1TDOA

L-amino acid oxidae from agkistrodon halys in complex with l-phenylalanine
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complexes with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 166
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdoA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdoA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdoA01
2WU5A 2AR8A 2B9YA 3AE2A 5FS9A 1LV0A 1W4XA 2XFOA 1D4DA 1N1PA 3VR9A 2BK5A 2WU2A 2YM1A 4FK1A 4FK1C 4H4RA 2EQ7A 4AOXA 2FJDA 2NPXA 2XLTA 1S3BA 1COYA 2XVJA 3RNMA 1GXFA 3ALLA 3C4AA 2X8HA 3NYCA 2WS3A 3AE8A 4EQRA 4Z44A 5KOXA 3KVEA 2QA1A 1D4EA 4A7AA 4U8PA 4B63A 4D04A 1PJ6A 3SM8A 4A9WA 3DK4A 3NYFA 2C70A 2YR6A 1BF3A 1GETA 2BC0A 3FMWA 3QSEA 1N4WA 2GAGB 4OCGA 2O9ZA 5L46A 5FS7A 1DODA 4LIIA 4CNKA 4UDPA 1ZKQA 3DA1A 2YLXA 3AE9A 2Q0LA 5KOWA 4H50A 1CF3A 4EM4A 3NTDA 1K4QA 3F8RA 2YLTA 4KPRA 2XFUA 1TRBA 1ZX9A 4J2WA 2BXRA 2YG3A 5IQ4A 3P4RA 3SFDA 4NTEA 3II4A 5J60A 3F8PA 5BVAA 1E1NA 3AEAA 2CVJA 3ATQA 4MJWA 4WCTA 1QLBA 5J7XA 3UKLA 3AE7A 4CBQA 1TDOA 1GTEA 2X8GA 3P9UA 4EQXA 2FJAA 4BJYA 2XLUA 2XDOA 1DXLA 2WDRA 4Z2TA 4A99A 4CY6A 1GNDA 4YT0A 4ECHA 4Z25A 1E6EA 3UOYA 1PN0A 2OALA 3H4KA 4TM3A 3GMCA 3NK2X 1KF6A 1ZK7A 3AE3A 4YWOA 5GRTA 3QJ4A 2YAUA 4H4TA 4J31A 4K8DA 3CPHG 3RP6A 5C3JA 2GR0A 3LJPA 3K7MX 2WOIA 1GRHA 4ZCDA 3FBSA 1TYTA 2QAEA 4O5QA 5U25A 2BCPA 2GF3A 3DH9A 3ICSA 1EL5A 3UOXA 1XDIA 3GDNA 2B76A 2BYBA 3E1TA 4U2LA 4K22A 3NN0X 3GYJA 3M12A 4OPGA 3WE0A 4FDCB 2CFYA 2GAHB 2HQMA 2ZZBA 3CTYA 1TDKA 2C75A 3CGEA 3EAOA 1Y56B 1GRTA 2A89A 1EL7A 5FS8A 3QSSA 1MXTA 3DMEA 1CJ2A 2XVFA 3I3LA 5KVIA 3CGDA 2V6OA 2EQ9A 1DNCA 4YKFA 2VZ2A 1B4VA 1NG3A 3EANA 1CJ3A 1FEAA 1L0VA 1M64A 2C65A 3URHA 4IA5A 2V61A 1NDAA 4B67A 4PABA 1Y0PA 4H2QA 4YTNA 1F8SA 2VQ7A 3CNTA 3NNEA 4BV6A 1JRZA 1PXCA 3CGBA 4ICYA 4TM1A 1S2YA 1N4VA 3D8XA 4BJZA 1XHCA 3B3RA 3UOVA 1VG9A 4JN9A 2R4JA 4I59A 1ZP0A 4A5LA 5KXJA 2GVCA 3AD9B 3LXDA 3AE5A 4NZHA 3QFAA 3AWIA 4OPIA 2ZZCA 3AEBA 2YLZA 2Q7VA 4H4XA 4Z2RA 5M0ZA 4Z24A 3DJDA 4APNA 2XLPA 2B9XA 4OPUA 4J33A 3AEEA 5EB5A 4BK2A 3V3OA 1K0LA 4A6NB 4Z2UA 1CC2A 1D7LA 2H89A 1ZMCA 1GRGA 1XPQA 4JDRA 4NTCA 1IUUA 2YG4A 2Y6RA 2XVEA 1GRFA 2XYOA 3K7QX 1IUXA 2WOWA 5JCIA 2YG7A 3LZXA 4CY8A 1PJ7A 2GR1A 1VRQB 3L8KA 2WEUA 1LTXR 4EMJA 2OLNA 4H4WA 4CCRA 2C64A 3UP5A 4GF7A 1O95A 4YSZA 3FIMB 4OPCA 2R45A 2NVKX 4U2TA 4Y4NA 3P4SA 3AYIA 3O0HA 3BNUA 4ZN0A 1UKVG 1B5QA 5JCMA 2YVFA 2XVIA 3NLCA 2F5ZA 1JRYA 4RG4A 3AECA 4GDPA 4GR1A 2R0PA 3GRSA 4HB9A 2WPEA 2XLSA 1EL9A 1KSSA 2YLRA 4TLZA 4C77A 5HY5A 5JCKA 2C7GA 5FS6A 4YXDA 2DKIA 5CQFA 2JB2A 3KA7A 4DGKA 1LJ1A 3L1RA 3Q6JA 4K5RA 4U8JA 5BRTA 2WPCA 4REKA 4IVOB 3RP8A 2X8CA 1L9CA 2RABA 2R0CA 3VR8A 1BKWA 4NEVA 2PHHA 3GSIA 3CNJA 3DJJA 4GCMA 3D1CA 4C3YA 1CC4A 2XVHA 3CNSA 1IUWA 2AQJA 2JKCA 4GRTA 1F8WA 4EQSA 5M10A 1DOCA 1Z6LA 1OJTA 2OAMA 3B6DA 2WP9A 4K2XA 1GTHA 3QVPA 3AEFA 1GRBA 2YQUA 4CCQA 1DOEA 2WDQA 2VRMA 4EMWA 3OC4A 2C76A 3QFBA 2R46A 2APGA 4LU6A 4JY2A 2XFQA 5JCNA 4EMIA 1MO9A 4A65A 1EL8A 3LADA 3ALJA 1NAAA 1TDNA 1IUSA 5HXIA 2FBWA 2V60A 3T37A 3CPIG 3NG7X 1YQZA 3FPZA 4BK3A 2YR5A 4Y4LA 2Z5YA 5EOWA 1Y56A 3NHOX 4EIQA 4U8IA 2IVEA 3P4QA 4XWZA 4DSGA 2B7RA 1S3EA 4CNJA 3FG2P 2GQFA 2GMHA 3ATRA 4TLXA 1TDFA 4IA6A 1LVLA 2JAEA 3AE6A 4H4VA 1L9DA 1CBOA 4H4YA 1F6MA 3AEGA 1D7YA 4OVIA 3AYJA 2X3NA 1H86A 3K30A 4EQWA 4IV9A 2FJEA 4YSXA 4D03A 5GSNA 2WHDA 1YY5A 2BS4A 1D5TA 2FJBA 3EPTA 3IHGA 4JQ9A 1F3PA 1KNPA 1LQTA 2R0GA 3P4PA 4YTPA 1FL2A 1JEHA 3NK0X 2GR3A 1B8SA 1CC6A 1BWCA 3AE4A 3DGZA 1BZLA 3UKAA 3VRBA 1PXAA 2Z5XA 1NG4A 1KNRA 3PVCA 4JNAA 5HHFA 4K7ZA 2RGJA 5BUKA 4I58A 2BCGG 1PBFA 3G5QA 3PS9A 3UTHA 1VDCA 2GRTA 2ARDA 2R4EA 4LA1A 3UP4A 1PBCA 4YTMA 2VQBA 3IHMA 4YSYA 3KU9A 3ABVA 3NGCX 1JRXA 3I6DA 3CPJG 3NIXA 1H83A 1H82A 2WESA 3BI4A 2WDVA 4DSHA 1FECA 3V76A 1E7PA 1P2HA 4UP3A 4AOSA 3UTGA 4USRA 4H2RA 4TM0A 4ADWA 4H4SA 1YKJA 1DJNA 4AT2A 1FCDA 3ALMA 4KX6A 1KDGA 2E5VA 2TPRA 2A8XA 2YLSA 4O5UA 3UOZA 3CNPA 4XXGA 4H4PA 2C73A 5IQ1A 3GYIA 3AE1A 1X31B 4X9MA 3S5WA 2VVLA 2JBVA 1PJ5A 3AD7B 3NYEA 3UKFA 1KSUA 3K7TA 2YG6A 5HYMA 1GRAA 2ACZA 4J36A 2RGOA 2VVMA 4UDQA 4C5OA 1H81A 3AB1A 3UCLA 3UKQA 4AP1A 3GRTA 2C3CA 4RSLA 1O94A 2XFNA 2CULA 3GD4A 1ELIA 4C74A 2BA9A 2X50A 1P2EA 4J56A 2W0HA 3SGLA 2PYXA 3LOVA 4U8KA 2EQ6A 3P1WA 1K0IA 1KFYA 1LPFA 1XANA 2BS2A 3H8LA 1HYUA 4X4JA 2B7SA 3SFEA 2RGHA 2WBAA 3LZWA 3DGHA 4BURA 3C4NA 3EF6A 1GT8A 2Q6UA 2QA2A 2JB3A 3ZYXA 3GMBA 1GSNA 4B69A 4A79A 4Z43A 4ZCCA 2XCGA 1QO8A 2C3DA 3DJEA 3CN8A 1RSGA 2C66A 4U8MA 2EQ8A 3UKKA 2C72A 2JB1A 4U2SA 5JCLA 1E1MA 2C67A 5IPYA 5U63A 1GERA 4H2NA 5EBKA 1AOGA 4NEWA 2GR2A 4B66A 1H6VA 1GESA 3NH3X 1VG0A 1PDHA 2E4GA 3IC9A 2AAQA 5ER0A 2BC1A 3M0OA 1OJCA 5CKUA 3REDA 1OJDA 1H7XA 3C96A 3S61A 2VVLG 1K0JA 2BXSA 4H7UA 3SQPA 5DBJA 5KVHA 4C3XA 2VRLA 1BGNA 2YVJA 2GMJA 4JNQA 3AEDA 3COXA 4U8OA 3RP7A 3DK8A 2YG5A 2YM2A 2QCUA 2BK4A 1PBBA 4HA6A 3GWFA 3NTAA 3BHKA 4E0VA 4B68A 3G5SA 1GALA 1PBEA 1GPEA 2XLRA 3CIRA 4JY3A 3KLJA 1CHUA 4N9XA 1IJHA 3GD3A 1CL0A 2VOUA 1NEKA 2BS3A 1V59A 2E1MA 1ZOYA 2WOVA 2GB0A 4RG3A 1IUTA 1H84A 1NHQA 1Q9IA 2V3BA 3ITJA 5EB4A 3RHAA 4B1BA 2DKHA 3BHFA 3V3NA 4FX9A 1SEZA 2TMDA 4OPTA 2GEWA 3GDPA 1ZY8A 1PS9A 4PAAA 1H7WA 4EM3A 5TR3A 1D4CA 3AD8B 4DNAA 3LB8A 3DK9A 1CJ4A 1JOAA 4H4QA 1CJCA 1JU2A 1RYIA 1REOA 4OPDA 3PO7A 1PHHA 4Z26A 1E1KA 5FMHA 4YSHA 4J34A 4OPLA 2V3AA 1TYPA 4U8NA 2WETA 4GDEA 1DOBA 3KPFA 5C2TA 3G5RA 4M52A 3CNDA 3F8DA 4P9SA 4B65A 4UDRA 3UTFA 3GWDA 4EIPA 2WP6A 2H88A 3AYLA 5U1OA 3ZDNA 4IVMB 2B9WA 1YQ3A 4X9NA 5BULA 1NHPA 3AXBA 4USQA 5LV9A 1NPXA 1ZDLA 3QSMA 4XWRA 1BGJA 3UKHA 1QJDA 1TDEA 3ICRA 4GUVA 3CGCA 1OJ9A 4WX1A 1FOHA 1NHRA 1NHSA 3BI2A 1E39A 3VRDB 4NTDA 3UKPA 4H4UA 1FEBA 2BK3A 2Y6QA 3BI5A 5KWFA 5KRQA 2R9ZA 3KD9A 3IWAA 1GV4A 4A6NA 2GH5A 3KKJA 2ZBWA 4TM4A 1ZMDA 1S2QA 2V5ZA 3HZLA 2Q0KA 3R9UA 2WPFA 4U8LA 1PBDA 3ICTA 1Q1WA 3NT6A 1ONFA 2WP5A 2CDUA 1LQUA 1E1LA 3Q9TA 2YLWA 3NN6X 4K5SA 1YQ4A 4BK1A 4H4ZA 1GEUA 2IVDA 2J3NA 3H8IA 1DJQA 3M13A 1VQWA 3ADAB 1EBDA 2UZZA 1B37A 4AT0A 1L9EA 1JNRA 2XFPA 1GREA 4AP3A 3VQRA 3UTEA 3NKSA 2GQWA 2ZZ0A 3NK1X 2IIDA 2OLOA 2BABA 2OA1A 2JK6A 1JNZA 4YKGA 1O5WA 1ZOVA 3VRAA 2YR4A 1PXBA 2A87A 1MOKA 2BACA 2I0ZA 2YVGA 1RP0A 1F8RA 4CRTA 1Q1RA 3ISHA 2YWLA 3IF9A 1OJAA 1GOSA 3QVRA 4J57A 4Y4MA 1IUVA 3BNMA 1M6IA 2X99A 1NENA 3JSKA 3NRNA 2WQYA 3OZ2A 1N4UA 2GV8A 4B64A 3DJGX 4H2PA
chains in the Genus database with same CATH superfamily
2WU5A 2AR8A 2B9YA 3AE2A 5FS9A 1LV0A 1W4XA 2XFOA 1D4DA 1N1PA 3VR9A 2BK5A 2WU2A 2YM1A 4FK1A 4FK1C 4H4RA 2EQ7A 4AOXA 2FJDA 2NPXA 2XLTA 1S3BA 1COYA 2XVJA 3RNMA 1GXFA 3ALLA 3C4AA 2X8HA 3NYCA 2WS3A 3AE8A 4EQRA 4Z44A 5KOXA 3KVEA 2QA1A 1D4EA 4A7AA 4GAPA 4U8PA 4B63A 4D04A 1PJ6A 3SM8A 4A9WA 3DK4A 3NYFA 2C70A 2YR6A 1BF3A 1GETA 2BC0A 3FMWA 3QSEA 1N4WA 2GAGB 4OCGA 2O9ZA 5L46A 5FS7A 1DODA 4LIIA 4CNKA 4UDPA 1ZKQA 3DA1A 2YLXA 3AE9A 2Q0LA 5KOWA 4H50A 1CF3A 4EM4A 3NTDA 1K4QA 3F8RA 2YLTA 4KPRA 4II3A 2XFUA 1TRBA 1ZX9A 4J2WA 2BXRA 2YG3A 4NNJA 5IQ4A 3P4RA 3SFDA 4NTEA 3II4A 5J60A 3F8PA 5BVAA 1E1NA 3AEAA 2CVJA 3ATQA 4MJWA 4WCTA 1QLBA 5J7XA 3SY4A 3AE7A 3UKLA 4CBQA 1TDOA 1GTEA 2X8GA 3P9UA 4EQXA 2FJAA 4BJYA 2XLUA 2XDOA 1DXLA 2WDRA 4Z2TA 4A99A 4CY6A 1GNDA 4YT0A 4ECHA 4Z25A 1E6EA 3UOYA 1PN0A 2OALA 3H4KA 4TM3A 3GMCA 3NK2X 1KF6A 1ZK7A 3AE3A 4YWOA 5GRTA 3QJ4A 2YAUA 4H4TA 4J31A 4K8DA 3CPHG 3RP6A 5C3JA 2GR0A 3LJPA 3K7MX 2WOIA 1GRHA 4ZCDA 3FBSA 1TYTA 2BRYA 2QAEA 4O5QA 5U25A 2BCPA 2GF3A 3DH9A 3ICSA 1EL5A 3UOXA 1XDIA 3GDNA 2B76A 2BYBA 3E1TA 4U2LA 3CMMA 4K22A 3NN0X 3GYJA 3M12A 3WE0A 4OPGA 4FDCB 2CFYA 2GAHB 2HQMA 2ZZBA 3CTYA 1TDKA 2C75A 3CGEA 3EAOA 1Y56B 1GRTA 2A89A 1EL7A 5FS8A 3QSSA 1MXTA 3DMEA 1CJ2A 2XVFA 3I3LA 5KVIA 3SYIA 3CGDA 2V6OA 2EQ9A 1DNCA 4YKFA 2VZ2A 1B4VA 1NG3A 3EANA 1CJ3A 1FEAA 1L0VA 1M64A 2C65A 3URHA 4IA5A 2V61A 1NDAA 4B67A 4PABA 1Y0PA 4G73A 4H2QA 4YTNA 1F8SA 2VQ7A 3CNTA 3SZCA 3SZWA 3NNEA 4BV6A 1JRZA 1PXCA 3CGBA 4ICYA 4TM1A 1S2YA 1N4VA 3D8XA 4BJZA 1XHCA 3B3RA 3UOVA 1VG9A 4JN9A 2R4JA 4I59A 1ZP0A 4A5LA 5KXJA 2GVCA 3AD9B 3LXDA 3AE5A 4NZHA 3QFAA 3AWIA 4OPIA 2ZZCA 3AEBA 2YLZA 2Q7VA 4H4XA 4Z2RA 5M0ZA 4Z24A 3DJDA 4APNA 2XLPA 2B9XA 4OPUA 4J33A 3AEEA 5EB5A 4BK2A 4II2A 3V3OA 1K0LA 4A6NB 4Z2UA 1CC2A 1D7LA 2H89A 1ZMCA 1GRGA 1XPQA 4JDRA 4NTCA 5KMRA 1IUUA 2YG4A 2Y6RA 2XVEA 1GRFA 2XYOA 3K7QX 1IUXA 2WOWA 5JCIA 2YG7A 3LZXA 4CY8A 1PJ7A 2GR1A 1VRQB 3L8KA 2WEUA 1LTXR 4EMJA 2OLNA 4H4WA 4CCRA 2C64A 3UP5A 4GF7A 1O95A 4YSZA 3FIMB 4OPCA 2R45A 2NVKX 3T2YA 4U2TA 4Y4NA 3P4SA 3AYIA 3O0HA 3BNUA 4ZN0A 1UKVG 1B5QA 5JCMA 2YVFA 2XVIA 3NLCA 2F5ZA 1JRYA 4RG4A 3AECA 4GDPA 4GR1A 2R0PA 3GRSA 4HB9A 2WPEA 2XLSA 1EL9A 1KSSA 2YLRA 4TLZA 4C77A 5HY5A 5JCKA 2C7GA 5FS6A 4YXDA 2DKIA 5CQFA 2JB2A 3KA7A 4DGKA 1LJ1A 3L1RA 3Q6JA 4K5RA 3HYVA 4U8JA 2WPCA 5BRTA 4REKA 4IVOB 3RP8A 3T31A 2X8CA 1L9CA 2RABA 2R0CA 3VR8A 5KMPA 1BKWA 4NEVA 2PHHA 3GSIA 3CNJA 3DJJA 4GCMA 3D1CA 3T14A 1CC4A 4C3YA 2XVHA 3CNSA 1IUWA 2AQJA 2JKCA 4GRTA 1F8WA 4EQSA 5M10A 1DOCA 1Z6LA 1OJTA 2OAMA 3B6DA 2WP9A 4K2XA 1GTHA 3QVPA 3AEFA 1GRBA 2YQUA 4CCQA 1DOEA 2WDQA 2VRMA 4EMWA 3OC4A 2C76A 3QFBA 4G6GA 2R46A 2APGA 4LU6A 4JY2A 2XFQA 5JCNA 4EMIA 1MO9A 4A65A 1EL8A 3LADA 3ALJA 1NAAA 1TDNA 1IUSA 5HXIA 2FBWA 2V60A 3T37A 3CPIG 3NG7X 1YQZA 3FPZA 4BK3A 2YR5A 4Y4LA 2Z5YA 5EOWA 1Y56A 3NHOX 4EIQA 4U8IA 2IVEA 3P4QA 4XWZA 4DSGA 2B7RA 1S3EA 4CNJA 3FG2P 2GQFA 2GMHA 3ATRA 4TLXA 1TDFA 4IA6A 1LVLA 2JAEA 3KPKA 3AE6A 4H4VA 1L9DA 1CBOA 4H4YA 1F6MA 3AEGA 1D7YA 4OVIA 4GAVA 3AYJA 2X3NA 1H86A 3K30A 4EQWA 4IV9A 2FJEA 4YSXA 4D03A 5GSNA 2WHDA 1YY5A 2BS4A 1D5TA 2FJBA 3EPTA 3IHGA 3SZFA 4JQ9A 1F3PA 3SXIA 1KNPA 1LQTA 2R0GA 3P4PA 4YTPA 1FL2A 1JEHA 3NK0X 2GR3A 1B8SA 1CC6A 1BWCA 3AE4A 3DGZA 1BZLA 3UKAA 3VRBA 1PXAA 2Z5XA 3GYXA 1NG4A 1KNRA 3PVCA 4JNAA 5HHFA 4K7ZA 2RGJA 5BUKA 4I58A 2BCGG 1PBFA 3G5QA 3PS9A 3UTHA 1VDCA 2GRTA 2ARDA 2R4EA 4LA1A 3UP4A 1PBCA 4YTMA 2VQBA 3IHMA 4YSYA 3KU9A 3ABVA 3NGCX 1JRXA 3I6DA 3CPJG 3NIXA 1H83A 1H82A 2WESA 3BI4A 2WDVA 4DSHA 1FECA 3V76A 1E7PA 1P2HA 4UP3A 4AOSA 3UTGA 4USRA 4H2RA 4TM0A 4ADWA 4H4SA 1YKJA 1DJNA 4AT2A 1FCDA 3ALMA 4KX6A 1KDGA 2E5VA 2TPRA 2A8XA 2YLSA 4O5UA 3UOZA 3CNPA 4XXGA 4H4PA 2C4CA 2C73A 5IQ1A 3T2KA 3GYIA 3AE1A 1X31B 4X9MA 3S5WA 2VVLA 2JBVA 1PJ5A 3AD7B 3NYEA 3UKFA 1KSUA 3K7TA 2YG6A 5HYMA 1GRAA 2ACZA 4J36A 2RGOA 2VVMA 4UDQA 4C5OA 1H81A 3AB1A 5KMQA 3UCLA 3UKQA 4AP1A 3GRTA 2C3CA 4RSLA 1O94A 2XFNA 2CULA 3GD4A 1ELIA 4C74A 2BA9A 2X50A 1P2EA 4J56A 2W0HA 3SGLA 2PYXA 3LOVA 4G6HA 4U8KA 2EQ6A 3P1WA 1K0IA 1KFYA 1LPFA 1XANA 2BS2A 3H8LA 1HYUA 4X4JA 2B7SA 3SFEA 2RGHA 2WBAA 3LZWA 3DGHA 4BURA 3C4NA 3EF6A 1GT8A 2Q6UA 2QA2A 2JB3A 3ZYXA 3GMBA 1GSNA 4B69A 4A79A 4Z43A 4ZCCA 2XCGA 1QO8A 2C3DA 3DJEA 3CN8A 1RSGA 2C66A 4U8MA 2EQ8A 3UKKA 2C72A 2JB1A 4U2SA 5JCLA 1E1MA 2C67A 5IPYA 5U63A 1GERA 4H2NA 5EBKA 1AOGA 4NEWA 2GR2A 4B66A 1H6VA 1GESA 3NH3X 1VG0A 1PDHA 2E4GA 3IC9A 2AAQA 5ER0A 2BC1A 3M0OA 1OJCA 5CKUA 3REDA 1OJDA 1H7XA 3C96A 3S61A 2VVLG 1K0JA 2BXSA 4H7UA 3SQPA 5DBJA 5KVHA 4C3XA 2VRLA 1BGNA 2YVJA 2GMJA 4JNQA 3AEDA 3COXA 4U8OA 3RP7A 3DK8A 2YG5A 2YM2A 2QCUA 2BK4A 1PBBA 4HA6A 3GWFA 3NTAA 3BHKA 4E0VA 4B68A 3G5SA 1GALA 1PBEA 1GPEA 2XLRA 3CIRA 4JY3A 3KLJA 1CHUA 4N9XA 1IJHA 3GD3A 1CL0A 2VOUA 1NEKA 2BS3A 1V59A 2E1MA 1ZOYA 2WOVA 2GB0A 4RG3A 1IUTA 1H84A 1NHQA 1Q9IA 2V3BA 3ITJA 5EB4A 3RHAA 3SZ0A 2DKHA 4B1BA 3BHFA 3V3NA 4FX9A 1SEZA 2TMDA 4OPTA 2GEWA 3GDPA 1ZY8A 1PS9A 4PAAA 1H7WA 4EM3A 5TR3A 1D4CA 3AD8B 4DNAA 3LB8A 4NWZA 3DK9A 1CJ4A 1JOAA 4H4QA 1CJCA 1JU2A 1RYIA 1REOA 4OPDA 3PO7A 1PHHA 4Z26A 1E1KA 5FMHA 4YSHA 4J34A 4OPLA 2V3AA 1TYPA 4U8NA 2WETA 4GDEA 1DOBA 3KPFA 5C2TA 3G5RA 4M52A 3CNDA 3F8DA 4P9SA 4B65A 4UDRA 3UTFA 3GWDA 4EIPA 2WP6A 2H88A 3AYLA 5U1OA 3ZDNA 4IVMB 2B9WA 1YQ3A 4X9NA 5BULA 1NHPA 3AXBA 4USQA 5LV9A 1NPXA 1ZDLA 3QSMA 4XWRA 1BGJA 3UKHA 1QJDA 1TDEA 3ICRA 4GUVA 3CGCA 1OJ9A 4WX1A 1FOHA 1NHRA 1NHSA 3BI2A 3HYXA 1E39A 3VRDB 4NTDA 3UKPA 4H4UA 1FEBA 2BK3A 2Y6QA 3BI5A 5KWFA 5KRQA 2R9ZA 3KD9A 3IWAA 5KMSA 1GV4A 4A6NA 5KNLA 2GH5A 3KKJA 2ZBWA 4TM4A 1ZMDA 1S2QA 2V5ZA 3HZLA 2Q0KA 2BRAA 3R9UA 2WPFA 3T0KA 4U8LA 1PBDA 3ICTA 1Q1WA 3NT6A 1ONFA 2WP5A 2CDUA 1LQUA 1E1LA 3Q9TA 2YLWA 3NN6X 4K5SA 1YQ4A 4BK1A 4H4ZA 1GEUA 2IVDA 2J3NA 3H8IA 1DJQA 3M13A 4G74A 1VQWA 3ADAB 1EBDA 2UZZA 1B37A 4AT0A 1L9EA 4G9KA 1JNRA 2XFPA 1GREA 4AP3A 3VQRA 3UTEA 3SX6A 3NKSA 2GQWA 2ZZ0A 3NK1X 2IIDA 2OLOA 3HYWA 2BABA 2OA1A 2JK6A 1JNZA 4YKGA 1O5WA 1ZOVA 3VRAA 2YR4A 1PXBA 2A87A 2BACA 1MOKA 2I0ZA 2YVGA 3T2ZA 1RP0A 1F8RA 4CRTA 1Q1RA 3ISHA 2YWLA 3IF9A 1OJAA 1GOSA 3QVRA 4J57A 4Y4MA 1IUVA 3BNMA 1M6IA 2X99A 1NENA 3JSKA 3NRNA 2WQYA 3OZ2A 1N4UA 2GV8A 4B64A 3DJGX 4H2PA
chains in the Genus database with same CATH topology
2WU5A 2AR8A 2B9YA 3AE2A 5FS9A 1LV0A 1W4XA 2XFOA 1D4DA 1N1PA 3VR9A 2BK5A 2WU2A 2YM1A 4FK1A 4FK1C 4H4RA 2EQ7A 4AOXA 2FJDA 2NPXA 2XLTA 1S3BA 1COYA 2XVJA 3RNMA 1GXFA 3ALLA 3C4AA 2X8HA 3NYCA 2WS3A 3AE8A 4EQRA 4Z44A 5KOXA 3KVEA 2QA1A 1D4EA 4A7AA 4GAPA 4U8PA 4B63A 4D04A 1PJ6A 3SM8A 4A9WA 3DK4A 3NYFA 2C70A 2YR6A 1BF3A 1GETA 2BC0A 3FMWA 3QSEA 1N4WA 2GAGB 4OCGA 2O9ZA 5L46A 5FS7A 1DODA 4LIIA 4CNKA 4UDPA 1ZKQA 3DA1A 2YLXA 3AE9A 2Q0LA 5KOWA 4H50A 1CF3A 4EM4A 3NTDA 1K4QA 3F8RA 2YLTA 4KPRA 4II3A 2XFUA 1TRBA 1ZX9A 4J2WA 2BXRA 2YG3A 4NNJA 5IQ4A 3P4RA 3SFDA 4NTEA 3II4A 5J60A 3F8PA 5BVAA 1E1NA 3AEAA 2CVJA 3ATQA 4MJWA 4WCTA 1QLBA 5J7XA 3SY4A 3AE7A 3UKLA 4CBQA 1TDOA 1GTEA 2X8GA 3P9UA 4EQXA 2FJAA 4BJYA 2XLUA 2XDOA 1DXLA 2WDRA 4Z2TA 4A99A 4CY6A 1GNDA 4YT0A 4ECHA 4Z25A 1E6EA 3UOYA 1PN0A 2OALA 3H4KA 4TM3A 3GMCA 3NK2X 1KF6A 1ZK7A 3AE3A 4YWOA 5GRTA 3QJ4A 2YAUA 4H4TA 4J31A 4K8DA 3CPHG 3RP6A 5C3JA 2GR0A 3LJPA 3K7MX 2WOIA 1GRHA 4ZCDA 3FBSA 1TYTA 2BRYA 2QAEA 4O5QA 5U25A 2BCPA 2GF3A 3DH9A 3ICSA 1EL5A 3UOXA 1XDIA 3GDNA 2B76A 2BYBA 3E1TA 4U2LA 3CMMA 4K22A 3NN0X 3GYJA 3M12A 4OPGA 3WE0A 4FDCB 2CFYA 2GAHB 2HQMA 2ZZBA 3CTYA 1TDKA 2C75A 3CGEA 3EAOA 1Y56B 1GRTA 2A89A 1EL7A 5FS8A 3QSSA 1MXTA 3DMEA 1CJ2A 2XVFA 3I3LA 5KVIA 3SYIA 3CGDA 2V6OA 2EQ9A 1DNCA 4YKFA 2VZ2A 1B4VA 1NG3A 3EANA 1CJ3A 1FEAA 1L0VA 1M64A 2C65A 3URHA 4IA5A 2V61A 1NDAA 4B67A 4PABA 1Y0PA 4G73A 4H2QA 4YTNA 1F8SA 2VQ7A 3CNTA 3SZCA 3SZWA 3NNEA 4BV6A 1JRZA 1PXCA 3CGBA 4ICYA 4TM1A 1S2YA 1N4VA 3D8XA 4BJZA 1XHCA 3B3RA 3UOVA 1VG9A 4JN9A 2R4JA 4I59A 1ZP0A 4A5LA 5KXJA 2GVCA 3AD9B 3LXDA 3AE5A 4NZHA 3QFAA 3AWIA 4OPIA 2ZZCA 3AEBA 2YLZA 2Q7VA 4H4XA 4Z2RA 5M0ZA 4Z24A 3DJDA 4APNA 2XLPA 2B9XA 4OPUA 4J33A 3AEEA 5EB5A 4BK2A 4II2A 3V3OA 1K0LA 4A6NB 4Z2UA 1CC2A 1D7LA 2H89A 1ZMCA 1GRGA 1XPQA 4JDRA 4NTCA 5KMRA 1IUUA 2YG4A 2Y6RA 2XVEA 1GRFA 2XYOA 3K7QX 1IUXA 2WOWA 5JCIA 2YG7A 3LZXA 4CY8A 1PJ7A 2GR1A 1VRQB 3L8KA 2WEUA 1LTXR 4EMJA 2OLNA 4H4WA 4CCRA 2C64A 3UP5A 4GF7A 1O95A 4YSZA 3FIMB 4OPCA 2R45A 2NVKX 3T2YA 4U2TA 4Y4NA 3P4SA 3AYIA 3O0HA 3BNUA 4ZN0A 1UKVG 1B5QA 5JCMA 2YVFA 2XVIA 3NLCA 2F5ZA 1JRYA 4RG4A 3AECA 4GDPA 4GR1A 2R0PA 3GRSA 4HB9A 2WPEA 2XLSA 1EL9A 1KSSA 2YLRA 4TLZA 4C77A 5HY5A 5JCKA 2C7GA 5FS6A 4YXDA 2DKIA 5CQFA 2JB2A 3KA7A 4DGKA 1LJ1A 3L1RA 3Q6JA 4K5RA 3HYVA 4U8JA 2WPCA 5BRTA 4REKA 4IVOB 3RP8A 3T31A 2X8CA 1L9CA 2RABA 2R0CA 3VR8A 5KMPA 1BKWA 4NEVA 2PHHA 3GSIA 3CNJA 3DJJA 4GCMA 3D1CA 3T14A 1CC4A 4C3YA 2XVHA 3CNSA 1IUWA 2AQJA 2JKCA 4GRTA 1F8WA 4EQSA 5M10A 1DOCA 1Z6LA 1OJTA 2OAMA 3B6DA 2WP9A 4K2XA 1GTHA 3QVPA 3AEFA 1GRBA 2YQUA 4CCQA 1DOEA 2WDQA 2VRMA 4EMWA 3OC4A 2C76A 3QFBA 4G6GA 2R46A 2APGA 4LU6A 4JY2A 2XFQA 5JCNA 4EMIA 1MO9A 4A65A 1EL8A 3LADA 3ALJA 1NAAA 1TDNA 1IUSA 5HXIA 2FBWA 2V60A 3T37A 3CPIG 3NG7X 1YQZA 3FPZA 4BK3A 2YR5A 4Y4LA 2Z5YA 5EOWA 1Y56A 3NHOX 4EIQA 4U8IA 2IVEA 3P4QA 4XWZA 4DSGA 2B7RA 1S3EA 4CNJA 3FG2P 2GQFA 2GMHA 3ATRA 4TLXA 1TDFA 4IA6A 1LVLA 2JAEA 3KPKA 3AE6A 4H4VA 1L9DA 1CBOA 4H4YA 1F6MA 3AEGA 1D7YA 4OVIA 4GAVA 3AYJA 2X3NA 1H86A 3K30A 4EQWA 4IV9A 2FJEA 4YSXA 4D03A 5GSNA 2WHDA 1YY5A 2BS4A 1D5TA 2FJBA 3EPTA 3IHGA 3SZFA 4JQ9A 1F3PA 3SXIA 1KNPA 1LQTA 2R0GA 3P4PA 4YTPA 1FL2A 1JEHA 3NK0X 2GR3A 1B8SA 1CC6A 1BWCA 3AE4A 3DGZA 1BZLA 3UKAA 3VRBA 1PXAA 2Z5XA 3GYXA 1NG4A 1KNRA 3PVCA 4JNAA 5HHFA 4K7ZA 2RGJA 5BUKA 4I58A 2BCGG 1PBFA 3G5QA 3PS9A 3UTHA 1VDCA 2GRTA 2ARDA 2R4EA 4LA1A 3UP4A 1PBCA 4YTMA 2VQBA 3IHMA 4YSYA 3KU9A 3ABVA 3NGCX 1JRXA 3I6DA 3CPJG 3NIXA 1H83A 1H82A 2WESA 3BI4A 2WDVA 4DSHA 1FECA 3V76A 1E7PA 1P2HA 4UP3A 4AOSA 3UTGA 4USRA 4H2RA 4TM0A 4ADWA 4H4SA 1YKJA 1DJNA 4AT2A 1FCDA 3ALMA 4KX6A 1KDGA 2E5VA 2TPRA 2A8XA 2YLSA 4O5UA 3UOZA 3CNPA 4XXGA 4H4PA 2C4CA 2C73A 5IQ1A 3T2KA 3GYIA 3AE1A 1X31B 4X9MA 3S5WA 2VVLA 2JBVA 1PJ5A 3AD7B 3NYEA 3UKFA 1KSUA 3K7TA 2YG6A 5HYMA 1GRAA 2ACZA 4J36A 2RGOA 2VVMA 4UDQA 4C5OA 1H81A 3AB1A 5KMQA 3UCLA 3UKQA 4AP1A 3GRTA 2C3CA 4RSLA 1O94A 2XFNA 2CULA 3GD4A 1ELIA 4C74A 2BA9A 2X50A 1P2EA 4J56A 2W0HA 3SGLA 2PYXA 3LOVA 4G6HA 4U8KA 2EQ6A 3P1WA 1K0IA 1KFYA 1LPFA 1XANA 2BS2A 3H8LA 1HYUA 4X4JA 2B7SA 3SFEA 2RGHA 2WBAA 3LZWA 3DGHA 4BURA 3C4NA 3EF6A 1GT8A 2Q6UA 2QA2A 2JB3A 3ZYXA 3GMBA 1GSNA 4B69A 4A79A 4Z43A 4ZCCA 2XCGA 1QO8A 2C3DA 3DJEA 3CN8A 1RSGA 2C66A 4U8MA 2EQ8A 3UKKA 2C72A 2JB1A 4U2SA 5JCLA 1E1MA 2C67A 5IPYA 5U63A 1GERA 4H2NA 5EBKA 1AOGA 4NEWA 2GR2A 4B66A 1H6VA 1GESA 3NH3X 1VG0A 1PDHA 2E4GA 3IC9A 2AAQA 5ER0A 2BC1A 3M0OA 1OJCA 5CKUA 3REDA 1OJDA 1H7XA 3C96A 3S61A 2VVLG 1K0JA 2BXSA 4H7UA 3SQPA 5DBJA 5KVHA 4C3XA 2VRLA 1BGNA 2YVJA 2GMJA 4JNQA 3AEDA 3COXA 4U8OA 3RP7A 3DK8A 2YG5A 2YM2A 2QCUA 2BK4A 1PBBA 4HA6A 3GWFA 3NTAA 3BHKA 4E0VA 4B68A 3G5SA 1GALA 1PBEA 1GPEA 2XLRA 3CIRA 4JY3A 3KLJA 1CHUA 4N9XA 1IJHA 3GD3A 1CL0A 2VOUA 1NEKA 2BS3A 1V59A 2E1MA 1ZOYA 2WOVA 2GB0A 4RG3A 1IUTA 1H84A 1NHQA 1Q9IA 2V3BA 3ITJA 5EB4A 3RHAA 3SZ0A 2DKHA 4B1BA 3BHFA 3V3NA 4FX9A 1SEZA 2TMDA 4OPTA 2GEWA 3GDPA 1ZY8A 1PS9A 4PAAA 1H7WA 4EM3A 5TR3A 1D4CA 3AD8B 4DNAA 3LB8A 4NWZA 3DK9A 1CJ4A 1JOAA 4H4QA 1CJCA 1JU2A 1RYIA 1REOA 4OPDA 3PO7A 1PHHA 4Z26A 1E1KA 5FMHA 4YSHA 4J34A 4OPLA 2V3AA 1TYPA 4U8NA 2WETA 4GDEA 1DOBA 3KPFA 5C2TA 3G5RA 4M52A 3CNDA 3F8DA 4P9SA 4B65A 4UDRA 3UTFA 3GWDA 4EIPA 2WP6A 2H88A 3AYLA 5U1OA 3ZDNA 4IVMB 2B9WA 1YQ3A 4X9NA 5BULA 1NHPA 3AXBA 4USQA 5LV9A 1NPXA 1ZDLA 3QSMA 4XWRA 1BGJA 3UKHA 1QJDA 1TDEA 3ICRA 4GUVA 3CGCA 1OJ9A 4WX1A 1FOHA 1NHRA 1NHSA 3BI2A 3HYXA 1E39A 3VRDB 4NTDA 3UKPA 4H4UA 1FEBA 2BK3A 2Y6QA 3BI5A 5KWFA 5KRQA 2R9ZA 3KD9A 3IWAA 5KMSA 1GV4A 4A6NA 5KNLA 2GH5A 3KKJA 2ZBWA 4TM4A 1ZMDA 1S2QA 2V5ZA 3HZLA 2Q0KA 2BRAA 3R9UA 2WPFA 3T0KA 4U8LA 1PBDA 3ICTA 1Q1WA 3NT6A 1ONFA 2WP5A 2CDUA 1LQUA 1E1LA 3Q9TA 2YLWA 3NN6X 4K5SA 1YQ4A 4BK1A 4H4ZA 1GEUA 2IVDA 2J3NA 3H8IA 1DJQA 3M13A 4G74A 1VQWA 3ADAB 1EBDA 2UZZA 1B37A 4AT0A 1L9EA 4G9KA 1JNRA 2XFPA 1GREA 4AP3A 3VQRA 3UTEA 3SX6A 3NKSA 2GQWA 2ZZ0A 3NK1X 2IIDA 2OLOA 3HYWA 2BABA 2OA1A 2JK6A 1JNZA 4YKGA 1O5WA 1ZOVA 3VRAA 2YR4A 1PXBA 2A87A 1MOKA 2BACA 2I0ZA 2YVGA 3T2ZA 1RP0A 1F8RA 4CRTA 1Q1RA 3ISHA 2YWLA 3IF9A 1OJAA 1GOSA 3QVRA 4J57A 4Y4MA 1IUVA 3BNMA 1M6IA 2X99A 1NENA 3JSKA 3NRNA 2WQYA 3OZ2A 1N4UA 2GV8A 4B64A 3DJGX 4H2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WU5 A;  2AR8 A;  2B9Y A;  3AE2 A;  5FS9 A;  1LV0 A;  1W4X A;  2XFO A;  1D4D A;  1N1P A;  3VR9 A;  2BK5 A;  2WU2 A;  2YM1 A;  4FK1 A;  4FK1 C;  4H4R A;  2EQ7 A;  4AOX A;  2FJD A;  2NPX A;  2XLT A;  1S3B A;  1COY A;  2XVJ A;  3RNM A;  1GXF A;  3ALL A;  3C4A A;  2X8H A;  3NYC A;  2WS3 A;  3AE8 A;  4EQR A;  4Z44 A;  5KOX A;  3KVE A;  2QA1 A;  1D4E A;  4A7A A;  4U8P A;  4B63 A;  4D04 A;  1PJ6 A;  3SM8 A;  4A9W A;  3DK4 A;  3NYF A;  2C70 A;  2YR6 A;  1BF3 A;  1GET A;  2BC0 A;  3FMW A;  3QSE A;  1N4W A;  2GAG B;  4OCG A;  2O9Z A;  5L46 A;  5FS7 A;  1DOD A;  4LII A;  4CNK A;  4UDP A;  1ZKQ A;  3DA1 A;  2YLX A;  3AE9 A;  2Q0L A;  5KOW A;  4H50 A;  1CF3 A;  4EM4 A;  3NTD A;  1K4Q A;  3F8R A;  2YLT A;  4KPR A;  2XFU A;  1TRB A;  1ZX9 A;  4J2W A;  2BXR A;  2YG3 A;  5IQ4 A;  3P4R A;  3SFD A;  4NTE A;  3II4 A;  5J60 A;  3F8P A;  5BVA A;  1E1N A;  3AEA A;  2CVJ A;  3ATQ A;  4MJW A;  4WCT A;  1QLB A;  5J7X A;  3UKL A;  3AE7 A;  4CBQ A;  1TDO A;  1GTE A;  2X8G A;  3P9U A;  4EQX A;  2FJA A;  4BJY A;  2XLU A;  2XDO A;  1DXL A;  2WDR A;  4Z2T A;  4A99 A;  4CY6 A;  1GND A;  4YT0 A;  4ECH A;  4Z25 A;  1E6E A;  3UOY A;  1PN0 A;  2OAL A;  3H4K A;  4TM3 A;  3GMC A;  3NK2 X;  1KF6 A;  1ZK7 A;  3AE3 A;  4YWO A;  5GRT A;  3QJ4 A;  2YAU A;  4H4T A;  4J31 A;  4K8D A;  3CPH G;  3RP6 A;  5C3J A;  2GR0 A;  3LJP A;  3K7M X;  2WOI A;  1GRH A;  4ZCD A;  3FBS A;  1TYT A;  2QAE A;  4O5Q A;  5U25 A;  2BCP A;  2GF3 A;  3DH9 A;  3ICS A;  1EL5 A;  3UOX A;  1XDI A;  3GDN A;  2B76 A;  2BYB A;  3E1T A;  4U2L A;  4K22 A;  3NN0 X;  3GYJ A;  3M12 A;  4OPG A;  3WE0 A;  4FDC B;  2CFY A;  2GAH B;  2HQM A;  2ZZB A;  3CTY A;  1TDK A;  2C75 A;  3CGE A;  3EAO A;  1Y56 B;  1GRT A;  2A89 A;  1EL7 A;  5FS8 A;  3QSS A;  1MXT A;  3DME A;  1CJ2 A;  2XVF A;  3I3L A;  5KVI A;  3CGD A;  2V6O A;  2EQ9 A;  1DNC A;  4YKF A;  2VZ2 A;  1B4V A;  1NG3 A;  3EAN A;  1CJ3 A;  1FEA A;  1L0V A;  1M64 A;  2C65 A;  3URH A;  4IA5 A;  2V61 A;  1NDA A;  4B67 A;  4PAB A;  1Y0P A;  4H2Q A;  4YTN A;  1F8S A;  2VQ7 A;  3CNT A;  3NNE A;  4BV6 A;  1JRZ A;  1PXC A;  3CGB A;  4ICY A;  4TM1 A;  1S2Y A;  1N4V A;  3D8X A;  4BJZ A;  1XHC A;  3B3R A;  3UOV A;  1VG9 A;  4JN9 A;  2R4J A;  4I59 A;  1ZP0 A;  4A5L A;  5KXJ A;  2GVC A;  3AD9 B;  3LXD A;  3AE5 A;  4NZH A;  3QFA A;  3AWI A;  4OPI A;  2ZZC A;  3AEB A;  2YLZ A;  2Q7V A;  4H4X A;  4Z2R A;  5M0Z A;  4Z24 A;  3DJD A;  4APN A;  2XLP A;  2B9X A;  4OPU A;  4J33 A;  3AEE A;  5EB5 A;  4BK2 A;  3V3O A;  1K0L A;  4A6N B;  4Z2U A;  1CC2 A;  1D7L A;  2H89 A;  1ZMC A;  1GRG A;  1XPQ A;  4JDR A;  4NTC A;  1IUU A;  2YG4 A;  2Y6R A;  2XVE A;  1GRF A;  2XYO A;  3K7Q X;  1IUX A;  2WOW A;  5JCI A;  2YG7 A;  3LZX A;  4CY8 A;  1PJ7 A;  2GR1 A;  1VRQ B;  3L8K A;  2WEU A;  1LTX R;  4EMJ A;  2OLN A;  4H4W A;  4CCR A;  2C64 A;  3UP5 A;  4GF7 A;  1O95 A;  4YSZ A;  3FIM B;  4OPC A;  2R45 A;  2NVK X;  4U2T A;  4Y4N A;  3P4S A;  3AYI A;  3O0H A;  3BNU A;  4ZN0 A;  1UKV G;  1B5Q A;  5JCM A;  2YVF A;  2XVI A;  3NLC A;  2F5Z A;  1JRY A;  4RG4 A;  3AEC A;  4GDP A;  4GR1 A;  2R0P A;  3GRS A;  4HB9 A;  2WPE A;  2XLS A;  1EL9 A;  1KSS A;  2YLR A;  4TLZ A;  4C77 A;  5HY5 A;  5JCK A;  2C7G A;  5FS6 A;  4YXD A;  2DKI A;  5CQF A;  2JB2 A;  3KA7 A;  4DGK A;  1LJ1 A;  3L1R A;  3Q6J A;  4K5R A;  4U8J A;  5BRT A;  2WPC A;  4REK A;  4IVO B;  3RP8 A;  2X8C A;  1L9C A;  2RAB A;  2R0C A;  3VR8 A;  1BKW A;  4NEV A;  2PHH A;  3GSI A;  3CNJ A;  3DJJ A;  4GCM A;  3D1C A;  4C3Y A;  1CC4 A;  2XVH A;  3CNS A;  1IUW A;  2AQJ A;  2JKC A;  4GRT A;  1F8W A;  4EQS A;  5M10 A;  1DOC A;  1Z6L A;  1OJT A;  2OAM A;  3B6D A;  2WP9 A;  4K2X A;  1GTH A;  3QVP A;  3AEF A;  1GRB A;  2YQU A;  4CCQ A;  1DOE A;  2WDQ A;  2VRM A;  4EMW A;  3OC4 A;  2C76 A;  3QFB A;  2R46 A;  2APG A;  4LU6 A;  4JY2 A;  2XFQ A;  5JCN A;  4EMI A;  1MO9 A;  4A65 A;  1EL8 A;  3LAD A;  3ALJ A;  1NAA A;  1TDN A;  1IUS A;  5HXI A;  2FBW A;  2V60 A;  3T37 A;  3CPI G;  3NG7 X;  1YQZ A;  3FPZ A;  4BK3 A;  2YR5 A;  4Y4L A;  2Z5Y A;  5EOW A;  1Y56 A;  3NHO X;  4EIQ A;  4U8I A;  2IVE A;  3P4Q A;  4XWZ A;  4DSG A;  2B7R A;  1S3E A;  4CNJ A;  3FG2 P;  2GQF A;  2GMH A;  3ATR A;  4TLX A;  1TDF A;  4IA6 A;  1LVL A;  2JAE A;  3AE6 A;  4H4V A;  1L9D A;  1CBO A;  4H4Y A;  1F6M A;  3AEG A;  1D7Y A;  4OVI A;  3AYJ A;  2X3N A;  1H86 A;  3K30 A;  4EQW A;  4IV9 A;  2FJE A;  4YSX A;  4D03 A;  5GSN A;  2WHD A;  1YY5 A;  2BS4 A;  1D5T A;  2FJB A;  3EPT A;  3IHG A;  4JQ9 A;  1F3P A;  1KNP A;  1LQT A;  2R0G A;  3P4P A;  4YTP A;  1FL2 A;  1JEH A;  3NK0 X;  2GR3 A;  1B8S A;  1CC6 A;  1BWC A;  3AE4 A;  3DGZ A;  1BZL A;  3UKA A;  3VRB A;  1PXA A;  2Z5X A;  1NG4 A;  1KNR A;  3PVC A;  4JNA A;  5HHF A;  4K7Z A;  2RGJ A;  5BUK A;  4I58 A;  2BCG G;  1PBF A;  3G5Q A;  3PS9 A;  3UTH A;  1VDC A;  2GRT A;  2ARD A;  2R4E A;  4LA1 A;  3UP4 A;  1PBC A;  4YTM A;  2VQB A;  3IHM A;  4YSY A;  3KU9 A;  3ABV A;  3NGC X;  1JRX A;  3I6D A;  3CPJ G;  3NIX A;  1H83 A;  1H82 A;  2WES A;  3BI4 A;  2WDV A;  4DSH A;  1FEC A;  3V76 A;  1E7P A;  1P2H A;  4UP3 A;  4AOS A;  3UTG A;  4USR A;  4H2R A;  4TM0 A;  4ADW A;  4H4S A;  1YKJ A;  1DJN A;  4AT2 A;  1FCD A;  3ALM A;  4KX6 A;  1KDG A;  2E5V A;  2TPR A;  2A8X A;  2YLS A;  4O5U A;  3UOZ A;  3CNP A;  4XXG A;  4H4P A;  2C73 A;  5IQ1 A;  3GYI A;  3AE1 A;  1X31 B;  4X9M A;  3S5W A;  2VVL A;  2JBV A;  1PJ5 A;  3AD7 B;  3NYE A;  3UKF A;  1KSU A;  3K7T A;  2YG6 A;  5HYM A;  1GRA A;  2ACZ A;  4J36 A;  2RGO A;  2VVM A;  4UDQ A;  4C5O A;  1H81 A;  3AB1 A;  3UCL A;  3UKQ A;  4AP1 A;  3GRT A;  2C3C A;  4RSL A;  1O94 A;  2XFN A;  2CUL A;  3GD4 A;  1ELI A;  4C74 A;  2BA9 A;  2X50 A;  1P2E A;  4J56 A;  2W0H A;  3SGL A;  2PYX A;  3LOV A;  4U8K A;  2EQ6 A;  3P1W A;  1K0I A;  1KFY A;  1LPF A;  1XAN A;  2BS2 A;  3H8L A;  1HYU A;  4X4J A;  2B7S A;  3SFE A;  2RGH A;  2WBA A;  3LZW A;  3DGH A;  4BUR A;  3C4N A;  3EF6 A;  1GT8 A;  2Q6U A;  2QA2 A;  2JB3 A;  3ZYX A;  3GMB A;  1GSN A;  4B69 A;  4A79 A;  4Z43 A;  4ZCC A;  2XCG A;  1QO8 A;  2C3D A;  3DJE A;  3CN8 A;  1RSG A;  2C66 A;  4U8M A;  2EQ8 A;  3UKK A;  2C72 A;  2JB1 A;  4U2S A;  5JCL A;  1E1M A;  2C67 A;  5IPY A;  5U63 A;  1GER A;  4H2N A;  5EBK A;  1AOG A;  4NEW A;  2GR2 A;  4B66 A;  1H6V A;  1GES A;  3NH3 X;  1VG0 A;  1PDH A;  2E4G A;  3IC9 A;  2AAQ A;  5ER0 A;  2BC1 A;  3M0O A;  1OJC A;  5CKU A;  3RED A;  1OJD A;  1H7X A;  3C96 A;  3S61 A;  2VVL G;  1K0J A;  2BXS A;  4H7U A;  3SQP A;  5DBJ A;  5KVH A;  4C3X A;  2VRL A;  1BGN A;  2YVJ A;  2GMJ A;  4JNQ A;  3AED A;  3COX A;  4U8O A;  3RP7 A;  3DK8 A;  2YG5 A;  2YM2 A;  2QCU A;  2BK4 A;  1PBB A;  4HA6 A;  3GWF A;  3NTA A;  3BHK A;  4E0V A;  4B68 A;  3G5S A;  1GAL A;  1PBE A;  1GPE A;  2XLR A;  3CIR A;  4JY3 A;  3KLJ A;  1CHU A;  4N9X A;  1IJH A;  3GD3 A;  1CL0 A;  2VOU A;  1NEK A;  2BS3 A;  1V59 A;  2E1M A;  1ZOY A;  2WOV A;  2GB0 A;  4RG3 A;  1IUT A;  1H84 A;  1NHQ A;  1Q9I A;  2V3B A;  3ITJ A;  5EB4 A;  3RHA A;  4B1B A;  2DKH A;  3BHF A;  3V3N A;  4FX9 A;  1SEZ A;  2TMD A;  4OPT A;  2GEW A;  3GDP A;  1ZY8 A;  1PS9 A;  4PAA A;  1H7W A;  4EM3 A;  5TR3 A;  1D4C A;  3AD8 B;  4DNA A;  3LB8 A;  3DK9 A;  1CJ4 A;  1JOA A;  4H4Q A;  1CJC A;  1JU2 A;  1RYI A;  1REO A;  4OPD A;  3PO7 A;  1PHH A;  4Z26 A;  1E1K A;  5FMH A;  4YSH A;  4J34 A;  4OPL A;  2V3A A;  1TYP A;  4U8N A;  2WET A;  4GDE A;  1DOB A;  3KPF A;  5C2T A;  3G5R A;  4M52 A;  3CND A;  3F8D A;  4P9S A;  4B65 A;  4UDR A;  3UTF A;  3GWD A;  4EIP A;  2WP6 A;  2H88 A;  3AYL A;  5U1O A;  3ZDN A;  4IVM B;  2B9W A;  1YQ3 A;  4X9N A;  5BUL A;  1NHP A;  3AXB A;  4USQ A;  5LV9 A;  1NPX A;  1ZDL A;  3QSM A;  4XWR A;  1BGJ A;  3UKH A;  1QJD A;  1TDE A;  3ICR A;  4GUV A;  3CGC A;  1OJ9 A;  4WX1 A;  1FOH A;  1NHR A;  1NHS A;  3BI2 A;  1E39 A;  3VRD B;  4NTD A;  3UKP A;  4H4U A;  1FEB A;  2BK3 A;  2Y6Q A;  3BI5 A;  5KWF A;  5KRQ A;  2R9Z A;  3KD9 A;  3IWA A;  1GV4 A;  4A6N A;  2GH5 A;  3KKJ A;  2ZBW A;  4TM4 A;  1ZMD A;  1S2Q A;  2V5Z A;  3HZL A;  2Q0K A;  3R9U A;  2WPF A;  4U8L A;  1PBD A;  3ICT A;  1Q1W A;  3NT6 A;  1ONF A;  2WP5 A;  2CDU A;  1LQU A;  1E1L A;  3Q9T A;  2YLW A;  3NN6 X;  4K5S A;  1YQ4 A;  4BK1 A;  4H4Z A;  1GEU A;  2IVD A;  2J3N A;  3H8I A;  1DJQ A;  3M13 A;  1VQW A;  3ADA B;  1EBD A;  2UZZ A;  1B37 A;  4AT0 A;  1L9E A;  1JNR A;  2XFP A;  1GRE A;  4AP3 A;  3VQR A;  3UTE A;  3NKS A;  2GQW A;  2ZZ0 A;  3NK1 X;  2IID A;  2OLO A;  2BAB A;  2OA1 A;  2JK6 A;  1JNZ A;  4YKG A;  1O5W A;  1ZOV A;  3VRA A;  2YR4 A;  1PXB A;  2A87 A;  1MOK A;  2BAC A;  2I0Z A;  2YVG A;  1RP0 A;  1F8R A;  4CRT A;  1Q1R A;  3ISH A;  2YWL A;  3IF9 A;  1OJA A;  1GOS A;  3QVR A;  4J57 A;  4Y4M A;  1IUV A;  3BNM A;  1M6I A;  2X99 A;  1NEN A;  3JSK A;  3NRN A;  2WQY A;  3OZ2 A;  1N4U A;  2GV8 A;  4B64 A;  3DJG X;  4H2P A; 
#chains in the Genus database with same CATH topology
 2WU5 A;  2AR8 A;  2B9Y A;  3AE2 A;  5FS9 A;  1LV0 A;  1W4X A;  2XFO A;  1D4D A;  1N1P A;  3VR9 A;  2BK5 A;  2WU2 A;  2YM1 A;  4FK1 A;  4FK1 C;  4H4R A;  2EQ7 A;  4AOX A;  2FJD A;  2NPX A;  2XLT A;  1S3B A;  1COY A;  2XVJ A;  3RNM A;  1GXF A;  3ALL A;  3C4A A;  2X8H A;  3NYC A;  2WS3 A;  3AE8 A;  4EQR A;  4Z44 A;  5KOX A;  3KVE A;  2QA1 A;  1D4E A;  4A7A A;  4GAP A;  4U8P A;  4B63 A;  4D04 A;  1PJ6 A;  3SM8 A;  4A9W A;  3DK4 A;  3NYF A;  2C70 A;  2YR6 A;  1BF3 A;  1GET A;  2BC0 A;  3FMW A;  3QSE A;  1N4W A;  2GAG B;  4OCG A;  2O9Z A;  5L46 A;  5FS7 A;  1DOD A;  4LII A;  4CNK A;  4UDP A;  1ZKQ A;  3DA1 A;  2YLX A;  3AE9 A;  2Q0L A;  5KOW A;  4H50 A;  1CF3 A;  4EM4 A;  3NTD A;  1K4Q A;  3F8R A;  2YLT A;  4KPR A;  4II3 A;  2XFU A;  1TRB A;  1ZX9 A;  4J2W A;  2BXR A;  2YG3 A;  4NNJ A;  5IQ4 A;  3P4R A;  3SFD A;  4NTE A;  3II4 A;  5J60 A;  3F8P A;  5BVA A;  1E1N A;  3AEA A;  2CVJ A;  3ATQ A;  4MJW A;  4WCT A;  1QLB A;  5J7X A;  3SY4 A;  3AE7 A;  3UKL A;  4CBQ A;  1TDO A;  1GTE A;  2X8G A;  3P9U A;  4EQX A;  2FJA A;  4BJY A;  2XLU A;  2XDO A;  1DXL A;  2WDR A;  4Z2T A;  4A99 A;  4CY6 A;  1GND A;  4YT0 A;  4ECH A;  4Z25 A;  1E6E A;  3UOY A;  1PN0 A;  2OAL A;  3H4K A;  4TM3 A;  3GMC A;  3NK2 X;  1KF6 A;  1ZK7 A;  3AE3 A;  4YWO A;  5GRT A;  3QJ4 A;  2YAU A;  4H4T A;  4J31 A;  4K8D A;  3CPH G;  3RP6 A;  5C3J A;  2GR0 A;  3LJP A;  3K7M X;  2WOI A;  1GRH A;  4ZCD A;  3FBS A;  1TYT A;  2BRY A;  2QAE A;  4O5Q A;  5U25 A;  2BCP A;  2GF3 A;  3DH9 A;  3ICS A;  1EL5 A;  3UOX A;  1XDI A;  3GDN A;  2B76 A;  2BYB A;  3E1T A;  4U2L A;  3CMM A;  4K22 A;  3NN0 X;  3GYJ A;  3M12 A;  3WE0 A;  4OPG A;  4FDC B;  2CFY A;  2GAH B;  2HQM A;  2ZZB A;  3CTY A;  1TDK A;  2C75 A;  3CGE A;  3EAO A;  1Y56 B;  1GRT A;  2A89 A;  1EL7 A;  5FS8 A;  3QSS A;  1MXT A;  3DME A;  1CJ2 A;  2XVF A;  3I3L A;  5KVI A;  3SYI A;  3CGD A;  2V6O A;  2EQ9 A;  1DNC A;  4YKF A;  2VZ2 A;  1B4V A;  1NG3 A;  3EAN A;  1CJ3 A;  1FEA A;  1L0V A;  1M64 A;  2C65 A;  3URH A;  4IA5 A;  2V61 A;  1NDA A;  4B67 A;  4PAB A;  1Y0P A;  4G73 A;  4H2Q A;  4YTN A;  1F8S A;  2VQ7 A;  3CNT A;  3SZC A;  3SZW A;  3NNE A;  4BV6 A;  1JRZ A;  1PXC A;  3CGB A;  4ICY A;  4TM1 A;  1S2Y A;  1N4V A;  3D8X A;  4BJZ A;  1XHC A;  3B3R A;  3UOV A;  1VG9 A;  4JN9 A;  2R4J A;  4I59 A;  1ZP0 A;  4A5L A;  5KXJ A;  2GVC A;  3AD9 B;  3LXD A;  3AE5 A;  4NZH A;  3QFA A;  3AWI A;  4OPI A;  2ZZC A;  3AEB A;  2YLZ A;  2Q7V A;  4H4X A;  4Z2R A;  5M0Z A;  4Z24 A;  3DJD A;  4APN A;  2XLP A;  2B9X A;  4OPU A;  4J33 A;  3AEE A;  5EB5 A;  4BK2 A;  4II2 A;  3V3O A;  1K0L A;  4A6N B;  4Z2U A;  1CC2 A;  1D7L A;  2H89 A;  1ZMC A;  1GRG A;  1XPQ A;  4JDR A;  4NTC A;  5KMR A;  1IUU A;  2YG4 A;  2Y6R A;  2XVE A;  1GRF A;  2XYO A;  3K7Q X;  1IUX A;  2WOW A;  5JCI A;  2YG7 A;  3LZX A;  4CY8 A;  1PJ7 A;  2GR1 A;  1VRQ B;  3L8K A;  2WEU A;  1LTX R;  4EMJ A;  2OLN A;  4H4W A;  4CCR A;  2C64 A;  3UP5 A;  4GF7 A;  1O95 A;  4YSZ A;  3FIM B;  4OPC A;  2R45 A;  2NVK X;  3T2Y A;  4U2T A;  4Y4N A;  3P4S A;  3AYI A;  3O0H A;  3BNU A;  4ZN0 A;  1UKV G;  1B5Q A;  5JCM A;  2YVF A;  2XVI A;  3NLC A;  2F5Z A;  1JRY A;  4RG4 A;  3AEC A;  4GDP A;  4GR1 A;  2R0P A;  3GRS A;  4HB9 A;  2WPE A;  2XLS A;  1EL9 A;  1KSS A;  2YLR A;  4TLZ A;  4C77 A;  5HY5 A;  5JCK A;  2C7G A;  5FS6 A;  4YXD A;  2DKI A;  5CQF A;  2JB2 A;  3KA7 A;  4DGK A;  1LJ1 A;  3L1R A;  3Q6J A;  4K5R A;  3HYV A;  4U8J A;  2WPC A;  5BRT A;  4REK A;  4IVO B;  3RP8 A;  3T31 A;  2X8C A;  1L9C A;  2RAB A;  2R0C A;  3VR8 A;  5KMP A;  1BKW A;  4NEV A;  2PHH A;  3GSI A;  3CNJ A;  3DJJ A;  4GCM A;  3D1C A;  3T14 A;  1CC4 A;  4C3Y A;  2XVH A;  3CNS A;  1IUW A;  2AQJ A;  2JKC A;  4GRT A;  1F8W A;  4EQS A;  5M10 A;  1DOC A;  1Z6L A;  1OJT A;  2OAM A;  3B6D A;  2WP9 A;  4K2X A;  1GTH A;  3QVP A;  3AEF A;  1GRB A;  2YQU A;  4CCQ A;  1DOE A;  2WDQ A;  2VRM A;  4EMW A;  3OC4 A;  2C76 A;  3QFB A;  4G6G A;  2R46 A;  2APG A;  4LU6 A;  4JY2 A;  2XFQ A;  5JCN A;  4EMI A;  1MO9 A;  4A65 A;  1EL8 A;  3LAD A;  3ALJ A;  1NAA A;  1TDN A;  1IUS A;  5HXI A;  2FBW A;  2V60 A;  3T37 A;  3CPI G;  3NG7 X;  1YQZ A;  3FPZ A;  4BK3 A;  2YR5 A;  4Y4L A;  2Z5Y A;  5EOW A;  1Y56 A;  3NHO X;  4EIQ A;  4U8I A;  2IVE A;  3P4Q A;  4XWZ A;  4DSG A;  2B7R A;  1S3E A;  4CNJ A;  3FG2 P;  2GQF A;  2GMH A;  3ATR A;  4TLX A;  1TDF A;  4IA6 A;  1LVL A;  2JAE A;  3KPK A;  3AE6 A;  4H4V A;  1L9D A;  1CBO A;  4H4Y A;  1F6M A;  3AEG A;  1D7Y A;  4OVI A;  4GAV A;  3AYJ A;  2X3N A;  1H86 A;  3K30 A;  4EQW A;  4IV9 A;  2FJE A;  4YSX A;  4D03 A;  5GSN A;  2WHD A;  1YY5 A;  2BS4 A;  1D5T A;  2FJB A;  3EPT A;  3IHG A;  3SZF A;  4JQ9 A;  1F3P A;  3SXI A;  1KNP A;  1LQT A;  2R0G A;  3P4P A;  4YTP A;  1FL2 A;  1JEH A;  3NK0 X;  2GR3 A;  1B8S A;  1CC6 A;  1BWC A;  3AE4 A;  3DGZ A;  1BZL A;  3UKA A;  3VRB A;  1PXA A;  2Z5X A;  3GYX A;  1NG4 A;  1KNR A;  3PVC A;  4JNA A;  5HHF A;  4K7Z A;  2RGJ A;  5BUK A;  4I58 A;  2BCG G;  1PBF A;  3G5Q A;  3PS9 A;  3UTH A;  1VDC A;  2GRT A;  2ARD A;  2R4E A;  4LA1 A;  3UP4 A;  1PBC A;  4YTM A;  2VQB A;  3IHM A;  4YSY A;  3KU9 A;  3ABV A;  3NGC X;  1JRX A;  3I6D A;  3CPJ G;  3NIX A;  1H83 A;  1H82 A;  2WES A;  3BI4 A;  2WDV A;  4DSH A;  1FEC A;  3V76 A;  1E7P A;  1P2H A;  4UP3 A;  4AOS A;  3UTG A;  4USR A;  4H2R A;  4TM0 A;  4ADW A;  4H4S A;  1YKJ A;  1DJN A;  4AT2 A;  1FCD A;  3ALM A;  4KX6 A;  1KDG A;  2E5V A;  2TPR A;  2A8X A;  2YLS A;  4O5U A;  3UOZ A;  3CNP A;  4XXG A;  4H4P A;  2C4C A;  2C73 A;  5IQ1 A;  3T2K A;  3GYI A;  3AE1 A;  1X31 B;  4X9M A;  3S5W A;  2VVL A;  2JBV A;  1PJ5 A;  3AD7 B;  3NYE A;  3UKF A;  1KSU A;  3K7T A;  2YG6 A;  5HYM A;  1GRA A;  2ACZ A;  4J36 A;  2RGO A;  2VVM A;  4UDQ A;  4C5O A;  1H81 A;  3AB1 A;  5KMQ A;  3UCL A;  3UKQ A;  4AP1 A;  3GRT A;  2C3C A;  4RSL A;  1O94 A;  2XFN A;  2CUL A;  3GD4 A;  1ELI A;  4C74 A;  2BA9 A;  2X50 A;  1P2E A;  4J56 A;  2W0H A;  3SGL A;  2PYX A;  3LOV A;  4G6H A;  4U8K A;  2EQ6 A;  3P1W A;  1K0I A;  1KFY A;  1LPF A;  1XAN A;  2BS2 A;  3H8L A;  1HYU A;  4X4J A;  2B7S A;  3SFE A;  2RGH A;  2WBA A;  3LZW A;  3DGH A;  4BUR A;  3C4N A;  3EF6 A;  1GT8 A;  2Q6U A;  2QA2 A;  2JB3 A;  3ZYX A;  3GMB A;  1GSN A;  4B69 A;  4A79 A;  4Z43 A;  4ZCC A;  2XCG A;  1QO8 A;  2C3D A;  3DJE A;  3CN8 A;  1RSG A;  2C66 A;  4U8M A;  2EQ8 A;  3UKK A;  2C72 A;  2JB1 A;  4U2S A;  5JCL A;  1E1M A;  2C67 A;  5IPY A;  5U63 A;  1GER A;  4H2N A;  5EBK A;  1AOG A;  4NEW A;  2GR2 A;  4B66 A;  1H6V A;  1GES A;  3NH3 X;  1VG0 A;  1PDH A;  2E4G A;  3IC9 A;  2AAQ A;  5ER0 A;  2BC1 A;  3M0O A;  1OJC A;  5CKU A;  3RED A;  1OJD A;  1H7X A;  3C96 A;  3S61 A;  2VVL G;  1K0J A;  2BXS A;  4H7U A;  3SQP A;  5DBJ A;  5KVH A;  4C3X A;  2VRL A;  1BGN A;  2YVJ A;  2GMJ A;  4JNQ A;  3AED A;  3COX A;  4U8O A;  3RP7 A;  3DK8 A;  2YG5 A;  2YM2 A;  2QCU A;  2BK4 A;  1PBB A;  4HA6 A;  3GWF A;  3NTA A;  3BHK A;  4E0V A;  4B68 A;  3G5S A;  1GAL A;  1PBE A;  1GPE A;  2XLR A;  3CIR A;  4JY3 A;  3KLJ A;  1CHU A;  4N9X A;  1IJH A;  3GD3 A;  1CL0 A;  2VOU A;  1NEK A;  2BS3 A;  1V59 A;  2E1M A;  1ZOY A;  2WOV A;  2GB0 A;  4RG3 A;  1IUT A;  1H84 A;  1NHQ A;  1Q9I A;  2V3B A;  3ITJ A;  5EB4 A;  3RHA A;  3SZ0 A;  2DKH A;  4B1B A;  3BHF A;  3V3N A;  4FX9 A;  1SEZ A;  2TMD A;  4OPT A;  2GEW A;  3GDP A;  1ZY8 A;  1PS9 A;  4PAA A;  1H7W A;  4EM3 A;  5TR3 A;  1D4C A;  3AD8 B;  4DNA A;  3LB8 A;  4NWZ A;  3DK9 A;  1CJ4 A;  1JOA A;  4H4Q A;  1CJC A;  1JU2 A;  1RYI A;  1REO A;  4OPD A;  3PO7 A;  1PHH A;  4Z26 A;  1E1K A;  5FMH A;  4YSH A;  4J34 A;  4OPL A;  2V3A A;  1TYP A;  4U8N A;  2WET A;  4GDE A;  1DOB A;  3KPF A;  5C2T A;  3G5R A;  4M52 A;  3CND A;  3F8D A;  4P9S A;  4B65 A;  4UDR A;  3UTF A;  3GWD A;  4EIP A;  2WP6 A;  2H88 A;  3AYL A;  5U1O A;  3ZDN A;  4IVM B;  2B9W A;  1YQ3 A;  4X9N A;  5BUL A;  1NHP A;  3AXB A;  4USQ A;  5LV9 A;  1NPX A;  1ZDL A;  3QSM A;  4XWR A;  1BGJ A;  3UKH A;  1QJD A;  1TDE A;  3ICR A;  4GUV A;  3CGC A;  1OJ9 A;  4WX1 A;  1FOH A;  1NHR A;  1NHS A;  3BI2 A;  3HYX A;  1E39 A;  3VRD B;  4NTD A;  3UKP A;  4H4U A;  1FEB A;  2BK3 A;  2Y6Q A;  3BI5 A;  5KWF A;  5KRQ A;  2R9Z A;  3KD9 A;  3IWA A;  5KMS A;  1GV4 A;  4A6N A;  5KNL A;  2GH5 A;  3KKJ A;  2ZBW A;  4TM4 A;  1ZMD A;  1S2Q A;  2V5Z A;  3HZL A;  2Q0K A;  2BRA A;  3R9U A;  2WPF A;  3T0K A;  4U8L A;  1PBD A;  3ICT A;  1Q1W A;  3NT6 A;  1ONF A;  2WP5 A;  2CDU A;  1LQU A;  1E1L A;  3Q9T A;  2YLW A;  3NN6 X;  4K5S A;  1YQ4 A;  4BK1 A;  4H4Z A;  1GEU A;  2IVD A;  2J3N A;  3H8I A;  1DJQ A;  3M13 A;  4G74 A;  1VQW A;  3ADA B;  1EBD A;  2UZZ A;  1B37 A;  4AT0 A;  1L9E A;  4G9K A;  1JNR A;  2XFP A;  1GRE A;  4AP3 A;  3VQR A;  3UTE A;  3SX6 A;  3NKS A;  2GQW A;  2ZZ0 A;  3NK1 X;  2IID A;  2OLO A;  3HYW A;  2BAB A;  2OA1 A;  2JK6 A;  1JNZ A;  4YKG A;  1O5W A;  1ZOV A;  3VRA A;  2YR4 A;  1PXB A;  2A87 A;  2BAC A;  1MOK A;  2I0Z A;  2YVG A;  3T2Z A;  1RP0 A;  1F8R A;  4CRT A;  1Q1R A;  3ISH A;  2YWL A;  3IF9 A;  1OJA A;  1GOS A;  3QVR A;  4J57 A;  4Y4M A;  1IUV A;  3BNM A;  1M6I A;  2X99 A;  1NEN A;  3JSK A;  3NRN A;  2WQY A;  3OZ2 A;  1N4U A;  2GV8 A;  4B64 A;  3DJG X;  4H2P A; 
#chains in the Genus database with same CATH homology
 2WU5 A;  2AR8 A;  2B9Y A;  3AE2 A;  5FS9 A;  1LV0 A;  1W4X A;  2XFO A;  1D4D A;  1N1P A;  3VR9 A;  2BK5 A;  2WU2 A;  2YM1 A;  4FK1 A;  4FK1 C;  4H4R A;  2EQ7 A;  4AOX A;  2FJD A;  2NPX A;  2XLT A;  1S3B A;  1COY A;  2XVJ A;  3RNM A;  1GXF A;  3ALL A;  3C4A A;  2X8H A;  3NYC A;  2WS3 A;  3AE8 A;  4EQR A;  4Z44 A;  5KOX A;  3KVE A;  2QA1 A;  1D4E A;  4A7A A;  4GAP A;  4U8P A;  4B63 A;  4D04 A;  1PJ6 A;  3SM8 A;  4A9W A;  3DK4 A;  3NYF A;  2C70 A;  2YR6 A;  1BF3 A;  1GET A;  2BC0 A;  3FMW A;  3QSE A;  1N4W A;  2GAG B;  4OCG A;  2O9Z A;  5L46 A;  5FS7 A;  1DOD A;  4LII A;  4CNK A;  4UDP A;  1ZKQ A;  3DA1 A;  2YLX A;  3AE9 A;  2Q0L A;  5KOW A;  4H50 A;  1CF3 A;  4EM4 A;  3NTD A;  1K4Q A;  3F8R A;  2YLT A;  4KPR A;  4II3 A;  2XFU A;  1TRB A;  1ZX9 A;  4J2W A;  2BXR A;  2YG3 A;  4NNJ A;  5IQ4 A;  3P4R A;  3SFD A;  4NTE A;  3II4 A;  5J60 A;  3F8P A;  5BVA A;  1E1N A;  3AEA A;  2CVJ A;  3ATQ A;  4MJW A;  4WCT A;  1QLB A;  5J7X A;  3SY4 A;  3AE7 A;  3UKL A;  4CBQ A;  1TDO A;  1GTE A;  2X8G A;  3P9U A;  4EQX A;  2FJA A;  4BJY A;  2XLU A;  2XDO A;  1DXL A;  2WDR A;  4Z2T A;  4A99 A;  4CY6 A;  1GND A;  4YT0 A;  4ECH A;  4Z25 A;  1E6E A;  3UOY A;  1PN0 A;  2OAL A;  3H4K A;  4TM3 A;  3GMC A;  3NK2 X;  1KF6 A;  1ZK7 A;  3AE3 A;  4YWO A;  5GRT A;  3QJ4 A;  2YAU A;  4H4T A;  4J31 A;  4K8D A;  3CPH G;  3RP6 A;  5C3J A;  2GR0 A;  3LJP A;  3K7M X;  2WOI A;  1GRH A;  4ZCD A;  3FBS A;  1TYT A;  2BRY A;  2QAE A;  4O5Q A;  5U25 A;  2BCP A;  2GF3 A;  3DH9 A;  3ICS A;  1EL5 A;  3UOX A;  1XDI A;  3GDN A;  2B76 A;  2BYB A;  3E1T A;  4U2L A;  3CMM A;  4K22 A;  3NN0 X;  3GYJ A;  3M12 A;  4OPG A;  3WE0 A;  4FDC B;  2CFY A;  2GAH B;  2HQM A;  2ZZB A;  3CTY A;  1TDK A;  2C75 A;  3CGE A;  3EAO A;  1Y56 B;  1GRT A;  2A89 A;  1EL7 A;  5FS8 A;  3QSS A;  1MXT A;  3DME A;  1CJ2 A;  2XVF A;  3I3L A;  5KVI A;  3SYI A;  3CGD A;  2V6O A;  2EQ9 A;  1DNC A;  4YKF A;  2VZ2 A;  1B4V A;  1NG3 A;  3EAN A;  1CJ3 A;  1FEA A;  1L0V A;  1M64 A;  2C65 A;  3URH A;  4IA5 A;  2V61 A;  1NDA A;  4B67 A;  4PAB A;  1Y0P A;  4G73 A;  4H2Q A;  4YTN A;  1F8S A;  2VQ7 A;  3CNT A;  3SZC A;  3SZW A;  3NNE A;  4BV6 A;  1JRZ A;  1PXC A;  3CGB A;  4ICY A;  4TM1 A;  1S2Y A;  1N4V A;  3D8X A;  4BJZ A;  1XHC A;  3B3R A;  3UOV A;  1VG9 A;  4JN9 A;  2R4J A;  4I59 A;  1ZP0 A;  4A5L A;  5KXJ A;  2GVC A;  3AD9 B;  3LXD A;  3AE5 A;  4NZH A;  3QFA A;  3AWI A;  4OPI A;  2ZZC A;  3AEB A;  2YLZ A;  2Q7V A;  4H4X A;  4Z2R A;  5M0Z A;  4Z24 A;  3DJD A;  4APN A;  2XLP A;  2B9X A;  4OPU A;  4J33 A;  3AEE A;  5EB5 A;  4BK2 A;  4II2 A;  3V3O A;  1K0L A;  4A6N B;  4Z2U A;  1CC2 A;  1D7L A;  2H89 A;  1ZMC A;  1GRG A;  1XPQ A;  4JDR A;  4NTC A;  5KMR A;  1IUU A;  2YG4 A;  2Y6R A;  2XVE A;  1GRF A;  2XYO A;  3K7Q X;  1IUX A;  2WOW A;  5JCI A;  2YG7 A;  3LZX A;  4CY8 A;  1PJ7 A;  2GR1 A;  1VRQ B;  3L8K A;  2WEU A;  1LTX R;  4EMJ A;  2OLN A;  4H4W A;  4CCR A;  2C64 A;  3UP5 A;  4GF7 A;  1O95 A;  4YSZ A;  3FIM B;  4OPC A;  2R45 A;  2NVK X;  3T2Y A;  4U2T A;  4Y4N A;  3P4S A;  3AYI A;  3O0H A;  3BNU A;  4ZN0 A;  1UKV G;  1B5Q A;  5JCM A;  2YVF A;  2XVI A;  3NLC A;  2F5Z A;  1JRY A;  4RG4 A;  3AEC A;  4GDP A;  4GR1 A;  2R0P A;  3GRS A;  4HB9 A;  2WPE A;  2XLS A;  1EL9 A;  1KSS A;  2YLR A;  4TLZ A;  4C77 A;  5HY5 A;  5JCK A;  2C7G A;  5FS6 A;  4YXD A;  2DKI A;  5CQF A;  2JB2 A;  3KA7 A;  4DGK A;  1LJ1 A;  3L1R A;  3Q6J A;  4K5R A;  3HYV A;  4U8J A;  2WPC A;  5BRT A;  4REK A;  4IVO B;  3RP8 A;  3T31 A;  2X8C A;  1L9C A;  2RAB A;  2R0C A;  3VR8 A;  5KMP A;  1BKW A;  4NEV A;  2PHH A;  3GSI A;  3CNJ A;  3DJJ A;  4GCM A;  3D1C A;  3T14 A;  1CC4 A;  4C3Y A;  2XVH A;  3CNS A;  1IUW A;  2AQJ A;  2JKC A;  4GRT A;  1F8W A;  4EQS A;  5M10 A;  1DOC A;  1Z6L A;  1OJT A;  2OAM A;  3B6D A;  2WP9 A;  4K2X A;  1GTH A;  3QVP A;  3AEF A;  1GRB A;  2YQU A;  4CCQ A;  1DOE A;  2WDQ A;  2VRM A;  4EMW A;  3OC4 A;  2C76 A;  3QFB A;  4G6G A;  2R46 A;  2APG A;  4LU6 A;  4JY2 A;  2XFQ A;  5JCN A;  4EMI A;  1MO9 A;  4A65 A;  1EL8 A;  3LAD A;  3ALJ A;  1NAA A;  1TDN A;  1IUS A;  5HXI A;  2FBW A;  2V60 A;  3T37 A;  3CPI G;  3NG7 X;  1YQZ A;  3FPZ A;  4BK3 A;  2YR5 A;  4Y4L A;  2Z5Y A;  5EOW A;  1Y56 A;  3NHO X;  4EIQ A;  4U8I A;  2IVE A;  3P4Q A;  4XWZ A;  4DSG A;  2B7R A;  1S3E A;  4CNJ A;  3FG2 P;  2GQF A;  2GMH A;  3ATR A;  4TLX A;  1TDF A;  4IA6 A;  1LVL A;  2JAE A;  3KPK A;  3AE6 A;  4H4V A;  1L9D A;  1CBO A;  4H4Y A;  1F6M A;  3AEG A;  1D7Y A;  4OVI A;  4GAV A;  3AYJ A;  2X3N A;  1H86 A;  3K30 A;  4EQW A;  4IV9 A;  2FJE A;  4YSX A;  4D03 A;  5GSN A;  2WHD A;  1YY5 A;  2BS4 A;  1D5T A;  2FJB A;  3EPT A;  3IHG A;  3SZF A;  4JQ9 A;  1F3P A;  3SXI A;  1KNP A;  1LQT A;  2R0G A;  3P4P A;  4YTP A;  1FL2 A;  1JEH A;  3NK0 X;  2GR3 A;  1B8S A;  1CC6 A;  1BWC A;  3AE4 A;  3DGZ A;  1BZL A;  3UKA A;  3VRB A;  1PXA A;  2Z5X A;  3GYX A;  1NG4 A;  1KNR A;  3PVC A;  4JNA A;  5HHF A;  4K7Z A;  2RGJ A;  5BUK A;  4I58 A;  2BCG G;  1PBF A;  3G5Q A;  3PS9 A;  3UTH A;  1VDC A;  2GRT A;  2ARD A;  2R4E A;  4LA1 A;  3UP4 A;  1PBC A;  4YTM A;  2VQB A;  3IHM A;  4YSY A;  3KU9 A;  3ABV A;  3NGC X;  1JRX A;  3I6D A;  3CPJ G;  3NIX A;  1H83 A;  1H82 A;  2WES A;  3BI4 A;  2WDV A;  4DSH A;  1FEC A;  3V76 A;  1E7P A;  1P2H A;  4UP3 A;  4AOS A;  3UTG A;  4USR A;  4H2R A;  4TM0 A;  4ADW A;  4H4S A;  1YKJ A;  1DJN A;  4AT2 A;  1FCD A;  3ALM A;  4KX6 A;  1KDG A;  2E5V A;  2TPR A;  2A8X A;  2YLS A;  4O5U A;  3UOZ A;  3CNP A;  4XXG A;  4H4P A;  2C4C A;  2C73 A;  5IQ1 A;  3T2K A;  3GYI A;  3AE1 A;  1X31 B;  4X9M A;  3S5W A;  2VVL A;  2JBV A;  1PJ5 A;  3AD7 B;  3NYE A;  3UKF A;  1KSU A;  3K7T A;  2YG6 A;  5HYM A;  1GRA A;  2ACZ A;  4J36 A;  2RGO A;  2VVM A;  4UDQ A;  4C5O A;  1H81 A;  3AB1 A;  5KMQ A;  3UCL A;  3UKQ A;  4AP1 A;  3GRT A;  2C3C A;  4RSL A;  1O94 A;  2XFN A;  2CUL A;  3GD4 A;  1ELI A;  4C74 A;  2BA9 A;  2X50 A;  1P2E A;  4J56 A;  2W0H A;  3SGL A;  2PYX A;  3LOV A;  4G6H A;  4U8K A;  2EQ6 A;  3P1W A;  1K0I A;  1KFY A;  1LPF A;  1XAN A;  2BS2 A;  3H8L A;  1HYU A;  4X4J A;  2B7S A;  3SFE A;  2RGH A;  2WBA A;  3LZW A;  3DGH A;  4BUR A;  3C4N A;  3EF6 A;  1GT8 A;  2Q6U A;  2QA2 A;  2JB3 A;  3ZYX A;  3GMB A;  1GSN A;  4B69 A;  4A79 A;  4Z43 A;  4ZCC A;  2XCG A;  1QO8 A;  2C3D A;  3DJE A;  3CN8 A;  1RSG A;  2C66 A;  4U8M A;  2EQ8 A;  3UKK A;  2C72 A;  2JB1 A;  4U2S A;  5JCL A;  1E1M A;  2C67 A;  5IPY A;  5U63 A;  1GER A;  4H2N A;  5EBK A;  1AOG A;  4NEW A;  2GR2 A;  4B66 A;  1H6V A;  1GES A;  3NH3 X;  1VG0 A;  1PDH A;  2E4G A;  3IC9 A;  2AAQ A;  5ER0 A;  2BC1 A;  3M0O A;  1OJC A;  5CKU A;  3RED A;  1OJD A;  1H7X A;  3C96 A;  3S61 A;  2VVL G;  1K0J A;  2BXS A;  4H7U A;  3SQP A;  5DBJ A;  5KVH A;  4C3X A;  2VRL A;  1BGN A;  2YVJ A;  2GMJ A;  4JNQ A;  3AED A;  3COX A;  4U8O A;  3RP7 A;  3DK8 A;  2YG5 A;  2YM2 A;  2QCU A;  2BK4 A;  1PBB A;  4HA6 A;  3GWF A;  3NTA A;  3BHK A;  4E0V A;  4B68 A;  3G5S A;  1GAL A;  1PBE A;  1GPE A;  2XLR A;  3CIR A;  4JY3 A;  3KLJ A;  1CHU A;  4N9X A;  1IJH A;  3GD3 A;  1CL0 A;  2VOU A;  1NEK A;  2BS3 A;  1V59 A;  2E1M A;  1ZOY A;  2WOV A;  2GB0 A;  4RG3 A;  1IUT A;  1H84 A;  1NHQ A;  1Q9I A;  2V3B A;  3ITJ A;  5EB4 A;  3RHA A;  3SZ0 A;  2DKH A;  4B1B A;  3BHF A;  3V3N A;  4FX9 A;  1SEZ A;  2TMD A;  4OPT A;  2GEW A;  3GDP A;  1ZY8 A;  1PS9 A;  4PAA A;  1H7W A;  4EM3 A;  5TR3 A;  1D4C A;  3AD8 B;  4DNA A;  3LB8 A;  4NWZ A;  3DK9 A;  1CJ4 A;  1JOA A;  4H4Q A;  1CJC A;  1JU2 A;  1RYI A;  1REO A;  4OPD A;  3PO7 A;  1PHH A;  4Z26 A;  1E1K A;  5FMH A;  4YSH A;  4J34 A;  4OPL A;  2V3A A;  1TYP A;  4U8N A;  2WET A;  4GDE A;  1DOB A;  3KPF A;  5C2T A;  3G5R A;  4M52 A;  3CND A;  3F8D A;  4P9S A;  4B65 A;  4UDR A;  3UTF A;  3GWD A;  4EIP A;  2WP6 A;  2H88 A;  3AYL A;  5U1O A;  3ZDN A;  4IVM B;  2B9W A;  1YQ3 A;  4X9N A;  5BUL A;  1NHP A;  3AXB A;  4USQ A;  5LV9 A;  1NPX A;  1ZDL A;  3QSM A;  4XWR A;  1BGJ A;  3UKH A;  1QJD A;  1TDE A;  3ICR A;  4GUV A;  3CGC A;  1OJ9 A;  4WX1 A;  1FOH A;  1NHR A;  1NHS A;  3BI2 A;  3HYX A;  1E39 A;  3VRD B;  4NTD A;  3UKP A;  4H4U A;  1FEB A;  2BK3 A;  2Y6Q A;  3BI5 A;  5KWF A;  5KRQ A;  2R9Z A;  3KD9 A;  3IWA A;  5KMS A;  1GV4 A;  4A6N A;  5KNL A;  2GH5 A;  3KKJ A;  2ZBW A;  4TM4 A;  1ZMD A;  1S2Q A;  2V5Z A;  3HZL A;  2Q0K A;  2BRA A;  3R9U A;  2WPF A;  3T0K A;  4U8L A;  1PBD A;  3ICT A;  1Q1W A;  3NT6 A;  1ONF A;  2WP5 A;  2CDU A;  1LQU A;  1E1L A;  3Q9T A;  2YLW A;  3NN6 X;  4K5S A;  1YQ4 A;  4BK1 A;  4H4Z A;  1GEU A;  2IVD A;  2J3N A;  3H8I A;  1DJQ A;  3M13 A;  4G74 A;  1VQW A;  3ADA B;  1EBD A;  2UZZ A;  1B37 A;  4AT0 A;  1L9E A;  4G9K A;  1JNR A;  2XFP A;  1GRE A;  4AP3 A;  3VQR A;  3UTE A;  3SX6 A;  3NKS A;  2GQW A;  2ZZ0 A;  3NK1 X;  2IID A;  2OLO A;  3HYW A;  2BAB A;  2OA1 A;  2JK6 A;  1JNZ A;  4YKG A;  1O5W A;  1ZOV A;  3VRA A;  2YR4 A;  1PXB A;  2A87 A;  1MOK A;  2BAC A;  2I0Z A;  2YVG A;  3T2Z A;  1RP0 A;  1F8R A;  4CRT A;  1Q1R A;  3ISH A;  2YWL A;  3IF9 A;  1OJA A;  1GOS A;  3QVR A;  4J57 A;  4Y4M A;  1IUV A;  3BNM A;  1M6I A;  2X99 A;  1NEN A;  3JSK A;  3NRN A;  2WQY A;  3OZ2 A;  1N4U A;  2GV8 A;  4B64 A;  3DJG X;  4H2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...