The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
111
|
structure length |
111
|
Chain Sequence |
MDIKSQTLYLNLSEAYKDPEVKANEFLSKLVVQCAGKLTASNSENSYIEVISLLSRGISSYYLSHKRIIPSSMLTIYTQIQKDIKNGNIDTEKLRKYEIAKGLMSVPYIYF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Antimicrobial protein
|
molecule keywords |
carnobacteriocin B2 immunity protein
|
publication title |
NMR Solution Structure of ImB2, a Protein Conferring Immunity to Antimicrobial Activity of the Type IIa Bacteriocin, Carnobacteriocin B2
pubmed doi rcsb |
source organism |
Carnobacterium maltaromaticum
|
total genus |
25
|
structure length |
111
|
sequence length |
111
|
ec nomenclature | |
pdb deposition date | 2004-05-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08951 | EntA_Immun | Enterocin A Immunity |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | Ta0600-like |
#chains in the Genus database with same CATH superfamily 2QZG A; 2QSB A; 2FU2 A; 2BL7 A; 1TDP A; 2BL8 A; #chains in the Genus database with same CATH topology 4HFV A; 2KKM A; 2P22 B; 3JSB A; 3B55 A; 4YZ9 A; 2QGM A; 3IAS 1; 1YO7 A; 3Q8D A; 4OAU C; 2ZRR A; 4PL3 A; 3IAM 1; 2ZW3 A; 2K19 A; 4G75 A; 3DA3 A; 1U5K A; 3LJ0 A; 4DWL A; 3DO9 A; 2HGK A; 3FBV A; 3KP9 A; 2A2C A; 2JB2 A; 4O1O A; 2YFB A; 4Q9V A; 3FNB A; 2BL8 A; 2GSC A; 1TDP A; 4YZC A; 2IP6 A; 2XMX A; 2JBW A; 2L1L B; 1W3S A; 4PL4 A; 4G76 A; 4Z7G A; 4O1P A; 4GXT A; 4NV2 A; 2BL7 A; 2ETD A; 2E8G A; 3AJF A; 4AS3 A; 4YZD A; 2MJF B; 4HEA 1; 1SJ8 A; 2V6E A; 2CAZ B; 3P23 A; 3SDJ A; 2F66 B; 3FVV A; 4I1T A; 2XTR A; 4AS2 A; 2F6M B; 3UIT A; 5HGI A; 2QZG A; 4OAV B; 2RAD A; 3VA9 A; 2YFA A; 1JQO A; 3L0I A; 4JCV E; 2FUG 1; 4PL5 A; 2XTQ A; 2JB3 A; 3DA4 A; 2RIO A; 2FEF A; 2QSB A; 2FU2 A; 2RLD A; 2V1C C; 2A2D A; 4Z7H A; 3F4M A; 3I9V 1; 4U6R A; 3LJ1 A; 4NV5 A; 2JB1 A; 3LJ2 A; 2JAE A; 5LNK 1; #chains in the Genus database with same CATH homology 2QZG A; 2QSB A; 2FU2 A; 2BL7 A; 1TDP A; 2BL8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...