1TDOA

L-amino acid oxidae from agkistrodon halys in complex with l-phenylalanine
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
484
structure length
484
Chain Sequence
b'DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complexes with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 166
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdoA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdoA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdoA01
2OAMA 3ATQA 3NHOX 1JEHA 4GDEA 4Z44A 4Y4LA 2CFYA 3C4NA 2C66A 1PBEA 4CNJA 3D1CA 3UKPA 2V60A 4ICYA 4Z43A 4UDPA 3QSMA 4USQA 4H4VA 4ZCDA 4EMWA 2GH5A 1GRFA 3E1TA 4LA1A 1JNZA 4YSHA 3CGBA 4Z2UA 4YSZA 1H7XA 4HA6A 1YKJA 2PYXA 4ADWA 5KWFA 3RP6A 4TLXA 1GXFA 1ZDLA 1S3EA 3D8XA 3NNEA 2WP9A 2X3NA 1CC4A 4NZHA 1D4CA 2WDQA 2Z5XA 2BS3A 3K7TA 3DJEA 3CTYA 1IUWA 3AYIA 2Q0KA 4C5OA 4OVIA 4J36A 3CGDA 4J34A 5HYMA 4JNAA 3AYJA 4YKFA 1YQ3A 1F8RA 2VQ7A 4UDRA 3CNTA 1KDGA 3AE5A 4K5SA 1JRXA 1CL0A 3VQRA 3DK8A 4B68A 2YAUA 1SEZA 1CC6A 1PBFA 2JAEA 3QSSA 1VRQB 1TDNA 3GDPA 1GTEA 4USRA 2JB1A 3IHMA 1VG0A 1JNRA 1NHPA 2C64A 3ZDNA 1E39A 3UKLA 4EMJA 3EPTA 1EL8A 4B66A 2BS4A 1H83A 1F8SA 3ABVA 3DJDA 3IWAA 4H4SA 4XWRA 4CY8A 2WDVA 4IA5A 5DBJA 4GR1A 2O9ZA 2JBVA 1UKVG 3C96A 4Z2TA 2V6OA 3BNMA 3EF6A 3Q6JA 2YG5A 2WU5A 2Q6UA 2XDOA 4A99A 3UP4A 5EOWA 4O5QA 2Q0LA 2C65A 3UCLA 4A79A 3QVPA 1H7WA 2GB0A 5FMHA 1RP0A 1BGJA 2YR6A 3CPIG 3LZXA 2VRMA 1KNRA 2YWLA 2NVKX 4H4ZA 1EL5A 1ZMDA 2XYOA 4AP3A 4NTCA 3IF9A 1IUTA 4X9MA 1GPEA 3AE7A 1DOCA 2BCGG 2TPRA 1E1MA 1YQZA 3UP5A 1GRBA 4A65A 2GMHA 4H50A 3K7MX 4UDQA 3L8KA 1N4WA 2I0ZA 3BI4A 3NKSA 3NYFA 4GUVA 4N9XA 4U8JA 4D03A 2YG4A 1GV4A 2BC1A 2DKHA 2ZZCA 2WESA 3AXBA 3P4RA 4EIPA 4C74A 5LV9A 1REOA 1QLBA 1IUSA 2WP6A 1M6IA 3GRSA 2YLWA 3FIMB 5FS8A 3NYEA 5CKUA 1COYA 4CCQA 4A9WA 2ZBWA 2R0GA 3AB1A 5BRTA 1CJ3A 3AD7B 3GWDA 2XLUA 3G5SA 4AOXA 3KKJA 5HHFA 2C73A 5EB4A 2BC0A 5IPYA 2BA9A 5KVIA 2R45A 4C77A 2J3NA 4FK1C 2GEWA 2UZZA 1FEBA 2QA2A 4E0VA 4Y4NA 3V3OA 1D7YA 3ALMA 1F3PA 1Q1WA 4H2RA 3F8RA 4U8OA 3PO7A 1ZOYA 3ALLA 3BI5A 3BHKA 3NT6A 4H4TA 4WCTA 5BVAA 3PS9A 4J33A 1GREA 1M64A 1FL2A 2H89A 3F8PA 3JSKA 3L1RA 2B9WA 2RGOA 4PAAA 1BZLA 5JCKA 5JCLA 2YR4A 3UTEA 1B37A 4YWOA 3CNSA 4EM4A 4UP3A 2FJDA 4H2QA 2B7RA 1NHSA 2GR1A 3I3LA 4U8KA 4AT2A 4O5UA 2WOWA 1L9CA 2CULA 4JY3A 3GMCA 3QFBA 4APNA 2XVEA 4NTDA 3NN6X 2WOVA 2Z5YA 3GRTA 3KU9A 1YY5A 3LXDA 2YG6A 1Z6LA 3UTFA 3QJ4A 1NHQA 4BJZA 1DJNA 4A6NA 3B6DA 1MXTA 4OPDA 2YG3A 4YTMA 2OA1A 3AE1A 2A89A 3BHFA 1NEKA 4LIIA 1D4EA 3NTAA 1CC2A 4GDPA 4Y4MA 3V76A 4D04A 1OJTA 4EQXA 2A8XA 1N1PA 1KFYA 3FPZA 1W4XA 1NG3A 4K22A 4NTEA 4CY6A 4JNQA 3AE2A 3ALJA 2CVJA 3LJPA 3DJGX 3SFEA 2XFPA 2XFOA 3FBSA 2YLZA 2GR3A 2R0PA 1X31B 3AE3A 2ZZBA 1ELIA 3AYLA 4JQ9A 4C3XA 2W0HA 2WPFA 2GQWA 3NLCA 1QO8A 2AR8A 1P2EA 4REKA 3II4A 4PABA 1CBOA 1HYUA 1PXBA 2GVCA 4FX9A 3AEDA 2FJBA 4MJWA 3SM8A 2C67A 1Y56A 4DNAA 1O5WA 1VDCA 3AWIA 2BK3A 4OPGA 3UOZA 1JU2A 1KSSA 3UKAA 4H4RA 1GRTA 2BS2A 3VRDB 1TDEA 5C3JA 3C4AA 4BURA 3P9UA 1N4UA 3ICTA 4H2NA 4U8MA 2RABA 4YT0A 2GF3A 2WQYA 3AEFA 3GSIA 2Y6QA 2GAGB 1GRGA 1V59A 4A5LA 3UTGA 3CNJA 2V61A 2JKCA 2YLRA 1GSNA 1CJCA 3GMBA 1LV0A 1TDOA 4EMIA 4U2SA 2ACZA 3B3RA 1E7PA 1D7LA 3M0OA 1FOHA 3DA1A 2Q7VA 2GMJA 3R9UA 4TLZA 3GYJA 2EQ9A 1GETA 2DKIA 4ZCCA 1B8SA 3K30A 4I59A 1K0IA 3OC4A 3ITJA 1H84A 2JB3A 1GEUA 1E1KA 1NHRA 1FCDA 2XLTA 4J57A 2R46A 1K0JA 1BWCA 1EBDA 2GV8A 3AD8B 4K8DA 3CIRA 3OZ2A 4HB9A 4YTPA 3H8IA 1B4VA 3GWFA 3VR9A 3CNPA 1XANA 1CJ4A 2C7GA 3M13A 1ZX9A 3NGCX 1H6VA 1VG9A 4ZN0A 4WX1A 4BK3A 2FJAA 2ARDA 1L9DA 3AE6A 4FDCB 4Z2RA 1H86A 2A87A 2IIDA 1PBBA 4OCGA 4U8LA 3G5RA 1O94A 4IV9A 3SQPA 1ZOVA 2WOIA 1EL9A 3DJJA 2JB2A 3DK4A 3AE4A 2GAHB 2WBAA 2GRTA 4A6NB 2YM1A 1NG4A 5KOXA 2VQBA 4EQWA 1LQUA 3CNDA 3QVRA 2B76A 2V3BA 3P1WA 1BF3A 1P2HA 2EQ7A 3P4SA 5U25A 3LZWA 4I58A 3BI2A 4YSXA 1NENA 2R4EA 2WETA 2BYBA 1TRBA 2TMDA 3EAOA 3AEEA 2OALA 1XHCA 2QAEA 1JOAA 3ICRA 3SGLA 4J56A 1PS9A 3GDNA 1GERA 3NK0X 1TYPA 2BACA 2WP5A 2WPEA 2YVGA 1PN0A 3IHGA 1GALA 4IA6A 1CF3A 3URHA 4GF7A 4RSLA 2C70A 3VRAA 3AE8A 5J60A 1NDAA 1PJ6A 3H4KA 3NG7X 2XFUA 4BK2A 1RYIA 2YR5A 4OPTA 2YG7A 1GTHA 2B9YA 1DOBA 1PXAA 2FJEA 4B67A 2BXSA 3VR8A 3ZYXA 1LQTA 3QFAA 4U8NA 4BK1A 2BABA 5FS7A 4YTNA 2GR0A 4DSGA 4H7UA 1KF6A 2OLOA 2RGHA 2YLXA 2XVHA 5GRTA 3GYIA 4U8PA 4U8IA 1OJCA 3V3NA 1BKWA 3ATRA 3NYCA 4TM1A 4AP1A 2GQFA 3NH3X 1E1LA 4H4PA 2WHDA 2C72A 3RP8A 5TR3A 1DJQA 4JN9A 5M0ZA 5GSNA 3EANA 1LPFA 1D4DA 3CGEA 3KPFA 3LOVA 1PHHA 2VVLG 1DODA 3NK1X 4J2WA 1PDHA 5J7XA 1JRZA 1LJ1A 2VVMA 4CRTA 3KVEA 1DOEA 4Z24A 2AQJA 2CDUA 3AD9B 3NK2X 1B5QA 2YM2A 1PXCA 4KX6A 4CBQA 4JY2A 5BUKA 3CPHG 1PJ7A 1Y0PA 3KLJA 2BCPA 4B65A 1RSGA 4TM4A 4M52A 1Q1RA 1N4VA 3DK9A 5ER0A 1OJAA 4EQRA 2YLTA 3UTHA 1KSUA 2FBWA 1O95A 3AEBA 4TM0A 3T37A 4JDRA 4J31A 4GCMA 1CHUA 1F8WA 3BNUA 1PBDA 2XVFA 3FG2P 4H4WA 4IVOB 4K5RA 3REDA 3CGCA 4EM3A 3COXA 2VZ2A 3S5WA 2QA1A 1K4QA 5KRQA 4B64A 2E1MA 2XLPA 3I6DA 5KOWA 5KXJA 2F5ZA 1S2YA 3AECA 2C75A 5IQ1A 4X4JA 3DMEA 1TDKA 1S3BA 5CQFA 2RGJA 3NRNA 4BV6A 3DGZA 3RNMA 4OPUA 1H82A 3PVCA 3UKFA 4GRTA 1MO9A 1GRAA 2X50A 4ECHA 3NTDA 1YQ4A 3CN8A 5L46A 3UOYA 4P9SA 4CNKA 1ONFA 1XPQA 4U2LA 3KD9A 5EBKA 4H4UA 4XWZA 5KVHA 4X9NA 2QCUA 5IQ4A 2H88A 3RP7A 1GT8A 1XDIA 3RHAA 1LVLA 4DGKA 2C3CA 2EQ6A 3UKKA 2WS3A 4EQSA 3LADA 2GR2A 3AE9A 4Z25A 4YXDA 1NAAA 1EL7A 1PJ5A 2XFNA 2X8GA 3GD3A 3O0HA 2NPXA 4C3YA 3VRBA 1FEAA 2B7SA 1ZP0A 3UOXA 1OJDA 1ZKQA 1PBCA 4NEWA 1K0LA 3H8LA 1E1NA 5JCMA 1GESA 2X8HA 2XCGA 1QJDA 4KPRA 1IUVA 1LTXR 4A7AA 1E6EA 1H81A 2B9XA 1IUUA 1DXLA 1ZY8A 3QSEA 1F6MA 2Y6RA 2VRLA 3FMWA 3GD4A 4EIQA 3UKQA 3K7QX 5U1OA 4YKGA 2V3AA 3LB8A 4RG4A 2V5ZA 2R0CA 3P4QA 4XXGA 5BULA 1AOGA 3F8DA 5C2TA 2EQ8A 5HXIA 5HY5A 2E4GA 2IVEA 2WPCA 4OPCA 3NIXA 3UOVA 4TM3A 2WEUA 2XVJA 2WU2A 4K2XA 2IVDA 3ISHA 1VQWA 4AOSA 5EB5A 4NEVA 4OPLA 4FK1A 4H4XA 3ICSA 3NN0X 3Q9TA 2BXRA 5FS6A 4AT0A 2PHHA 5JCNA 3CPJG 1OJ9A 1IJHA 1NPXA 3HZLA 3G5QA 3ADAB 4LU6A 1GOSA 2C3DA 5U63A 4CCRA 1TYTA 2BK5A 1IUXA 3IC9A 3WE0A 4B69A 2X8CA 4BJYA 1BGNA 4RG3A 2YVFA 2YLSA 3KA7A 1DNCA 1GRHA 2HQMA 1KNPA 3AEGA 4B1BA 1L0VA 4DSHA 2C76A 1Q9IA 2XLRA 1TDFA 1S2QA 2E5VA 2XVIA 4H4YA 5JCIA 4U2TA 2APGA 1JRYA 4B63A 1Y56B 5M10A 2WDRA 1D5TA 4OPIA 2R9ZA 2JK6A 2YVJA 1CJ2A 3M12A 4H4QA 3UKHA 1ZMCA 2VVLA 2VOUA 5FS9A 4Z26A 3P4PA 3S61A 2R4JA 2XLSA 3DGHA 4IVMB 2BK4A 1MOKA 1GNDA 1FECA 2OLNA 2ZZ0A 4H2PA 3AEAA 4YSYA 1L9EA 2X99A 2AAQA 4K7ZA 2YQUA 3SFDA 3DH9A 1ZK7A 2XFQA
chains in the Genus database with same CATH superfamily
2OAMA 3ATQA 3NHOX 1JEHA 4GDEA 4Z44A 4Y4LA 2CFYA 3C4NA 2C66A 1PBEA 4CNJA 3D1CA 3UKPA 2V60A 4ICYA 4Z43A 4UDPA 3QSMA 4USQA 4H4VA 4ZCDA 4EMWA 2GH5A 1GRFA 3E1TA 4LA1A 1JNZA 4YSHA 3CGBA 4Z2UA 4YSZA 1H7XA 4HA6A 1YKJA 2PYXA 4ADWA 5KWFA 3RP6A 4TLXA 3SZ0A 1GXFA 1ZDLA 1S3EA 3D8XA 3CMMA 3NNEA 2WP9A 2X3NA 1CC4A 4NZHA 1D4CA 2WDQA 3T31A 2Z5XA 2BS3A 3K7TA 3DJEA 3CTYA 1IUWA 3AYIA 2Q0KA 4C5OA 4OVIA 4J36A 3CGDA 4J34A 5HYMA 4JNAA 3AYJA 4YKFA 1YQ3A 1F8RA 2VQ7A 4UDRA 3CNTA 1KDGA 3AE5A 4K5SA 1JRXA 1CL0A 4GAVA 3VQRA 3DK8A 4B68A 2YAUA 5J60A 1SEZA 1CC6A 1PBFA 2JAEA 3QSSA 1VRQB 1TDNA 3GDPA 1GTEA 4USRA 2JB1A 3IHMA 1VG0A 1JNRA 1NHPA 2C64A 3ZDNA 1E39A 3UKLA 4EMJA 3EPTA 1EL8A 4B66A 2BS4A 1H83A 1F8SA 3ABVA 3DJDA 3IWAA 4H4SA 4XWRA 4CY8A 2WDVA 4IA5A 5DBJA 4GR1A 2O9ZA 2JBVA 1UKVG 3C96A 4Z2TA 2V6OA 3BNMA 3EF6A 3Q6JA 2YG5A 2WU5A 2Q6UA 2XDOA 4NWZA 4A99A 3UP4A 5EOWA 4O5QA 2Q0LA 2C65A 3UCLA 4A79A 3QVPA 1H7WA 2GB0A 5FMHA 1RP0A 1BGJA 2YR6A 3CPIG 3LZXA 2VRMA 1KNRA 2YWLA 2NVKX 4GAPA 4H4ZA 1EL5A 1ZMDA 2XYOA 4G6HA 4AP3A 4NTCA 3IF9A 1IUTA 4X9MA 1GPEA 3AE7A 1DOCA 2BCGG 2TPRA 1E1MA 1YQZA 3UP5A 1GRBA 4A65A 2GMHA 4H50A 3K7MX 4UDQA 3L8KA 1N4WA 2I0ZA 3BI4A 3NKSA 3NYFA 4GUVA 4N9XA 4U8JA 4D03A 2YG4A 1GV4A 2BC1A 2DKHA 2ZZCA 2WESA 3AXBA 3P4RA 4EIPA 4C74A 5LV9A 1REOA 1QLBA 3SZCA 1IUSA 2WP6A 1M6IA 3GRSA 2YLWA 3FIMB 5FS8A 3NYEA 5CKUA 1COYA 4CCQA 4A9WA 2ZBWA 2R0GA 3AB1A 5BRTA 5KMSA 1CJ3A 3AD7B 3GWDA 2XLUA 3G5SA 4AOXA 3KKJA 5HHFA 2C73A 5EB4A 2BC0A 5IPYA 2BA9A 5KVIA 2R45A 4C77A 2J3NA 4FK1C 2GEWA 2UZZA 1FEBA 2QA2A 4E0VA 4Y4NA 3V3OA 1D7YA 3ALMA 1F3PA 1Q1WA 4H2RA 3F8RA 4U8OA 3PO7A 1ZOYA 3ALLA 3BI5A 3BHKA 3NT6A 4H4TA 4WCTA 5BVAA 3PS9A 4J33A 1GREA 1M64A 1FL2A 2H89A 3F8PA 3JSKA 3L1RA 2B9WA 2RGOA 4PAAA 1BZLA 5JCKA 5JCLA 2YR4A 3UTEA 1B37A 4YWOA 3CNSA 4EM4A 4UP3A 2FJDA 4H2QA 3T14A 2B7RA 1NHSA 2GR1A 3I3LA 4U8KA 4AT2A 4O5UA 2WOWA 1L9CA 2CULA 4JY3A 3GMCA 3QFBA 4APNA 2XVEA 4NTDA 3NN6X 2WOVA 2Z5YA 3GRTA 3KU9A 1YY5A 3LXDA 2YG6A 1Z6LA 3T0KA 3UTFA 3QJ4A 1NHQA 4BJZA 1DJNA 4A6NA 3B6DA 1MXTA 4OPDA 2YG3A 4YTMA 2OA1A 3AE1A 2A89A 3BHFA 1NEKA 4LIIA 1D4EA 3NTAA 1CC2A 4GDPA 4Y4MA 3V76A 4D04A 1OJTA 4EQXA 2A8XA 1N1PA 1KFYA 3FPZA 1W4XA 1NG3A 3HYXA 4K22A 4NTEA 4CY6A 4JNQA 3AE2A 3ALJA 2CVJA 3LJPA 3DJGX 3SFEA 2XFPA 2XFOA 3FBSA 2YLZA 2GR3A 2R0PA 1X31B 3AE3A 2ZZBA 1ELIA 3AYLA 4JQ9A 4C3XA 2W0HA 2WPFA 2GQWA 3NLCA 1QO8A 2AR8A 1P2EA 4REKA 3II4A 4PABA 1CBOA 1HYUA 1PXBA 2GVCA 4FX9A 3AEDA 2FJBA 4MJWA 3SM8A 2C67A 1Y56A 4II3A 1O5WA 4DNAA 1VDCA 3AWIA 2BK3A 4OPGA 3UOZA 1JU2A 1KSSA 3UKAA 4H4RA 1GRTA 2BS2A 4G6GA 3VRDB 1TDEA 5C3JA 3C4AA 4BURA 3P9UA 1N4UA 3ICTA 4H2NA 4U8MA 2RABA 4YT0A 2GF3A 2WQYA 3AEFA 3GSIA 2Y6QA 2GAGB 1GRGA 1V59A 4A5LA 3UTGA 3SZWA 3CNJA 2V61A 2JKCA 2YLRA 1GSNA 1CJCA 3GMBA 1LV0A 1TDOA 4EMIA 4G73A 4U2SA 2ACZA 3B3RA 1E7PA 1D7LA 3M0OA 1FOHA 3T2KA 3DA1A 2Q7VA 2GMJA 3R9UA 4G9KA 3GYJA 2EQ9A 4TLZA 1GETA 2DKIA 4ZCCA 1B8SA 3K30A 4I59A 1K0IA 3OC4A 3ITJA 1H84A 2JB3A 1GEUA 1E1KA 1NHRA 1FCDA 2XLTA 4J57A 2R46A 1K0JA 1BWCA 1EBDA 2GV8A 3AD8B 4K8DA 3CIRA 3OZ2A 4HB9A 4YTPA 3H8IA 1B4VA 3GWFA 3VR9A 3CNPA 1XANA 1CJ4A 2C7GA 3M13A 1ZX9A 3NGCX 4NNJA 1H6VA 1VG9A 4ZN0A 3HYWA 4WX1A 4BK3A 2FJAA 2ARDA 1L9DA 3AE6A 4FDCB 4Z2RA 1H86A 2A87A 2C4CA 2IIDA 1PBBA 4OCGA 4U8LA 3G5RA 4IV9A 1O94A 3SQPA 1ZOVA 2WOIA 1EL9A 3DJJA 2BRYA 2JB2A 3KPKA 3DK4A 3AE4A 2GAHB 2WBAA 2GRTA 4A6NB 2YM1A 1NG4A 5KOXA 2VQBA 4EQWA 1LQUA 3CNDA 3QVRA 2B76A 2V3BA 3P1WA 1BF3A 1P2HA 2EQ7A 3P4SA 5U25A 3LZWA 4I58A 3BI2A 4YSXA 1NENA 2R4EA 2WETA 2BYBA 1TRBA 2TMDA 3EAOA 3AEEA 2OALA 1XHCA 2QAEA 1JOAA 3ICRA 3SGLA 4J56A 1PS9A 3GDNA 1GERA 3NK0X 2BACA 1TYPA 2WP5A 2WPEA 2YVGA 1PN0A 3IHGA 1GALA 4IA6A 1CF3A 3T2YA 2BRAA 4GF7A 2C70A 4RSLA 3AE8A 3URHA 1NDAA 3VRAA 1PJ6A 3H4KA 3NG7X 2XFUA 4BK2A 1RYIA 2YR5A 4OPTA 2YG7A 1GTHA 2B9YA 1DOBA 1PXAA 2FJEA 4B67A 2BXSA 3VR8A 3ZYXA 1LQTA 3QFAA 4U8NA 4BK1A 2BABA 5FS7A 4YTNA 2GR0A 4DSGA 4H7UA 1KF6A 2OLOA 2RGHA 2YLXA 5KMQA 2XVHA 5GRTA 3GYIA 4U8PA 4U8IA 1OJCA 3V3NA 1BKWA 3ATRA 3NYCA 4TM1A 4AP1A 2GQFA 3NH3X 1E1LA 4H4PA 2WHDA 2C72A 3RP8A 5TR3A 1DJQA 4JN9A 5M0ZA 5GSNA 3EANA 1LPFA 1D4DA 3CGEA 3KPFA 3LOVA 1PHHA 2VVLG 1DODA 3NK1X 4J2WA 1PDHA 5J7XA 1JRZA 1LJ1A 2VVMA 4CRTA 3KVEA 1DOEA 4Z24A 2AQJA 2CDUA 3AD9B 3NK2X 1B5QA 2YM2A 1PXCA 4KX6A 4CBQA 4JY2A 5BUKA 3CPHG 1PJ7A 1Y0PA 3KLJA 2BCPA 4B65A 1RSGA 4TM4A 4M52A 1Q1RA 1N4VA 3DK9A 5ER0A 1OJAA 4EQRA 2YLTA 3UTHA 1KSUA 2FBWA 1O95A 3SZFA 3AEBA 4TM0A 3T37A 4JDRA 4J31A 4GCMA 1CHUA 1F8WA 3BNUA 1PBDA 2XVFA 3FG2P 4H4WA 4IVOB 4K5RA 3REDA 3CGCA 4EM3A 3COXA 2VZ2A 3S5WA 2QA1A 1K4QA 4II2A 5KRQA 4B64A 2E1MA 2XLPA 3I6DA 5KOWA 5KXJA 2F5ZA 1S2YA 3AECA 2C75A 5IQ1A 4X4JA 3DMEA 1TDKA 1S3BA 3GYXA 5CQFA 2RGJA 3NRNA 4BV6A 5KNLA 3DGZA 3RNMA 4OPUA 1H82A 3PVCA 3UKFA 4GRTA 1MO9A 1GRAA 2X50A 4ECHA 3NTDA 1YQ4A 3CN8A 5L46A 3UOYA 3SXIA 4P9SA 4CNKA 1ONFA 1XPQA 4U2LA 3KD9A 5EBKA 4H4UA 4XWZA 5KVHA 4X9NA 2QCUA 5IQ4A 2H88A 3RP7A 1GT8A 1XDIA 3RHAA 1LVLA 4DGKA 2C3CA 2EQ6A 3UKKA 2WS3A 4EQSA 3LADA 3SX6A 2GR2A 3AE9A 4Z25A 4YXDA 1NAAA 1EL7A 1PJ5A 2XFNA 2X8GA 3GD3A 3O0HA 2NPXA 5KMPA 4C3YA 3VRBA 1FEAA 2B7SA 1ZP0A 3UOXA 1OJDA 1ZKQA 1PBCA 4NEWA 1K0LA 3H8LA 1E1NA 4G74A 5JCMA 1GESA 2X8HA 2XCGA 1QJDA 4KPRA 1IUVA 1LTXR 4A7AA 1E6EA 1H81A 2B9XA 1IUUA 1DXLA 1ZY8A 3QSEA 1F6MA 2Y6RA 2VRLA 3FMWA 3SY4A 3GD4A 4EIQA 3UKQA 3K7QX 5U1OA 4YKGA 2V3AA 3LB8A 4RG4A 2V5ZA 2R0CA 3P4QA 4XXGA 5BULA 1AOGA 3F8DA 5C2TA 2EQ8A 5HXIA 5HY5A 2E4GA 2IVEA 2WPCA 4OPCA 3NIXA 3UOVA 4TM3A 2WEUA 2XVJA 2WU2A 4K2XA 2IVDA 3ISHA 1VQWA 4AOSA 5EB5A 4NEVA 4OPLA 4FK1A 4H4XA 3ICSA 3NN0X 3Q9TA 2BXRA 5FS6A 4AT0A 2PHHA 5JCNA 3CPJG 1OJ9A 1IJHA 1NPXA 3HZLA 3G5QA 3ADAB 4LU6A 1GOSA 2C3DA 5U63A 4CCRA 1TYTA 2BK5A 1IUXA 3IC9A 3WE0A 4B69A 2X8CA 4BJYA 5KMRA 1BGNA 4RG3A 2YVFA 2YLSA 3KA7A 1DNCA 1GRHA 2HQMA 1KNPA 3AEGA 4B1BA 1L0VA 4DSHA 2C76A 1Q9IA 2XLRA 1TDFA 1S2QA 2E5VA 2XVIA 4H4YA 5JCIA 4U2TA 2APGA 1JRYA 4B63A 1Y56B 5M10A 2WDRA 1D5TA 4OPIA 2R9ZA 2JK6A 2YVJA 1CJ2A 3M12A 3HYVA 4H4QA 3UKHA 1ZMCA 2VVLA 2VOUA 5FS9A 4Z26A 3P4PA 3S61A 2R4JA 2XLSA 3DGHA 4IVMB 2BK4A 3SYIA 1MOKA 1GNDA 3T2ZA 1FECA 2OLNA 2ZZ0A 4H2PA 3AEAA 4YSYA 1L9EA 2X99A 2AAQA 4K7ZA 2YQUA 3SFDA 3DH9A 1ZK7A 2XFQA
chains in the Genus database with same CATH topology
2OAMA 3ATQA 3NHOX 1JEHA 4GDEA 4Z44A 4Y4LA 2CFYA 3C4NA 2C66A 1PBEA 4CNJA 3D1CA 3UKPA 2V60A 4ICYA 4Z43A 4UDPA 3QSMA 4USQA 4H4VA 4ZCDA 4EMWA 2GH5A 1GRFA 3E1TA 4LA1A 1JNZA 4YSHA 3CGBA 4Z2UA 4YSZA 1H7XA 4HA6A 1YKJA 2PYXA 4ADWA 5KWFA 3RP6A 4TLXA 3SZ0A 1GXFA 1ZDLA 1S3EA 3D8XA 3CMMA 3NNEA 2WP9A 2X3NA 1CC4A 4NZHA 1D4CA 2WDQA 3T31A 2Z5XA 2BS3A 3K7TA 3DJEA 3CTYA 1IUWA 3AYIA 2Q0KA 4C5OA 4OVIA 4J36A 3CGDA 4J34A 5HYMA 4JNAA 3AYJA 4YKFA 1YQ3A 1F8RA 2VQ7A 4UDRA 3CNTA 1KDGA 3AE5A 4K5SA 1JRXA 1CL0A 4GAVA 3VQRA 3DK8A 4B68A 2YAUA 5J60A 1SEZA 1CC6A 1PBFA 2JAEA 3QSSA 1VRQB 1TDNA 3GDPA 1GTEA 4USRA 2JB1A 3IHMA 1VG0A 1JNRA 1NHPA 2C64A 3ZDNA 1E39A 3UKLA 4EMJA 3EPTA 1EL8A 4B66A 2BS4A 1H83A 1F8SA 3ABVA 3DJDA 3IWAA 4H4SA 4XWRA 4CY8A 2WDVA 4IA5A 5DBJA 4GR1A 2O9ZA 2JBVA 1UKVG 3C96A 4Z2TA 2V6OA 3BNMA 3EF6A 3Q6JA 2YG5A 2WU5A 2Q6UA 2XDOA 4NWZA 4A99A 3UP4A 5EOWA 4O5QA 2Q0LA 2C65A 3UCLA 4A79A 3QVPA 1H7WA 2GB0A 5FMHA 1RP0A 1BGJA 2YR6A 3CPIG 3LZXA 2VRMA 1KNRA 2YWLA 2NVKX 4GAPA 4H4ZA 1EL5A 1ZMDA 2XYOA 4G6HA 4AP3A 4NTCA 3IF9A 1IUTA 4X9MA 1GPEA 3AE7A 1DOCA 2BCGG 2TPRA 1E1MA 1YQZA 3UP5A 1GRBA 4A65A 2GMHA 4H50A 3K7MX 4UDQA 3L8KA 1N4WA 2I0ZA 3BI4A 3NKSA 3NYFA 4GUVA 4N9XA 4U8JA 4D03A 2YG4A 1GV4A 2BC1A 2DKHA 2ZZCA 2WESA 3AXBA 3P4RA 4EIPA 4C74A 5LV9A 1REOA 1QLBA 3SZCA 1IUSA 2WP6A 1M6IA 3GRSA 2YLWA 3FIMB 5FS8A 3NYEA 5CKUA 1COYA 4CCQA 4A9WA 2ZBWA 2R0GA 3AB1A 5BRTA 5KMSA 1CJ3A 3AD7B 3GWDA 2XLUA 3G5SA 4AOXA 3KKJA 5HHFA 2C73A 5EB4A 2BC0A 5IPYA 2BA9A 5KVIA 2R45A 4C77A 2J3NA 4FK1C 2GEWA 2UZZA 1FEBA 2QA2A 4E0VA 4Y4NA 3V3OA 1D7YA 3ALMA 1F3PA 1Q1WA 4H2RA 3F8RA 4U8OA 3PO7A 1ZOYA 3ALLA 3BI5A 3BHKA 3NT6A 4H4TA 4WCTA 5BVAA 3PS9A 4J33A 1GREA 1M64A 1FL2A 2H89A 3F8PA 3JSKA 3L1RA 2B9WA 2RGOA 4PAAA 1BZLA 5JCKA 5JCLA 2YR4A 3UTEA 1B37A 4YWOA 3CNSA 4EM4A 4UP3A 2FJDA 4H2QA 3T14A 2B7RA 1NHSA 2GR1A 3I3LA 4U8KA 4AT2A 4O5UA 2WOWA 1L9CA 2CULA 4JY3A 3GMCA 3QFBA 4APNA 2XVEA 4NTDA 3NN6X 2WOVA 2Z5YA 3GRTA 3KU9A 1YY5A 3LXDA 2YG6A 1Z6LA 3T0KA 3UTFA 3QJ4A 1NHQA 4BJZA 1DJNA 4A6NA 3B6DA 1MXTA 4OPDA 2YG3A 4YTMA 2OA1A 3AE1A 2A89A 3BHFA 1NEKA 4LIIA 1D4EA 3NTAA 1CC2A 4GDPA 4Y4MA 3V76A 4D04A 1OJTA 4EQXA 2A8XA 1N1PA 1KFYA 3FPZA 1W4XA 1NG3A 3HYXA 4K22A 4NTEA 4CY6A 4JNQA 3AE2A 3ALJA 2CVJA 3LJPA 3DJGX 3SFEA 2XFPA 2XFOA 3FBSA 2YLZA 2GR3A 2R0PA 1X31B 3AE3A 2ZZBA 1ELIA 3AYLA 4JQ9A 4C3XA 2W0HA 2WPFA 2GQWA 3NLCA 1QO8A 2AR8A 1P2EA 4REKA 3II4A 4PABA 1CBOA 1HYUA 1PXBA 2GVCA 4FX9A 3AEDA 2FJBA 4MJWA 3SM8A 2C67A 1Y56A 4II3A 1O5WA 4DNAA 1VDCA 3AWIA 2BK3A 4OPGA 3UOZA 1JU2A 1KSSA 3UKAA 4H4RA 1GRTA 2BS2A 4G6GA 3VRDB 1TDEA 5C3JA 3C4AA 4BURA 3P9UA 1N4UA 3ICTA 4H2NA 4U8MA 2RABA 4YT0A 2GF3A 2WQYA 3AEFA 3GSIA 2Y6QA 2GAGB 1GRGA 1V59A 4A5LA 3UTGA 3SZWA 3CNJA 2V61A 2JKCA 2YLRA 1GSNA 1CJCA 3GMBA 1LV0A 1TDOA 4EMIA 4G73A 4U2SA 2ACZA 3B3RA 1E7PA 1D7LA 3M0OA 1FOHA 3T2KA 3DA1A 2Q7VA 2GMJA 3R9UA 4G9KA 3GYJA 2EQ9A 4TLZA 1GETA 2DKIA 4ZCCA 1B8SA 3K30A 4I59A 1K0IA 3OC4A 3ITJA 1H84A 2JB3A 1GEUA 1E1KA 1NHRA 1FCDA 2XLTA 4J57A 2R46A 1K0JA 1BWCA 1EBDA 2GV8A 3AD8B 4K8DA 3CIRA 3OZ2A 4HB9A 4YTPA 3H8IA 1B4VA 3GWFA 3VR9A 3CNPA 1XANA 1CJ4A 2C7GA 3M13A 1ZX9A 3NGCX 4NNJA 1H6VA 1VG9A 4ZN0A 3HYWA 4WX1A 4BK3A 2FJAA 2ARDA 1L9DA 3AE6A 4FDCB 4Z2RA 1H86A 2A87A 2C4CA 2IIDA 1PBBA 4OCGA 4U8LA 3G5RA 1O94A 4IV9A 3SQPA 1ZOVA 2WOIA 1EL9A 3DJJA 2BRYA 2JB2A 3KPKA 3DK4A 3AE4A 2GAHB 2WBAA 2GRTA 4A6NB 2YM1A 1NG4A 5KOXA 2VQBA 4EQWA 1LQUA 3CNDA 3QVRA 2B76A 2V3BA 3P1WA 1BF3A 1P2HA 2EQ7A 3P4SA 5U25A 3LZWA 4I58A 3BI2A 4YSXA 1NENA 2R4EA 2WETA 2BYBA 1TRBA 2TMDA 3EAOA 3AEEA 2OALA 1XHCA 2QAEA 1JOAA 3ICRA 3SGLA 4J56A 1PS9A 3GDNA 1GERA 3NK0X 1TYPA 2BACA 2WP5A 2WPEA 2YVGA 1PN0A 3IHGA 1GALA 4IA6A 1CF3A 3T2YA 2BRAA 4GF7A 2C70A 4RSLA 3AE8A 3URHA 1NDAA 3VRAA 1PJ6A 3H4KA 3NG7X 2XFUA 4BK2A 1RYIA 2YR5A 4OPTA 2YG7A 1GTHA 2B9YA 1DOBA 1PXAA 2FJEA 4B67A 2BXSA 3VR8A 3ZYXA 1LQTA 3QFAA 4U8NA 4BK1A 2BABA 5FS7A 4YTNA 2GR0A 4DSGA 4H7UA 1KF6A 2OLOA 2RGHA 2YLXA 5KMQA 2XVHA 5GRTA 3GYIA 4U8PA 4U8IA 1OJCA 3V3NA 1BKWA 3ATRA 3NYCA 4TM1A 4AP1A 2GQFA 3NH3X 1E1LA 4H4PA 2WHDA 2C72A 3RP8A 5TR3A 1DJQA 4JN9A 5M0ZA 5GSNA 3EANA 1LPFA 1D4DA 3CGEA 3KPFA 3LOVA 1PHHA 2VVLG 1DODA 3NK1X 4J2WA 1PDHA 5J7XA 1JRZA 1LJ1A 2VVMA 4CRTA 3KVEA 1DOEA 4Z24A 2AQJA 2CDUA 3AD9B 3NK2X 1B5QA 2YM2A 1PXCA 4KX6A 4CBQA 4JY2A 5BUKA 3CPHG 1PJ7A 1Y0PA 3KLJA 2BCPA 4B65A 1RSGA 4TM4A 4M52A 1Q1RA 1N4VA 3DK9A 5ER0A 1OJAA 4EQRA 2YLTA 3UTHA 1KSUA 2FBWA 1O95A 3SZFA 3AEBA 4TM0A 3T37A 4JDRA 4J31A 4GCMA 1CHUA 1F8WA 3BNUA 1PBDA 2XVFA 3FG2P 4H4WA 4IVOB 4K5RA 3REDA 3CGCA 4EM3A 3COXA 2VZ2A 3S5WA 2QA1A 1K4QA 4II2A 5KRQA 4B64A 2E1MA 2XLPA 3I6DA 5KOWA 5KXJA 2F5ZA 1S2YA 3AECA 2C75A 5IQ1A 4X4JA 3DMEA 1TDKA 1S3BA 3GYXA 5CQFA 2RGJA 3NRNA 4BV6A 5KNLA 3DGZA 3RNMA 4OPUA 1H82A 3PVCA 3UKFA 4GRTA 1MO9A 1GRAA 2X50A 4ECHA 3NTDA 1YQ4A 3CN8A 5L46A 3UOYA 3SXIA 4P9SA 4CNKA 1ONFA 1XPQA 4U2LA 3KD9A 5EBKA 4H4UA 4XWZA 5KVHA 4X9NA 2QCUA 5IQ4A 2H88A 3RP7A 1GT8A 1XDIA 3RHAA 1LVLA 4DGKA 2C3CA 2EQ6A 3UKKA 2WS3A 4EQSA 3LADA 3SX6A 2GR2A 3AE9A 4Z25A 4YXDA 1NAAA 1EL7A 1PJ5A 2XFNA 2X8GA 3GD3A 3O0HA 2NPXA 5KMPA 4C3YA 3VRBA 1FEAA 2B7SA 1ZP0A 3UOXA 1OJDA 1ZKQA 1PBCA 4NEWA 1K0LA 3H8LA 1E1NA 4G74A 5JCMA 1GESA 2X8HA 2XCGA 1QJDA 4KPRA 1IUVA 1LTXR 4A7AA 1E6EA 1H81A 2B9XA 1IUUA 1DXLA 1ZY8A 3QSEA 1F6MA 2Y6RA 2VRLA 3FMWA 3SY4A 3GD4A 4EIQA 3UKQA 3K7QX 5U1OA 4YKGA 2V3AA 3LB8A 4RG4A 2V5ZA 2R0CA 3P4QA 4XXGA 5BULA 1AOGA 3F8DA 5C2TA 2EQ8A 5HXIA 5HY5A 2E4GA 2IVEA 2WPCA 4OPCA 3NIXA 3UOVA 4TM3A 2WEUA 2XVJA 2WU2A 4K2XA 2IVDA 3ISHA 1VQWA 4AOSA 5EB5A 4NEVA 4OPLA 4FK1A 4H4XA 3ICSA 3NN0X 3Q9TA 2BXRA 5FS6A 4AT0A 2PHHA 5JCNA 3CPJG 1OJ9A 1IJHA 1NPXA 3HZLA 3G5QA 3ADAB 4LU6A 1GOSA 2C3DA 5U63A 4CCRA 1TYTA 2BK5A 1IUXA 3IC9A 3WE0A 4B69A 2X8CA 4BJYA 5KMRA 1BGNA 4RG3A 2YVFA 2YLSA 3KA7A 1DNCA 1GRHA 2HQMA 1KNPA 3AEGA 4B1BA 1L0VA 4DSHA 2C76A 1Q9IA 2XLRA 1TDFA 1S2QA 2E5VA 2XVIA 4H4YA 5JCIA 4U2TA 2APGA 1JRYA 4B63A 1Y56B 5M10A 2WDRA 1D5TA 4OPIA 2R9ZA 2JK6A 2YVJA 1CJ2A 3M12A 3HYVA 4H4QA 3UKHA 1ZMCA 2VVLA 2VOUA 5FS9A 4Z26A 3P4PA 3S61A 2R4JA 2XLSA 3DGHA 4IVMB 2BK4A 3SYIA 1MOKA 1GNDA 3T2ZA 1FECA 2OLNA 2ZZ0A 4H2PA 3AEAA 4YSYA 1L9EA 2X99A 2AAQA 4K7ZA 2YQUA 3SFDA 3DH9A 1ZK7A 2XFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAM A;  3ATQ A;  3NHO X;  1JEH A;  4GDE A;  4Z44 A;  4Y4L A;  2CFY A;  3C4N A;  2C66 A;  1PBE A;  4CNJ A;  3D1C A;  3UKP A;  2V60 A;  4ICY A;  4Z43 A;  4UDP A;  3QSM A;  4USQ A;  4H4V A;  4ZCD A;  4EMW A;  2GH5 A;  1GRF A;  3E1T A;  4LA1 A;  1JNZ A;  4YSH A;  3CGB A;  4Z2U A;  4YSZ A;  1H7X A;  4HA6 A;  1YKJ A;  2PYX A;  4ADW A;  5KWF A;  3RP6 A;  4TLX A;  1GXF A;  1ZDL A;  1S3E A;  3D8X A;  3NNE A;  2WP9 A;  2X3N A;  1CC4 A;  4NZH A;  1D4C A;  2WDQ A;  2Z5X A;  2BS3 A;  3K7T A;  3DJE A;  3CTY A;  1IUW A;  3AYI A;  2Q0K A;  4C5O A;  4OVI A;  4J36 A;  3CGD A;  4J34 A;  5HYM A;  4JNA A;  3AYJ A;  4YKF A;  1YQ3 A;  1F8R A;  2VQ7 A;  4UDR A;  3CNT A;  1KDG A;  3AE5 A;  4K5S A;  1JRX A;  1CL0 A;  3VQR A;  3DK8 A;  4B68 A;  2YAU A;  1SEZ A;  1CC6 A;  1PBF A;  2JAE A;  3QSS A;  1VRQ B;  1TDN A;  3GDP A;  1GTE A;  4USR A;  2JB1 A;  3IHM A;  1VG0 A;  1JNR A;  1NHP A;  2C64 A;  3ZDN A;  1E39 A;  3UKL A;  4EMJ A;  3EPT A;  1EL8 A;  4B66 A;  2BS4 A;  1H83 A;  1F8S A;  3ABV A;  3DJD A;  3IWA A;  4H4S A;  4XWR A;  4CY8 A;  2WDV A;  4IA5 A;  5DBJ A;  4GR1 A;  2O9Z A;  2JBV A;  1UKV G;  3C96 A;  4Z2T A;  2V6O A;  3BNM A;  3EF6 A;  3Q6J A;  2YG5 A;  2WU5 A;  2Q6U A;  2XDO A;  4A99 A;  3UP4 A;  5EOW A;  4O5Q A;  2Q0L A;  2C65 A;  3UCL A;  4A79 A;  3QVP A;  1H7W A;  2GB0 A;  5FMH A;  1RP0 A;  1BGJ A;  2YR6 A;  3CPI G;  3LZX A;  2VRM A;  1KNR A;  2YWL A;  2NVK X;  4H4Z A;  1EL5 A;  1ZMD A;  2XYO A;  4AP3 A;  4NTC A;  3IF9 A;  1IUT A;  4X9M A;  1GPE A;  3AE7 A;  1DOC A;  2BCG G;  2TPR A;  1E1M A;  1YQZ A;  3UP5 A;  1GRB A;  4A65 A;  2GMH A;  4H50 A;  3K7M X;  4UDQ A;  3L8K A;  1N4W A;  2I0Z A;  3BI4 A;  3NKS A;  3NYF A;  4GUV A;  4N9X A;  4U8J A;  4D03 A;  2YG4 A;  1GV4 A;  2BC1 A;  2DKH A;  2ZZC A;  2WES A;  3AXB A;  3P4R A;  4EIP A;  4C74 A;  5LV9 A;  1REO A;  1QLB A;  1IUS A;  2WP6 A;  1M6I A;  3GRS A;  2YLW A;  3FIM B;  5FS8 A;  3NYE A;  5CKU A;  1COY A;  4CCQ A;  4A9W A;  2ZBW A;  2R0G A;  3AB1 A;  5BRT A;  1CJ3 A;  3AD7 B;  3GWD A;  2XLU A;  3G5S A;  4AOX A;  3KKJ A;  5HHF A;  2C73 A;  5EB4 A;  2BC0 A;  5IPY A;  2BA9 A;  5KVI A;  2R45 A;  4C77 A;  2J3N A;  4FK1 C;  2GEW A;  2UZZ A;  1FEB A;  2QA2 A;  4E0V A;  4Y4N A;  3V3O A;  1D7Y A;  3ALM A;  1F3P A;  1Q1W A;  4H2R A;  3F8R A;  4U8O A;  3PO7 A;  1ZOY A;  3ALL A;  3BI5 A;  3BHK A;  3NT6 A;  4H4T A;  4WCT A;  5BVA A;  3PS9 A;  4J33 A;  1GRE A;  1M64 A;  1FL2 A;  2H89 A;  3F8P A;  3JSK A;  3L1R A;  2B9W A;  2RGO A;  4PAA A;  1BZL A;  5JCK A;  5JCL A;  2YR4 A;  3UTE A;  1B37 A;  4YWO A;  3CNS A;  4EM4 A;  4UP3 A;  2FJD A;  4H2Q A;  2B7R A;  1NHS A;  2GR1 A;  3I3L A;  4U8K A;  4AT2 A;  4O5U A;  2WOW A;  1L9C A;  2CUL A;  4JY3 A;  3GMC A;  3QFB A;  4APN A;  2XVE A;  4NTD A;  3NN6 X;  2WOV A;  2Z5Y A;  3GRT A;  3KU9 A;  1YY5 A;  3LXD A;  2YG6 A;  1Z6L A;  3UTF A;  3QJ4 A;  1NHQ A;  4BJZ A;  1DJN A;  4A6N A;  3B6D A;  1MXT A;  4OPD A;  2YG3 A;  4YTM A;  2OA1 A;  3AE1 A;  2A89 A;  3BHF A;  1NEK A;  4LII A;  1D4E A;  3NTA A;  1CC2 A;  4GDP A;  4Y4M A;  3V76 A;  4D04 A;  1OJT A;  4EQX A;  2A8X A;  1N1P A;  1KFY A;  3FPZ A;  1W4X A;  1NG3 A;  4K22 A;  4NTE A;  4CY6 A;  4JNQ A;  3AE2 A;  3ALJ A;  2CVJ A;  3LJP A;  3DJG X;  3SFE A;  2XFP A;  2XFO A;  3FBS A;  2YLZ A;  2GR3 A;  2R0P A;  1X31 B;  3AE3 A;  2ZZB A;  1ELI A;  3AYL A;  4JQ9 A;  4C3X A;  2W0H A;  2WPF A;  2GQW A;  3NLC A;  1QO8 A;  2AR8 A;  1P2E A;  4REK A;  3II4 A;  4PAB A;  1CBO A;  1HYU A;  1PXB A;  2GVC A;  4FX9 A;  3AED A;  2FJB A;  4MJW A;  3SM8 A;  2C67 A;  1Y56 A;  4DNA A;  1O5W A;  1VDC A;  3AWI A;  2BK3 A;  4OPG A;  3UOZ A;  1JU2 A;  1KSS A;  3UKA A;  4H4R A;  1GRT A;  2BS2 A;  3VRD B;  1TDE A;  5C3J A;  3C4A A;  4BUR A;  3P9U A;  1N4U A;  3ICT A;  4H2N A;  4U8M A;  2RAB A;  4YT0 A;  2GF3 A;  2WQY A;  3AEF A;  3GSI A;  2Y6Q A;  2GAG B;  1GRG A;  1V59 A;  4A5L A;  3UTG A;  3CNJ A;  2V61 A;  2JKC A;  2YLR A;  1GSN A;  1CJC A;  3GMB A;  1LV0 A;  1TDO A;  4EMI A;  4U2S A;  2ACZ A;  3B3R A;  1E7P A;  1D7L A;  3M0O A;  1FOH A;  3DA1 A;  2Q7V A;  2GMJ A;  3R9U A;  4TLZ A;  3GYJ A;  2EQ9 A;  1GET A;  2DKI A;  4ZCC A;  1B8S A;  3K30 A;  4I59 A;  1K0I A;  3OC4 A;  3ITJ A;  1H84 A;  2JB3 A;  1GEU A;  1E1K A;  1NHR A;  1FCD A;  2XLT A;  4J57 A;  2R46 A;  1K0J A;  1BWC A;  1EBD A;  2GV8 A;  3AD8 B;  4K8D A;  3CIR A;  3OZ2 A;  4HB9 A;  4YTP A;  3H8I A;  1B4V A;  3GWF A;  3VR9 A;  3CNP A;  1XAN A;  1CJ4 A;  2C7G A;  3M13 A;  1ZX9 A;  3NGC X;  1H6V A;  1VG9 A;  4ZN0 A;  4WX1 A;  4BK3 A;  2FJA A;  2ARD A;  1L9D A;  3AE6 A;  4FDC B;  4Z2R A;  1H86 A;  2A87 A;  2IID A;  1PBB A;  4OCG A;  4U8L A;  3G5R A;  1O94 A;  4IV9 A;  3SQP A;  1ZOV A;  2WOI A;  1EL9 A;  3DJJ A;  2JB2 A;  3DK4 A;  3AE4 A;  2GAH B;  2WBA A;  2GRT A;  4A6N B;  2YM1 A;  1NG4 A;  5KOX A;  2VQB A;  4EQW A;  1LQU A;  3CND A;  3QVR A;  2B76 A;  2V3B A;  3P1W A;  1BF3 A;  1P2H A;  2EQ7 A;  3P4S A;  5U25 A;  3LZW A;  4I58 A;  3BI2 A;  4YSX A;  1NEN A;  2R4E A;  2WET A;  2BYB A;  1TRB A;  2TMD A;  3EAO A;  3AEE A;  2OAL A;  1XHC A;  2QAE A;  1JOA A;  3ICR A;  3SGL A;  4J56 A;  1PS9 A;  3GDN A;  1GER A;  3NK0 X;  1TYP A;  2BAC A;  2WP5 A;  2WPE A;  2YVG A;  1PN0 A;  3IHG A;  1GAL A;  4IA6 A;  1CF3 A;  3URH A;  4GF7 A;  4RSL A;  2C70 A;  3VRA A;  3AE8 A;  5J60 A;  1NDA A;  1PJ6 A;  3H4K A;  3NG7 X;  2XFU A;  4BK2 A;  1RYI A;  2YR5 A;  4OPT A;  2YG7 A;  1GTH A;  2B9Y A;  1DOB A;  1PXA A;  2FJE A;  4B67 A;  2BXS A;  3VR8 A;  3ZYX A;  1LQT A;  3QFA A;  4U8N A;  4BK1 A;  2BAB A;  5FS7 A;  4YTN A;  2GR0 A;  4DSG A;  4H7U A;  1KF6 A;  2OLO A;  2RGH A;  2YLX A;  2XVH A;  5GRT A;  3GYI A;  4U8P A;  4U8I A;  1OJC A;  3V3N A;  1BKW A;  3ATR A;  3NYC A;  4TM1 A;  4AP1 A;  2GQF A;  3NH3 X;  1E1L A;  4H4P A;  2WHD A;  2C72 A;  3RP8 A;  5TR3 A;  1DJQ A;  4JN9 A;  5M0Z A;  5GSN A;  3EAN A;  1LPF A;  1D4D A;  3CGE A;  3KPF A;  3LOV A;  1PHH A;  2VVL G;  1DOD A;  3NK1 X;  4J2W A;  1PDH A;  5J7X A;  1JRZ A;  1LJ1 A;  2VVM A;  4CRT A;  3KVE A;  1DOE A;  4Z24 A;  2AQJ A;  2CDU A;  3AD9 B;  3NK2 X;  1B5Q A;  2YM2 A;  1PXC A;  4KX6 A;  4CBQ A;  4JY2 A;  5BUK A;  3CPH G;  1PJ7 A;  1Y0P A;  3KLJ A;  2BCP A;  4B65 A;  1RSG A;  4TM4 A;  4M52 A;  1Q1R A;  1N4V A;  3DK9 A;  5ER0 A;  1OJA A;  4EQR A;  2YLT A;  3UTH A;  1KSU A;  2FBW A;  1O95 A;  3AEB A;  4TM0 A;  3T37 A;  4JDR A;  4J31 A;  4GCM A;  1CHU A;  1F8W A;  3BNU A;  1PBD A;  2XVF A;  3FG2 P;  4H4W A;  4IVO B;  4K5R A;  3RED A;  3CGC A;  4EM3 A;  3COX A;  2VZ2 A;  3S5W A;  2QA1 A;  1K4Q A;  5KRQ A;  4B64 A;  2E1M A;  2XLP A;  3I6D A;  5KOW A;  5KXJ A;  2F5Z A;  1S2Y A;  3AEC A;  2C75 A;  5IQ1 A;  4X4J A;  3DME A;  1TDK A;  1S3B A;  5CQF A;  2RGJ A;  3NRN A;  4BV6 A;  3DGZ A;  3RNM A;  4OPU A;  1H82 A;  3PVC A;  3UKF A;  4GRT A;  1MO9 A;  1GRA A;  2X50 A;  4ECH A;  3NTD A;  1YQ4 A;  3CN8 A;  5L46 A;  3UOY A;  4P9S A;  4CNK A;  1ONF A;  1XPQ A;  4U2L A;  3KD9 A;  5EBK A;  4H4U A;  4XWZ A;  5KVH A;  4X9N A;  2QCU A;  5IQ4 A;  2H88 A;  3RP7 A;  1GT8 A;  1XDI A;  3RHA A;  1LVL A;  4DGK A;  2C3C A;  2EQ6 A;  3UKK A;  2WS3 A;  4EQS A;  3LAD A;  2GR2 A;  3AE9 A;  4Z25 A;  4YXD A;  1NAA A;  1EL7 A;  1PJ5 A;  2XFN A;  2X8G A;  3GD3 A;  3O0H A;  2NPX A;  4C3Y A;  3VRB A;  1FEA A;  2B7S A;  1ZP0 A;  3UOX A;  1OJD A;  1ZKQ A;  1PBC A;  4NEW A;  1K0L A;  3H8L A;  1E1N A;  5JCM A;  1GES A;  2X8H A;  2XCG A;  1QJD A;  4KPR A;  1IUV A;  1LTX R;  4A7A A;  1E6E A;  1H81 A;  2B9X A;  1IUU A;  1DXL A;  1ZY8 A;  3QSE A;  1F6M A;  2Y6R A;  2VRL A;  3FMW A;  3GD4 A;  4EIQ A;  3UKQ A;  3K7Q X;  5U1O A;  4YKG A;  2V3A A;  3LB8 A;  4RG4 A;  2V5Z A;  2R0C A;  3P4Q A;  4XXG A;  5BUL A;  1AOG A;  3F8D A;  5C2T A;  2EQ8 A;  5HXI A;  5HY5 A;  2E4G A;  2IVE A;  2WPC A;  4OPC A;  3NIX A;  3UOV A;  4TM3 A;  2WEU A;  2XVJ A;  2WU2 A;  4K2X A;  2IVD A;  3ISH A;  1VQW A;  4AOS A;  5EB5 A;  4NEV A;  4OPL A;  4FK1 A;  4H4X A;  3ICS A;  3NN0 X;  3Q9T A;  2BXR A;  5FS6 A;  4AT0 A;  2PHH A;  5JCN A;  3CPJ G;  1OJ9 A;  1IJH A;  1NPX A;  3HZL A;  3G5Q A;  3ADA B;  4LU6 A;  1GOS A;  2C3D A;  5U63 A;  4CCR A;  1TYT A;  2BK5 A;  1IUX A;  3IC9 A;  3WE0 A;  4B69 A;  2X8C A;  4BJY A;  1BGN A;  4RG3 A;  2YVF A;  2YLS A;  3KA7 A;  1DNC A;  1GRH A;  2HQM A;  1KNP A;  3AEG A;  4B1B A;  1L0V A;  4DSH A;  2C76 A;  1Q9I A;  2XLR A;  1TDF A;  1S2Q A;  2E5V A;  2XVI A;  4H4Y A;  5JCI A;  4U2T A;  2APG A;  1JRY A;  4B63 A;  1Y56 B;  5M10 A;  2WDR A;  1D5T A;  4OPI A;  2R9Z A;  2JK6 A;  2YVJ A;  1CJ2 A;  3M12 A;  4H4Q A;  3UKH A;  1ZMC A;  2VVL A;  2VOU A;  5FS9 A;  4Z26 A;  3P4P A;  3S61 A;  2R4J A;  2XLS A;  3DGH A;  4IVM B;  2BK4 A;  1MOK A;  1GND A;  1FEC A;  2OLN A;  2ZZ0 A;  4H2P A;  3AEA A;  4YSY A;  1L9E A;  2X99 A;  2AAQ A;  4K7Z A;  2YQU A;  3SFD A;  3DH9 A;  1ZK7 A;  2XFQ A; 
#chains in the Genus database with same CATH topology
 2OAM A;  3ATQ A;  3NHO X;  1JEH A;  4GDE A;  4Z44 A;  4Y4L A;  2CFY A;  3C4N A;  2C66 A;  1PBE A;  4CNJ A;  3D1C A;  3UKP A;  2V60 A;  4ICY A;  4Z43 A;  4UDP A;  3QSM A;  4USQ A;  4H4V A;  4ZCD A;  4EMW A;  2GH5 A;  1GRF A;  3E1T A;  4LA1 A;  1JNZ A;  4YSH A;  3CGB A;  4Z2U A;  4YSZ A;  1H7X A;  4HA6 A;  1YKJ A;  2PYX A;  4ADW A;  5KWF A;  3RP6 A;  4TLX A;  3SZ0 A;  1GXF A;  1ZDL A;  1S3E A;  3D8X A;  3CMM A;  3NNE A;  2WP9 A;  2X3N A;  1CC4 A;  4NZH A;  1D4C A;  2WDQ A;  3T31 A;  2Z5X A;  2BS3 A;  3K7T A;  3DJE A;  3CTY A;  1IUW A;  3AYI A;  2Q0K A;  4C5O A;  4OVI A;  4J36 A;  3CGD A;  4J34 A;  5HYM A;  4JNA A;  3AYJ A;  4YKF A;  1YQ3 A;  1F8R A;  2VQ7 A;  4UDR A;  3CNT A;  1KDG A;  3AE5 A;  4K5S A;  1JRX A;  1CL0 A;  4GAV A;  3VQR A;  3DK8 A;  4B68 A;  2YAU A;  5J60 A;  1SEZ A;  1CC6 A;  1PBF A;  2JAE A;  3QSS A;  1VRQ B;  1TDN A;  3GDP A;  1GTE A;  4USR A;  2JB1 A;  3IHM A;  1VG0 A;  1JNR A;  1NHP A;  2C64 A;  3ZDN A;  1E39 A;  3UKL A;  4EMJ A;  3EPT A;  1EL8 A;  4B66 A;  2BS4 A;  1H83 A;  1F8S A;  3ABV A;  3DJD A;  3IWA A;  4H4S A;  4XWR A;  4CY8 A;  2WDV A;  4IA5 A;  5DBJ A;  4GR1 A;  2O9Z A;  2JBV A;  1UKV G;  3C96 A;  4Z2T A;  2V6O A;  3BNM A;  3EF6 A;  3Q6J A;  2YG5 A;  2WU5 A;  2Q6U A;  2XDO A;  4NWZ A;  4A99 A;  3UP4 A;  5EOW A;  4O5Q A;  2Q0L A;  2C65 A;  3UCL A;  4A79 A;  3QVP A;  1H7W A;  2GB0 A;  5FMH A;  1RP0 A;  1BGJ A;  2YR6 A;  3CPI G;  3LZX A;  2VRM A;  1KNR A;  2YWL A;  2NVK X;  4GAP A;  4H4Z A;  1EL5 A;  1ZMD A;  2XYO A;  4G6H A;  4AP3 A;  4NTC A;  3IF9 A;  1IUT A;  4X9M A;  1GPE A;  3AE7 A;  1DOC A;  2BCG G;  2TPR A;  1E1M A;  1YQZ A;  3UP5 A;  1GRB A;  4A65 A;  2GMH A;  4H50 A;  3K7M X;  4UDQ A;  3L8K A;  1N4W A;  2I0Z A;  3BI4 A;  3NKS A;  3NYF A;  4GUV A;  4N9X A;  4U8J A;  4D03 A;  2YG4 A;  1GV4 A;  2BC1 A;  2DKH A;  2ZZC A;  2WES A;  3AXB A;  3P4R A;  4EIP A;  4C74 A;  5LV9 A;  1REO A;  1QLB A;  3SZC A;  1IUS A;  2WP6 A;  1M6I A;  3GRS A;  2YLW A;  3FIM B;  5FS8 A;  3NYE A;  5CKU A;  1COY A;  4CCQ A;  4A9W A;  2ZBW A;  2R0G A;  3AB1 A;  5BRT A;  5KMS A;  1CJ3 A;  3AD7 B;  3GWD A;  2XLU A;  3G5S A;  4AOX A;  3KKJ A;  5HHF A;  2C73 A;  5EB4 A;  2BC0 A;  5IPY A;  2BA9 A;  5KVI A;  2R45 A;  4C77 A;  2J3N A;  4FK1 C;  2GEW A;  2UZZ A;  1FEB A;  2QA2 A;  4E0V A;  4Y4N A;  3V3O A;  1D7Y A;  3ALM A;  1F3P A;  1Q1W A;  4H2R A;  3F8R A;  4U8O A;  3PO7 A;  1ZOY A;  3ALL A;  3BI5 A;  3BHK A;  3NT6 A;  4H4T A;  4WCT A;  5BVA A;  3PS9 A;  4J33 A;  1GRE A;  1M64 A;  1FL2 A;  2H89 A;  3F8P A;  3JSK A;  3L1R A;  2B9W A;  2RGO A;  4PAA A;  1BZL A;  5JCK A;  5JCL A;  2YR4 A;  3UTE A;  1B37 A;  4YWO A;  3CNS A;  4EM4 A;  4UP3 A;  2FJD A;  4H2Q A;  3T14 A;  2B7R A;  1NHS A;  2GR1 A;  3I3L A;  4U8K A;  4AT2 A;  4O5U A;  2WOW A;  1L9C A;  2CUL A;  4JY3 A;  3GMC A;  3QFB A;  4APN A;  2XVE A;  4NTD A;  3NN6 X;  2WOV A;  2Z5Y A;  3GRT A;  3KU9 A;  1YY5 A;  3LXD A;  2YG6 A;  1Z6L A;  3T0K A;  3UTF A;  3QJ4 A;  1NHQ A;  4BJZ A;  1DJN A;  4A6N A;  3B6D A;  1MXT A;  4OPD A;  2YG3 A;  4YTM A;  2OA1 A;  3AE1 A;  2A89 A;  3BHF A;  1NEK A;  4LII A;  1D4E A;  3NTA A;  1CC2 A;  4GDP A;  4Y4M A;  3V76 A;  4D04 A;  1OJT A;  4EQX A;  2A8X A;  1N1P A;  1KFY A;  3FPZ A;  1W4X A;  1NG3 A;  3HYX A;  4K22 A;  4NTE A;  4CY6 A;  4JNQ A;  3AE2 A;  3ALJ A;  2CVJ A;  3LJP A;  3DJG X;  3SFE A;  2XFP A;  2XFO A;  3FBS A;  2YLZ A;  2GR3 A;  2R0P A;  1X31 B;  3AE3 A;  2ZZB A;  1ELI A;  3AYL A;  4JQ9 A;  4C3X A;  2W0H A;  2WPF A;  2GQW A;  3NLC A;  1QO8 A;  2AR8 A;  1P2E A;  4REK A;  3II4 A;  4PAB A;  1CBO A;  1HYU A;  1PXB A;  2GVC A;  4FX9 A;  3AED A;  2FJB A;  4MJW A;  3SM8 A;  2C67 A;  1Y56 A;  4II3 A;  1O5W A;  4DNA A;  1VDC A;  3AWI A;  2BK3 A;  4OPG A;  3UOZ A;  1JU2 A;  1KSS A;  3UKA A;  4H4R A;  1GRT A;  2BS2 A;  4G6G A;  3VRD B;  1TDE A;  5C3J A;  3C4A A;  4BUR A;  3P9U A;  1N4U A;  3ICT A;  4H2N A;  4U8M A;  2RAB A;  4YT0 A;  2GF3 A;  2WQY A;  3AEF A;  3GSI A;  2Y6Q A;  2GAG B;  1GRG A;  1V59 A;  4A5L A;  3UTG A;  3SZW A;  3CNJ A;  2V61 A;  2JKC A;  2YLR A;  1GSN A;  1CJC A;  3GMB A;  1LV0 A;  1TDO A;  4EMI A;  4G73 A;  4U2S A;  2ACZ A;  3B3R A;  1E7P A;  1D7L A;  3M0O A;  1FOH A;  3T2K A;  3DA1 A;  2Q7V A;  2GMJ A;  3R9U A;  4G9K A;  3GYJ A;  2EQ9 A;  4TLZ A;  1GET A;  2DKI A;  4ZCC A;  1B8S A;  3K30 A;  4I59 A;  1K0I A;  3OC4 A;  3ITJ A;  1H84 A;  2JB3 A;  1GEU A;  1E1K A;  1NHR A;  1FCD A;  2XLT A;  4J57 A;  2R46 A;  1K0J A;  1BWC A;  1EBD A;  2GV8 A;  3AD8 B;  4K8D A;  3CIR A;  3OZ2 A;  4HB9 A;  4YTP A;  3H8I A;  1B4V A;  3GWF A;  3VR9 A;  3CNP A;  1XAN A;  1CJ4 A;  2C7G A;  3M13 A;  1ZX9 A;  3NGC X;  4NNJ A;  1H6V A;  1VG9 A;  4ZN0 A;  3HYW A;  4WX1 A;  4BK3 A;  2FJA A;  2ARD A;  1L9D A;  3AE6 A;  4FDC B;  4Z2R A;  1H86 A;  2A87 A;  2C4C A;  2IID A;  1PBB A;  4OCG A;  4U8L A;  3G5R A;  4IV9 A;  1O94 A;  3SQP A;  1ZOV A;  2WOI A;  1EL9 A;  3DJJ A;  2BRY A;  2JB2 A;  3KPK A;  3DK4 A;  3AE4 A;  2GAH B;  2WBA A;  2GRT A;  4A6N B;  2YM1 A;  1NG4 A;  5KOX A;  2VQB A;  4EQW A;  1LQU A;  3CND A;  3QVR A;  2B76 A;  2V3B A;  3P1W A;  1BF3 A;  1P2H A;  2EQ7 A;  3P4S A;  5U25 A;  3LZW A;  4I58 A;  3BI2 A;  4YSX A;  1NEN A;  2R4E A;  2WET A;  2BYB A;  1TRB A;  2TMD A;  3EAO A;  3AEE A;  2OAL A;  1XHC A;  2QAE A;  1JOA A;  3ICR A;  3SGL A;  4J56 A;  1PS9 A;  3GDN A;  1GER A;  3NK0 X;  2BAC A;  1TYP A;  2WP5 A;  2WPE A;  2YVG A;  1PN0 A;  3IHG A;  1GAL A;  4IA6 A;  1CF3 A;  3T2Y A;  2BRA A;  4GF7 A;  2C70 A;  4RSL A;  3AE8 A;  3URH A;  1NDA A;  3VRA A;  1PJ6 A;  3H4K A;  3NG7 X;  2XFU A;  4BK2 A;  1RYI A;  2YR5 A;  4OPT A;  2YG7 A;  1GTH A;  2B9Y A;  1DOB A;  1PXA A;  2FJE A;  4B67 A;  2BXS A;  3VR8 A;  3ZYX A;  1LQT A;  3QFA A;  4U8N A;  4BK1 A;  2BAB A;  5FS7 A;  4YTN A;  2GR0 A;  4DSG A;  4H7U A;  1KF6 A;  2OLO A;  2RGH A;  2YLX A;  5KMQ A;  2XVH A;  5GRT A;  3GYI A;  4U8P A;  4U8I A;  1OJC A;  3V3N A;  1BKW A;  3ATR A;  3NYC A;  4TM1 A;  4AP1 A;  2GQF A;  3NH3 X;  1E1L A;  4H4P A;  2WHD A;  2C72 A;  3RP8 A;  5TR3 A;  1DJQ A;  4JN9 A;  5M0Z A;  5GSN A;  3EAN A;  1LPF A;  1D4D A;  3CGE A;  3KPF A;  3LOV A;  1PHH A;  2VVL G;  1DOD A;  3NK1 X;  4J2W A;  1PDH A;  5J7X A;  1JRZ A;  1LJ1 A;  2VVM A;  4CRT A;  3KVE A;  1DOE A;  4Z24 A;  2AQJ A;  2CDU A;  3AD9 B;  3NK2 X;  1B5Q A;  2YM2 A;  1PXC A;  4KX6 A;  4CBQ A;  4JY2 A;  5BUK A;  3CPH G;  1PJ7 A;  1Y0P A;  3KLJ A;  2BCP A;  4B65 A;  1RSG A;  4TM4 A;  4M52 A;  1Q1R A;  1N4V A;  3DK9 A;  5ER0 A;  1OJA A;  4EQR A;  2YLT A;  3UTH A;  1KSU A;  2FBW A;  1O95 A;  3SZF A;  3AEB A;  4TM0 A;  3T37 A;  4JDR A;  4J31 A;  4GCM A;  1CHU A;  1F8W A;  3BNU A;  1PBD A;  2XVF A;  3FG2 P;  4H4W A;  4IVO B;  4K5R A;  3RED A;  3CGC A;  4EM3 A;  3COX A;  2VZ2 A;  3S5W A;  2QA1 A;  1K4Q A;  4II2 A;  5KRQ A;  4B64 A;  2E1M A;  2XLP A;  3I6D A;  5KOW A;  5KXJ A;  2F5Z A;  1S2Y A;  3AEC A;  2C75 A;  5IQ1 A;  4X4J A;  3DME A;  1TDK A;  1S3B A;  3GYX A;  5CQF A;  2RGJ A;  3NRN A;  4BV6 A;  5KNL A;  3DGZ A;  3RNM A;  4OPU A;  1H82 A;  3PVC A;  3UKF A;  4GRT A;  1MO9 A;  1GRA A;  2X50 A;  4ECH A;  3NTD A;  1YQ4 A;  3CN8 A;  5L46 A;  3UOY A;  3SXI A;  4P9S A;  4CNK A;  1ONF A;  1XPQ A;  4U2L A;  3KD9 A;  5EBK A;  4H4U A;  4XWZ A;  5KVH A;  4X9N A;  2QCU A;  5IQ4 A;  2H88 A;  3RP7 A;  1GT8 A;  1XDI A;  3RHA A;  1LVL A;  4DGK A;  2C3C A;  2EQ6 A;  3UKK A;  2WS3 A;  4EQS A;  3LAD A;  3SX6 A;  2GR2 A;  3AE9 A;  4Z25 A;  4YXD A;  1NAA A;  1EL7 A;  1PJ5 A;  2XFN A;  2X8G A;  3GD3 A;  3O0H A;  2NPX A;  5KMP A;  4C3Y A;  3VRB A;  1FEA A;  2B7S A;  1ZP0 A;  3UOX A;  1OJD A;  1ZKQ A;  1PBC A;  4NEW A;  1K0L A;  3H8L A;  1E1N A;  4G74 A;  5JCM A;  1GES A;  2X8H A;  2XCG A;  1QJD A;  4KPR A;  1IUV A;  1LTX R;  4A7A A;  1E6E A;  1H81 A;  2B9X A;  1IUU A;  1DXL A;  1ZY8 A;  3QSE A;  1F6M A;  2Y6R A;  2VRL A;  3FMW A;  3SY4 A;  3GD4 A;  4EIQ A;  3UKQ A;  3K7Q X;  5U1O A;  4YKG A;  2V3A A;  3LB8 A;  4RG4 A;  2V5Z A;  2R0C A;  3P4Q A;  4XXG A;  5BUL A;  1AOG A;  3F8D A;  5C2T A;  2EQ8 A;  5HXI A;  5HY5 A;  2E4G A;  2IVE A;  2WPC A;  4OPC A;  3NIX A;  3UOV A;  4TM3 A;  2WEU A;  2XVJ A;  2WU2 A;  4K2X A;  2IVD A;  3ISH A;  1VQW A;  4AOS A;  5EB5 A;  4NEV A;  4OPL A;  4FK1 A;  4H4X A;  3ICS A;  3NN0 X;  3Q9T A;  2BXR A;  5FS6 A;  4AT0 A;  2PHH A;  5JCN A;  3CPJ G;  1OJ9 A;  1IJH A;  1NPX A;  3HZL A;  3G5Q A;  3ADA B;  4LU6 A;  1GOS A;  2C3D A;  5U63 A;  4CCR A;  1TYT A;  2BK5 A;  1IUX A;  3IC9 A;  3WE0 A;  4B69 A;  2X8C A;  4BJY A;  5KMR A;  1BGN A;  4RG3 A;  2YVF A;  2YLS A;  3KA7 A;  1DNC A;  1GRH A;  2HQM A;  1KNP A;  3AEG A;  4B1B A;  1L0V A;  4DSH A;  2C76 A;  1Q9I A;  2XLR A;  1TDF A;  1S2Q A;  2E5V A;  2XVI A;  4H4Y A;  5JCI A;  4U2T A;  2APG A;  1JRY A;  4B63 A;  1Y56 B;  5M10 A;  2WDR A;  1D5T A;  4OPI A;  2R9Z A;  2JK6 A;  2YVJ A;  1CJ2 A;  3M12 A;  3HYV A;  4H4Q A;  3UKH A;  1ZMC A;  2VVL A;  2VOU A;  5FS9 A;  4Z26 A;  3P4P A;  3S61 A;  2R4J A;  2XLS A;  3DGH A;  4IVM B;  2BK4 A;  3SYI A;  1MOK A;  1GND A;  3T2Z A;  1FEC A;  2OLN A;  2ZZ0 A;  4H2P A;  3AEA A;  4YSY A;  1L9E A;  2X99 A;  2AAQ A;  4K7Z A;  2YQU A;  3SFD A;  3DH9 A;  1ZK7 A;  2XFQ A; 
#chains in the Genus database with same CATH homology
 2OAM A;  3ATQ A;  3NHO X;  1JEH A;  4GDE A;  4Z44 A;  4Y4L A;  2CFY A;  3C4N A;  2C66 A;  1PBE A;  4CNJ A;  3D1C A;  3UKP A;  2V60 A;  4ICY A;  4Z43 A;  4UDP A;  3QSM A;  4USQ A;  4H4V A;  4ZCD A;  4EMW A;  2GH5 A;  1GRF A;  3E1T A;  4LA1 A;  1JNZ A;  4YSH A;  3CGB A;  4Z2U A;  4YSZ A;  1H7X A;  4HA6 A;  1YKJ A;  2PYX A;  4ADW A;  5KWF A;  3RP6 A;  4TLX A;  3SZ0 A;  1GXF A;  1ZDL A;  1S3E A;  3D8X A;  3CMM A;  3NNE A;  2WP9 A;  2X3N A;  1CC4 A;  4NZH A;  1D4C A;  2WDQ A;  3T31 A;  2Z5X A;  2BS3 A;  3K7T A;  3DJE A;  3CTY A;  1IUW A;  3AYI A;  2Q0K A;  4C5O A;  4OVI A;  4J36 A;  3CGD A;  4J34 A;  5HYM A;  4JNA A;  3AYJ A;  4YKF A;  1YQ3 A;  1F8R A;  2VQ7 A;  4UDR A;  3CNT A;  1KDG A;  3AE5 A;  4K5S A;  1JRX A;  1CL0 A;  4GAV A;  3VQR A;  3DK8 A;  4B68 A;  2YAU A;  5J60 A;  1SEZ A;  1CC6 A;  1PBF A;  2JAE A;  3QSS A;  1VRQ B;  1TDN A;  3GDP A;  1GTE A;  4USR A;  2JB1 A;  3IHM A;  1VG0 A;  1JNR A;  1NHP A;  2C64 A;  3ZDN A;  1E39 A;  3UKL A;  4EMJ A;  3EPT A;  1EL8 A;  4B66 A;  2BS4 A;  1H83 A;  1F8S A;  3ABV A;  3DJD A;  3IWA A;  4H4S A;  4XWR A;  4CY8 A;  2WDV A;  4IA5 A;  5DBJ A;  4GR1 A;  2O9Z A;  2JBV A;  1UKV G;  3C96 A;  4Z2T A;  2V6O A;  3BNM A;  3EF6 A;  3Q6J A;  2YG5 A;  2WU5 A;  2Q6U A;  2XDO A;  4NWZ A;  4A99 A;  3UP4 A;  5EOW A;  4O5Q A;  2Q0L A;  2C65 A;  3UCL A;  4A79 A;  3QVP A;  1H7W A;  2GB0 A;  5FMH A;  1RP0 A;  1BGJ A;  2YR6 A;  3CPI G;  3LZX A;  2VRM A;  1KNR A;  2YWL A;  2NVK X;  4GAP A;  4H4Z A;  1EL5 A;  1ZMD A;  2XYO A;  4G6H A;  4AP3 A;  4NTC A;  3IF9 A;  1IUT A;  4X9M A;  1GPE A;  3AE7 A;  1DOC A;  2BCG G;  2TPR A;  1E1M A;  1YQZ A;  3UP5 A;  1GRB A;  4A65 A;  2GMH A;  4H50 A;  3K7M X;  4UDQ A;  3L8K A;  1N4W A;  2I0Z A;  3BI4 A;  3NKS A;  3NYF A;  4GUV A;  4N9X A;  4U8J A;  4D03 A;  2YG4 A;  1GV4 A;  2BC1 A;  2DKH A;  2ZZC A;  2WES A;  3AXB A;  3P4R A;  4EIP A;  4C74 A;  5LV9 A;  1REO A;  1QLB A;  3SZC A;  1IUS A;  2WP6 A;  1M6I A;  3GRS A;  2YLW A;  3FIM B;  5FS8 A;  3NYE A;  5CKU A;  1COY A;  4CCQ A;  4A9W A;  2ZBW A;  2R0G A;  3AB1 A;  5BRT A;  5KMS A;  1CJ3 A;  3AD7 B;  3GWD A;  2XLU A;  3G5S A;  4AOX A;  3KKJ A;  5HHF A;  2C73 A;  5EB4 A;  2BC0 A;  5IPY A;  2BA9 A;  5KVI A;  2R45 A;  4C77 A;  2J3N A;  4FK1 C;  2GEW A;  2UZZ A;  1FEB A;  2QA2 A;  4E0V A;  4Y4N A;  3V3O A;  1D7Y A;  3ALM A;  1F3P A;  1Q1W A;  4H2R A;  3F8R A;  4U8O A;  3PO7 A;  1ZOY A;  3ALL A;  3BI5 A;  3BHK A;  3NT6 A;  4H4T A;  4WCT A;  5BVA A;  3PS9 A;  4J33 A;  1GRE A;  1M64 A;  1FL2 A;  2H89 A;  3F8P A;  3JSK A;  3L1R A;  2B9W A;  2RGO A;  4PAA A;  1BZL A;  5JCK A;  5JCL A;  2YR4 A;  3UTE A;  1B37 A;  4YWO A;  3CNS A;  4EM4 A;  4UP3 A;  2FJD A;  4H2Q A;  3T14 A;  2B7R A;  1NHS A;  2GR1 A;  3I3L A;  4U8K A;  4AT2 A;  4O5U A;  2WOW A;  1L9C A;  2CUL A;  4JY3 A;  3GMC A;  3QFB A;  4APN A;  2XVE A;  4NTD A;  3NN6 X;  2WOV A;  2Z5Y A;  3GRT A;  3KU9 A;  1YY5 A;  3LXD A;  2YG6 A;  1Z6L A;  3T0K A;  3UTF A;  3QJ4 A;  1NHQ A;  4BJZ A;  1DJN A;  4A6N A;  3B6D A;  1MXT A;  4OPD A;  2YG3 A;  4YTM A;  2OA1 A;  3AE1 A;  2A89 A;  3BHF A;  1NEK A;  4LII A;  1D4E A;  3NTA A;  1CC2 A;  4GDP A;  4Y4M A;  3V76 A;  4D04 A;  1OJT A;  4EQX A;  2A8X A;  1N1P A;  1KFY A;  3FPZ A;  1W4X A;  1NG3 A;  3HYX A;  4K22 A;  4NTE A;  4CY6 A;  4JNQ A;  3AE2 A;  3ALJ A;  2CVJ A;  3LJP A;  3DJG X;  3SFE A;  2XFP A;  2XFO A;  3FBS A;  2YLZ A;  2GR3 A;  2R0P A;  1X31 B;  3AE3 A;  2ZZB A;  1ELI A;  3AYL A;  4JQ9 A;  4C3X A;  2W0H A;  2WPF A;  2GQW A;  3NLC A;  1QO8 A;  2AR8 A;  1P2E A;  4REK A;  3II4 A;  4PAB A;  1CBO A;  1HYU A;  1PXB A;  2GVC A;  4FX9 A;  3AED A;  2FJB A;  4MJW A;  3SM8 A;  2C67 A;  1Y56 A;  4II3 A;  1O5W A;  4DNA A;  1VDC A;  3AWI A;  2BK3 A;  4OPG A;  3UOZ A;  1JU2 A;  1KSS A;  3UKA A;  4H4R A;  1GRT A;  2BS2 A;  4G6G A;  3VRD B;  1TDE A;  5C3J A;  3C4A A;  4BUR A;  3P9U A;  1N4U A;  3ICT A;  4H2N A;  4U8M A;  2RAB A;  4YT0 A;  2GF3 A;  2WQY A;  3AEF A;  3GSI A;  2Y6Q A;  2GAG B;  1GRG A;  1V59 A;  4A5L A;  3UTG A;  3SZW A;  3CNJ A;  2V61 A;  2JKC A;  2YLR A;  1GSN A;  1CJC A;  3GMB A;  1LV0 A;  1TDO A;  4EMI A;  4G73 A;  4U2S A;  2ACZ A;  3B3R A;  1E7P A;  1D7L A;  3M0O A;  1FOH A;  3T2K A;  3DA1 A;  2Q7V A;  2GMJ A;  3R9U A;  4G9K A;  3GYJ A;  2EQ9 A;  4TLZ A;  1GET A;  2DKI A;  4ZCC A;  1B8S A;  3K30 A;  4I59 A;  1K0I A;  3OC4 A;  3ITJ A;  1H84 A;  2JB3 A;  1GEU A;  1E1K A;  1NHR A;  1FCD A;  2XLT A;  4J57 A;  2R46 A;  1K0J A;  1BWC A;  1EBD A;  2GV8 A;  3AD8 B;  4K8D A;  3CIR A;  3OZ2 A;  4HB9 A;  4YTP A;  3H8I A;  1B4V A;  3GWF A;  3VR9 A;  3CNP A;  1XAN A;  1CJ4 A;  2C7G A;  3M13 A;  1ZX9 A;  3NGC X;  4NNJ A;  1H6V A;  1VG9 A;  4ZN0 A;  3HYW A;  4WX1 A;  4BK3 A;  2FJA A;  2ARD A;  1L9D A;  3AE6 A;  4FDC B;  4Z2R A;  1H86 A;  2A87 A;  2C4C A;  2IID A;  1PBB A;  4OCG A;  4U8L A;  3G5R A;  1O94 A;  4IV9 A;  3SQP A;  1ZOV A;  2WOI A;  1EL9 A;  3DJJ A;  2BRY A;  2JB2 A;  3KPK A;  3DK4 A;  3AE4 A;  2GAH B;  2WBA A;  2GRT A;  4A6N B;  2YM1 A;  1NG4 A;  5KOX A;  2VQB A;  4EQW A;  1LQU A;  3CND A;  3QVR A;  2B76 A;  2V3B A;  3P1W A;  1BF3 A;  1P2H A;  2EQ7 A;  3P4S A;  5U25 A;  3LZW A;  4I58 A;  3BI2 A;  4YSX A;  1NEN A;  2R4E A;  2WET A;  2BYB A;  1TRB A;  2TMD A;  3EAO A;  3AEE A;  2OAL A;  1XHC A;  2QAE A;  1JOA A;  3ICR A;  3SGL A;  4J56 A;  1PS9 A;  3GDN A;  1GER A;  3NK0 X;  1TYP A;  2BAC A;  2WP5 A;  2WPE A;  2YVG A;  1PN0 A;  3IHG A;  1GAL A;  4IA6 A;  1CF3 A;  3T2Y A;  2BRA A;  4GF7 A;  2C70 A;  4RSL A;  3AE8 A;  3URH A;  1NDA A;  3VRA A;  1PJ6 A;  3H4K A;  3NG7 X;  2XFU A;  4BK2 A;  1RYI A;  2YR5 A;  4OPT A;  2YG7 A;  1GTH A;  2B9Y A;  1DOB A;  1PXA A;  2FJE A;  4B67 A;  2BXS A;  3VR8 A;  3ZYX A;  1LQT A;  3QFA A;  4U8N A;  4BK1 A;  2BAB A;  5FS7 A;  4YTN A;  2GR0 A;  4DSG A;  4H7U A;  1KF6 A;  2OLO A;  2RGH A;  2YLX A;  5KMQ A;  2XVH A;  5GRT A;  3GYI A;  4U8P A;  4U8I A;  1OJC A;  3V3N A;  1BKW A;  3ATR A;  3NYC A;  4TM1 A;  4AP1 A;  2GQF A;  3NH3 X;  1E1L A;  4H4P A;  2WHD A;  2C72 A;  3RP8 A;  5TR3 A;  1DJQ A;  4JN9 A;  5M0Z A;  5GSN A;  3EAN A;  1LPF A;  1D4D A;  3CGE A;  3KPF A;  3LOV A;  1PHH A;  2VVL G;  1DOD A;  3NK1 X;  4J2W A;  1PDH A;  5J7X A;  1JRZ A;  1LJ1 A;  2VVM A;  4CRT A;  3KVE A;  1DOE A;  4Z24 A;  2AQJ A;  2CDU A;  3AD9 B;  3NK2 X;  1B5Q A;  2YM2 A;  1PXC A;  4KX6 A;  4CBQ A;  4JY2 A;  5BUK A;  3CPH G;  1PJ7 A;  1Y0P A;  3KLJ A;  2BCP A;  4B65 A;  1RSG A;  4TM4 A;  4M52 A;  1Q1R A;  1N4V A;  3DK9 A;  5ER0 A;  1OJA A;  4EQR A;  2YLT A;  3UTH A;  1KSU A;  2FBW A;  1O95 A;  3SZF A;  3AEB A;  4TM0 A;  3T37 A;  4JDR A;  4J31 A;  4GCM A;  1CHU A;  1F8W A;  3BNU A;  1PBD A;  2XVF A;  3FG2 P;  4H4W A;  4IVO B;  4K5R A;  3RED A;  3CGC A;  4EM3 A;  3COX A;  2VZ2 A;  3S5W A;  2QA1 A;  1K4Q A;  4II2 A;  5KRQ A;  4B64 A;  2E1M A;  2XLP A;  3I6D A;  5KOW A;  5KXJ A;  2F5Z A;  1S2Y A;  3AEC A;  2C75 A;  5IQ1 A;  4X4J A;  3DME A;  1TDK A;  1S3B A;  3GYX A;  5CQF A;  2RGJ A;  3NRN A;  4BV6 A;  5KNL A;  3DGZ A;  3RNM A;  4OPU A;  1H82 A;  3PVC A;  3UKF A;  4GRT A;  1MO9 A;  1GRA A;  2X50 A;  4ECH A;  3NTD A;  1YQ4 A;  3CN8 A;  5L46 A;  3UOY A;  3SXI A;  4P9S A;  4CNK A;  1ONF A;  1XPQ A;  4U2L A;  3KD9 A;  5EBK A;  4H4U A;  4XWZ A;  5KVH A;  4X9N A;  2QCU A;  5IQ4 A;  2H88 A;  3RP7 A;  1GT8 A;  1XDI A;  3RHA A;  1LVL A;  4DGK A;  2C3C A;  2EQ6 A;  3UKK A;  2WS3 A;  4EQS A;  3LAD A;  3SX6 A;  2GR2 A;  3AE9 A;  4Z25 A;  4YXD A;  1NAA A;  1EL7 A;  1PJ5 A;  2XFN A;  2X8G A;  3GD3 A;  3O0H A;  2NPX A;  5KMP A;  4C3Y A;  3VRB A;  1FEA A;  2B7S A;  1ZP0 A;  3UOX A;  1OJD A;  1ZKQ A;  1PBC A;  4NEW A;  1K0L A;  3H8L A;  1E1N A;  4G74 A;  5JCM A;  1GES A;  2X8H A;  2XCG A;  1QJD A;  4KPR A;  1IUV A;  1LTX R;  4A7A A;  1E6E A;  1H81 A;  2B9X A;  1IUU A;  1DXL A;  1ZY8 A;  3QSE A;  1F6M A;  2Y6R A;  2VRL A;  3FMW A;  3SY4 A;  3GD4 A;  4EIQ A;  3UKQ A;  3K7Q X;  5U1O A;  4YKG A;  2V3A A;  3LB8 A;  4RG4 A;  2V5Z A;  2R0C A;  3P4Q A;  4XXG A;  5BUL A;  1AOG A;  3F8D A;  5C2T A;  2EQ8 A;  5HXI A;  5HY5 A;  2E4G A;  2IVE A;  2WPC A;  4OPC A;  3NIX A;  3UOV A;  4TM3 A;  2WEU A;  2XVJ A;  2WU2 A;  4K2X A;  2IVD A;  3ISH A;  1VQW A;  4AOS A;  5EB5 A;  4NEV A;  4OPL A;  4FK1 A;  4H4X A;  3ICS A;  3NN0 X;  3Q9T A;  2BXR A;  5FS6 A;  4AT0 A;  2PHH A;  5JCN A;  3CPJ G;  1OJ9 A;  1IJH A;  1NPX A;  3HZL A;  3G5Q A;  3ADA B;  4LU6 A;  1GOS A;  2C3D A;  5U63 A;  4CCR A;  1TYT A;  2BK5 A;  1IUX A;  3IC9 A;  3WE0 A;  4B69 A;  2X8C A;  4BJY A;  5KMR A;  1BGN A;  4RG3 A;  2YVF A;  2YLS A;  3KA7 A;  1DNC A;  1GRH A;  2HQM A;  1KNP A;  3AEG A;  4B1B A;  1L0V A;  4DSH A;  2C76 A;  1Q9I A;  2XLR A;  1TDF A;  1S2Q A;  2E5V A;  2XVI A;  4H4Y A;  5JCI A;  4U2T A;  2APG A;  1JRY A;  4B63 A;  1Y56 B;  5M10 A;  2WDR A;  1D5T A;  4OPI A;  2R9Z A;  2JK6 A;  2YVJ A;  1CJ2 A;  3M12 A;  3HYV A;  4H4Q A;  3UKH A;  1ZMC A;  2VVL A;  2VOU A;  5FS9 A;  4Z26 A;  3P4P A;  3S61 A;  2R4J A;  2XLS A;  3DGH A;  4IVM B;  2BK4 A;  3SYI A;  1MOK A;  1GND A;  3T2Z A;  1FEC A;  2OLN A;  2ZZ0 A;  4H2P A;  3AEA A;  4YSY A;  1L9E A;  2X99 A;  2AAQ A;  4K7Z A;  2YQU A;  3SFD A;  3DH9 A;  1ZK7 A;  2XFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...