1TDOA

L-amino acid oxidae from agkistrodon halys in complex with l-phenylalanine
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complexes with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 166
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdoA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdoA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdoA01
3UKAA 2B7SA 3G5SA 1GSNA 4CRTA 1LJ1A 3QSEA 2XLSA 1KSSA 4GDPA 3F8PA 1O5WA 3KD9A 3URHA 4YSYA 3AE1A 5C3JA 2JAEA 1GESA 1H6VA 2WOIA 3CGBA 3CGEA 1L9EA 4J36A 2WQYA 2J3NA 2QCUA 2CVJA 1VG0A 4OPUA 3RP8A 1GRFA 4YTMA 2XYOA 2PYXA 1LQTA 1QLBA 1D4DA 2VVLG 3LXDA 2V61A 4D03A 4A6NB 3AYLA 4FDCB 4TM0A 5U63A 3SGLA 3VR9A 2CDUA 3RP6A 4C5OA 4NEWA 3UKQA 3NK0X 3LZWA 1P2HA 2JBVA 3EANA 3NYCA 1NAAA 4U8MA 4DNAA 1TYPA 2DKIA 4TM3A 2OLOA 1PJ6A 4AT2A 1CF3A 3ZDNA 3FIMB 2AQJA 3AD8B 3V3OA 5U25A 1BKWA 1VDCA 1E1LA 4Z26A 1JOAA 2EQ9A 3VRDB 3KKJA 1Y56B 4MJWA 3S61A 1O94A 2QA2A 4YSZA 1O95A 4J31A 4H7UA 4H2NA 3DGZA 4H4PA 5J7XA 4J57A 3Q9TA 1N4UA 1IUUA 4B63A 3CIRA 2YWLA 3H8LA 4IA5A 1M64A 3ICSA 2BYBA 4EM3A 5EOWA 1N4WA 3R9UA 2C72A 3REDA 1CJ3A 3GD3A 3RHAA 3SQPA 4UDRA 2Q7VA 4CBQA 4EQXA 5HY5A 1H82A 3NRNA 5EB4A 4FX9A 2XVEA 4EMIA 4BK1A 4ZN0A 2B9YA 1NG3A 3NHOX 1CC4A 4B67A 1NHPA 4A79A 1XDIA 4CCRA 2XFOA 2C73A 2YG6A 1OJTA 2YM1A 4TLXA 4U8OA 3AE7A 4EQRA 2UZZA 1PBFA 1D7LA 4BV6A 4U8JA 5BULA 1REOA 2DKHA 4NZHA 4O5UA 5GSNA 2C65A 3V3NA 1H7WA 4EMJA 2VQBA 2W0HA 2NVKX 5KOWA 4K7ZA 1ZOYA 1F6MA 3PS9A 1BGNA 2NPXA 1NENA 3LOVA 1BZLA 1PBBA 1B8SA 3IF9A 3UKHA 4M52A 2YG3A 1DOCA 3KA7A 3DK8A 3GDNA 3AD9B 2R0CA 4APNA 1ZY8A 1PS9A 2V3AA 3AEAA 1LPFA 1NHSA 1GRGA 4AT0A 4I59A 4ICYA 1RSGA 1JU2A 2R9ZA 2WPCA 4LU6A 1CL0A 3P9UA 1ZK7A 1GEUA 1KFYA 4U2SA 2XVIA 5DBJA 1LQUA 1VG9A 2QAEA 3DK9A 2H89A 2PHHA 1NG4A 1MXTA 1TYTA 3QVPA 2XLTA 2GQWA 4GCMA 1AOGA 2WU5A 1GNDA 2EQ7A 4H4RA 1E1KA 2TPRA 2BACA 3F8RA 4X9MA 2BK5A 1GV4A 4Z43A 3ALMA 2ACZA 2GAGB 5M0ZA 4C74A 2FJAA 3NYEA 3K7MX 2WPEA 4U8KA 3UTFA 1NEKA 1KNRA 1X31B 2B9XA 2C7GA 4IVOB 3FPZA 2AAQA 4CY6A 2GR0A 4H4ZA 4A5LA 1E1NA 4DSHA 3II4A 2XFNA 4JNQA 3UP5A 4OPTA 1EL9A 2VVMA 3VQRA 5FS7A 1FOHA 2GR3A 3AE9A 5FMHA 1SEZA 3LADA 2CULA 2YLRA 4XWZA 5CKUA 4EIPA 3ALLA 2X50A 3BI2A 3L1RA 3G5RA 1YQ4A 3QVRA 4B1BA 4AP1A 5JCLA 4ZCDA 1UKVG 1OJAA 2E5VA 2YLXA 2QA1A 4H4VA 1FCDA 3UKLA 3VRBA 4B65A 3P4RA 2RABA 2VVLA 4P9SA 3GDPA 4TLZA 3SFEA 3UKPA 1DOEA 3AEFA 3CPJG 1IUSA 2V5ZA 1NDAA 1QO8A 1ZKQA 3H8IA 3Q6JA 4OPLA 4TM4A 1NHQA 3K7TA 5JCMA 3FG2P 4BURA 3CNDA 3NIXA 2BXRA 2FJEA 2E4GA 2HQMA 1GRHA 4RG3A 3CGCA 1XPQA 3UCLA 2GF3A 2CFYA 4DSGA 2YR5A 4C3XA 1PDHA 2YQUA 4B66A 3NGCX 4WCTA 4O5QA 3EPTA 3UTHA 1GOSA 4YWOA 4Z25A 4H4YA 1ZDLA 1IJHA 1PBCA 4OPCA 2XLUA 4U8IA 3PVCA 5KWFA 4EMWA 2RGOA 2V6OA 2YR4A 1IUXA 1D5TA 2EQ8A 4FK1C 3SFDA 2BXSA 3BHKA 4HB9A 4DGKA 2V60A 4OVIA 3NH3X 2XFPA 3NK1X 4PAAA 3BNUA 3UKFA 1EL7A 1Q9IA 2WEUA 3CNTA 1ZX9A 5JCKA 4IV9A 1L9CA 3UTGA 3NTDA 4YTPA 5U1OA 2WBAA 2GV8A 4A7AA 3P4SA 4GF7A 2XVJA 4JN9A 4IVMB 1FEAA 2GMJA 3GMBA 2TMDA 2BS3A 2I0ZA 1CJCA 4CNKA 5KRQA 2X8HA 1DNCA 4Z2TA 2WDQA 4GDEA 3B6DA 2R45A 3CNPA 5JCNA 4H4WA 3IWAA 3NG7X 4RG4A 3L8KA 1DODA 2V3BA 4BK3A 1V59A 2YG5A 3RNMA 1IUVA 2IIDA 3CGDA 3BNMA 4NTCA 1CBOA 4NTDA 3K30A 1GRTA 1GTEA 5IQ1A 1LVLA 3DK4A 4GR1A 5J60A 1OJCA 1YQ3A 1E39A 3DJEA 1E6EA 3NNEA 4X9NA 3V76A 4Z2RA 3CPIG 3EF6A 2C76A 3AB1A 4AP3A 4LA1A 1JRXA 1H81A 4E0VA 3AE3A 1K0IA 1D7YA 2BC1A 3I3LA 3H4KA 3M12A 2GQFA 2C70A 4LIIA 1TDFA 2YG7A 2WDRA 2BA9A 3AYJA 5KVHA 4B69A 1TRBA 1D4EA 1B37A 1EL5A 2APGA 2OA1A 3AE4A 3C96A 2GH5A 3D8XA 2Y6RA 4GRTA 3ICRA 3E1TA 1B5QA 4Z24A 1CC2A 2B9WA 4B64A 5C2TA 2F5ZA 3UOZA 2BC0A 3GRSA 3UTEA 4H50A 1S2YA 2OAMA 1F3PA 1IUTA 4NTEA 2XFUA 2Z5YA 2GVCA 1JNRA 1K0LA 1KDGA 2WP6A 2GB0A 2XVHA 3F8DA 1CJ4A 2C3DA 2WETA 3NK2X 2ZZCA 4OPGA 3SM8A 1H86A 2FJBA 4U8PA 4K22A 4FK1A 4H2RA 2WOVA 3D1CA 4OCGA 4A6NA 4YT0A 3UOXA 2BS4A 2WS3A 3CNSA 3CNJA 4ZCCA 4U2TA 4D04A 1H84A 2RGHA 2WESA 3P4QA 4YSXA 3AE6A 1FL2A 2ZZ0A 3VR8A 4A65A 3LB8A 2A8XA 2VOUA 3DGHA 1PXAA 1YKJA 4USQA 2AR8A 4HA6A 3KVEA 3ATQA 4JDRA 3NN0X 3GRTA 4I58A 1ZMDA 3K7QX 3DJGX 1F8WA 1E1MA 2XLPA 1Y56A 2RGJA 3GWFA 3AE5A 4KPRA 1F8SA 1GPEA 1PHHA 3AEGA 3UOYA 1CHUA 2R46A 4YKFA 4UP3A 3T37A 3C4AA 2E1MA 1CJ2A 4H2PA 3ISHA 4Z44A 1OJDA 2JK6A 3UKKA 4WX1A 2C66A 3FMWA 3B3RA 1D4CA 2YM2A 3AEBA 3RP7A 1ZP0A 1JNZA 4CCQA 4A9WA 4YKGA 1BGJA 1CC6A 1W4XA 3NT6A 3I6DA 2XDOA 3C4NA 2JKCA 1NPXA 2YLSA 2ARDA 2FJDA 4OPDA 4YXDA 2JB1A 2XLRA 4BJYA 1E7PA 5BUKA 1JRYA 4TM1A 5GRTA 2BCPA 1Q1RA 5BVAA 4C3YA 1S3EA 3QSSA 2XFQA 3OC4A 4U8NA 4YTNA 4Z2UA 4CY8A 4BJZA 3LJPA 4U8LA 3NKSA 2IVDA 1EBDA 4J34A 3NYFA 1FEBA 2OLNA 3EAOA 4H4SA 2GMHA 4K5SA 1S2QA 1GERA 3AEEA 2GR2A 4CNJA 4USRA 2BCGG 5EBKA 1TDNA 3KPFA 3BI4A 3O0HA 4A99A 2GRTA 4J2WA 1GT8A 1OJ9A 3GWDA 5IPYA 4X4JA 1GXFA 3QSMA 4XWRA 5FS9A 3AYIA 5M10A 5HYMA 2BABA 1TDOA 3DA1A 2VZ2A 3M13A 2Y6QA 3M0OA 5EB5A 3AEDA 4UDPA 2WOWA 3ALJA 4K2XA 2JB2A 4H4XA 4K8DA 1L0VA 2C64A 4JNAA 4PABA 1QJDA 3OZ2A 4EIQA 3DH9A 3GYJA 1VRQB 3CTYA 3ICTA 4H4QA 4OPIA 4N9XA 2YAUA 2H88A 1ZOVA 4H2QA 1B4VA 2WPFA 2OALA 5ER0A 3IC9A 2IVEA 2WP9A 3ATRA 1MOKA 1N1PA 1MO9A 2X3NA 3CN8A 4Y4LA 1LTXR 2R4JA 1XHCA 2Q6UA 1KSUA 4Y4NA 3KU9A 2B76A 4EM4A 2GR1A 2BK3A 1ZMCA 1ONFA 2A89A 2YVFA 3G5QA 2EQ6A 1IUWA 3DMEA 2YLTA 3WE0A 1DOBA 2VRLA 3AXBA 3GYIA 4JQ9A 5HHFA 3ADAB 4Y4MA 3NN6X 2FBWA 3CPHG 2A87A 1Q1WA 2YVGA 3VRAA 2WP5A 1KF6A 1BWCA 1GETA 2GAHB 2C75A 1GALA 1K4QA 1HYUA 3QFAA 2Q0KA 1GTHA 5FS6A 3HZLA 2C67A 3KLJA 1PJ5A 4AOXA 2X99A 3JSKA 1BF3A 4REKA 3COXA 1S3BA 1H83A 4EQWA 1COYA 4RSLA 3IHMA 3IHGA 5L46A 1RYIA 1NHRA 3BI5A 1VQWA 1RP0A 2GEWA 1PXBA 2R0PA 3AD7B 5IQ4A 3P4PA 4H4TA 4IA6A 4NEVA 1PJ7A 2VRMA 2WU2A 2Z5XA 2XVFA 3AECA 1JRZA 1XANA 2BK4A 5CQFA 1KNPA 1M6IA 1DJNA 1H7XA 2Q0LA 4ADWA 5BRTA 2R0GA 5JCIA 1Z6LA 1YQZA 5KXJA 4AOSA 2WHDA 1LV0A 1N4VA 2YVJA 4UDQA 3AWIA 1PBDA 3PO7A 2WDVA 1FECA 4EQSA 4JY3A 2O9ZA 1DJQA 4BK2A 5HXIA 5KOXA 1PXCA 1PBEA 2ZZBA 1K0JA 3DJJA 2C3CA 3NLCA 3GD4A 1L9DA 3LZXA 3UP4A 1TDEA 3ITJA 4U2LA 2ZBWA 2YG4A 4J33A 4KX6A 1GRBA 3ABVA 4GUVA 4C77A 4ECHA 4H4UA 3GMCA 1GRAA 3AE2A 3DJDA 2B7RA 3QJ4A 4JY2A 3P1WA 2BS2A 2JB3A 4K5RA 3S5WA 4B68A 1GREA 1P2EA 1JEHA 1Y0PA 2X8GA 2YR6A 1EL8A 2YLWA 5FS8A 3GSIA 1DXLA 5LV9A 1ELIA 2YLZA 2X8CA 3NTAA 4YSHA 5KVIA 3UOVA 4J56A 3QFBA 4XXGA 2R4EA 3BHFA 5TR3A 1YY5A 2VQ7A 3ZYXA 3AE8A 1F8RA 1PN0A 3FBSA 1TDKA 2XCGA
chains in the Genus database with same CATH superfamily
3UKAA 2B7SA 3G5SA 1GSNA 4CRTA 1LJ1A 3QSEA 2XLSA 1KSSA 4GDPA 3F8PA 1O5WA 4II2A 3KD9A 3URHA 4YSYA 3AE1A 5C3JA 2JAEA 1GESA 1H6VA 2WOIA 3CGBA 3CGEA 1L9EA 4J36A 2WQYA 2J3NA 2QCUA 2CVJA 1VG0A 4OPUA 3RP8A 1GRFA 4YTMA 2XYOA 2PYXA 1LQTA 1QLBA 1D4DA 2VVLG 3LXDA 2V61A 4D03A 4A6NB 3AYLA 2BRAA 4FDCB 4TM0A 5U63A 3SGLA 3VR9A 2CDUA 3RP6A 4C5OA 4NEWA 3UKQA 3NK0X 3LZWA 1P2HA 2JBVA 3EANA 3NYCA 1NAAA 4U8MA 4DNAA 1TYPA 3SZFA 2DKIA 4TM3A 2OLOA 1PJ6A 4AT2A 1CF3A 3ZDNA 3FIMB 2AQJA 3AD8B 3V3OA 5U25A 1BKWA 1VDCA 1E1LA 4Z26A 1JOAA 3T0KA 2EQ9A 5KMQA 3HYWA 3VRDB 3KKJA 1Y56B 3T31A 4MJWA 3S61A 1O94A 2QA2A 4YSZA 1O95A 4J31A 4H7UA 4H2NA 3DGZA 4H4PA 5J7XA 4J57A 3Q9TA 1N4UA 1IUUA 4B63A 3CIRA 3SZCA 2YWLA 3H8LA 4IA5A 1M64A 3ICSA 2BYBA 4EM3A 3HYVA 1N4WA 5EOWA 3R9UA 2C72A 3REDA 1CJ3A 3GD3A 3RHAA 3SQPA 4UDRA 2Q7VA 3SYIA 4CBQA 4EQXA 5HY5A 1H82A 3NRNA 5EB4A 4FX9A 2XVEA 4EMIA 4BK1A 4ZN0A 2B9YA 1NG3A 3NHOX 1CC4A 4B67A 1NHPA 4A79A 1XDIA 4CCRA 2XFOA 2C73A 2YG6A 1OJTA 2YM1A 4TLXA 4U8OA 3AE7A 4G74A 4EQRA 2UZZA 1PBFA 1D7LA 4BV6A 4U8JA 5BULA 1REOA 2DKHA 4NZHA 4O5UA 5GSNA 3SY4A 2C65A 3V3NA 1H7WA 4EMJA 2VQBA 2W0HA 2NVKX 5KOWA 4K7ZA 1ZOYA 1F6MA 3PS9A 1BGNA 2NPXA 1NENA 3LOVA 1BZLA 1PBBA 1B8SA 3IF9A 3UKHA 4M52A 2YG3A 1DOCA 3KA7A 3DK8A 3GDNA 3AD9B 2R0CA 4APNA 1ZY8A 1PS9A 2V3AA 3AEAA 1LPFA 1NHSA 1GRGA 5KNLA 4AT0A 4I59A 4ICYA 1RSGA 1JU2A 2R9ZA 2WPCA 4LU6A 1CL0A 3P9UA 1ZK7A 1GEUA 1KFYA 4U2SA 2XVIA 5DBJA 1LQUA 1VG9A 2QAEA 3DK9A 2H89A 2PHHA 1NG4A 1MXTA 1TYTA 3QVPA 2XLTA 2GQWA 4GCMA 1AOGA 2WU5A 1GNDA 2EQ7A 4H4RA 1E1KA 2TPRA 2BACA 3F8RA 4X9MA 2BK5A 1GV4A 4Z43A 3ALMA 2ACZA 2GAGB 5M0ZA 4C74A 2FJAA 3NYEA 3K7MX 2WPEA 4U8KA 3UTFA 1NEKA 2B9XA 1KNRA 1X31B 2C7GA 4IVOB 3FPZA 2AAQA 4CY6A 2GR0A 4H4ZA 4A5LA 1E1NA 4DSHA 3II4A 2XFNA 4JNQA 3UP5A 4OPTA 1EL9A 2VVMA 3VQRA 5FS7A 1FOHA 2BRYA 2GR3A 3AE9A 5FMHA 1SEZA 3LADA 2CULA 2YLRA 4XWZA 5CKUA 4EIPA 3ALLA 2X50A 3BI2A 3L1RA 3G5RA 1YQ4A 3QVRA 4B1BA 4AP1A 5JCLA 4ZCDA 1UKVG 1OJAA 2E5VA 2YLXA 2QA1A 4H4VA 1FCDA 3UKLA 3VRBA 4B65A 3P4RA 2RABA 2VVLA 4P9SA 3GDPA 4TLZA 3SFEA 3UKPA 1DOEA 3AEFA 3CPJG 1IUSA 2V5ZA 1NDAA 1QO8A 1ZKQA 3H8IA 3Q6JA 4OPLA 4TM4A 3SX6A 1NHQA 3K7TA 5JCMA 3SZ0A 3FG2P 4BURA 3CNDA 3NIXA 2BXRA 2FJEA 2E4GA 2HQMA 1GRHA 4RG3A 3CGCA 1XPQA 3UCLA 2GF3A 2CFYA 4DSGA 2YR5A 4C3XA 1PDHA 2YQUA 4B66A 3NGCX 4WCTA 4O5QA 3EPTA 3UTHA 1GOSA 4YWOA 4Z25A 4H4YA 1ZDLA 1IJHA 1PBCA 4OPCA 2XLUA 4U8IA 3PVCA 5KWFA 4EMWA 2RGOA 2V6OA 2YR4A 1IUXA 1D5TA 2EQ8A 4FK1C 3SFDA 2BXSA 3BHKA 4HB9A 4DGKA 2V60A 4OVIA 3NH3X 2XFPA 3NK1X 2C4CA 4PAAA 3BNUA 3UKFA 1EL7A 1Q9IA 2WEUA 3CNTA 3T2ZA 1ZX9A 5JCKA 4IV9A 1L9CA 3UTGA 3NTDA 4YTPA 5U1OA 2WBAA 2GV8A 4A7AA 3P4SA 4GF7A 2XVJA 4JN9A 4IVMB 1FEAA 2GMJA 3GMBA 2TMDA 2BS3A 2I0ZA 1CJCA 4CNKA 5KRQA 2X8HA 1DNCA 4Z2TA 2WDQA 4GDEA 3B6DA 2R45A 3CNPA 5JCNA 4H4WA 3IWAA 3NG7X 4RG4A 3L8KA 1DODA 2V3BA 4BK3A 1V59A 2YG5A 3RNMA 1IUVA 2IIDA 3CGDA 3BNMA 4NTCA 1CBOA 4NTDA 3K30A 1GRTA 1GTEA 5IQ1A 1LVLA 3DK4A 4GR1A 5J60A 1OJCA 1YQ3A 1E39A 3DJEA 1E6EA 3NNEA 4X9NA 3V76A 3KPKA 4Z2RA 3CPIG 3EF6A 4G6HA 5KMRA 3T2KA 2C76A 3AB1A 4AP3A 4LA1A 1JRXA 1H81A 4E0VA 3AE3A 1K0IA 1D7YA 2BC1A 3I3LA 3H4KA 3M12A 2GQFA 2C70A 4LIIA 1TDFA 2YG7A 2WDRA 2BA9A 3AYJA 5KVHA 4B69A 1TRBA 1D4EA 1B37A 1EL5A 2APGA 4G73A 2OA1A 3AE4A 3C96A 2GH5A 3D8XA 2Y6RA 4GRTA 3ICRA 3E1TA 1B5QA 4Z24A 2B9WA 1CC2A 4B64A 5C2TA 2F5ZA 3UOZA 2BC0A 3GRSA 3UTEA 4H50A 1S2YA 2OAMA 1F3PA 1IUTA 4NTEA 2XFUA 3SZWA 2Z5YA 2GVCA 1JNRA 1K0LA 1KDGA 2WP6A 2GB0A 2XVHA 3F8DA 1CJ4A 2C3DA 2WETA 3NK2X 2ZZCA 4OPGA 3SM8A 1H86A 2FJBA 4U8PA 4K22A 4FK1A 4H2RA 2WOVA 3D1CA 4OCGA 4A6NA 4YT0A 3UOXA 2BS4A 2WS3A 3CNSA 3CNJA 4ZCCA 4U2TA 4D04A 1H84A 2RGHA 2WESA 3P4QA 4YSXA 3AE6A 4NWZA 1FL2A 2ZZ0A 3VR8A 4A65A 3LB8A 2A8XA 2VOUA 3DGHA 3CMMA 1PXAA 1YKJA 4USQA 2AR8A 4HA6A 3KVEA 3ATQA 4JDRA 3NN0X 3GRTA 4I58A 1ZMDA 3K7QX 3DJGX 1F8WA 1E1MA 2XLPA 1Y56A 2RGJA 3GWFA 3AE5A 4KPRA 1F8SA 1GPEA 1PHHA 3AEGA 3UOYA 1CHUA 2R46A 4YKFA 4UP3A 3T14A 3T37A 3C4AA 2E1MA 1CJ2A 4H2PA 3ISHA 4Z44A 1OJDA 2JK6A 3UKKA 4WX1A 2C66A 3FMWA 3B3RA 1D4CA 2YM2A 3AEBA 3RP7A 1ZP0A 1JNZA 4CCQA 4A9WA 4YKGA 1BGJA 1CC6A 1W4XA 3NT6A 3I6DA 2XDOA 3C4NA 2JKCA 1NPXA 2YLSA 2ARDA 2FJDA 4OPDA 4YXDA 2JB1A 2XLRA 4BJYA 1E7PA 5BUKA 1JRYA 4TM1A 5GRTA 2BCPA 1Q1RA 5BVAA 4C3YA 1S3EA 3QSSA 2XFQA 3OC4A 4U8NA 4YTNA 4Z2UA 4CY8A 4GAPA 3LJPA 4BJZA 4U8LA 3NKSA 2IVDA 1EBDA 4J34A 3NYFA 1FEBA 2OLNA 3EAOA 4H4SA 2GMHA 4K5SA 1S2QA 1GERA 3AEEA 2GR2A 4CNJA 4USRA 2BCGG 5EBKA 1TDNA 3KPFA 3BI4A 3O0HA 4A99A 2GRTA 4J2WA 1GT8A 1OJ9A 3GWDA 5IPYA 4X4JA 1GXFA 3QSMA 4XWRA 5FS9A 3AYIA 5M10A 5HYMA 2BABA 1TDOA 3DA1A 2VZ2A 5KMSA 3M13A 2Y6QA 3M0OA 5EB5A 3AEDA 4UDPA 2WOWA 3SXIA 3ALJA 4K2XA 2JB2A 4H4XA 4K8DA 1L0VA 2C64A 4JNAA 4PABA 1QJDA 3OZ2A 4EIQA 3DH9A 3GYJA 1VRQB 3CTYA 3ICTA 4H4QA 4OPIA 4N9XA 2YAUA 2H88A 1ZOVA 4G6GA 1B4VA 4H2QA 2WPFA 2OALA 5ER0A 3IC9A 2IVEA 2WP9A 3ATRA 1MOKA 1N1PA 1MO9A 2X3NA 3CN8A 4Y4LA 1LTXR 2R4JA 1XHCA 3HYXA 5KMPA 2Q6UA 1KSUA 4Y4NA 3KU9A 2B76A 4EM4A 4NNJA 2GR1A 2BK3A 1ZMCA 1ONFA 2A89A 2YVFA 3G5QA 2EQ6A 1IUWA 3DMEA 3WE0A 2YLTA 1DOBA 2VRLA 3AXBA 3GYIA 4JQ9A 5HHFA 3ADAB 4Y4MA 3NN6X 2FBWA 3CPHG 2A87A 1Q1WA 2YVGA 3VRAA 2WP5A 1KF6A 1BWCA 1GETA 2GAHB 2C75A 1GALA 1K4QA 1HYUA 3QFAA 2Q0KA 1GTHA 5FS6A 3GYXA 2C67A 3HZLA 3KLJA 1PJ5A 4AOXA 2X99A 3JSKA 1BF3A 4REKA 3COXA 1S3BA 1H83A 4EQWA 1COYA 4RSLA 3IHMA 3IHGA 5L46A 1RYIA 1NHRA 3BI5A 1VQWA 1RP0A 2GEWA 1PXBA 2R0PA 3AD7B 5IQ4A 3P4PA 4H4TA 4IA6A 4NEVA 1PJ7A 2VRMA 2WU2A 2Z5XA 2XVFA 3AECA 1JRZA 1XANA 2BK4A 5CQFA 1KNPA 1M6IA 1DJNA 1H7XA 2Q0LA 4ADWA 5BRTA 2R0GA 5JCIA 4II3A 1Z6LA 1YQZA 5KXJA 4AOSA 2WHDA 1LV0A 4G9KA 1N4VA 2YVJA 3T2YA 4UDQA 3AWIA 1PBDA 3PO7A 2WDVA 1FECA 4EQSA 4JY3A 2O9ZA 1DJQA 4BK2A 5HXIA 5KOXA 1PXCA 1PBEA 2ZZBA 1K0JA 3DJJA 2C3CA 3NLCA 3GD4A 1L9DA 3LZXA 3UP4A 1TDEA 3ITJA 4U2LA 2ZBWA 2YG4A 4J33A 4KX6A 1GRBA 3ABVA 4GUVA 4C77A 4ECHA 4H4UA 3GMCA 1GRAA 3AE2A 3DJDA 2B7RA 3QJ4A 4JY2A 3P1WA 2BS2A 2JB3A 4K5RA 3S5WA 4B68A 1GREA 1P2EA 1JEHA 1Y0PA 2X8GA 2YR6A 1EL8A 2YLWA 5FS8A 3GSIA 1DXLA 5LV9A 1ELIA 2YLZA 2X8CA 3NTAA 4YSHA 5KVIA 3UOVA 4GAVA 4J56A 3QFBA 4XXGA 2R4EA 3BHFA 5TR3A 1YY5A 2VQ7A 3ZYXA 3AE8A 1F8RA 1PN0A 3FBSA 1TDKA 2XCGA
chains in the Genus database with same CATH topology
3UKAA 2B7SA 3G5SA 1GSNA 4CRTA 1LJ1A 3QSEA 2XLSA 1KSSA 4GDPA 3F8PA 1O5WA 4II2A 3KD9A 3URHA 4YSYA 3AE1A 5C3JA 2JAEA 1GESA 1H6VA 2WOIA 3CGBA 3CGEA 1L9EA 4J36A 2WQYA 2J3NA 2QCUA 2CVJA 1VG0A 4OPUA 3RP8A 1GRFA 4YTMA 2XYOA 2PYXA 1LQTA 1QLBA 1D4DA 2VVLG 3LXDA 2V61A 4D03A 4A6NB 3AYLA 2BRAA 4FDCB 4TM0A 5U63A 3SGLA 3VR9A 2CDUA 3RP6A 4C5OA 4NEWA 3UKQA 3NK0X 3LZWA 1P2HA 2JBVA 3EANA 3NYCA 1NAAA 4U8MA 4DNAA 1TYPA 3SZFA 2DKIA 4TM3A 2OLOA 1PJ6A 4AT2A 1CF3A 3ZDNA 3FIMB 2AQJA 3AD8B 3V3OA 5U25A 1BKWA 1VDCA 1E1LA 4Z26A 1JOAA 3T0KA 2EQ9A 5KMQA 3HYWA 3VRDB 3KKJA 1Y56B 3T31A 4MJWA 3S61A 1O94A 2QA2A 4YSZA 1O95A 4J31A 4H7UA 4H2NA 3DGZA 4H4PA 5J7XA 4J57A 3Q9TA 1N4UA 1IUUA 4B63A 3CIRA 3SZCA 2YWLA 3H8LA 4IA5A 1M64A 3ICSA 2BYBA 4EM3A 3HYVA 1N4WA 5EOWA 3R9UA 2C72A 3REDA 1CJ3A 3GD3A 3RHAA 3SQPA 4UDRA 2Q7VA 3SYIA 4CBQA 4EQXA 5HY5A 1H82A 3NRNA 5EB4A 4FX9A 2XVEA 4EMIA 4BK1A 4ZN0A 2B9YA 1NG3A 3NHOX 1CC4A 4B67A 1NHPA 4A79A 1XDIA 4CCRA 2XFOA 2C73A 2YG6A 1OJTA 2YM1A 4TLXA 4U8OA 3AE7A 4G74A 4EQRA 2UZZA 1PBFA 1D7LA 4BV6A 4U8JA 5BULA 1REOA 2DKHA 4NZHA 4O5UA 5GSNA 3SY4A 2C65A 3V3NA 1H7WA 4EMJA 2VQBA 2W0HA 2NVKX 5KOWA 4K7ZA 1ZOYA 1F6MA 3PS9A 1BGNA 2NPXA 1NENA 3LOVA 1BZLA 1PBBA 1B8SA 3IF9A 3UKHA 4M52A 2YG3A 1DOCA 3KA7A 3DK8A 3GDNA 3AD9B 2R0CA 4APNA 1ZY8A 1PS9A 2V3AA 3AEAA 1LPFA 1NHSA 1GRGA 5KNLA 4AT0A 4I59A 4ICYA 1RSGA 1JU2A 2R9ZA 2WPCA 4LU6A 1CL0A 3P9UA 1ZK7A 1GEUA 1KFYA 4U2SA 2XVIA 5DBJA 1LQUA 1VG9A 2QAEA 3DK9A 2H89A 2PHHA 1NG4A 1MXTA 1TYTA 3QVPA 2XLTA 2GQWA 4GCMA 1AOGA 2WU5A 1GNDA 2EQ7A 4H4RA 1E1KA 2TPRA 2BACA 3F8RA 4X9MA 2BK5A 1GV4A 4Z43A 3ALMA 2ACZA 2GAGB 5M0ZA 4C74A 2FJAA 3NYEA 3K7MX 2WPEA 4U8KA 3UTFA 1NEKA 1KNRA 1X31B 2B9XA 2C7GA 4IVOB 3FPZA 2AAQA 4CY6A 2GR0A 4H4ZA 4A5LA 1E1NA 4DSHA 3II4A 2XFNA 4JNQA 3UP5A 4OPTA 1EL9A 2VVMA 3VQRA 5FS7A 1FOHA 2BRYA 2GR3A 3AE9A 5FMHA 1SEZA 3LADA 2CULA 2YLRA 4XWZA 5CKUA 4EIPA 3ALLA 2X50A 3BI2A 3L1RA 3G5RA 1YQ4A 3QVRA 4B1BA 4AP1A 5JCLA 4ZCDA 1UKVG 1OJAA 2E5VA 2YLXA 2QA1A 4H4VA 1FCDA 3UKLA 3VRBA 4B65A 3P4RA 2RABA 2VVLA 4P9SA 3GDPA 4TLZA 3SFEA 3UKPA 1DOEA 3AEFA 3CPJG 1IUSA 2V5ZA 1NDAA 1QO8A 1ZKQA 3H8IA 3Q6JA 4OPLA 4TM4A 3SX6A 1NHQA 3K7TA 5JCMA 3SZ0A 3FG2P 4BURA 3CNDA 3NIXA 2BXRA 2FJEA 2E4GA 2HQMA 1GRHA 4RG3A 3CGCA 1XPQA 3UCLA 2GF3A 2CFYA 4DSGA 2YR5A 4C3XA 1PDHA 2YQUA 4B66A 3NGCX 4WCTA 4O5QA 3EPTA 3UTHA 1GOSA 4YWOA 4Z25A 4H4YA 1ZDLA 1IJHA 1PBCA 4OPCA 2XLUA 4U8IA 3PVCA 5KWFA 4EMWA 2RGOA 2V6OA 2YR4A 1IUXA 1D5TA 2EQ8A 4FK1C 3SFDA 2BXSA 3BHKA 4HB9A 4DGKA 2V60A 4OVIA 3NH3X 2XFPA 3NK1X 2C4CA 4PAAA 3BNUA 3UKFA 1EL7A 1Q9IA 2WEUA 3CNTA 3T2ZA 1ZX9A 5JCKA 4IV9A 1L9CA 3UTGA 3NTDA 4YTPA 5U1OA 2WBAA 2GV8A 4A7AA 3P4SA 4GF7A 2XVJA 4JN9A 4IVMB 1FEAA 2GMJA 3GMBA 2TMDA 2BS3A 2I0ZA 1CJCA 4CNKA 5KRQA 2X8HA 1DNCA 4Z2TA 2WDQA 4GDEA 3B6DA 2R45A 3CNPA 5JCNA 4H4WA 3IWAA 3NG7X 4RG4A 3L8KA 1DODA 2V3BA 4BK3A 1V59A 2YG5A 3RNMA 1IUVA 2IIDA 3CGDA 3BNMA 4NTCA 1CBOA 4NTDA 3K30A 1GRTA 1GTEA 5IQ1A 1LVLA 3DK4A 4GR1A 5J60A 1OJCA 1YQ3A 1E39A 3DJEA 1E6EA 3NNEA 4X9NA 3V76A 3KPKA 4Z2RA 3CPIG 3EF6A 4G6HA 5KMRA 3T2KA 2C76A 3AB1A 4AP3A 4LA1A 1JRXA 1H81A 4E0VA 3AE3A 1K0IA 1D7YA 2BC1A 3I3LA 3H4KA 3M12A 2GQFA 2C70A 4LIIA 1TDFA 2YG7A 2WDRA 2BA9A 3AYJA 5KVHA 4B69A 1TRBA 1D4EA 1B37A 1EL5A 2APGA 4G73A 2OA1A 3AE4A 3C96A 2GH5A 3D8XA 2Y6RA 4GRTA 3ICRA 3E1TA 1B5QA 4Z24A 1CC2A 2B9WA 4B64A 5C2TA 2F5ZA 3UOZA 2BC0A 3GRSA 3UTEA 4H50A 1S2YA 2OAMA 1F3PA 1IUTA 4NTEA 2XFUA 3SZWA 2Z5YA 2GVCA 1JNRA 1K0LA 1KDGA 2WP6A 2GB0A 2XVHA 3F8DA 1CJ4A 2C3DA 2WETA 3NK2X 2ZZCA 4OPGA 3SM8A 1H86A 2FJBA 4U8PA 4K22A 4FK1A 4H2RA 2WOVA 3D1CA 4OCGA 4A6NA 4YT0A 3UOXA 2BS4A 2WS3A 3CNSA 3CNJA 4ZCCA 4U2TA 4D04A 1H84A 2RGHA 2WESA 3P4QA 4YSXA 3AE6A 4NWZA 1FL2A 2ZZ0A 3VR8A 4A65A 3LB8A 2A8XA 2VOUA 3DGHA 3CMMA 1PXAA 1YKJA 4USQA 2AR8A 4HA6A 3KVEA 3ATQA 4JDRA 3NN0X 3GRTA 4I58A 1ZMDA 3K7QX 3DJGX 1F8WA 1E1MA 2XLPA 1Y56A 2RGJA 3GWFA 3AE5A 4KPRA 1F8SA 1GPEA 1PHHA 3AEGA 3UOYA 1CHUA 2R46A 4YKFA 4UP3A 3T14A 3T37A 3C4AA 2E1MA 1CJ2A 4H2PA 3ISHA 4Z44A 1OJDA 2JK6A 3UKKA 4WX1A 2C66A 3FMWA 3B3RA 1D4CA 2YM2A 3AEBA 3RP7A 1ZP0A 1JNZA 4CCQA 4A9WA 4YKGA 1BGJA 1CC6A 1W4XA 3NT6A 3I6DA 2XDOA 3C4NA 2JKCA 1NPXA 2YLSA 2ARDA 2FJDA 4OPDA 4YXDA 2JB1A 2XLRA 4BJYA 1E7PA 5BUKA 1JRYA 4TM1A 5GRTA 2BCPA 1Q1RA 5BVAA 4C3YA 1S3EA 3QSSA 2XFQA 3OC4A 4U8NA 4YTNA 4Z2UA 4CY8A 4GAPA 3LJPA 4BJZA 4U8LA 3NKSA 2IVDA 1EBDA 4J34A 3NYFA 1FEBA 2OLNA 3EAOA 4H4SA 2GMHA 4K5SA 1S2QA 1GERA 3AEEA 2GR2A 4CNJA 4USRA 2BCGG 5EBKA 1TDNA 3KPFA 3BI4A 3O0HA 4A99A 2GRTA 4J2WA 1GT8A 1OJ9A 3GWDA 5IPYA 4X4JA 1GXFA 3QSMA 4XWRA 5FS9A 3AYIA 5M10A 5HYMA 2BABA 1TDOA 3DA1A 2VZ2A 5KMSA 3M13A 2Y6QA 3M0OA 5EB5A 3AEDA 4UDPA 2WOWA 3SXIA 3ALJA 4K2XA 2JB2A 4H4XA 4K8DA 1L0VA 2C64A 4JNAA 4PABA 1QJDA 3OZ2A 4EIQA 3DH9A 3GYJA 1VRQB 3CTYA 3ICTA 4H4QA 4OPIA 4N9XA 2YAUA 2H88A 1ZOVA 4G6GA 1B4VA 4H2QA 2WPFA 2OALA 5ER0A 3IC9A 2IVEA 2WP9A 3ATRA 1MOKA 1N1PA 1MO9A 2X3NA 3CN8A 4Y4LA 1LTXR 2R4JA 1XHCA 3HYXA 5KMPA 2Q6UA 1KSUA 4Y4NA 3KU9A 2B76A 4EM4A 4NNJA 2GR1A 2BK3A 1ZMCA 1ONFA 2A89A 2YVFA 3G5QA 2EQ6A 1IUWA 3DMEA 2YLTA 3WE0A 1DOBA 2VRLA 3AXBA 3GYIA 4JQ9A 5HHFA 3ADAB 4Y4MA 3NN6X 2FBWA 3CPHG 2A87A 1Q1WA 2YVGA 3VRAA 2WP5A 1KF6A 1BWCA 1GETA 2GAHB 2C75A 1GALA 1K4QA 1HYUA 3QFAA 2Q0KA 1GTHA 5FS6A 3GYXA 2C67A 3HZLA 3KLJA 1PJ5A 4AOXA 2X99A 3JSKA 1BF3A 4REKA 3COXA 1S3BA 1H83A 4EQWA 1COYA 4RSLA 3IHMA 3IHGA 5L46A 1RYIA 1NHRA 3BI5A 1VQWA 1RP0A 2GEWA 1PXBA 2R0PA 3AD7B 5IQ4A 3P4PA 4H4TA 4IA6A 4NEVA 1PJ7A 2VRMA 2WU2A 2Z5XA 2XVFA 3AECA 1JRZA 1XANA 2BK4A 5CQFA 1KNPA 1M6IA 1DJNA 1H7XA 2Q0LA 4ADWA 5BRTA 2R0GA 5JCIA 4II3A 1Z6LA 1YQZA 5KXJA 4AOSA 2WHDA 1LV0A 4G9KA 1N4VA 2YVJA 3T2YA 4UDQA 3AWIA 1PBDA 3PO7A 2WDVA 1FECA 4EQSA 4JY3A 2O9ZA 1DJQA 4BK2A 5HXIA 5KOXA 1PXCA 1PBEA 2ZZBA 1K0JA 3DJJA 2C3CA 3NLCA 3GD4A 1L9DA 3LZXA 3UP4A 1TDEA 3ITJA 4U2LA 2ZBWA 2YG4A 4J33A 4KX6A 1GRBA 3ABVA 4GUVA 4C77A 4ECHA 4H4UA 3GMCA 1GRAA 3AE2A 3DJDA 2B7RA 3QJ4A 4JY2A 3P1WA 2BS2A 2JB3A 4K5RA 3S5WA 4B68A 1GREA 1P2EA 1JEHA 1Y0PA 2X8GA 2YR6A 1EL8A 2YLWA 5FS8A 3GSIA 1DXLA 5LV9A 1ELIA 2YLZA 2X8CA 3NTAA 4YSHA 5KVIA 3UOVA 4GAVA 4J56A 3QFBA 4XXGA 2R4EA 3BHFA 5TR3A 1YY5A 2VQ7A 3ZYXA 3AE8A 1F8RA 1PN0A 3FBSA 1TDKA 2XCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKA A;  2B7S A;  3G5S A;  1GSN A;  4CRT A;  1LJ1 A;  3QSE A;  2XLS A;  1KSS A;  4GDP A;  3F8P A;  1O5W A;  3KD9 A;  3URH A;  4YSY A;  3AE1 A;  5C3J A;  2JAE A;  1GES A;  1H6V A;  2WOI A;  3CGB A;  3CGE A;  1L9E A;  4J36 A;  2WQY A;  2J3N A;  2QCU A;  2CVJ A;  1VG0 A;  4OPU A;  3RP8 A;  1GRF A;  4YTM A;  2XYO A;  2PYX A;  1LQT A;  1QLB A;  1D4D A;  2VVL G;  3LXD A;  2V61 A;  4D03 A;  4A6N B;  3AYL A;  4FDC B;  4TM0 A;  5U63 A;  3SGL A;  3VR9 A;  2CDU A;  3RP6 A;  4C5O A;  4NEW A;  3UKQ A;  3NK0 X;  3LZW A;  1P2H A;  2JBV A;  3EAN A;  3NYC A;  1NAA A;  4U8M A;  4DNA A;  1TYP A;  2DKI A;  4TM3 A;  2OLO A;  1PJ6 A;  4AT2 A;  1CF3 A;  3ZDN A;  3FIM B;  2AQJ A;  3AD8 B;  3V3O A;  5U25 A;  1BKW A;  1VDC A;  1E1L A;  4Z26 A;  1JOA A;  2EQ9 A;  3VRD B;  3KKJ A;  1Y56 B;  4MJW A;  3S61 A;  1O94 A;  2QA2 A;  4YSZ A;  1O95 A;  4J31 A;  4H7U A;  4H2N A;  3DGZ A;  4H4P A;  5J7X A;  4J57 A;  3Q9T A;  1N4U A;  1IUU A;  4B63 A;  3CIR A;  2YWL A;  3H8L A;  4IA5 A;  1M64 A;  3ICS A;  2BYB A;  4EM3 A;  5EOW A;  1N4W A;  3R9U A;  2C72 A;  3RED A;  1CJ3 A;  3GD3 A;  3RHA A;  3SQP A;  4UDR A;  2Q7V A;  4CBQ A;  4EQX A;  5HY5 A;  1H82 A;  3NRN A;  5EB4 A;  4FX9 A;  2XVE A;  4EMI A;  4BK1 A;  4ZN0 A;  2B9Y A;  1NG3 A;  3NHO X;  1CC4 A;  4B67 A;  1NHP A;  4A79 A;  1XDI A;  4CCR A;  2XFO A;  2C73 A;  2YG6 A;  1OJT A;  2YM1 A;  4TLX A;  4U8O A;  3AE7 A;  4EQR A;  2UZZ A;  1PBF A;  1D7L A;  4BV6 A;  4U8J A;  5BUL A;  1REO A;  2DKH A;  4NZH A;  4O5U A;  5GSN A;  2C65 A;  3V3N A;  1H7W A;  4EMJ A;  2VQB A;  2W0H A;  2NVK X;  5KOW A;  4K7Z A;  1ZOY A;  1F6M A;  3PS9 A;  1BGN A;  2NPX A;  1NEN A;  3LOV A;  1BZL A;  1PBB A;  1B8S A;  3IF9 A;  3UKH A;  4M52 A;  2YG3 A;  1DOC A;  3KA7 A;  3DK8 A;  3GDN A;  3AD9 B;  2R0C A;  4APN A;  1ZY8 A;  1PS9 A;  2V3A A;  3AEA A;  1LPF A;  1NHS A;  1GRG A;  4AT0 A;  4I59 A;  4ICY A;  1RSG A;  1JU2 A;  2R9Z A;  2WPC A;  4LU6 A;  1CL0 A;  3P9U A;  1ZK7 A;  1GEU A;  1KFY A;  4U2S A;  2XVI A;  5DBJ A;  1LQU A;  1VG9 A;  2QAE A;  3DK9 A;  2H89 A;  2PHH A;  1NG4 A;  1MXT A;  1TYT A;  3QVP A;  2XLT A;  2GQW A;  4GCM A;  1AOG A;  2WU5 A;  1GND A;  2EQ7 A;  4H4R A;  1E1K A;  2TPR A;  2BAC A;  3F8R A;  4X9M A;  2BK5 A;  1GV4 A;  4Z43 A;  3ALM A;  2ACZ A;  2GAG B;  5M0Z A;  4C74 A;  2FJA A;  3NYE A;  3K7M X;  2WPE A;  4U8K A;  3UTF A;  1NEK A;  1KNR A;  1X31 B;  2B9X A;  2C7G A;  4IVO B;  3FPZ A;  2AAQ A;  4CY6 A;  2GR0 A;  4H4Z A;  4A5L A;  1E1N A;  4DSH A;  3II4 A;  2XFN A;  4JNQ A;  3UP5 A;  4OPT A;  1EL9 A;  2VVM A;  3VQR A;  5FS7 A;  1FOH A;  2GR3 A;  3AE9 A;  5FMH A;  1SEZ A;  3LAD A;  2CUL A;  2YLR A;  4XWZ A;  5CKU A;  4EIP A;  3ALL A;  2X50 A;  3BI2 A;  3L1R A;  3G5R A;  1YQ4 A;  3QVR A;  4B1B A;  4AP1 A;  5JCL A;  4ZCD A;  1UKV G;  1OJA A;  2E5V A;  2YLX A;  2QA1 A;  4H4V A;  1FCD A;  3UKL A;  3VRB A;  4B65 A;  3P4R A;  2RAB A;  2VVL A;  4P9S A;  3GDP A;  4TLZ A;  3SFE A;  3UKP A;  1DOE A;  3AEF A;  3CPJ G;  1IUS A;  2V5Z A;  1NDA A;  1QO8 A;  1ZKQ A;  3H8I A;  3Q6J A;  4OPL A;  4TM4 A;  1NHQ A;  3K7T A;  5JCM A;  3FG2 P;  4BUR A;  3CND A;  3NIX A;  2BXR A;  2FJE A;  2E4G A;  2HQM A;  1GRH A;  4RG3 A;  3CGC A;  1XPQ A;  3UCL A;  2GF3 A;  2CFY A;  4DSG A;  2YR5 A;  4C3X A;  1PDH A;  2YQU A;  4B66 A;  3NGC X;  4WCT A;  4O5Q A;  3EPT A;  3UTH A;  1GOS A;  4YWO A;  4Z25 A;  4H4Y A;  1ZDL A;  1IJH A;  1PBC A;  4OPC A;  2XLU A;  4U8I A;  3PVC A;  5KWF A;  4EMW A;  2RGO A;  2V6O A;  2YR4 A;  1IUX A;  1D5T A;  2EQ8 A;  4FK1 C;  3SFD A;  2BXS A;  3BHK A;  4HB9 A;  4DGK A;  2V60 A;  4OVI A;  3NH3 X;  2XFP A;  3NK1 X;  4PAA A;  3BNU A;  3UKF A;  1EL7 A;  1Q9I A;  2WEU A;  3CNT A;  1ZX9 A;  5JCK A;  4IV9 A;  1L9C A;  3UTG A;  3NTD A;  4YTP A;  5U1O A;  2WBA A;  2GV8 A;  4A7A A;  3P4S A;  4GF7 A;  2XVJ A;  4JN9 A;  4IVM B;  1FEA A;  2GMJ A;  3GMB A;  2TMD A;  2BS3 A;  2I0Z A;  1CJC A;  4CNK A;  5KRQ A;  2X8H A;  1DNC A;  4Z2T A;  2WDQ A;  4GDE A;  3B6D A;  2R45 A;  3CNP A;  5JCN A;  4H4W A;  3IWA A;  3NG7 X;  4RG4 A;  3L8K A;  1DOD A;  2V3B A;  4BK3 A;  1V59 A;  2YG5 A;  3RNM A;  1IUV A;  2IID A;  3CGD A;  3BNM A;  4NTC A;  1CBO A;  4NTD A;  3K30 A;  1GRT A;  1GTE A;  5IQ1 A;  1LVL A;  3DK4 A;  4GR1 A;  5J60 A;  1OJC A;  1YQ3 A;  1E39 A;  3DJE A;  1E6E A;  3NNE A;  4X9N A;  3V76 A;  4Z2R A;  3CPI G;  3EF6 A;  2C76 A;  3AB1 A;  4AP3 A;  4LA1 A;  1JRX A;  1H81 A;  4E0V A;  3AE3 A;  1K0I A;  1D7Y A;  2BC1 A;  3I3L A;  3H4K A;  3M12 A;  2GQF A;  2C70 A;  4LII A;  1TDF A;  2YG7 A;  2WDR A;  2BA9 A;  3AYJ A;  5KVH A;  4B69 A;  1TRB A;  1D4E A;  1B37 A;  1EL5 A;  2APG A;  2OA1 A;  3AE4 A;  3C96 A;  2GH5 A;  3D8X A;  2Y6R A;  4GRT A;  3ICR A;  3E1T A;  1B5Q A;  4Z24 A;  1CC2 A;  2B9W A;  4B64 A;  5C2T A;  2F5Z A;  3UOZ A;  2BC0 A;  3GRS A;  3UTE A;  4H50 A;  1S2Y A;  2OAM A;  1F3P A;  1IUT A;  4NTE A;  2XFU A;  2Z5Y A;  2GVC A;  1JNR A;  1K0L A;  1KDG A;  2WP6 A;  2GB0 A;  2XVH A;  3F8D A;  1CJ4 A;  2C3D A;  2WET A;  3NK2 X;  2ZZC A;  4OPG A;  3SM8 A;  1H86 A;  2FJB A;  4U8P A;  4K22 A;  4FK1 A;  4H2R A;  2WOV A;  3D1C A;  4OCG A;  4A6N A;  4YT0 A;  3UOX A;  2BS4 A;  2WS3 A;  3CNS A;  3CNJ A;  4ZCC A;  4U2T A;  4D04 A;  1H84 A;  2RGH A;  2WES A;  3P4Q A;  4YSX A;  3AE6 A;  1FL2 A;  2ZZ0 A;  3VR8 A;  4A65 A;  3LB8 A;  2A8X A;  2VOU A;  3DGH A;  1PXA A;  1YKJ A;  4USQ A;  2AR8 A;  4HA6 A;  3KVE A;  3ATQ A;  4JDR A;  3NN0 X;  3GRT A;  4I58 A;  1ZMD A;  3K7Q X;  3DJG X;  1F8W A;  1E1M A;  2XLP A;  1Y56 A;  2RGJ A;  3GWF A;  3AE5 A;  4KPR A;  1F8S A;  1GPE A;  1PHH A;  3AEG A;  3UOY A;  1CHU A;  2R46 A;  4YKF A;  4UP3 A;  3T37 A;  3C4A A;  2E1M A;  1CJ2 A;  4H2P A;  3ISH A;  4Z44 A;  1OJD A;  2JK6 A;  3UKK A;  4WX1 A;  2C66 A;  3FMW A;  3B3R A;  1D4C A;  2YM2 A;  3AEB A;  3RP7 A;  1ZP0 A;  1JNZ A;  4CCQ A;  4A9W A;  4YKG A;  1BGJ A;  1CC6 A;  1W4X A;  3NT6 A;  3I6D A;  2XDO A;  3C4N A;  2JKC A;  1NPX A;  2YLS A;  2ARD A;  2FJD A;  4OPD A;  4YXD A;  2JB1 A;  2XLR A;  4BJY A;  1E7P A;  5BUK A;  1JRY A;  4TM1 A;  5GRT A;  2BCP A;  1Q1R A;  5BVA A;  4C3Y A;  1S3E A;  3QSS A;  2XFQ A;  3OC4 A;  4U8N A;  4YTN A;  4Z2U A;  4CY8 A;  4BJZ A;  3LJP A;  4U8L A;  3NKS A;  2IVD A;  1EBD A;  4J34 A;  3NYF A;  1FEB A;  2OLN A;  3EAO A;  4H4S A;  2GMH A;  4K5S A;  1S2Q A;  1GER A;  3AEE A;  2GR2 A;  4CNJ A;  4USR A;  2BCG G;  5EBK A;  1TDN A;  3KPF A;  3BI4 A;  3O0H A;  4A99 A;  2GRT A;  4J2W A;  1GT8 A;  1OJ9 A;  3GWD A;  5IPY A;  4X4J A;  1GXF A;  3QSM A;  4XWR A;  5FS9 A;  3AYI A;  5M10 A;  5HYM A;  2BAB A;  1TDO A;  3DA1 A;  2VZ2 A;  3M13 A;  2Y6Q A;  3M0O A;  5EB5 A;  3AED A;  4UDP A;  2WOW A;  3ALJ A;  4K2X A;  2JB2 A;  4H4X A;  4K8D A;  1L0V A;  2C64 A;  4JNA A;  4PAB A;  1QJD A;  3OZ2 A;  4EIQ A;  3DH9 A;  3GYJ A;  1VRQ B;  3CTY A;  3ICT A;  4H4Q A;  4OPI A;  4N9X A;  2YAU A;  2H88 A;  1ZOV A;  4H2Q A;  1B4V A;  2WPF A;  2OAL A;  5ER0 A;  3IC9 A;  2IVE A;  2WP9 A;  3ATR A;  1MOK A;  1N1P A;  1MO9 A;  2X3N A;  3CN8 A;  4Y4L A;  1LTX R;  2R4J A;  1XHC A;  2Q6U A;  1KSU A;  4Y4N A;  3KU9 A;  2B76 A;  4EM4 A;  2GR1 A;  2BK3 A;  1ZMC A;  1ONF A;  2A89 A;  2YVF A;  3G5Q A;  2EQ6 A;  1IUW A;  3DME A;  2YLT A;  3WE0 A;  1DOB A;  2VRL A;  3AXB A;  3GYI A;  4JQ9 A;  5HHF A;  3ADA B;  4Y4M A;  3NN6 X;  2FBW A;  3CPH G;  2A87 A;  1Q1W A;  2YVG A;  3VRA A;  2WP5 A;  1KF6 A;  1BWC A;  1GET A;  2GAH B;  2C75 A;  1GAL A;  1K4Q A;  1HYU A;  3QFA A;  2Q0K A;  1GTH A;  5FS6 A;  3HZL A;  2C67 A;  3KLJ A;  1PJ5 A;  4AOX A;  2X99 A;  3JSK A;  1BF3 A;  4REK A;  3COX A;  1S3B A;  1H83 A;  4EQW A;  1COY A;  4RSL A;  3IHM A;  3IHG A;  5L46 A;  1RYI A;  1NHR A;  3BI5 A;  1VQW A;  1RP0 A;  2GEW A;  1PXB A;  2R0P A;  3AD7 B;  5IQ4 A;  3P4P A;  4H4T A;  4IA6 A;  4NEV A;  1PJ7 A;  2VRM A;  2WU2 A;  2Z5X A;  2XVF A;  3AEC A;  1JRZ A;  1XAN A;  2BK4 A;  5CQF A;  1KNP A;  1M6I A;  1DJN A;  1H7X A;  2Q0L A;  4ADW A;  5BRT A;  2R0G A;  5JCI A;  1Z6L A;  1YQZ A;  5KXJ A;  4AOS A;  2WHD A;  1LV0 A;  1N4V A;  2YVJ A;  4UDQ A;  3AWI A;  1PBD A;  3PO7 A;  2WDV A;  1FEC A;  4EQS A;  4JY3 A;  2O9Z A;  1DJQ A;  4BK2 A;  5HXI A;  5KOX A;  1PXC A;  1PBE A;  2ZZB A;  1K0J A;  3DJJ A;  2C3C A;  3NLC A;  3GD4 A;  1L9D A;  3LZX A;  3UP4 A;  1TDE A;  3ITJ A;  4U2L A;  2ZBW A;  2YG4 A;  4J33 A;  4KX6 A;  1GRB A;  3ABV A;  4GUV A;  4C77 A;  4ECH A;  4H4U A;  3GMC A;  1GRA A;  3AE2 A;  3DJD A;  2B7R A;  3QJ4 A;  4JY2 A;  3P1W A;  2BS2 A;  2JB3 A;  4K5R A;  3S5W A;  4B68 A;  1GRE A;  1P2E A;  1JEH A;  1Y0P A;  2X8G A;  2YR6 A;  1EL8 A;  2YLW A;  5FS8 A;  3GSI A;  1DXL A;  5LV9 A;  1ELI A;  2YLZ A;  2X8C A;  3NTA A;  4YSH A;  5KVI A;  3UOV A;  4J56 A;  3QFB A;  4XXG A;  2R4E A;  3BHF A;  5TR3 A;  1YY5 A;  2VQ7 A;  3ZYX A;  3AE8 A;  1F8R A;  1PN0 A;  3FBS A;  1TDK A;  2XCG A; 
#chains in the Genus database with same CATH topology
 3UKA A;  2B7S A;  3G5S A;  1GSN A;  4CRT A;  1LJ1 A;  3QSE A;  2XLS A;  1KSS A;  4GDP A;  3F8P A;  1O5W A;  4II2 A;  3KD9 A;  3URH A;  4YSY A;  3AE1 A;  5C3J A;  2JAE A;  1GES A;  1H6V A;  2WOI A;  3CGB A;  3CGE A;  1L9E A;  4J36 A;  2WQY A;  2J3N A;  2QCU A;  2CVJ A;  1VG0 A;  4OPU A;  3RP8 A;  1GRF A;  4YTM A;  2XYO A;  2PYX A;  1LQT A;  1QLB A;  1D4D A;  2VVL G;  3LXD A;  2V61 A;  4D03 A;  4A6N B;  3AYL A;  2BRA A;  4FDC B;  4TM0 A;  5U63 A;  3SGL A;  3VR9 A;  2CDU A;  3RP6 A;  4C5O A;  4NEW A;  3UKQ A;  3NK0 X;  3LZW A;  1P2H A;  2JBV A;  3EAN A;  3NYC A;  1NAA A;  4U8M A;  4DNA A;  1TYP A;  3SZF A;  2DKI A;  4TM3 A;  2OLO A;  1PJ6 A;  4AT2 A;  1CF3 A;  3ZDN A;  3FIM B;  2AQJ A;  3AD8 B;  3V3O A;  5U25 A;  1BKW A;  1VDC A;  1E1L A;  4Z26 A;  1JOA A;  3T0K A;  2EQ9 A;  5KMQ A;  3HYW A;  3VRD B;  3KKJ A;  1Y56 B;  3T31 A;  4MJW A;  3S61 A;  1O94 A;  2QA2 A;  4YSZ A;  1O95 A;  4J31 A;  4H7U A;  4H2N A;  3DGZ A;  4H4P A;  5J7X A;  4J57 A;  3Q9T A;  1N4U A;  1IUU A;  4B63 A;  3CIR A;  3SZC A;  2YWL A;  3H8L A;  4IA5 A;  1M64 A;  3ICS A;  2BYB A;  4EM3 A;  3HYV A;  1N4W A;  5EOW A;  3R9U A;  2C72 A;  3RED A;  1CJ3 A;  3GD3 A;  3RHA A;  3SQP A;  4UDR A;  2Q7V A;  3SYI A;  4CBQ A;  4EQX A;  5HY5 A;  1H82 A;  3NRN A;  5EB4 A;  4FX9 A;  2XVE A;  4EMI A;  4BK1 A;  4ZN0 A;  2B9Y A;  1NG3 A;  3NHO X;  1CC4 A;  4B67 A;  1NHP A;  4A79 A;  1XDI A;  4CCR A;  2XFO A;  2C73 A;  2YG6 A;  1OJT A;  2YM1 A;  4TLX A;  4U8O A;  3AE7 A;  4G74 A;  4EQR A;  2UZZ A;  1PBF A;  1D7L A;  4BV6 A;  4U8J A;  5BUL A;  1REO A;  2DKH A;  4NZH A;  4O5U A;  5GSN A;  3SY4 A;  2C65 A;  3V3N A;  1H7W A;  4EMJ A;  2VQB A;  2W0H A;  2NVK X;  5KOW A;  4K7Z A;  1ZOY A;  1F6M A;  3PS9 A;  1BGN A;  2NPX A;  1NEN A;  3LOV A;  1BZL A;  1PBB A;  1B8S A;  3IF9 A;  3UKH A;  4M52 A;  2YG3 A;  1DOC A;  3KA7 A;  3DK8 A;  3GDN A;  3AD9 B;  2R0C A;  4APN A;  1ZY8 A;  1PS9 A;  2V3A A;  3AEA A;  1LPF A;  1NHS A;  1GRG A;  5KNL A;  4AT0 A;  4I59 A;  4ICY A;  1RSG A;  1JU2 A;  2R9Z A;  2WPC A;  4LU6 A;  1CL0 A;  3P9U A;  1ZK7 A;  1GEU A;  1KFY A;  4U2S A;  2XVI A;  5DBJ A;  1LQU A;  1VG9 A;  2QAE A;  3DK9 A;  2H89 A;  2PHH A;  1NG4 A;  1MXT A;  1TYT A;  3QVP A;  2XLT A;  2GQW A;  4GCM A;  1AOG A;  2WU5 A;  1GND A;  2EQ7 A;  4H4R A;  1E1K A;  2TPR A;  2BAC A;  3F8R A;  4X9M A;  2BK5 A;  1GV4 A;  4Z43 A;  3ALM A;  2ACZ A;  2GAG B;  5M0Z A;  4C74 A;  2FJA A;  3NYE A;  3K7M X;  2WPE A;  4U8K A;  3UTF A;  1NEK A;  2B9X A;  1KNR A;  1X31 B;  2C7G A;  4IVO B;  3FPZ A;  2AAQ A;  4CY6 A;  2GR0 A;  4H4Z A;  4A5L A;  1E1N A;  4DSH A;  3II4 A;  2XFN A;  4JNQ A;  3UP5 A;  4OPT A;  1EL9 A;  2VVM A;  3VQR A;  5FS7 A;  1FOH A;  2BRY A;  2GR3 A;  3AE9 A;  5FMH A;  1SEZ A;  3LAD A;  2CUL A;  2YLR A;  4XWZ A;  5CKU A;  4EIP A;  3ALL A;  2X50 A;  3BI2 A;  3L1R A;  3G5R A;  1YQ4 A;  3QVR A;  4B1B A;  4AP1 A;  5JCL A;  4ZCD A;  1UKV G;  1OJA A;  2E5V A;  2YLX A;  2QA1 A;  4H4V A;  1FCD A;  3UKL A;  3VRB A;  4B65 A;  3P4R A;  2RAB A;  2VVL A;  4P9S A;  3GDP A;  4TLZ A;  3SFE A;  3UKP A;  1DOE A;  3AEF A;  3CPJ G;  1IUS A;  2V5Z A;  1NDA A;  1QO8 A;  1ZKQ A;  3H8I A;  3Q6J A;  4OPL A;  4TM4 A;  3SX6 A;  1NHQ A;  3K7T A;  5JCM A;  3SZ0 A;  3FG2 P;  4BUR A;  3CND A;  3NIX A;  2BXR A;  2FJE A;  2E4G A;  2HQM A;  1GRH A;  4RG3 A;  3CGC A;  1XPQ A;  3UCL A;  2GF3 A;  2CFY A;  4DSG A;  2YR5 A;  4C3X A;  1PDH A;  2YQU A;  4B66 A;  3NGC X;  4WCT A;  4O5Q A;  3EPT A;  3UTH A;  1GOS A;  4YWO A;  4Z25 A;  4H4Y A;  1ZDL A;  1IJH A;  1PBC A;  4OPC A;  2XLU A;  4U8I A;  3PVC A;  5KWF A;  4EMW A;  2RGO A;  2V6O A;  2YR4 A;  1IUX A;  1D5T A;  2EQ8 A;  4FK1 C;  3SFD A;  2BXS A;  3BHK A;  4HB9 A;  4DGK A;  2V60 A;  4OVI A;  3NH3 X;  2XFP A;  3NK1 X;  2C4C A;  4PAA A;  3BNU A;  3UKF A;  1EL7 A;  1Q9I A;  2WEU A;  3CNT A;  3T2Z A;  1ZX9 A;  5JCK A;  4IV9 A;  1L9C A;  3UTG A;  3NTD A;  4YTP A;  5U1O A;  2WBA A;  2GV8 A;  4A7A A;  3P4S A;  4GF7 A;  2XVJ A;  4JN9 A;  4IVM B;  1FEA A;  2GMJ A;  3GMB A;  2TMD A;  2BS3 A;  2I0Z A;  1CJC A;  4CNK A;  5KRQ A;  2X8H A;  1DNC A;  4Z2T A;  2WDQ A;  4GDE A;  3B6D A;  2R45 A;  3CNP A;  5JCN A;  4H4W A;  3IWA A;  3NG7 X;  4RG4 A;  3L8K A;  1DOD A;  2V3B A;  4BK3 A;  1V59 A;  2YG5 A;  3RNM A;  1IUV A;  2IID A;  3CGD A;  3BNM A;  4NTC A;  1CBO A;  4NTD A;  3K30 A;  1GRT A;  1GTE A;  5IQ1 A;  1LVL A;  3DK4 A;  4GR1 A;  5J60 A;  1OJC A;  1YQ3 A;  1E39 A;  3DJE A;  1E6E A;  3NNE A;  4X9N A;  3V76 A;  3KPK A;  4Z2R A;  3CPI G;  3EF6 A;  4G6H A;  5KMR A;  3T2K A;  2C76 A;  3AB1 A;  4AP3 A;  4LA1 A;  1JRX A;  1H81 A;  4E0V A;  3AE3 A;  1K0I A;  1D7Y A;  2BC1 A;  3I3L A;  3H4K A;  3M12 A;  2GQF A;  2C70 A;  4LII A;  1TDF A;  2YG7 A;  2WDR A;  2BA9 A;  3AYJ A;  5KVH A;  4B69 A;  1TRB A;  1D4E A;  1B37 A;  1EL5 A;  2APG A;  4G73 A;  2OA1 A;  3AE4 A;  3C96 A;  2GH5 A;  3D8X A;  2Y6R A;  4GRT A;  3ICR A;  3E1T A;  1B5Q A;  4Z24 A;  2B9W A;  1CC2 A;  4B64 A;  5C2T A;  2F5Z A;  3UOZ A;  2BC0 A;  3GRS A;  3UTE A;  4H50 A;  1S2Y A;  2OAM A;  1F3P A;  1IUT A;  4NTE A;  2XFU A;  3SZW A;  2Z5Y A;  2GVC A;  1JNR A;  1K0L A;  1KDG A;  2WP6 A;  2GB0 A;  2XVH A;  3F8D A;  1CJ4 A;  2C3D A;  2WET A;  3NK2 X;  2ZZC A;  4OPG A;  3SM8 A;  1H86 A;  2FJB A;  4U8P A;  4K22 A;  4FK1 A;  4H2R A;  2WOV A;  3D1C A;  4OCG A;  4A6N A;  4YT0 A;  3UOX A;  2BS4 A;  2WS3 A;  3CNS A;  3CNJ A;  4ZCC A;  4U2T A;  4D04 A;  1H84 A;  2RGH A;  2WES A;  3P4Q A;  4YSX A;  3AE6 A;  4NWZ A;  1FL2 A;  2ZZ0 A;  3VR8 A;  4A65 A;  3LB8 A;  2A8X A;  2VOU A;  3DGH A;  3CMM A;  1PXA A;  1YKJ A;  4USQ A;  2AR8 A;  4HA6 A;  3KVE A;  3ATQ A;  4JDR A;  3NN0 X;  3GRT A;  4I58 A;  1ZMD A;  3K7Q X;  3DJG X;  1F8W A;  1E1M A;  2XLP A;  1Y56 A;  2RGJ A;  3GWF A;  3AE5 A;  4KPR A;  1F8S A;  1GPE A;  1PHH A;  3AEG A;  3UOY A;  1CHU A;  2R46 A;  4YKF A;  4UP3 A;  3T14 A;  3T37 A;  3C4A A;  2E1M A;  1CJ2 A;  4H2P A;  3ISH A;  4Z44 A;  1OJD A;  2JK6 A;  3UKK A;  4WX1 A;  2C66 A;  3FMW A;  3B3R A;  1D4C A;  2YM2 A;  3AEB A;  3RP7 A;  1ZP0 A;  1JNZ A;  4CCQ A;  4A9W A;  4YKG A;  1BGJ A;  1CC6 A;  1W4X A;  3NT6 A;  3I6D A;  2XDO A;  3C4N A;  2JKC A;  1NPX A;  2YLS A;  2ARD A;  2FJD A;  4OPD A;  4YXD A;  2JB1 A;  2XLR A;  4BJY A;  1E7P A;  5BUK A;  1JRY A;  4TM1 A;  5GRT A;  2BCP A;  1Q1R A;  5BVA A;  4C3Y A;  1S3E A;  3QSS A;  2XFQ A;  3OC4 A;  4U8N A;  4YTN A;  4Z2U A;  4CY8 A;  4GAP A;  3LJP A;  4BJZ A;  4U8L A;  3NKS A;  2IVD A;  1EBD A;  4J34 A;  3NYF A;  1FEB A;  2OLN A;  3EAO A;  4H4S A;  2GMH A;  4K5S A;  1S2Q A;  1GER A;  3AEE A;  2GR2 A;  4CNJ A;  4USR A;  2BCG G;  5EBK A;  1TDN A;  3KPF A;  3BI4 A;  3O0H A;  4A99 A;  2GRT A;  4J2W A;  1GT8 A;  1OJ9 A;  3GWD A;  5IPY A;  4X4J A;  1GXF A;  3QSM A;  4XWR A;  5FS9 A;  3AYI A;  5M10 A;  5HYM A;  2BAB A;  1TDO A;  3DA1 A;  2VZ2 A;  5KMS A;  3M13 A;  2Y6Q A;  3M0O A;  5EB5 A;  3AED A;  4UDP A;  2WOW A;  3SXI A;  3ALJ A;  4K2X A;  2JB2 A;  4H4X A;  4K8D A;  1L0V A;  2C64 A;  4JNA A;  4PAB A;  1QJD A;  3OZ2 A;  4EIQ A;  3DH9 A;  3GYJ A;  1VRQ B;  3CTY A;  3ICT A;  4H4Q A;  4OPI A;  4N9X A;  2YAU A;  2H88 A;  1ZOV A;  4G6G A;  1B4V A;  4H2Q A;  2WPF A;  2OAL A;  5ER0 A;  3IC9 A;  2IVE A;  2WP9 A;  3ATR A;  1MOK A;  1N1P A;  1MO9 A;  2X3N A;  3CN8 A;  4Y4L A;  1LTX R;  2R4J A;  1XHC A;  3HYX A;  5KMP A;  2Q6U A;  1KSU A;  4Y4N A;  3KU9 A;  2B76 A;  4EM4 A;  4NNJ A;  2GR1 A;  2BK3 A;  1ZMC A;  1ONF A;  2A89 A;  2YVF A;  3G5Q A;  2EQ6 A;  1IUW A;  3DME A;  3WE0 A;  2YLT A;  1DOB A;  2VRL A;  3AXB A;  3GYI A;  4JQ9 A;  5HHF A;  3ADA B;  4Y4M A;  3NN6 X;  2FBW A;  3CPH G;  2A87 A;  1Q1W A;  2YVG A;  3VRA A;  2WP5 A;  1KF6 A;  1BWC A;  1GET A;  2GAH B;  2C75 A;  1GAL A;  1K4Q A;  1HYU A;  3QFA A;  2Q0K A;  1GTH A;  5FS6 A;  3GYX A;  2C67 A;  3HZL A;  3KLJ A;  1PJ5 A;  4AOX A;  2X99 A;  3JSK A;  1BF3 A;  4REK A;  3COX A;  1S3B A;  1H83 A;  4EQW A;  1COY A;  4RSL A;  3IHM A;  3IHG A;  5L46 A;  1RYI A;  1NHR A;  3BI5 A;  1VQW A;  1RP0 A;  2GEW A;  1PXB A;  2R0P A;  3AD7 B;  5IQ4 A;  3P4P A;  4H4T A;  4IA6 A;  4NEV A;  1PJ7 A;  2VRM A;  2WU2 A;  2Z5X A;  2XVF A;  3AEC A;  1JRZ A;  1XAN A;  2BK4 A;  5CQF A;  1KNP A;  1M6I A;  1DJN A;  1H7X A;  2Q0L A;  4ADW A;  5BRT A;  2R0G A;  5JCI A;  4II3 A;  1Z6L A;  1YQZ A;  5KXJ A;  4AOS A;  2WHD A;  1LV0 A;  4G9K A;  1N4V A;  2YVJ A;  3T2Y A;  4UDQ A;  3AWI A;  1PBD A;  3PO7 A;  2WDV A;  1FEC A;  4EQS A;  4JY3 A;  2O9Z A;  1DJQ A;  4BK2 A;  5HXI A;  5KOX A;  1PXC A;  1PBE A;  2ZZB A;  1K0J A;  3DJJ A;  2C3C A;  3NLC A;  3GD4 A;  1L9D A;  3LZX A;  3UP4 A;  1TDE A;  3ITJ A;  4U2L A;  2ZBW A;  2YG4 A;  4J33 A;  4KX6 A;  1GRB A;  3ABV A;  4GUV A;  4C77 A;  4ECH A;  4H4U A;  3GMC A;  1GRA A;  3AE2 A;  3DJD A;  2B7R A;  3QJ4 A;  4JY2 A;  3P1W A;  2BS2 A;  2JB3 A;  4K5R A;  3S5W A;  4B68 A;  1GRE A;  1P2E A;  1JEH A;  1Y0P A;  2X8G A;  2YR6 A;  1EL8 A;  2YLW A;  5FS8 A;  3GSI A;  1DXL A;  5LV9 A;  1ELI A;  2YLZ A;  2X8C A;  3NTA A;  4YSH A;  5KVI A;  3UOV A;  4GAV A;  4J56 A;  3QFB A;  4XXG A;  2R4E A;  3BHF A;  5TR3 A;  1YY5 A;  2VQ7 A;  3ZYX A;  3AE8 A;  1F8R A;  1PN0 A;  3FBS A;  1TDK A;  2XCG A; 
#chains in the Genus database with same CATH homology
 3UKA A;  2B7S A;  3G5S A;  1GSN A;  4CRT A;  1LJ1 A;  3QSE A;  2XLS A;  1KSS A;  4GDP A;  3F8P A;  1O5W A;  4II2 A;  3KD9 A;  3URH A;  4YSY A;  3AE1 A;  5C3J A;  2JAE A;  1GES A;  1H6V A;  2WOI A;  3CGB A;  3CGE A;  1L9E A;  4J36 A;  2WQY A;  2J3N A;  2QCU A;  2CVJ A;  1VG0 A;  4OPU A;  3RP8 A;  1GRF A;  4YTM A;  2XYO A;  2PYX A;  1LQT A;  1QLB A;  1D4D A;  2VVL G;  3LXD A;  2V61 A;  4D03 A;  4A6N B;  3AYL A;  2BRA A;  4FDC B;  4TM0 A;  5U63 A;  3SGL A;  3VR9 A;  2CDU A;  3RP6 A;  4C5O A;  4NEW A;  3UKQ A;  3NK0 X;  3LZW A;  1P2H A;  2JBV A;  3EAN A;  3NYC A;  1NAA A;  4U8M A;  4DNA A;  1TYP A;  3SZF A;  2DKI A;  4TM3 A;  2OLO A;  1PJ6 A;  4AT2 A;  1CF3 A;  3ZDN A;  3FIM B;  2AQJ A;  3AD8 B;  3V3O A;  5U25 A;  1BKW A;  1VDC A;  1E1L A;  4Z26 A;  1JOA A;  3T0K A;  2EQ9 A;  5KMQ A;  3HYW A;  3VRD B;  3KKJ A;  1Y56 B;  3T31 A;  4MJW A;  3S61 A;  1O94 A;  2QA2 A;  4YSZ A;  1O95 A;  4J31 A;  4H7U A;  4H2N A;  3DGZ A;  4H4P A;  5J7X A;  4J57 A;  3Q9T A;  1N4U A;  1IUU A;  4B63 A;  3CIR A;  3SZC A;  2YWL A;  3H8L A;  4IA5 A;  1M64 A;  3ICS A;  2BYB A;  4EM3 A;  3HYV A;  1N4W A;  5EOW A;  3R9U A;  2C72 A;  3RED A;  1CJ3 A;  3GD3 A;  3RHA A;  3SQP A;  4UDR A;  2Q7V A;  3SYI A;  4CBQ A;  4EQX A;  5HY5 A;  1H82 A;  3NRN A;  5EB4 A;  4FX9 A;  2XVE A;  4EMI A;  4BK1 A;  4ZN0 A;  2B9Y A;  1NG3 A;  3NHO X;  1CC4 A;  4B67 A;  1NHP A;  4A79 A;  1XDI A;  4CCR A;  2XFO A;  2C73 A;  2YG6 A;  1OJT A;  2YM1 A;  4TLX A;  4U8O A;  3AE7 A;  4G74 A;  4EQR A;  2UZZ A;  1PBF A;  1D7L A;  4BV6 A;  4U8J A;  5BUL A;  1REO A;  2DKH A;  4NZH A;  4O5U A;  5GSN A;  3SY4 A;  2C65 A;  3V3N A;  1H7W A;  4EMJ A;  2VQB A;  2W0H A;  2NVK X;  5KOW A;  4K7Z A;  1ZOY A;  1F6M A;  3PS9 A;  1BGN A;  2NPX A;  1NEN A;  3LOV A;  1BZL A;  1PBB A;  1B8S A;  3IF9 A;  3UKH A;  4M52 A;  2YG3 A;  1DOC A;  3KA7 A;  3DK8 A;  3GDN A;  3AD9 B;  2R0C A;  4APN A;  1ZY8 A;  1PS9 A;  2V3A A;  3AEA A;  1LPF A;  1NHS A;  1GRG A;  5KNL A;  4AT0 A;  4I59 A;  4ICY A;  1RSG A;  1JU2 A;  2R9Z A;  2WPC A;  4LU6 A;  1CL0 A;  3P9U A;  1ZK7 A;  1GEU A;  1KFY A;  4U2S A;  2XVI A;  5DBJ A;  1LQU A;  1VG9 A;  2QAE A;  3DK9 A;  2H89 A;  2PHH A;  1NG4 A;  1MXT A;  1TYT A;  3QVP A;  2XLT A;  2GQW A;  4GCM A;  1AOG A;  2WU5 A;  1GND A;  2EQ7 A;  4H4R A;  1E1K A;  2TPR A;  2BAC A;  3F8R A;  4X9M A;  2BK5 A;  1GV4 A;  4Z43 A;  3ALM A;  2ACZ A;  2GAG B;  5M0Z A;  4C74 A;  2FJA A;  3NYE A;  3K7M X;  2WPE A;  4U8K A;  3UTF A;  1NEK A;  1KNR A;  1X31 B;  2B9X A;  2C7G A;  4IVO B;  3FPZ A;  2AAQ A;  4CY6 A;  2GR0 A;  4H4Z A;  4A5L A;  1E1N A;  4DSH A;  3II4 A;  2XFN A;  4JNQ A;  3UP5 A;  4OPT A;  1EL9 A;  2VVM A;  3VQR A;  5FS7 A;  1FOH A;  2BRY A;  2GR3 A;  3AE9 A;  5FMH A;  1SEZ A;  3LAD A;  2CUL A;  2YLR A;  4XWZ A;  5CKU A;  4EIP A;  3ALL A;  2X50 A;  3BI2 A;  3L1R A;  3G5R A;  1YQ4 A;  3QVR A;  4B1B A;  4AP1 A;  5JCL A;  4ZCD A;  1UKV G;  1OJA A;  2E5V A;  2YLX A;  2QA1 A;  4H4V A;  1FCD A;  3UKL A;  3VRB A;  4B65 A;  3P4R A;  2RAB A;  2VVL A;  4P9S A;  3GDP A;  4TLZ A;  3SFE A;  3UKP A;  1DOE A;  3AEF A;  3CPJ G;  1IUS A;  2V5Z A;  1NDA A;  1QO8 A;  1ZKQ A;  3H8I A;  3Q6J A;  4OPL A;  4TM4 A;  3SX6 A;  1NHQ A;  3K7T A;  5JCM A;  3SZ0 A;  3FG2 P;  4BUR A;  3CND A;  3NIX A;  2BXR A;  2FJE A;  2E4G A;  2HQM A;  1GRH A;  4RG3 A;  3CGC A;  1XPQ A;  3UCL A;  2GF3 A;  2CFY A;  4DSG A;  2YR5 A;  4C3X A;  1PDH A;  2YQU A;  4B66 A;  3NGC X;  4WCT A;  4O5Q A;  3EPT A;  3UTH A;  1GOS A;  4YWO A;  4Z25 A;  4H4Y A;  1ZDL A;  1IJH A;  1PBC A;  4OPC A;  2XLU A;  4U8I A;  3PVC A;  5KWF A;  4EMW A;  2RGO A;  2V6O A;  2YR4 A;  1IUX A;  1D5T A;  2EQ8 A;  4FK1 C;  3SFD A;  2BXS A;  3BHK A;  4HB9 A;  4DGK A;  2V60 A;  4OVI A;  3NH3 X;  2XFP A;  3NK1 X;  2C4C A;  4PAA A;  3BNU A;  3UKF A;  1EL7 A;  1Q9I A;  2WEU A;  3CNT A;  3T2Z A;  1ZX9 A;  5JCK A;  4IV9 A;  1L9C A;  3UTG A;  3NTD A;  4YTP A;  5U1O A;  2WBA A;  2GV8 A;  4A7A A;  3P4S A;  4GF7 A;  2XVJ A;  4JN9 A;  4IVM B;  1FEA A;  2GMJ A;  3GMB A;  2TMD A;  2BS3 A;  2I0Z A;  1CJC A;  4CNK A;  5KRQ A;  2X8H A;  1DNC A;  4Z2T A;  2WDQ A;  4GDE A;  3B6D A;  2R45 A;  3CNP A;  5JCN A;  4H4W A;  3IWA A;  3NG7 X;  4RG4 A;  3L8K A;  1DOD A;  2V3B A;  4BK3 A;  1V59 A;  2YG5 A;  3RNM A;  1IUV A;  2IID A;  3CGD A;  3BNM A;  4NTC A;  1CBO A;  4NTD A;  3K30 A;  1GRT A;  1GTE A;  5IQ1 A;  1LVL A;  3DK4 A;  4GR1 A;  5J60 A;  1OJC A;  1YQ3 A;  1E39 A;  3DJE A;  1E6E A;  3NNE A;  4X9N A;  3V76 A;  3KPK A;  4Z2R A;  3CPI G;  3EF6 A;  4G6H A;  5KMR A;  3T2K A;  2C76 A;  3AB1 A;  4AP3 A;  4LA1 A;  1JRX A;  1H81 A;  4E0V A;  3AE3 A;  1K0I A;  1D7Y A;  2BC1 A;  3I3L A;  3H4K A;  3M12 A;  2GQF A;  2C70 A;  4LII A;  1TDF A;  2YG7 A;  2WDR A;  2BA9 A;  3AYJ A;  5KVH A;  4B69 A;  1TRB A;  1D4E A;  1B37 A;  1EL5 A;  2APG A;  4G73 A;  2OA1 A;  3AE4 A;  3C96 A;  2GH5 A;  3D8X A;  2Y6R A;  4GRT A;  3ICR A;  3E1T A;  1B5Q A;  4Z24 A;  1CC2 A;  2B9W A;  4B64 A;  5C2T A;  2F5Z A;  3UOZ A;  2BC0 A;  3GRS A;  3UTE A;  4H50 A;  1S2Y A;  2OAM A;  1F3P A;  1IUT A;  4NTE A;  2XFU A;  3SZW A;  2Z5Y A;  2GVC A;  1JNR A;  1K0L A;  1KDG A;  2WP6 A;  2GB0 A;  2XVH A;  3F8D A;  1CJ4 A;  2C3D A;  2WET A;  3NK2 X;  2ZZC A;  4OPG A;  3SM8 A;  1H86 A;  2FJB A;  4U8P A;  4K22 A;  4FK1 A;  4H2R A;  2WOV A;  3D1C A;  4OCG A;  4A6N A;  4YT0 A;  3UOX A;  2BS4 A;  2WS3 A;  3CNS A;  3CNJ A;  4ZCC A;  4U2T A;  4D04 A;  1H84 A;  2RGH A;  2WES A;  3P4Q A;  4YSX A;  3AE6 A;  4NWZ A;  1FL2 A;  2ZZ0 A;  3VR8 A;  4A65 A;  3LB8 A;  2A8X A;  2VOU A;  3DGH A;  3CMM A;  1PXA A;  1YKJ A;  4USQ A;  2AR8 A;  4HA6 A;  3KVE A;  3ATQ A;  4JDR A;  3NN0 X;  3GRT A;  4I58 A;  1ZMD A;  3K7Q X;  3DJG X;  1F8W A;  1E1M A;  2XLP A;  1Y56 A;  2RGJ A;  3GWF A;  3AE5 A;  4KPR A;  1F8S A;  1GPE A;  1PHH A;  3AEG A;  3UOY A;  1CHU A;  2R46 A;  4YKF A;  4UP3 A;  3T14 A;  3T37 A;  3C4A A;  2E1M A;  1CJ2 A;  4H2P A;  3ISH A;  4Z44 A;  1OJD A;  2JK6 A;  3UKK A;  4WX1 A;  2C66 A;  3FMW A;  3B3R A;  1D4C A;  2YM2 A;  3AEB A;  3RP7 A;  1ZP0 A;  1JNZ A;  4CCQ A;  4A9W A;  4YKG A;  1BGJ A;  1CC6 A;  1W4X A;  3NT6 A;  3I6D A;  2XDO A;  3C4N A;  2JKC A;  1NPX A;  2YLS A;  2ARD A;  2FJD A;  4OPD A;  4YXD A;  2JB1 A;  2XLR A;  4BJY A;  1E7P A;  5BUK A;  1JRY A;  4TM1 A;  5GRT A;  2BCP A;  1Q1R A;  5BVA A;  4C3Y A;  1S3E A;  3QSS A;  2XFQ A;  3OC4 A;  4U8N A;  4YTN A;  4Z2U A;  4CY8 A;  4GAP A;  3LJP A;  4BJZ A;  4U8L A;  3NKS A;  2IVD A;  1EBD A;  4J34 A;  3NYF A;  1FEB A;  2OLN A;  3EAO A;  4H4S A;  2GMH A;  4K5S A;  1S2Q A;  1GER A;  3AEE A;  2GR2 A;  4CNJ A;  4USR A;  2BCG G;  5EBK A;  1TDN A;  3KPF A;  3BI4 A;  3O0H A;  4A99 A;  2GRT A;  4J2W A;  1GT8 A;  1OJ9 A;  3GWD A;  5IPY A;  4X4J A;  1GXF A;  3QSM A;  4XWR A;  5FS9 A;  3AYI A;  5M10 A;  5HYM A;  2BAB A;  1TDO A;  3DA1 A;  2VZ2 A;  5KMS A;  3M13 A;  2Y6Q A;  3M0O A;  5EB5 A;  3AED A;  4UDP A;  2WOW A;  3SXI A;  3ALJ A;  4K2X A;  2JB2 A;  4H4X A;  4K8D A;  1L0V A;  2C64 A;  4JNA A;  4PAB A;  1QJD A;  3OZ2 A;  4EIQ A;  3DH9 A;  3GYJ A;  1VRQ B;  3CTY A;  3ICT A;  4H4Q A;  4OPI A;  4N9X A;  2YAU A;  2H88 A;  1ZOV A;  4G6G A;  1B4V A;  4H2Q A;  2WPF A;  2OAL A;  5ER0 A;  3IC9 A;  2IVE A;  2WP9 A;  3ATR A;  1MOK A;  1N1P A;  1MO9 A;  2X3N A;  3CN8 A;  4Y4L A;  1LTX R;  2R4J A;  1XHC A;  3HYX A;  5KMP A;  2Q6U A;  1KSU A;  4Y4N A;  3KU9 A;  2B76 A;  4EM4 A;  4NNJ A;  2GR1 A;  2BK3 A;  1ZMC A;  1ONF A;  2A89 A;  2YVF A;  3G5Q A;  2EQ6 A;  1IUW A;  3DME A;  2YLT A;  3WE0 A;  1DOB A;  2VRL A;  3AXB A;  3GYI A;  4JQ9 A;  5HHF A;  3ADA B;  4Y4M A;  3NN6 X;  2FBW A;  3CPH G;  2A87 A;  1Q1W A;  2YVG A;  3VRA A;  2WP5 A;  1KF6 A;  1BWC A;  1GET A;  2GAH B;  2C75 A;  1GAL A;  1K4Q A;  1HYU A;  3QFA A;  2Q0K A;  1GTH A;  5FS6 A;  3GYX A;  2C67 A;  3HZL A;  3KLJ A;  1PJ5 A;  4AOX A;  2X99 A;  3JSK A;  1BF3 A;  4REK A;  3COX A;  1S3B A;  1H83 A;  4EQW A;  1COY A;  4RSL A;  3IHM A;  3IHG A;  5L46 A;  1RYI A;  1NHR A;  3BI5 A;  1VQW A;  1RP0 A;  2GEW A;  1PXB A;  2R0P A;  3AD7 B;  5IQ4 A;  3P4P A;  4H4T A;  4IA6 A;  4NEV A;  1PJ7 A;  2VRM A;  2WU2 A;  2Z5X A;  2XVF A;  3AEC A;  1JRZ A;  1XAN A;  2BK4 A;  5CQF A;  1KNP A;  1M6I A;  1DJN A;  1H7X A;  2Q0L A;  4ADW A;  5BRT A;  2R0G A;  5JCI A;  4II3 A;  1Z6L A;  1YQZ A;  5KXJ A;  4AOS A;  2WHD A;  1LV0 A;  4G9K A;  1N4V A;  2YVJ A;  3T2Y A;  4UDQ A;  3AWI A;  1PBD A;  3PO7 A;  2WDV A;  1FEC A;  4EQS A;  4JY3 A;  2O9Z A;  1DJQ A;  4BK2 A;  5HXI A;  5KOX A;  1PXC A;  1PBE A;  2ZZB A;  1K0J A;  3DJJ A;  2C3C A;  3NLC A;  3GD4 A;  1L9D A;  3LZX A;  3UP4 A;  1TDE A;  3ITJ A;  4U2L A;  2ZBW A;  2YG4 A;  4J33 A;  4KX6 A;  1GRB A;  3ABV A;  4GUV A;  4C77 A;  4ECH A;  4H4U A;  3GMC A;  1GRA A;  3AE2 A;  3DJD A;  2B7R A;  3QJ4 A;  4JY2 A;  3P1W A;  2BS2 A;  2JB3 A;  4K5R A;  3S5W A;  4B68 A;  1GRE A;  1P2E A;  1JEH A;  1Y0P A;  2X8G A;  2YR6 A;  1EL8 A;  2YLW A;  5FS8 A;  3GSI A;  1DXL A;  5LV9 A;  1ELI A;  2YLZ A;  2X8C A;  3NTA A;  4YSH A;  5KVI A;  3UOV A;  4GAV A;  4J56 A;  3QFB A;  4XXG A;  2R4E A;  3BHF A;  5TR3 A;  1YY5 A;  2VQ7 A;  3ZYX A;  3AE8 A;  1F8R A;  1PN0 A;  3FBS A;  1TDK A;  2XCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...