WWX A;  1MXO A;  3C4P A;  1K54 C;  4WZ5 A;  5E2E A;  1RP5 A;  1MBL A;  5FQK A;  3MXR A;  1XPB A;  2XEP A;  4MBK A;  4Y0O A;  5L2F A;  3UDX A;  3LEZ A;  2PBY A;  2WUQ A;  1EI5 A;  2XD5 A;  4JXG A;  4N1H A;  2HDQ A;  1ERO A;  2H0Y A;  4R4R A;  1L0D A;  3C7U A;  1ALQ A;  4QY6 A;  1L0G A;  2OLU A;  2V20 A;  3HRE A;  5EOE A;  1K57 A;  3MKE A;  4ZBE A;  5M1A A;  1L0E A;  1IEM A;  3LY3 A;  4IED A;  4WMC D;  1BZA A;  3NIA A;  5FAT A;  1FOF A;  2Z2M B;  4X68 A;  1RGZ A;  2FFY A;  3IH9 A;  2XD1 A;  3FWL A;  4HBU A;  1GA0 A;  1PZP A;  4S2N A;  4BL3 A;  4PM5 A;  1CI8 A;  4KG5 A;  4N9L A;  2IWD A;  3SS3 A;  5CHU A;  4JF6 A;  1W7F A;  3ZHH A;  4UA7 A;  5GLD A;  3SH7 A;  1QMF A;  3PBO A;  4IVK A;  4WEK A;  5EEC A;  1E25 A;  3BFD A;  1K54 A;  1ZC2 A;  2Y2J A;  3DWZ A;  2Y2I A;  4C3Q A;  3QNB A;  5EVI C;  3VP3 A;  3PBQ A;  4UAA A;  4OP5 A;  2ZC7 A;  4X69 A;  1JWV A;  3UO9 A;  1LI9 A;  3E2K A;  2A49 A;  3Q81 A;  4WM9 A;  1VQQ A;  2HDU A;  2X01 A;  2Q9N A;  1O07 A;  1FCM A;  1L2S A;  4OLD A;  2E8I A;  1NY0 A;  1NZU A;  4H8R A;  4LV3 A;  1LL5 A;  2Y55 A;  1YLT A;  1VM1 A;  4OKP A;  4U0X A;  4LV2 A;  1KGE A;  3TSG A;  3ZG5 A;  1MWT A;  4P85 A;  3AGF A;  1GHM A;  2ZD8 A;  5HW3 A;  2Y2L A;  5A92 A;  4OPR A;  1IKG A;  5GHZ A;  3SH9 A;  2HDS A;  2HDR A;  3N8S A;  4KZB A;  1QME A;  3ZG8 B;  4OH0 A;  5F1F A;  1JWZ A;  5KMW A;  1U60 A;  2V2F F;  3ZDJ A;  2EXA A;  3W4O A;  5CTN A;  4E3N A;  1Q2P A;  2HP9 A;  2CC1 A;  5FQI A;  4BD1 A;  3HVF A;  3HUN A;  4X55 A;  3OCN A;  5EVI A;  1NXY A;  4N9K A;  2EFU A;  4FSF A;  1YT4 A;  3I7J A;  3UNW A;  1ES4 A;  4NET A;  3GMW A;  4LEN A;  5CHJ A;  2XK1 A;  5TFQ A;  2R9X A;  4OVD A;  1IYQ A;  4MEZ A;  1IYP A;  3UDI A;  4PPR A;  4ZJ1 A;  2BG1 A;  3M6B A;  3O86 A;  4EQI A;  1BLP A;  4DXC A;  1K4F A;  2WAE A;  3ISG A;  1ZG4 A;  3MZF A;  4KZ8 A;  4WEL A;  4OOL A;  2XF3 A;  4BL2 A;  1SHV A;  4GDN A;  4E3I A;  3CG5 A;  1XGI A;  1ES3 A;  4P87 A;  3GQZ A;  5FI2 A;  5M19 A;  3G4P A;  3VP4 A;  3N6I A;  3UN7 A;  4R4S A;  4CPK A;  5JYO A;  2UWX A;  4Y0T A;  3GR2 A;  3IXD A;  4DRT A;  5KSH A;  4PM8 A;  1N9B A;  4A5R A;  4S2K A;  5FAS A;  3JYI A;  1WE4 A;  2Y2G A;  1ESU A;  5HFO A;  3S1Y A;  5JYP A;  5E2G A;  2P9V A;  3IQA A;  1MWS A;  3VSK A;  2ZC6 B;  3OPL A;  1PW1 A;  3MXS A;  2Y2O A;  1K4E A;  2WGW A;  3N8L A;  4ZJ3 A;  5EPH A;  4X6T A;  4ID4 A;  4DKI A;  4GNU A;  5HAR A;  1K55 A;  3NBL A;  3VOZ A;  1KGF A;  3QNC A;  1ZKJ A;  1TVF A;  5D3O A;  4DXB A;  2BLS A;  2EX6 A;  1E4D A;  5G18 A;  5E2F A;  1C3B A;  3BYD A;  5U47 A;  1ES2 A;  1MWR A;  3NY4 A;  3NCK A;  3G32 A;  5GHX A;  2HP5 A;  3LY4 A;  3PTE A;  1BLS A;  4FCF A;  4S2J A;  5F82 A;  4UA9 A;  4KZ9 A;  2ZQ9 A;  5KZH A;  4MBF A;  4GDB A;  5EUA A;  4KZ5 A;  2J8Y A;  3MZE A;  5IHV A;  4OPQ A;  4OLG A;  1JTD A;  3C4O A;  3Q7V B;  4OQG A;  4Y0U A;  1XGJ A;  3HLE A;  3IXG A;  3CMZ A;  1GHP A;  5FI6 A;  4R3B A;  4E3O A;  3IWQ A;  4LV0 A;  1LI0 A;  2Y2Q A;  4DE3 A;  2ZQC A;  5EOO A;  5CXW A;  4MLL A;  2ZM8 A;  5FQ9 A;  5BOH A;  4EV4 A;  3NDG A;  4ZTK A;  4B88 A;  3V3R A;  1JVJ A;  4OP8 A;  4BEN A;  3IF6 C;  1E3U A;  5GLC A;  2FFF B;  4MNR A;  4KZ3 A;  4ZAM A;  5CEB A;  3BLM A;  1MKI A;  4FH4 A;  1K56 A;  5FAO A;  4EWF A;  1GHI A;  4DF6 A;  1BUL A;  3VMA A;  3M2K A;  1ERQ A;  3OPP A;  2H10 A;  2J9O A;  1G68 A;  4JKT A;  5CTM A;  4DDY A;  2DNS A;  3BFC A;  1YMS A;  4E3J A;  3SOI A;  3HUO A;  3W4P A;  3A3F A;  3S22 A;  3VFF A;  1BLC A;  3EQV A;  1YLJ A;  3GVB A;  1ZG6 A;  2Y4A A;  4E6W A;  2ZJ9 A;  5J8X A;  3TOI A;  3WRT A;  4EBP A;  5CGW A;  2WGI A;  3G34 A;  1XKZ A;  2HPB A;  3SS4 A;  3G2Z A;  4GB7 A;  2JC7 A;  3BRM A;  2IWC A;  3GV9 A;  4P6B A;  4ZDX A;  2WKE A;  1FSY A;  2QMI A;  4JF4 A;  1FCO A;  5CED A;  1K25 A;  2WGW B;  1WYC A;  4D2O A;  3DTM A;  3OC2 A;  5DTT A;  4B4X A;  3N8R A;  1LHY A;  1I2W A;  3W8K A;  4BJP A;  4XUX A;  3W4Q A;  2XFS A;  3A3J A;  3ITA A;  3O87 A;  4FH2 A;  1KGG A;  5CHM A;  1PI4 A;  4RX2 A;  5AQB A;  4UA6 A;  1SDE A;  5FDH A;  5FQM A;  3MZD A;  3EQU A;  2I72 A;  4FD8 A;  4L0L A;  1YLW A;  3ZG0 A;  3B3X A;  5EVI D;  3GRJ A;  2RL3 A;  1FSW A;  4YIN A;  3ZFZ A;  5FQJ A;  2ZC4 B;  1YLP A;  3P98 A;  5FQQ A;  2PU4 A;  1KVM A;  1S6R A;  1PWC A;  2R9W A;  5FAQ A;  1BSG A;  1HVB A;  3RXX A;  1Y54 A;  3HLB A;  3VP2 A;  1FQG A;  2WAF A;  1PI5 A;  3HLW A;  5DF8 A;  3HLD A;  4S2L A;  4KQO A;  3ZVW A;  3DWK A;  5I94 A;  3OZH A;  4OPZ A;  4E3M A;  4KG6 A;  2Y59 A;  3SS5 A;  3NDE A;  1G6A A;  2WAD A;  1HZO A;  3HUM A;  4GOG A;  4LCM A;  2Z2L B;  3IHB A;  2ZC5 B;  3S4X A;  1GA9 A;  2H0T A;  2ZM2 A;  3V39 A;  2Y2P A;  1HD8 A;  1GCE A;  1BLH A;  4JXV A;  1PIO A;  1RCJ A;  1YLZ A;  5DF9 A;  3WS1 A;  5CGX A;  4EBN A;  1XA1 A;  4NK3 A;  1K6S A;  4JXW A;  1KE0 A;  5CRF A;  2DRW A;  1Q2Q A;  4F94 A;  3G35 A;  5DVA A;  4DE1 A;  1L0F A;  1ES5 A;  1RGY A;  2X02 A;  4RX3 A;  4Q8I A;  1WYB A;  1KVL A;  2A3U A;  3BEC A;  5AQ9 A;  2WZX A;  3UPO A;  4KEN B;  2J9P A;  5HAI A;  2G2U A;  4WYY A;  5FAP A;  4OOY A;  5F83 A;  3AGD A;  3ZG9 B;  2ZM0 A;  4JLF A;  2WGV A;  1FR1 A;  3UDF A;  4GD6 A;  1W8Y A;  1N4O A;  1O7E A;  2ZQ8 A;  1EWZ A;  1H5X A;  4LCL A;  4S2I A;  1NZO A;  2B5R A;  2Y2K A;  4S2O A;  2G2W A;  2HP6 A;  2Y91 A;  5TGF A;  1BT5 A;  3BEB A;  4HBT A;  5E2H A;  4DDS A;  1YM1 A;  2WYX A;  2P74 A;  3VP1 A;  2QZ6 A;  3FZC A;  4XUZ A;  3A3E A;  2OSU A;  1K6R A;  5HAP A;  1W79 A;  2ZQ7 A;  1K57 C;  3RJU A;  1NYY A;  3E2L A;  3MKF A;  3LO7 A;  3PBT A;  3Q7Z A;  5EVI B;  3IHA A;  5AQ7 A;  3VFH A;  1TDG A;  3UPP A;  4X56 A;  2XDM A;  3ZG7 B;  5M18 A;  2X71 A;  3N7W A;  2OLV A;  4ZJ2 A;  1DJC A;  5HX9 A;  1DY6 A;  4MBH A;  3OPH A;  1M6K A;  4Z9Q A;  4R1G A;  1W5D A;  1E3U D;  4KZ7 A;  3BM6 A;  3VSL A;  1AXB A;  4N1X A;  4OOM A;  2OV5 A;  1YMX A;  3MBZ A;  3N4I A;  4JF5 A;  4BLM A;  4E6X A;  3Q1F A;  3WS5 A;  1PW8 A;  1K56 D;  3ZNT A;  4U0T A;  1YLY A;  3M6H A;  1IYS A;  2VGJ A;  3HLC A;  1ERM A;  2WKI A;  4UHU A;  3WS2 A;  3OPR A;  4KQQ A;  4DE2 A;  3CZD A;  3OCL A;  1JTG A;  3MFD A;  1CEF A;  5F1G A;  3C7V A;  5FI7 A;  3IT9 A;  4KG2 A;  2RCX A;  4RA7 A;  4Y7P A;  4YFM A;  4WMC A;  1SCW A;  1J9M A;  3C5A A;  3RXW A;  4R3J A;  1XA7 A;  4GN2 A;  4M3K A;  4CJN A;  3UE3 A;  3WRZ A;  3IH8 A;  4OPY A;  1CEG A;  3G30 A;  4PM6 A;  3IF6 A;  3UE1 A;  2P9V B;  2XLN A;  1SKF A;  3VP0 A;  4QU3 A;  1SDN A;  3BFG A;  4LV1 A;  4GD8 A;  4K91 A;  3ZVT A;  3IF5 A;  2IWB A;  1PWG A;  1I5Q A;  4EUZ A;  2C5W B;  2Y2M A;  4DE0 A;  3BFE A;  3NI9 A;  1CK3 A;  1KDW A;  5GL9 A;  3LCE A;  2EX8 A;  4E3K A;  1DJA A;  1ONH A;  1S0W A;  2JE5 A;  3QHY A;  4XXR A;  4K0W A;  5GHY A;  3FKV A;  1MY8 A;  2ZC3 B;  4KZA A;  5AQA A;  3PAE A;  5E43 A;  3V50 A;  1Z6F A;  2XFT A;  4HEF A;  3BLS A;  2DCF A;  5KSC A;  3IXB A;  1MPL A;  1ONG A;  1ESI A;  4S2P A;  3HL9 A;  1TDL A;  2ZMA A;  3PBR A;  3ITB A;  4QHC A;  3TG9 A;  1DJB A;  4EBL A;  4N92 A;  2WZZ A;  4IBR A;  1LL9 A;  1YQS A;  3ZCZ A;  3PBS A;  3UE0 A;  5A93 A;  3NC8 A;  1KDS A;  2Q9M A;  4IBX A;  2J7V A;  4RVA A;  2XGN A;  1BUE A;  4OQ0 A;  1BTL A;  1H8Z A;  3V5M A;  1NYM A;  3Q7V A;  2XR0 A;  2EX2 A;  1TEM A;  3UY6 A;  1JWP A;  1H8Y A;  4QB8 A;  1XXM A;  4C6Y A;  3CJM A;  4GKU A;  1NRF A;  4WZ4 A;  3A3I A;  2XQZ A;  5DTK A;  2ZLY A;  3IWI A;  5GLB A;  4JBF A;  3PAG A;  2GDN A;  4E3L A;  1K38 A;  1KE4 A;  1NJ4 A;  2VGK A;  5EVL A;  2Y2H A;  4KZ6 A;  5DTS A;  1PYY A;  3FV7 A;  3P09 A;  3UPN A;  3AGE A;  4R23 A;  2ZQA A;  3D4F A;  4QY5 A;  4WEJ A;  1HTZ A;  1XX2 A;  2V1Z A;  3O3V A;  1K55 C;  4GZB A;  3A3D A;  3FKW A;  4O7D A;  4BQM A;  5A91 A;  3SH8 A;  3WS0 A;  2WKH A;  4JPM A;  2ZQD A;  4P0M A;  4IVI A;  4OQH A;  4C75 A;  4HES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...