1TE1A

Crystal structure of family 11 xylanase in complex with inhibitor (xip-i)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
molecule keywords xylanase inhibitor protein I
molecule tags Hydrolase inhibitor/hydrolase
source organism Penicillium funiculosum
total genus 92
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1te1A00
5I79A 4M82A 4AD3A 2WKLA 4TTGA 3WF3A 4FLQA 1KB3A 1QW8A 2X0HA 3M6DA 1SR0A 1WZKA 3WDRA 5EMYA 4C7FA 4AZHA 4PMYA 1H41A 3VM5A 2W62A 2PWEA 5ABFB 1ZBWA 1E3ZA 3PZVA 3WF2A 1G1YA 1UD8A 4S3KA 3WMBA 4P8XA 5E6YA 1H4PA 4W5UA 2WANA 2VNCA 4CD5A 2XGBA 4JCLA 1J11A 3VX0A 2GDUA 2DPEA 4OKDA 2J7DA 2C0HA 4H41A 1E6XM 3K8LA 4GO8A 3VUPA 3GNPA 5A8MA 5BYWA 3WENA 3VIPA 1SMDA 4JL2A 1E6NA 3EMZA 4W85A 2PWDA 3ZSTA 4AEFA 4PEEA 3PBGA 3OLDA 3WQVA 2CBVA 2BHUA 2XIIA 1W2PA 2O9OA 5BRQA 5BROA 1J0ZA 1JDDA 3M7SA 2CITA 4PCTA 3U57A 2J7GA 5A6KA 5IDIA 4E8CA 1BGGA 3PTMA 3EDDA 3LPGA 2MANA 2IXVA 1ZB5A 1TZ7A 2YL9A 2OSXA 1HKJA 2PF0A 2VRKA 2J47A 5DMYA 1UWSA 1E6QM 1R7AA 3AMCA 3B9AA 4FLRA 5I23A 2BY0A 2XVNA 3ZJ8A 5ABEA 2WC3A 3OZPA 3WSUA 1ZBCA 3TTQA 1JFXA 4CVWA 5BXTA 1AQMA 2WNWA 1LG1A 3A3HA 2BHZA 5EBAA 5C8BB 1GOIA 3AYSA 1GHRA 2WHJA 1V6WA 4PUEA 3VD9A 1UQYA 1AMYA 3UCQA 1CGUA 3SEPA 2WK2A 3UR7A 2D0HA 2C7FA 4TUFA 2E9BA 4KH2A 3KWXA 3QOKA 3AIWA 1EDGA 2W66A 1XHGA 1ISWA 2YOCA 3POCA 4IISA 2DH3A 1UYQA 1UWTA 5BCAA 3L2MA 3GXFA 1ISZA 5LYRA 3W4RA 2J74A 3VGGA 4S3JA 4TTUA 1BQCA 5A2BA 2GK1B 5ECUA 3VDCA 3TONA 2GSJA 1U33A 3PZQA 1HVXA 2GUYA 2VTFA 3PZGA 2FDMA 1NQ6A 1B90A 4DUWA 6A3HA 2G3MA 3WNKA 3VIHA 2J25A 4JZ5A 3VIOA 3WNNA 1M04A 4CD7A 4HOZA 4D6FA 2A3BA 1MFUA 1C7TA 2VVSA 4NRSA 5A6JA 2EQDA 1QI5A 5BXRA 1BTCA 4UFIA 1KFWA 4GQQA 2DT1A 3L4VA 4J27A 1EO7A 2V5DA 1QPKA 1MXDA 3WEZA 3WF1A 1VJZA 4Z2KA 1XH0A 4XUYA 2D2OA 1CXLA 5DFAA 4F9JA 2TAAA 1FFRA 4XV0A 1F4HA 3AIRA 1E9LA 2VX7A 3THDA 1V0NA 2PI6A 3SCPA 3GH7A 3E1F1 1WB0A 2WMIB 4HA3A 1RH9A 1WDPA 3WFLA 3FY1A 1UD6A 1KQZA 1H3GA 2OYMA 3B8SA 3MUZ1 3SCRA 5IFTA 1HF6A 4JAWA 4BS0A 1CWYA 1E6PA 3WQ8A 1UHVA 1WZAA 2OWCA 4HMCA 1BLIA 4AMCA 1OD0A 3L2LA 5M3WA 3RM4A 3A4AA 1C8XA 4UQDA 4DWSB 4PYSA 1ITCA 3GXIA 4M80A 2QLYA 1GJWA 5FKYA 4KRTA 2WHLA 5CSUA 1ZU8A 1FA2A 1C93A 4QLJA 3APGA 2WAGA 3BSHA 4W8BA 1PIGA 3DYMA 1QHOA 3RMEA 5ABFA 3OA5A 4CCDA 3TA9A 2YL6A 2BHYA 1DWFM 4TVDA 2X1IA 5DT7A 3NSXA 3LPPA 4PMOA 3WBEA 3WQ6A 4U31A 1CENA 4TX8A 3NJ3A 4AZ7A 1OT2A 1QI0A 3ARRA 1BG9A 5AYBA 4MJ2A 2XVPA 1A47A 2YLLA 1UR2A 2YDRA 1V03A 3VX1A 1OGSA 3WH6A 3IK2A 1ZJAA 2WZIA 3UR8A 4D6DA 1MYRA 5GNXA 2A3HA 3PZMA 1X6NA 3SIMA 4BCEA 1B1YA 3DYOA 1LLOA 3LMYA 2NT0A 2VCBA 4H8UA 5A3HA 1C7SA 2WM0A 1WPCA 2EO7A 2WBGA 3N9KA 4MNJA 3W29A 3RIKA 3MUIA 1KGXA 4R5EA 1SFSA 4MB3A 3D5HA 2QMJA 3OZOA 1UKOA 4QAWA 2JIWA 5FL0A 4W8LA 1JYNA 4EK7A 1XV8A 3SUSA 5EFFA 3L4YA 3O6AA 3VNYA 1I75A 2ZICA 3WUGA 2VR4A 1NWUA 1N82A 1JAEA 4BQ2A 4M29A 1XC6A 2EBNA 5A6MA 2G3JA 2J78A 2XFFA 3J7HA 2BY3A 1ZS2A 2OWWA 1LQ0A 3MANA 3VIGA 1XSKA 3IAQA 1W9DM 4NRRA 1RP9A 3SCNA 2VL4A 2DT3A 1BAGA 2EPOA 2ZOXA 4P7LA 2PBGA 3POHA 1UH2A 3T2OA 7A3HA 1G0CA 4HMEA 4W7WA 3WN6A 2RGMA 1HL8A 3UEQA 1E55A 1UKTA 3TTSA 2WMJA 3FN9A 3VNZA 4A4AA 3BMVA 1HXJA 2DT0A 4U5KA 2NSXA 1E40A 1GVYA 4X0VA 3HJEA 1VRXA 2ZUSA 1GZJA 2J4GA 2OYLA 4WF7A 2Y4SA 2ZWZA 1V6VA 4GZIA 5IHSA 5BRPA 1C90A 3ZJ6A 1EDQA 3PZTA 3ZJKA 3WH7A 1QNRA 2GK1A 3VMOA 4PUDA 1HP5A 1C8YA 2G4FA 4J3TA 2XM2A 1MWOA 4AZ5A 5DT5A 1J01A 4ZE4A 1E1FA 4PMZA 2XFRA 4OBRA 1L0PA 1O6IA 3MSGA 4NZCA 3BH4A 3ARWA 2ZX8A 5FL1A 1J10A 1WAWA 6TAAA 3EMCA 3M46A 2ZWYA 3CUFA 1K6AA 2BXZA 1B9ZA 3MMUA 3AICA 2VZSA 1KBKA 1MFVA 1UH3A 1GQKA 1V0LA 2O9RA 2VI0A 5GQBA 1ZBKA 1RP8A 3HMCA 1HN1A 4JIEA 4P7RA 2WBKA 5CPTA 3NDYA 3AMKA 2E0PA 2CIPA 3BAWA 3GDBA 2EPNA 1E0WA 1DWAM 3A4WA 2VZVA 2BXYA 3EYPA 1BYBA 1JFHA 4CD4A 5E9AA 3NCOA 2F2HA 4D6CA 3HN3A 1U30A 1CGVA 2QF8A 1Q6DA 3N04A 1KXVA 2JF7A 3VD3A 1E70M 4PMRA 1GPFA 4XB3A 3WBAA 1PX3A 3N11A 1VFFA 4C7DA 4NSBA 4UNIA 3AIBA 4PBGA 1IZJA 4EAMA 2CEQA 1H11A 3B9DA 3N15A 3L4UA 5CSYA 4DWSA 5CXPA 1KQYA 3N18A 1QOXA 1PBGA 1IZKA 4GIAA 3VDAA 4MTVA 3JUGA 4AZ6A 1C92A 3W28A 1CYGA 1U2YA 8A3HA 4WKFA 4Z2LA 4V2XA 3OGVA 2E9MA 4JL1A 1JZ6A 3DHUA 4DWSC 5JIWA 4QDMA 1FFQA 2JE8A 5HDRA 2VRJA 1HKMA 4JFUA 2BV9A 2PBOA 5I3DA 3ARVA 2WLZA 4AYSA 3MSDA 1QNOA 1E5JA 2F8QA 2J8GA 4OZOA 3ARYA 5JUVA 3GBEA 5D9OA 1KWKA 3MO4A 4IUGA 4D6JA 1R87A 3SUUA 1QHPA 1VBRA 3AXHA 1EOKA 3KE0A 2DSKA 2VRQA 2VZOA 3RDKA 5A8NA 4EKJA 4DUVA 1AVAA 3PN8A 3CMJA 1ESWA 4GI6A 1UH4A 5EB8A 3W37A 1CGXA 4ZXOA 1MQRA 1H49A 4OUEA 3VGEA 1JYXA 4JKMA 4W7VA 4D6EA 5AC5A 4PCSA 1J12A 3VGDA 1B3VA 3WQ5A 4U5IA 1XRVA 2X05A 5E09A 3PZNA 5HPOA 1W91A 5EFDA 1UZ4A 1QBBA 4UQAA 1KXHA 2XWEA 2HVMA 4TX6A 3N13A 1XH1A 3WD3A 2ZX6A 7CGTA 3O9NA 1JI1A 2WCAA 1WDRA 3TP4A 3ZM8A 1RD6A 3WUFA 4UFLA 3W38A 3F5KA 4JCMA 3CTTA 5AY7A 2J7FA 4W89A 1V08A 2JEQA 3FAWA 3WH5A 2DSZA 3VGHA 1ITXA 4D1IA 4OJYA 4M24A 3AMGA 3BCFA 2D24A 1MQPA 3VD7A 5E70A 3QHMA 1ODUA 1JZ4A 1CEOA 1NOUA 1PX4A 1CXFA 1EA9C 4M8UA 4WJXA 1J0KA 4D6IA 1US3A 4AEEA 1HJQA 4W87A 4YHGA 4UFHA 3WD2A 3LPFA 4LPCA 1KBBA 3SURA 2V3FA 3WIJA 1OM0A 3ZT5A 3W24A 2VQUA 3T0BA 2XYLA 1HNYA 1CBGA 3MV01 4BQ3A 1EQPA 2ZXAA 2X2YA 2YLAA 1EHNA 1UWUA 1WKYA 3DECA 1WP6A 5HPCA 3G6LA 1E56A 1V6YA 1VJSA 3VVGA 1JAKA 2WPGA 2FHCA 4MAZA 4UOJA 4MB4A 2J7EA 5IFPA 3WUBA 1V0MA 2BVDA 4E2OA 3WF4A 1CXKA 3MMWA 3CZGA 3WF0A 1H0GA 1MXGA 4UTFA 4D6HA 4CN6A 3BAKA 1E4NA 3AHVA 4JFSA 5I5RA 1O7AA 1YQ2A 3T2PA 5A2CA 1AQHA 1E71M 1OGBA 4WK9A 4JKLA 1PZ3A 1UKPA 1NM9A 1QVBA 1HJXA 2DDXA 2CPUA 2D1ZA 3MUAA 2WW5A 3FAXA 1IT0A 2WVUA 3K4DA 1CGTA 3ARTA 2PWFA 2GDVA 3OBAA 1G9HA 3N12A 1W3HA 2D22A 5I6SA 5I0DA 3PTQA 3BGAA 1KWGA 1BPLB 4GO9A 3L4TA 2DIJA 1BF2A 3W6MA 3ZR6A 3ALFA 1UQZA 1UR1A 2A3CA 1DWJM 2AAAA 1VFMA 2UWFA 4F8XA 2VUYA 4HOXA 4EE9A 1GOKA 4D1JA 1R7OA 4PTMA 2E8YA 1E73M 3BAXA 2J62A 1K9FA 5JBFA 5GPRA 4P7QA 1FP9A 1WZMA 2WYSA 4PTXA 3ECQA 3AJ7A 5C71A 5D8ZA 1MQQA 1WNOA 3GNRA 4WKHA 3BLKA 4MJ4A 1X1NA 4MADA 4GZEA 1VAHA 2ZXDA 3ZOAA 1DP0A 2ZIDA 3ZT7A 2QPSA 1XD0A 1HJUA 2CKRA 2JEPA 3A4XA 1M7XA 3RM8A 1E4IA 3TTYA 2WC7A 4TVCA 1E1EA 4UFMA 4CU8A 1W3LA 4BQ4A 8CGTA 3KEHA 1LL7A 1KXTA 3CO4A 4MAVA 4B9ZA 4CCCA 4QFUA 1HP4A 1TR1A 4CN4A 5A6BD 1E5NA 1JI2A 2ZX5A 1FHLA 1CDGA 5CPQA 4ACZB 5FIPA 1FH8A 4W8AA 2OYKA 1BHGA 2YKKA 1VIWA 3CHFA 1OB0A 3SUTA 1J0HA 2VVNA 5LA2A 1J0YA 2YL5A 1E0VA 1NWRA 2J75A 2CNCA 3CH9A 3GNOA 4KGJA 1UKQA 3ARZA 1UD5A 2J77A 1EO5A 4L4OA 1K9EA 3KL5A 5HBFA 1CIUA 1LF1A 2FGZA 4HMDA 3ZQ9A 5A95A 2WWCA 2WZHA 1UR4A 3IJ8A 2JFEX 3UG5A 1E0XA 2QV4A 5IXEA 1D2KA 5TD4A 1GQJA 5M17A 1GQIA 2DSWA 2ESCA 2XVLA 1UUQA 3AIVA 1OIFA 4P8UA 4J3XA 2GFTA 1UD3A 1GCYA 5CZKA 5JBDA 2Y5EA 3WNPA 1Y7VA 2WKGA 1W1TA 2J8FA 2YA1A 5DF0A 1PAMA 1OBAA 4JFWA 1GOWA 4PSRA 3VOCA 3WFZA 4QCFA 1GONA 2J7HA 4CD6A 3UG4A 4CKQA 3O2LA 3CIVA 4XZBA 1KCLA 1V02A 4TOQA 2GJXB 5D9PA 4AD1A 5JBEA 3W26A 1ISXA 2BS9A 1NOWA 1V6XA 3TTOA 2WCSA 3MS8A 4UCFA 2WHMA 1H5VA 4HZ6A 4WSJA 2WHKA 1US2A 4H04A 1GNXA 2Y8KA 3K8MA 5I77A 1Q6CA 1ODZA 1VFUA 1W9UA 1TVPA 3VIJA 5GNYA 1G5AA 3WDHA 3PZ9A 2CHOA 2GJRA 2V3GA 4RE4A 3VGFA 3AFBA 2VX6A 3SCSA 4WLCA 5CLTA 2WMKA 4MB1A 9CGTA 1IV8A 1H09A 2PWGA 3OGSA 4J28A 4CUCA 1JZ3A 1CGWA 4L4PA 2WVSA 1LJYA 1UR8A 2WXDM 4KGLA 2OSYA 1J9YA 4AWEA 4HU0A 2VC9A 1EQCA 4GINA 3WUEA 4AZIA 1Q6GA 3AHXA 3MKKA 3WH9A 5F7UA 2DH2A 3MUY1 5HXMA 2X09A 4OOUA 1PEZA 3NUKA 4BA0A 4W7UA 1SYTA 1WDSA 1XSIA 3CBWA 4Z2GA 2WMHA 3IJ9A 2FHFA 4UQ9A 4D72A 2WSPA 4JHZA 4P8VA 1KR0A 1J0IA 4KWUA 1PZ2A 3AS3A 4JHOA 1M53A 1V02E 2BFGA 5D8WA 1BGAA 1BYAA 4IPNB 3AMLA 4JKKA 3VKKA 5I78A 1QNSA 4CU7A 5A69A 2OSWA 4AD4A 4ATWA 2J7CA 2UY2A 4JFVA 3UERA 4GI8A 1H0IA 3CZEA 3MV11 4J3VA 1UZ1A 4F9DA 3WMSA 5A6AA 3OG2A 4HA1A 1B3YA 1V3KA 3PZUA 3RILA 2BVYA 1W1PA 4WSKA 4H8HA 3VPLA 4WIWA 2VX5A 3U7BA 3DC0A 1ISVA 3ARPA 2VMFA 4YN5A 3AXIA 3PZOA 3EDKA 3CUJA 3GH5A 4Z2JA 5LA0A 2VOTA 3I3BA 1OWQA 1LWHA 1EHAA 1A3HA 4N0RA 4ACZA 3I3DA 2D20A 4UQBA 4PMXA 2HISA 3AIQA 4J3UA 4QLKA 3WY1A 1MW3A 4HPHA 4PMNA 2CBIA 2EPKX 1G94A 3THCA 3WQWA 2G3NA 3AS2A 1PIFA 4HPGA 4J3SA 5LA1A 4AC1X 4DUXA 3K46A 1EH9A 1I1XA 3VMNA 4BF7A 3DYPA 3WDPP 4ATLA 2G41A 2IXUA 3SCWA 3BMWA 1ZBVA 1GVIA 5ABGA 3B9EA 3K4AA 1I1WA 2QMKA 2WWDA 4M1RA 4XZWA 1EXPA 1VBUA 3AHYA 1Q6FA 3CGTA 2W5FA 3PZIA 1B3WA 1W3KA 1BSIA 1B30A 3I3EA 1H2JA 3WNMA 3UESA 3W25A 3QR3A 3NYDA 5CG0A 2ZUWA 1W32A 4GQRA 4NF7A 3ZO9A 2E40A 2EPLX 5CJ5A 3RCNA 1UD4A 1C91A 1E6SM 1ZL1A 1TG7A 4HZ7A 1HKIA 3RPMA 1B31A 2ZUVA 3L4XA 2O92A 4DM2A 1E3XA 2YDQA 1QI3A 2JIEA 1R86A 1W1YA 2XIBA 4MPKA 4PTWA 2DEPA 1UWRA 1OIMA 2VQTA 1FP8A 4ZENA 4MB5A 1XD1A 2GJXA 3OIHA 4AD5A 5A8PA 5CQ1A 3VU2A 1DTUA 1QHZA 2D23A 4B3LA 1JF5A 3NDZA 3SCTA 2UY5A 2WVTA 3M07A 3AS1A 4UQEA 3WNLA 2WMGA 3BAIA 4W86A 3ALGA 1MW2A 1FH7A 3VILA 2RGLA 4KRUA 2CYGA 2FHBA 2VZUA 2YL8A 1ECEA 2XVKA 3K1DA 1B2YA 5E6ZA 4YHEA 1QNPA 4AZCB 2W67A 1V3JA 1JYWA 5HOSA 1H1NA 2ZX9A 3QHOA 2O9TA 3HU7A 3CUGA 1JZ5A 2EXOA 5M03A 2PWHA 4YPJA 1LWJA 1CZ1A 2X8RA 3EMQA 1QI2A 4Z2IA 1P6WA 3AXXA 1JDCA 5ABHA 5CGTA 1CXHA 4PSPA 3WL1A 5A8OA 2F61A 3KZSA 5A8QA 3IJ7A 3VIIA 1J0JA 3SUVA 1L8NA 1F4AA 3GXDA 2W61A 1HJVA 3AISA 1JD7A 1Q4NX 4ZXLA 1BYCA 1GJUA 5C70A 2XHYA 4URIA 1NARA 3WL0A 1PX8A 5DO8A 4D71A 4F66A 3AIUA 5FCZA 3ARUA 3S6TA 4DM1A 4UFJA 5CGMA 3AMDA 3AZTA 3WD4A 3IAPA 2CESA 3BCDA 3W6LA 2CCRA 3RJYA 4GI9A 1C3FA 1LL6A 3QOMA 1WE5A 3U5YA 2BVTA 4OIFA 4Z2HA 6CGTA 1CTNA 1AQ0A 3WEOA 2QHAA 1NP2A 2O9PA 2VJXA 3LPOA 1TCMA 1W3JA 3AHZA 2FH6A 2CHNA 3SCOA 2Q8XA 1KGWA 2E4TA 3ARSA 2J79A 1E4MM 1E6RA 4CVUA 4BZYA 5A2AA 4AIUA 1GW1A 3AROA 4AZBA 4PMDA 1KGUA 1OINA 2XTKA 1WZLA 4KMQA 1XH2A 3SCQA 3AZRA 1BVNP 2CERA 4UOZA 4WKAA 3CZ8A 2V3DA 3BLPX 1WO2A 1V3HA 4NI3A 3OLEA 2CBUA 4H7VA 4JFTA 4FMVA 2VT0A 2B31A 3U5UA 3WDQA 4HA4A 3CHCA 2ZX7A 5E0FA 1DEDA 1MW1A 1GUVA 1D3CA 1D7FA 4U33A 3W53A 3T0DA 1JG9A 3FHAA 4K68A 4C7GA 1LG2A 3VINA 2CXGA 2WCGA 2ZUTA 1E15A 1OCQA 4CGTA 1JXKA 3FXYA 1DWHM 1Z32X 2W63A 1JD9A 1JF6A 2E9LA 4ATDA 4EANA 1W1VA 3AI0A 3VIFA 3WH8A 4LGXA 4M56A 1W9BM 1CLVA 2W92A 4R27A 4P7OA 4W84A 1V0KA 4QCEA 2WVVB 2X0YA 5KEZA 4LXFA 3RO8A 1UA3A 2G3IA 3II1A 3BAYA 3A47A 1TVNA 1XGZA 3GH4A 3CHEA 5I2UA 3AHTA 1PPIA 2YDSA 1E6ZA 2VCCA 1OT1A 4GKLA 1V3IA 1E72M 3BC9A 4HTYA 3N1AA 1BYDA 2EPMX 5BWFA 4ZEPA 1QW9A 3ZT6A 2XFYA 4B3KA 3VM7A 2Y24A 3PHAA 2BNJA 1HKKA 3FW6A 4M81A 4LYPA 3CUHA 4IPLA 5A1AA 3BSGA 1K9DA 2PB1A 1HIZA 4QLLA 4RL3A 2VURA 5FOOA 2IUZA 3WQ4A 4E4PA 4V27A 4U3AA 2AMGA 2W91A 3AQUA 1BFNA 4OBSA 1TE1A 3VO0A 1JZ2A 1EIBA 1M03A 2DGAA 4PMUA 3SCUA 4AZGA 3ZSSA 1SMAA 3U7VA 4DWSD 4CU6A 2BY1A 1JIBA 5DEZA 1B3ZA 4AW7A 1W9VA 3VDHA 4AZCA 5AC4A 1R8LA 3FHQA 1HT6A 1J18A 3T09A 1UD2A 4FLSA 1JZ8A 4P8WA 4UR9A 4J3WA 1K9TA 4ZFMA 3MMDA 3ZR5A 3QHNA 3ZIZA 4PMQA 2E3ZA 2CBJA 2WMFA 3W82A 5FD0A 2Z1SA 1LL4A 5D4YA 2WB5A 1WDQA 1VB9A 3OB8A 4UFKA 2GVYA 2OWXA 4MDOA 1JGIA 1S46A 4TVUA 2C8NA 4RE2A 2V3EA 2DIEA 1NP0A 3T0AA 2JALA 3GM8A 5D9MA 2YA0A 4E8DA 2Y8VA 1MW0A 2YBTA 2VZTA 3GBDA 1G01A 2ZUMA 1KCKA 3WKZA 3AOFA 3AS0A 3NIYA 1CECA 4U3CA 1VEPA 4QP0A 2EEXA 5HNNA 4UQCA 3F4VA 2ZXQA 1ISYA 4PMVA 4A3HA 2DT2A 4LYRA 4Q7NA 2XGIA 1GOMA 2XVGA 3T2QA 2DQXA 2ZUNA 1TA3B 3MU7A 4H2CA 4PN2A 2OLHA 3PTKA 2FGLA 2ZUUA 4FK9A 3GXMA 1UWIA 2D0FA 1CNVA 1CGYA 1JZ7A 3WELA 4ACYA 3N17A 1GHSA 1GORA 1TFVA 4MDPA 1VFOA 3WNOA 1B0IA 3KL3A 4V28A 2Z1KA 2YA2A 3OGRA 3BXWA 3CUIA 1XCWA 4AISA 3CLWA 3CPUA 3CMGA 4OOZA 4CN1A 2ZXBA 2V38A 1HX0A 3ARXA 3GZAA 3QGVA 1JL8A 1WCGA 4XX6A 5I24A 3ZJ7A 3OLIA 1XYFA 2XUCA 1QI4A 2JF6A 4B9YA 3VDBA 3VGBA 1TMQA 2DSUA 5M5DA 3SUWA 2EJ1A 5CLWA 3K8KA 4CD8A 1OD8A 2GJPA 2VCAA 4CCEA 2D3LA 3VTRA 4X9YA 4A3YA 4LQ1A 2XSBA 3CZJA 1VEOA 1JNDA 2CETA 1W9PA 1VF8A 2WVVA 4GZJA 4RE3A 1CPUA 4AIEA 5AYIA 3L4WA 4ZE5A 4MNMA 3W0KA 1DWIM 4FLOA 3AZSA 1HJWA 3VIKA 1EDTA 3ZMRA 3UG3A 2WC4A 3TOPA 1UOKA 4LYQA 1CXIA 1CLXA 3CZKA 4F79A 3DHPA 3WD0A 3S2CA 3AIEA 2DSVA 3D3AA 1JYVA 1NH6A 2CKSA 3WEMA 3A6OA 1ZJBA 1HJSA 1JDAA 3WDIA 2PC8A 3T08A 3BAJA 4UOQA 1KXQA 4AXNA 1HL9A 1NWSA 1UG6A 3CZLA 1EGZA 3AYRA 2A3EA 2YIHA 1PJ9A 3L4ZA 5E0CA 2BY2A 4MNKA 1C8QA 4N42A 5CPSA 1JNEA 3W81A 4MNLA 5A6SA 4GPNA 1BVZA 2V5CA 4Y7EA 1GQLA 1OSEA 2ZE0A 3F5JA 4J7RA 4UZUA 1E4LA 3W27A 4W93A 2XG9A 4BQ5A 5A94A 1UWQA 1HVQA 2D3NA 1E43A 3RJXA 5A6BA 2NT1A 3GYCA 2WMIA 1DWGM 4H8VA 4X0NA 3WD1A 2G8ZA 1CXEA 1KR1A 4Q22A 3NSNA 1NWTA 1FHDA 2VR5A 3EBVA 1V3MA 4ML4A 3UETA 2NW0A 1UKSA 4HZ8A 1YHTA 1W2VA 1VENA 5GNZA 3NSMA 3RM9A 1Q6EA 2WSKA 1QBAA 3CHDA 1R85A 5D9NA 4LX4A 2D0GA 2VO5A 1DHKA 1W9XA 4PRWA 1B3XA 2XJ7A 1XCXA 1UR0A 4P7NA 1V3LA 5IHRA 4HP5A 3SCVA 4HOWA 2WZEA 2AOSA 5A6LA 3WMCA 3G6MA 4D6GA 1BG4A 5JIPA 4GXPA 2UY4A 2E8ZA 2FH8A 1JXJA 1V6UA 1GOQA 2W4XA 4AD0A 1OGGA 2QPUA 3VMPA 2XWDA 2VX4A 1X6LA 4AD2A 4PTVA 1MVYA 1TUXA 3VD5A 3GTNA 1RPKA 3KL0A 7TAAA 3IANA 4AY1A 1XSJA 1TA3A 1NOFA 5BXSA 3VIMA 2XSAA 2A3AA 3OLGA 1M01A 4U2ZA 5BXPA 1VEMA 3EDEA 4U2YA 4W5ZA 1GOOA 4AIOA 2YBUA 2WLYA 4W88A 5KZ6A 2XPKA 1EOMA 3EDJA 4FF5A 1FOBA 2UY3A 3VD4A 1XYZA 2YJQA 3F5LA 2J7BA 2Y2WA 4HU8A 1FH9A 1UA7A 3FNDA 4TXEA 2XM1A 4B15A 3ARQA 4UZSA 4IM4A 1UR9A 3WDJA 3EDFA 1QNQA 4B16A
chains in the Genus database with same CATH superfamily
4IGMA 5I79A 3HZ3A 3WF3A 4FLQA 4BI5A 3CPRA 2WQDA 4Q8OA 1PYMA 2GUBA 3DFPA 4PBFA 1R47A 4AZHA 2P0OA 3W84A 1T8QA 2PWEA 3NA8A 2PWUA 5ABFB 2PP3A 4C91A 1KM6A 3I4KA 4Q4MA 5BOFA 5LGZA 2QVNA 3JW7A 5E6YA 4CD5A 2XGBA 4WSHA 1J11A 2YXOA 4YVPA 2C0HA 3VUPA 1VPXA 2XSXA 3GNPA 5BYWA 2G95A 1ZZMA 2IPGA 1UR3M 1RXOB 4JL2A 3T40A 3EMZA 2V81A 1M68A 3A3WA 2Y6ZA 2JKAA 2PWDA 1F2JA 4AEFA 4PEEA 5IBXC 2CBVA 1W2PA 1J0ZA 1EC7A 4GACA 3BLLA 3QGKC 5A6KA 5IDIA 3HGRA 1QWGA 1BGGA 3EDDA 3O1NA 2YL9A 1HKJA 2PF0A 1XQKA 2OO6A 2Z2UA 3NGJA 4FOJA 2HROA 3WJSA 1R7AA 3B9AA 3V36A 4GXMA 5FEXA 2PTDA 2XVNA 2O0TA 3W2NA 4FO4A 1B3OA 1A4LA 4DI8A 1GOIA 4I90A 3UG8A 2C7FA 5AN7A 1JEZA 1N2VA 2E9BA 4LSBA 3GDLA 3DFNA 1FWBC 3USBA 1FWSA 1FXPA 2HBXA 3AIWA 2W66A 4L6HA 5LIWX 4YTRA 3E96A 5I3FA 1A5LC 1W0MA 2IW0A 4K2SA 3MZNA 1UYQA 1UWTA 2PDBA 2PC4A 1ISZA 4HMNA 2J74A 3DGRA 4S3JA 2CWXA 3R10A 5A2BA 1PIIA 3PC0A 1IYXA 3TONA 2GSJA 1HVXA 3PZGA 5G4HC 1GQNA 2XDFA 1P7TA 4DUWA 4LEQA 3DFHA 4XBJA 2G3FA 2QGHA 1N8IA 2VVSA 4GQQA 3M4HA 5CZTA 3KP0A 3WQCA 5C7HA 3N29A 4AUBA 7ENLA 3O6CA 3H53A 3E2VA 2V5DA 3W72A 4MY8A 1MXDA 3GRIA 3LSCA 3LLDA 3GVWA 2PRHA 2FVKA 3GUWA 1CXLA 4E3TA 1F4HA 3AIRA 3FVMA 3R0DA 1A5AA 3GXPA 1W5OA 2PI6A 5HUOA 2JBMA 3IPWA 4PCNA 5SWUA 4WHBA 1RQBA 3NXLA 5CH9A 3NGFA 4LUSA 1WUFA 1WDPA 3FY1A 1H3GA 4K38A 2OYMA 3MW7A 3WJWA 4DXVA 3SY5A 3W1RA 4C6LA 4BS0A 5BMWA 3T55A 2TPSA 3M0IA 1WZAA 3BZGA 1R3VA 2OWCA 2H9AA 1G69A 5AOUA 5E0KA 5KETA 4B5VA 2E5DA 1C8XA 4PYSA 1AH4A 4I7VA 4M80A 2WHLA 1M1BA 1FA2A 1XRTA 4QLJA 3APGA 4HN4A 2ZZ3A 1DIEA 5ABFA 1TE6A 2BHYA 3F2BA 2VC6A 3U6WA 3I4EA 4IL0A 2QEZA 4PMOA 1VYRA 2VP8A 3E0FA 1HFBA 2C15A 4MJ2A 4YU1A 3B04A 4IJRA 3KLLA 1MYRA 6REQB 3PZMA 4HTBA 3S5YA 3H12A 4LV4A 4US6A 3SIMA 3HFYA 1XIBA 4YXGA 3IWPA 3CUXA 2NT0A 3NPUA 3MCNA 4MFDA 4H8UA 5A3HA 3W29A 2PDGA 1F74A 1KGXA 3MUCA 4R5EA 1SFSA 4MB3A 4UTWA 3D5HA 1UKOA 3P80A 4RDZA 4EK7A 3S42A 3QZEA 1XV8A 1FRBA 1F6YA 4IPIA 1HGYA 4GX8A 1I75A 3RHGA 4L4LA 4BQ2A 2WV8A 1XC6A 5EYWA 2XFFA 1JQVA 3J7HA 2NUXA 3H23A 3M0HA 4DBDA 1ZS2A 2Q71A 1TPDA 4DVOA 3B0VC 4ZQRA 3DFOA 4R34A 5DRCA 3MTWA 4Y9NA 4FHAA 4GYJA 4NRRA 4GBUA 4MZ8A 4P7LA 2ZOXA 2PBGA 1UH2A 4JTEA 7A3HA 1QOPA 3D6NA 3EA2A 1HL8A 4H7CA 4GQ0A 1S2TA 3FN9A 1WBHA 1XFCA 1GVFA 3CMFA 2GGIA 3HQNA 1GVYA 3HJEA 2O7QA 4RXGA 5CBIA 1C29A 5B7ZA 4H9MA 2Y4SA 3APYA 3UXKA 1C90A 4FXFA 3WH7A 5CC6A 4PUDA 1HP5A 1RA5A 4ICNA 2G4FA 3VXGA 2FMNA 1MWOA 4IFRA 3W1MA 2Q01A 4JQ3A 5DT5A 4ZE4A 1E1FA 5LNSA 1O6IA 4Q8VA 3BH4A 1GOXA 3W74A 3LCGA 5FL1A 1WAWA 1W8SA 3FLUA 3TK7A 1DIDA 3F03K 1B9ZA 2ZBTA 1TTJA 2VZSA 1KBKA 1UH3A 3TC7A 5H8MA 2VI0A 1X1OA 3N4AA 5GQBA 1KTNA 4FOUA 2HSAA 2Z29A 4JIEA 4P7RA 4U10A 4P2VA 5D2XA 1JCTA 3THQA 3IRSA 2X1UA 4LBSA 5D30A 1PTGA 4A3RA 4IMDA 1E0WA 2P53A 1IHIA 4CD4A 2VFFA 1UMYA 3HN3A 3ITXA 1CGVA 4UBPC 4PMRA 1RCQA 4FNRA 3W1LA 1VFFA 3IIOA 4GCAA 4LRSA 4PBGA 3TW7A 4DBUA 3LDVA 4ERIA 1GYNA 3L4UA 1LRTA 4FI4A 3L21A 1PBGA 4A8LA 3VDAA 4AZ6A 3ZFHA 1C92A 4RNJA 4HJWA 4KPLA 4AY7A 4Z2LA 2HXUA 4D8AA 1LLZA 3OGVA 4JL1A 4LF1A 3DBPA 4N9CA 4DWSC 4QDMA 2PLJA 3PB2A 1F3EA 1TZ9A 2JE8A 1HKMA 5FF0A 4Q4RA 3SW6A 1TPFA 3DCPA 1KD0A 3CT7A 4LAZA 2G37A 4YNGA 3MO4A 1EZWA 1S2CA 1R87A 4J3ZA 4CQ9A 3SUUA 1JVNA 2PP1A 1QHPA 4O1FA 5C9UA 3QKEA 3LBCA 2IQTA 1EOKA 3ZVHB 6REQA 2QAPA 2R91A 5HQEA 3L0KA 4LRTA 5A8NA 4GK8A 4GI6A 5EB8A 3C0QA 3W37A 3IVTA 4YS1A 1MQRA 3VGEA 1E51A 5CBJA 4D6EA 1WXZA 4PCSA 3T05A 1DJWA 2HPIA 3PY2A 1XRVA 4U5IA 5BU6A 1XDMA 4W9TA 4QDPA 5E09A 3W85A 1YW1A 3M5YA 4F40A 1W91A 4GOAA 1QBBA 4UQAA 2VDGA 1MEWA 2ZX6A 3UZZA 1JI1A 2WCAA 1RD6A 4WY0B 3LM3A 2F6UA 3EA1A 2NWSA 4DO7A 4S3GA 1KW1A 3RPTA 3GIQA 3FAWA 3GC5A 3B06A 3VGHA 3LEPA 3ATYA 4OJYA 4M24A 2ZADA 2J9YA 5XIAA 3LHYA 2WZMA 6XIAA 2JGYA 1CEOA 2G50A 4J9JA 2CLIA 4HKPA 3P0WA 4HIBA 1OX4B 3WBXA 4JTDA 3KAOA 3LZ3A 3LPFA 3ZT5A 2EF9A 2WSQA 3W7LA 4GUGA 2NWRA 2PU1A 2OXNA 5HR6A 4GC4A 1A5NC 5LIUX 1L6FA 4BQ3A 1YPFA 2WSRA 1XP3A 2X2YA 3UZJA 3W1PA 3LQLA 3G6LA 1VJSA 2WPGA 4HSOA 4QROA 3KCJA 3MY9A 2E5CA 1KRCC 1R9YA 2J7EA 2GOUA 1AA1B 2GL5A 3WUBA 4GISA 1V0MA 2BVDA 4DXXA 3MSYA 4REQB 4O8RA 1ZHAA 2FTYA 1H0GA 4OT7A 4D6HA 1R3QA 4N6EA 1MEHA 1E4NA 5I5RA 1O7AA 3T2PA 5A2CA 1A5BA 1PZ3A 2YPIA 1EUAA 4L4MA 4Z0JA 1D8WA 2Z26A 3NQ6A 5FAJA 3MUAA 3FAXA 2PFHA 3KZPA 3RNDA 1UP2A 3K4DA 3ARTA 2PWFA 3M0VA 2WJEA 3FKRA 2CWNA 4IMEA 1MZRA 3LGEA 1DL3A 5HJXA 4O19A 4IP5A 3T1GA 2PRLA 1KWGA 3R89A 4GO9A 1FDZA 1NY1A 4QM1A 5XIMA 1BF2A 3W6MA 1UQZA 1SZGA 3VKCA 9XIAA 1DWJM 1VFMA 4H8NA 5TNVA 4F8XA 4H00A 4WCJA 3BZJA 3FSUA 3BAXA 3EOUA 4DPQA 1NDVA 2V5JA 2WYSA 3S83A 2V82A 3GU1A 2OOGA 1R3TA 3ORWA 3AJ7A 4LUIA 5D8ZA 3GNRA 1WNOA 4JIPA 2X1TA 4WKHA 4MJ4A 4MADA 3G5EA 4GZEA 1SVDA 3CQHA 1DP0A 4DZAA 1JPMA 1DJGA 2OQHA 1HJUA 1M7XA 4O18A 3Q94A 4DO6A 1E4IA 3UWWA 3LZ5A 1E1EA 3BOFA 1W3LA 4JXCA 3W7EA 3PWIA 3CO4A 4B9ZA 3A9IA 1XKJA 4CN4A 3H22A 5CPQA 4ACZB 2Z2AA 5FIPA 3SN4A 3ZVHA 3S9ZA 3PP7A 3T44A 2QCEA 1D8CA 3CHFA 1R30A 1VHNA 2OQYA 3H2AA 2VVNA 1RBOB 5LA2A 5D04C 1NWRA 2J75A 3BLDA 3ITYA 3GNOA 5FEZA 2FPYA 4C65A 3ARZA 4NU7A 4L4OA 1K9EA 3KL5A 5HBFA 2FGZA 1HGWA 3KDNA 1GKPA 2ZCGA 4I5RA 3ABOA 3JU2A 8TIMA 1IE7C 4L80A 3R5EA 3NQMA 2QV4A 5IXEA 4WY0A 5K9CA 1HTIA 3DG6A 4UTLA 3RRXA 4F0HA 3LENA 1ADDA 1GQIA 3AIVA 3AO0A 2GWGA 5IOBA 3A4JA 4IWWA 1GCYA 5AECA 2EAWA 3O06A 5CZKA 2C14A 3W2KA 3WNPA 3HPZA 1VBJA 4DELA 4FIQA 3WZ0E 4GQBA 1JDFA 4CD6A 1KKOA 1RJRA 3VNMA 1KCLA 1V02A 3BW3A 4TOQA 1OX4A 3NQEA 5D9PA 4PC8A 3OEXA 3MS8A 4NJJA 1XIHA 4WSJA 1US2A 3GKAA 4F0SA 5HINA 1W9UA 2NV9A 1EYWA 1EGMA 1BQGA 1TVPA 2OT1A 3QYSA 3UD6A 5GNYA 1E0UA 2YR1A 3VGFA 2NQZA 2VX6A 4MB1A 3P8IA 1H09A 1VH7A 3P6LA 4NX0A 1LWIA 4J28A 1JZ3A 4JTJA 2Q3RA 2ALDA 4O28A 3M0YA 1DXIA 1LJYA 4O8AA 4REQA 4QJ4B 4TV5A 2AQOA 2WXDM 4DJDD 1J9YA 4IQJA 4IIDA 4ZODA 4AZIA 3MKKA 4TV6A 5F7UA 4G8TA 4QAIA 4QBXA 1OJXA 1W5QA 4QEHA 3M64A 3NUKA 4OOUA 1EP1A 1AL8A 1NEYA 1WDSA 4O54A 3V4BA 1XRSA 2ZRUA 3DEQA 4Z2GA 1WA3A 2FHFA 3N9SA 4D72A 3N6QA 2ON3A 1TWZA 4M6QA 3S8HA 5M2FX 1PZ2A 5KSWA 2BFGA 5D8WA 3CQ0A 1BGAA 4H2HA 2W9MA 3LCXA 1B57A 2NQHA 3M5VA 1QNSA 4CU7A 5A69A 4AD4A 2J7CA 3B9NA 3UERA 3CZEA 2QIWA 3MV11 3STPA 2PDXA 1I60A 3DI0A 4F2BA 2CFFA 1UZ1A 1NIUA 2VEFA 3UA3A 5A6AA 1ADSA 3T81A 3NXFA 3RILA 4ML9A 5HWNA 4AAJA 5B80A 2F84A 2X1RA 4H6EA 4L61A 1IEVA 3IJLA 4HK6A 4LCQA 4NXSA 3E2RA 2FMOA 1NVMA 4KW2A 3AXIA 1AD1A 3GH5A 4Z2JA 1UJQA 1OWQA 1LWHA 1A3HA 4GHRA 4NKCA 4ACZA 4N4PA 1MW3A 2CBIA 1G94A 4YYCA 4UTHA 1PIFA 4HPGA 4J3SA 5CZJA 5HATA 4A2SA 2E28A 3K46A 3WDPP 3SCWA 3F2CA 3UWEA 3C8FA 4HCDA 3HURA 4ERAA 4FNTA 4CQCA 4HJFA 3EPMA 1I1WA 4B5SA 4HHHA 1JCNA 4DPPA 3HG3A 3PZIA 4JN6A 3S5OA 3HO8A 3I3EA 4KEMA 3NYDA 1ZENA 4GQRA 4V33A 1E9IA 2E40A 1P4CA 1QR7A 1OYBA 1C91A 3EB4A 4OBTA 1HKIA 3RPMA 4B5XA 5IM51 5F1VA 3V16A 1E3XA 1QI3A 2JIEA 1R86A 5BU9A 5BZAA 1PHQA 3HG4A 4MB5A 2I56A 2GOKA 3IVSA 2D23A 3GS6A 3LD5A 3CQKA 3QQ0A 1YEYA 2UY5A 3ANUA 1A80A 5H8UA 3AS1A 3R11A 4Q4KA 4LU0A 3BAIA 2NQ5A 3GNNA 4JTGA 3RCMA 1RD5A 3GTXA 3CASA 1XBZA 4PR4A 3K1DA 1X7FA 1BKSA 2O4QA 3FS2A 1JYWA 4AIBA 2ZX9A 2O9TA 3HU7A 1OF6A 4PFHA 3R79A 2EXOA 4RDWA 2RHGA 3STCA 1LWJA 1CZ1A 1QCWA 4Z2IA 3G1VA 5J8LA 4FB7A 1P6WA 4UIOA 5CGTA 4DNHA 2X16A 2Y63A 4E0CA 2R1NA 3MI2A 1J79A 4RK8A 1F4AA 3E0IA 3AISA 1BYCA 3NO5A 5C70A 4AF0B 3UT0A 1P43A 1NARA 3WL0A 2QCFA 3BJTA 3BGGA 1FCQA 3ITTA 4C6NA 3ARUA 3MUXA 4QJ1A 4RZ6A 4UFJA 1SW7A 2OJPA 3MVTA 3AZTA 3MMTA 4D9PA 3I68A 3BCDA 2I16A 3RJYA 4GI9A 1H60A 4K3ZA 4Q4PA 1W3NA 3N4FA 1WE5A 4N02A 2BVTA 4OIFA 3BARA 2OGJA 3GIYA 4S3BA 3QRHA 1W54A 3NPXA 1CTNA 3WJXA 1AQ0A 2QHAA 3E38A 4HNOA 3S9IA 3W2UA 3PBVA 1W3JA 4WR3A 4JR5A 1FCUA 2VD8A 1TJ1A 5A2AA 3AROA 1TMLA 3JVAA 1V4YA 2FTWA 4AZBA 1DJQA 1SFLA 1T6MA 1KGUA 2IMRA 3AZRA 3MHUA 1TWIA 2QCDB 4OHQA 5XINA 2OB3A 4UOZA 1UMLA 1Q13A 1V3HA 3TW9A 2Z00A 3QTGA 1EIXA 3QFEA 2VT0A 3WDQA 4IUOA 4I3GA 3U5UA 3H4XA 4HA4A 2V2DA 2VHLA 1XIIA 1D7FA 1UP3A 3E02A 4ONVA 2QUUA 4C7GA 3U48A 5JU6A 1FWTA 3OYZA 3CHVA 3MP3A 2ZUTA 5LIXX 4A05A 2PTZA 1Q66A 2PWVA 3RLHA 1Z32X 2WJFA 3VE7A 1JD9A 1JF6A 4FSAA 1XLGA 2P3ZA 3VIFA 4G9PA 4AVNA 1TCDA 1Z3NA 4I7UA 1SO6A 3SSJA 1UZDA 3RO8A 3VDGA 7ODCA 1YXDA 1VPQA 4EXQA 3B8TA 4YTTA 3KDOA 5DX7A 3A47A 1XGZA 3EKZA 4DJFD 5LNWA 4GKLA 1CI1A 3BC9A 3GHSA 4IQEA 4HTYA 2EPMX 4ZEPA 1QW9A 2FZBA 2XFYA 3CXOA 3RITA 2BMBA 2Y24A 2QT3A 3LUTA 3FW6A 3GFXA 4M81A 3EXSA 5LSMA 4IPLA 4J2PA 1K9DA 4NL1A 2IUZA 4AHQA 3L2IA 4L1XA 3USZA 1EJVC 3FX4A 4OBSA 4RZBA 1EIBA 5HA7A 1JR1A 1OFQA 1JIBA 4KS0A 3GTFA 4M6VA 1R8LA 1AL7A 3FK4A 1J18A 1XRFA 3T09A 4H9ZA 1H7OA 1JZ8A 3VFLA 4UR9A 1JQXA 4GI4A 5H8PA 1AG1O 1K9TA 4ZFMA 5BOOA 1SJDA 1YDYA 3VFCA 4PMQA 3WLLA 3W82A 3MI3A 4IX2A 3GVGA 3W9ZA 1SFTA 5D4YA 1WDQA 2OELA 5C2GA 2PLMA 3P60A 4FX8A 4UFKA 5LHFA 3HFTA 1LORA 3M7WA 4MDOA 1THFD 1WX0A 4L64A 4TVUA 1FWIC 1XLEA 4NZJA 4R7JA 4AF0A 1EJRC 3WBWA 2JALA 3TCEA 3W7GA 4JNZA 4E8DA 2YBTA 3WKZA 4PEKA 4LTSA 2INFA 2L5HA 3AXKA 2QJHA 4U3CA 3IK4A 4M3PA 1NDWA 3GKFA 5HNNA 4UQCA 1H1ZA 4ES4A 3F4VA 3GTHA 1EA0A 1ISYA 5D2VA 4A3HA 4JS3A 4Q7NA 1G67A 4PULA 2PS2A 1U5VA 3KWSA 3SQSA 2XVGA 3AWOA 3BV7A 2CXEA 5HAOA 2H8ZA 3DESA 4POCA 1ZUAX 2ZUUA 5AKQA 3PAJA 1QDSA 5A6TC 1CGYA 1JZ7A 4AC7C 1GHSA 1J8VA 2O4MA 4WUIA 4F3HA 4I9MA 1VFOA 3XIMA 1U1HA 1XLLA 1SO4A 3WLRA 2QCDA 1MRQA 1NFBA 3O6DA 3BXWA 2J27A 1TMHA 3CLWA 1TPWA 3CPUA 4DIAA 4OOZA 3TYUA 3GVRA 2PEVA 4NX5A 2V38A 1YYAA 1HX0A 2I57A 4GYPA 4LT9A 1JL8A 5I24A 3ZJ7A 1OEPA 3DFSA 3OLIA 4NZ5A 1POKA 1QMLA 3BSMA 4KRZA 4UR7A 4LB3A 1F5ZA 4B9YA 4QNWA 3WLHA 3H7VA 3PK7A 3CH0A 3VGBA 3FIGA 3G22A 5HQLA 3G1HA 3K8KA 1KM3A 1U22A 4X9YA 3H21A 3SRFA 3CZJA 1XPGA 4Z1DA 4JBRA 3M6YA 4GH1A 2A0NA 3IV8A 4RE3A 3HM7A 3MB9A 2GQ3A 3P82A 1X39A 4K8EA 4Q33A 4ZE5A 1DWIM 2UZ9A 4LCSA 1UWAA 3AZSA 1HJWA 3LB0A 5FA5A 3GZ3A 3UG3A 3SADA 4DBSA 4R9OA 3TOPA 4LYQA 1X97A 3DHPA 4XZHA 3WD0A 3AIEA 1F9CA 3D3AA 2QGYA 3RYSA 3WLKX 1RR2A 4UC5A 2VFEA 2VEKA 1DYSA 4GGHA 4FR6A 3VCCA 4PUUA 4J4KA 3NQBA 3WEMA 1A5OC 1HJSA 2BASA 3DN5A 4GJ1A 3MP4A 1Q6RA 1FWJC 3T08A 3BAJA 3TVAA 3OTRA 4AXNA 4ZSUA 4AYGA 1XC4A 3G3MA 3CZLA 2A3EA 2YIHA 4N42A 1TSIA 4GPNA 5T26A 3WCZA 3V5CA 3KBNA 2GGHA 3TJXA 1OSEA 2ZE0A 3MCOA 3GDKA 4XZ9A 4UZUA 1VBHA 4R7OA 2VR2A 3L5LA 3GWQA 3SGUA 5DELA 5A94A 1UWQA 5MHBA 3EWYA 1VFLA 1S5WA 4AEOA 4QIUA 3QVQA 2I5IA 3V0UA 2I14A 4Q22A 1DPMA 3PWGA 4NZ3A 4ML4A 5U7SA 3UETA 3XINA 1A50A 3UJSA 2W3ZA 3RM9A 1Q6EA 3M0KA 5ABTA 3LHWA 3HPSA 1W9XA 4QG8A 2EKGA 4PRWA 2XJ7A 3CNYA 3VNLA 3N25A 4HOWA 1W3TA 1O95A 3C52A 4DF1A 5J04A 2WZEA 4NNAA 4DAIA 1I9CB 4D6GA 3A9BA 4H01A 5JVLA 3EKLA 3W7PA 2V69A 1EBGA 2UY4A 3TNOA 4DLFA 2FH8A 4PCFA 4UTTC 3WBYA 1KFCA 2QXWA 3PSWA 1X6LA 2C71A 4Q6XA 4PTVA 4JY8A 1TUXA 3VD5A 3WLIA 3KL0A 4GLEA 3S9YA 3ES8A 1XSJA 4KFOA 1NOFA 2AL1A 3M44A 2HWGA 1R3YA 5C9XA 1MNZA 1Q45A 4LALA 3HB9A 4HPNA 1PL9A 3TN4A 1GOOA 5K3VA 1IXNA 2XPKA 3F7JA 3EDJA 3NURA 2PDHA 4XISA 3VD4A 3OOQA 3I10A 1QATA 3F5LA 3IJDA 3VOJA 1GEHA 2OODA 4UZSA 3QMTA 4YVVA 2MUCA 1KRAC 2XN0A 4MLJA 1UIPA 1TX2A 3NAVA 3SSZA 1P0BA 4MKNA 1GPWA 4DJDA 4TTGA 2X0HA 1PZ0A 1SR0A 3WDRA 1IF2A 1H41A 5DXYA 1K03A 4MKSA 2B0MA 3VM5A 4B4FA 2W62A 3GC4A 4KEVA 1CB2A 1ZBWA 3ITCA 3GY1A 3KRZA 3PZVA 4XAYA 1YE6A 4CQBA 2QCHA 4LFYA 4O1BA 3W73A 1QTWA 1H4PA 2WANA 3S1XA 4JCLA 3VX0A 3UJFA 3WLTA 4Z42C 3ITOA 3UWQA 1Q7QA 3F2DA 4LH8A 1E6XM 1XFBA 3W7DA 5A8MA 4KQNA 3ERPA 3QM3A 1A0EA 3VYLA 3WENA 1SMDA 3GK0A 1O1HA 4W85A 5AHLA 4KT2A 1F61A 3TMLA 2BHUA 2O9OA 5BRQA 5BROA 4MWAD 2AKZA 4H6QA 1FWNA 2J7GA 1GW9A 1ONXA 1A53A 4ZOEA 3C0SA 1WAUA 3S2MA 2MANA 2IXVA 3BG3A 1TZ7A 2OSXA 2OEJA 3KHJA 1ZJHA 2V67A 2VRKA 2J47A 5DMYA 3S5ZA 2VC7A 1WKDA 3TTQA 3EOSA 3KTSA 3WK3A 5BXTA 1AQMA 3TNBA 3A3HA 3LCIA 1OK6A 3G3DA 5C8BB 3AYSA 4EWJA 1GHRA 5HMDA 5FJTA 3VD9A 1AMYA 4WXZA 3UCQA 3SEPA 3UR7A 1Q8JA 4O1DA 1YNPA 3KWXA 4PTDA 2JGQA 3ZWSA 4AMAA 1XHGA 4NZFA 4MIMA 1E9ZB 3POCA 2VFIA 2TYSA 4Z1YA 5AZ0A 1Y5WA 3UWVA 1PKLA 1U5HA 5BCAA 4JTCA 2OT0A 1SGJA 2X40A 3EWZA 1WXYA 3GXFA 4GNKB 5LYRA 3RLUA 1YBQB 4TTUA 1BQCA 3VKDA 1K6WA 2GK1B 3WO8A 1RQHA 1U33A 2PCQA 2VTFA 1P6BA 4ORIA 3W88A 5J5RA 1T7LA 4Z0SA 6A3HA 2G3MA 3WNKA 3W7NA 1M04A 4HOZA 1FWHC 1C7TA 1FWGC 2GJNA 5LXEA 1QI5A 4UFIA 4ZZ9A 3EXTA 4J27A 8XIAA 1EO7A 1OX6A 3RR4A 4AVOA 3G0SA 3TSBA 3KOYA 1QPKA 4C6IA 3WEZA 2ATSA 4Z2KA 4D8ZA 5JH2A 5DFAA 3PUDA 1FFRA 4XV0A 4DB7A 4A8RA 1E9LA 2UBPC 2VX7A 3FDGA 2BOGX 1DJXA 1VBGA 3GH7A 1WB0A 3TJIA 3WQGA 3ABRA 4WY0F 2ISDA 4UNLA 1RH9A 1W31A 4JYEA 5G2HA 2FLIA 2XIMA 3B8SA 3SCRA 1DVJA 5IFTA 4JYFA 1W17A 1HF6A 1CWYA 1E6PA 4HMCA 1BLIA 2GVEA 3EA3A 3QV6A 3L2LA 1N8WA 1XIJA 5M3WA 3A4AA 1OZMA 1VP5A 1ITCA 3GXIA 2GSHA 1M5WA 3QV7A 2QLYA 1LOLA 1FUYA 2DY3A 3A23A 4DJED 3TYDA 3M0MA 4US5D 3NTYA 3TN6A 1PIGA 1GVSA 3DYMA 3PJWA 3FVDA 3W75A 2YXGA 2PTYA 3OA5A 3CB8A 3TA9A 2YZRA 4QRNA 3S1WA 4PRRA 5GJNA 6TIMA 3GC2A 4DBEA 3LPPA 3WQ6A 2OKOA 4TX8A 2C16A 2C1GA 3TSDA 2PZ0A 1QI0A 2VKZG 2A2IA 3UPBA 4NAEB 2GGEA 3HTWA 3N2XA 1F07A 1LDCA 1UR2A 1V03A 4LUTB 3WH6A 1Y0EA 4ZSTA 5GNXA 1UZHA 2A3HA 3CEPA 1IIGA 2YZ5A 4BCEA 1O60A 1SW0A 4IPPA 3DYOA 2VCBA 3WLSA 2EO7A 2WBGA 4MNJA 3KX6A 3ZWTA 1Q7MA 3RIKA 4CNTA 5K9DA 5EA9A 2VEPA 4QAWA 2VELA 2JIWA 1XIGA 4W8LA 1JYNA 1G4EA 3SUSA 3NQ7A 3O6AA 3M5XA 3VNYA 2ZICA 1PHWA 2VR4A 2F9RA 1OFEA 4UTWC 3MBFA 4M29A 4H6KA 2EBNA 5A6MA 3STEA 4WJ8A 1LQ0A 2FFIA 1P0EA 1XSKA 3CL8A 2F6XA 3IAQA 1RP9A 3SCNA 5E93A 2PPGA 4AB4A 3SAZA 5HMFA 1EL3A 2JK2A 3JS3A 3CUZA 3C8NA 5CZSA 1UBSA 4OUIA 1E55A 3VNZA 1KLZA 2DUZA 3BLOA 3BMVA 1HXJA 1LUCB 2DT0A 2HVOA 4Y8FA 5EU9A 4HYRA 2PCEA 1VRXA 1EC8A 2PMQA 4NXKA 2OYLA 5ENLA 2VXNA 2ZWZA 4TMCA 1BD0A 1V6VA 2HBVA 5F4WA 5IHSA 2XFWA 3R43A 5BRPA 5F4SA 1EDQA 3SRHA 3PZTA 1YBQA 1QNRA 2GK1A 2VEIA 4GUFA 1SM9A 1C8YA 3SJ3A 1P1XA 2QIIA 4AZ5A 5HK4A 3CEUA 3EX6A 2NV2A 4IMGA 3WLNA 3QLLA 1KM5A 4OBRA 3OP2A 4NZCA 2X2GA 2PURA 1NU5A 6TAAA 3EMCA 3M46A 3K5XA 2ZWYA 5DCDA 3HG5A 4HYWA 3UJRA 4S3AA 4U4MA 1MFVA 2ABAA 3N4EA 4LVAA 1GQKA 1IWAA 4DJFA 1ICPA 1HN1A 1TYGA 1XJBA 3IGUA 4ZBCA 4K1GA 2WBKA 3OODA 3NZGA 4RW3A 3E0LA 1HKWA 2EPNA 3UWYA 1DWAM 4XQ6A 2PGEA 3MDUA 2VZVA 1AW1A 2F2HA 2X30A 2AMXA 2ISWA 3VKBA 2QF8A 3N04A 4NQ1A 3QY6A 1KXVA 4BFAA 2ZVIA 1RUSA 4XB3A 3W70A 2DZTA 1PX3A 5DQPA 3N11A 4C7DA 2E7FA 4EAMA 1H11A 3GFYA 1KFJA 5CSYA 3NEVA 1QOXA 1V7YA 4DZIA 3VNJA 3RXZA 3JUGA 3W28A 2FZDA 4A6GA 8A3HA 4ZQNA 3NL2A 4ZVJA 3IIPA 3PM6A 4C6DA 5CG7A 2GQAA 4E3VA 5I3DA 2WLZA 4HK7A 4XWUA 5T91A 4JQ2A 5H6HA 3MSDA 3SQMA 6ALDA 1RK6A 2F8QA 1T8XA 2J8GA 4XG1A 3ARYA 3FGCB 1TJ0A 4NILA 1I6NA 3GBEA 5D9OA 3KVLA 4ZQCA 4KETA 4NAEA 4XIAA 4K8HA 1VBRA 4ZO8A 3C2VA 4LUTA 3VKAA 3W6YA 2Y0FA 1HQTA 2DSKA 4F0LA 4J1OA 2VZOA 3W2MA 1GKQA 3BJSA 4DUVA 1S39A 2P88A 4L1WA 3LTSA 3C0JA 4WQ6A 1XBYA 4JKMA 5TBOA 1T40A 5EMJA 4YWSA 2E1WA 3WQ5A 1K70A 4L7ZA 3HA1A 1RK5A 5EFDA 3BJFA 4TX6A 1KV5A 2HVMA 2XH2A 2RDTA 7CGTA 3WD3A 2I7GA 4FOKA 3O9NA 3DKLA 3ID7A 1MSSA 4KERA 3F5KA 4PZVA 4W89A 4YTUA 2A4AA 3WH5A 3CJPA 1AD4A 5FJUA 3KCLA 1ITXA 3CYJA 4KEZA 4D1IA 4AHOA 4O1AA 2FIQA 3NQVA 2D24A 3HPXA 2Z7GA 2HV5A 5E70A 3QHMA 3DZ1A 1ODUA 1ZP3A 3TFCA 1NOUA 4Y9OA 5LNUA 2DFAA 4AWUA 1LUCA 3ZXWA 4AEEA 1HJQA 4AX6A 2D2JA 4UFHA 4ZB2A 3WIJA 3W24A 2XIJA 2Z28A 2E6DA 2XYLA 2CC0A 2OX4A 1ML1A 1AQFA 3MV01 4J2MA 4EAYA 3QGAC 1EHNA 1UWUA 1WKYA 1WP6A 4O13A 3VCRA 3O16A 2VDHA 3OVRA 2FHCA 3KP1A 2GVLA 1EPVA 4KKXA 3W1QA 2XISA 4JY9A 1YTDA 4PTNA 3H24A 4RCXA 3CZGA 1KTBA 2GJLA 3TH6A 4UTFA 3DBNA 5T9BG 3UXLA 3UPWA 1AQHA 5AB3A 1OGBA 1UKPA 1ALDA 2NZLA 4K37A 3TQKA 2Q6ZA 2D69A 1VFHA 3P8JA 2CPUA 1GEQA 2D1ZA 1K8ZA 4LAKA 2WW5A 4LW7A 4S3EA 2WVUA 2Z4GA 1F05A 2PU0A 1C9WA 3GG7A 2DIKA 4MFEA 2IPWA 3LRMA 1W3HA 3NWRA 3PBMA 4MWAB 5BRBA 2VWTA 2Z7KA 3BGAA 2AQVA 4L65A 3WMLA 1EC9A 4A8IA 5I3HA 2DIJA 2GWNA 3ALFA 4L9ZA 3GNDA 5E9XA 1YPXA 4KWVA 4Q8TA 2A3CA 4LBUA 2AAAA 1OYAA 3NPWA 3CWNA 1ICQA 3DH7A 5FESA 2TRSA 1GOKA 2PDQA 2EJAA 2E8YA 2PA6A 1K9FA 5JBFA 4P7QA 4RZ4A 3KCOA 3BICA 3E9AA 1VS1A 4DX3A 3H8AA 3BLKA 2WNQA 4GUHA 4E2BA 1OFRA 3VNIA 1FQ0A 3NZPA 4ASTA 3MYPA 3VZZA 1XD0A 2JEPA 4Q8UA 3UY7A 4BF9A 3EOEA 3FGCA 3H7UA 4Z1AA 8CGTA 2FZNA 1KXTA 4MAVA 3RU6A 4LVGA 4QFUA 3OO2A 1XIDA 3TXZA 2ZX5A 3LRKA 1FHLA 3MA8A 1CDGA 2ZA1A 3EWXA 3KW3A 3M43A 4RZ5A 2OYKA 1VIWA 2QCCA 3IEBA 3TA6A 3UYCA 1J0YA 3FJ6A 4NASA 4WEVX 2YL5A 3A3XA 2RDWA 1E0VA 1VC4A 3CH9A 1UKQA 3NVDA 1UD5A 2A21A 2J77A 2CW6A 1EO5A 1CIUA 3HG2A 1I2NA 4HMDA 4S3DA 4O14A 1H51A 5A95A 4DNMA 3IJ8A 1X96A 5I3JA 1E0XA 5AHIA 1F7BA 1BSLA 4QG9A 1F73A 3FV9A 4R9XA 1TKKA 2XVLA 4EPEC 1ICSA 5MF5A 4J3XA 2BTMA 3HQOA 2GQ9A 3QC0A 1GZGA 4RDVA 4XVEA 3PSVA 1Y7VA 5DF0A 1OBAA 3BUVA 4MM1A 4PCPA 3NZ1A 1GOWA 2QUMA 1GONA 4JX4A 3UG4A 2H3DA 2Y89A 3O2LA 3W7OA 2GJXB 4KF1A 4AD1A 5JBEA 3TEVA 1V6XA 3QPZA 1KTCA 1EP2A 4HNNA 1YPIA 4FX7A 2WHKA 3TJ4A 4H04A 3K8MA 2EKCA 2CHRA 1Q6CA 1XI3A 1ODZA 1RA0A 3KTXA 1XLKA 1AH3A 4FNUA 1S1RA 4ZQPA 3ABZA 3PZ9A 1RLCL 4RE4A 3S1UA 3V35A 3AFBA 5CLTA 4O1EA 3R94A 3OGSA 3HGSA 5C5YA 3W71A 4CUCA 4L4PA 5DBUA 2CLFA 3A5FA 1PTAA 1UR8A 4AU0A 3N2BA 4JIHA 2QJIA 4JNYA 3WUEA 4K39A 1PUDA 2ANUA 1WQ5A 4GZ7A 3MUY1 1O4UA 3I6EA 2NX1A 2X09A 1PEZA 1RZMA 4BA0A 1NSJA 1D9EA 2WMHA 4MWAA 1RY8A 1UUMA 3B9OA 3MSRA 3JZUA 5G2IA 3FJNA 1XG4A 1XYMA 2DVTA 5LGXA 3QSRA 4KWUA 1TREA 2R1KA 3NQDA 2R6OA 1EEXA 1BYAA 4JKKA 5CZ0A 3APTA 1H7PA 3LTPA 2OSWA 2UY2A 4R53A 3VOIA 1DV7A 2RUSA 3WMSA 5D2WA 4XAGA 3NM1A 3LV5A 3VCNA 3OG2A 2QJGA 4HA1A 1B3YA 1V3KA 3PZUA 1W1PA 1YLVA 4JTLA 3VPLA 4H8HA 2V30A 2VX5A 3U7BA 5K4ZA 3DC0A 1PCKA 2BGSA 1ISVA 3VC6A 3ARPA 2VMFA 4YN5A 3URAA 2C1HA 3PZOA 4R88A 2PODA 4DN1A 3PWAA 4GY1A 2VOTA 3I3DA 2D20A 2PE4A 3AIQA 4J3UA 4O15A 4HPHA 3GXTA 1JCXA 4PMNA 2EPKX 5D09A 4E5TA 4NP7A 3AS2A 4NJHA 4C5YA 4QE1A 3R8RA 1ECQA 3CO8A 1H63A 1XCFA 1M65A 4BF7A 3DYPA 2G41A 4BHYA 3VNKA 5DRIA 1ZBVA 1XS2A 1GVIA 1ZSXA 3ZVIA 1F3WA 4M1RA 1LBFA 2QMKA 1I4NA 2I5GA 3CGTA 1L6WA 1B3WA 4E6MA 3TN3A 1B30A 1H2JA 1O5KA 3WNMA 1M7JA 4YTQA 3ZYZA 1QJWA 2ZZ4A 5CG0A 2ZUWA 3QC3A 1W32A 4NF7A 4LAUA 2WNZA 1UD4A 1Z69A 1E6SM 4HZ7A 1PKNA 2O92A 4DM2A 3SGZA 4AQLA 1W1YA 1QAPA 3CB3A 4MPKA 1UWRA 1OIMA 1FP8A 2V5BA 2GJXA 3OIHA 1G6CA 5AYXA 2DP3A 4XSMA 4UTTA 4B3LA 3NDZA 2WVTA 4ZFCA 2X0SA 3M07A 3B0UX 3KOFA 1VIZA 2PRMA 3MHGA 3H2OA 4DJEA 5TQLA 4G5DA 3C2YA 3EEGA 1O1ZA 4US5A 3VILA 4IXHA 2RGLA 3CV1A 3C61A 1XYAA 2HE5A 4KRUA 5DN1A 1NTHA 1SO3A 2YX0A 4QS5A 3T8QA 1XDJA 2YL8A 2V0TA 1EB3A 1KM2A 3W01A 4LNYA 3DKJA 3C0LA 4KWSA 1UC5A 2CLLA 3ZS4A 4HNVA 1J6OA 3FJ4A 3LRLA 4RNIA 1YXCA 2C1IA 3P61A 5M03A 2PWHA 4YPJA 3PPHA 1P0DA 1JCYA 3KOZA 1Z89A 3BDKA 1R2SA 4C1NB 2QYGA 3AXXA 1JDCA 2P3EA 1CXHA 3G24A 2F61A 3KZSA 3FXGA 5L9FA 4GMEA 1J0JA 3SUVA 1L8NA 3W76A 5EGRA 2ISFA 5HJLA 3H2FA 4XZMX 2W61A 4GC3A 1HJVA 4ZO6A 4CCZA 1VLWA 1XLHA 2NUYA 2ZRWA 4DWDA 1PX8A 5DO8A 3AIUA 3G0XA 2P8CA 2E09A 4DM1A 2E67A 1ZCOA 1V6TA 4JIIX 3SDOA 3IAPA 3W07A 4XD4A 4IJBA 3TN5A 3G1YA 2FDSA 1QPRA 4Z1BA 5MKGB 1OZQA 3U5YA 3EWCA 5RUBA 1VCGA 5C9WA 6CGTA 4BKNA 1F8MA 3WEOA 4S39A 1BWLA 3LK6A 1SQ7A 3BE7A 3N2OA 2GQ8A 2VJXA 1W56A 2Y88A 1YE4A 1EWDA 3UW6A 1XWYA 2B7PA 4JN8A 4GBDA 2H3BA 4ICMA 1J5SA 1E4MM 3KVJA 4CVUA 4QG6A 1X1ZA 1GW1A 4PMDA 4A3UA 4RPPA 3Q65A 5KZDA 3SCQA 2E6YA 1BVNP 3W2JA 3CZ8A 2V3DA 3RX4A 5AFDA 1YX1A 2CBUA 4H7VA 3NO1A 1YRRA 3CWOX 2B31A 2ZX7A 3CAQA 3O07A 1D3CA 3T0DA 3V5OA 1W5PA 2PD9A 4K68A 1H62A 1LG2A 2NLYA 1E15A 4GG9A 1LOSA 2A7NA 4MVAA 1JULA 4HSHA 2W63A 3EX1A 3SFWA 4N6FA 1R2RA 3I7QA 2OMAA 1N7KA 1W1VA 3AI0A 4JTSA 3OIXA 1PVNA 4LGXA 3KBJA 2KX9A 1CLVA 2QJNA 2CLHA 2C0AA 1DQUA 8RUCA 2IKGA 4W84A 5LKYA 3TTEA 5CPMA 2WVVB 4Q4SA 1N55A 4LXFA 1GJPA 3FEQA 3ITLA 5HWMA 3SJNA 1KCXA 3BAYA 5K9XA 4I8YA 1TVNA 3BG5A 5I2UA 3GFZA 2YDSA 4LY4A 1E6ZA 3HIJA 1OT1A 2RKXA 3LCFA 5F2GA 1G4TA 1ZAHA 4UCGA 3PBWA 5BWFA 5C55A 4PRTA 3BGJA 4KESA 2BNJA 1I0BA 5KINA 3BSGA 2HPMA 4ENLA 2VURA 5FOOA 4E4PA 4IF2A 4U3AA 4Q4OA 1NFGA 3AQUA 1BFNA 5HULA 3M41A 1JZ2A 5AYZA 4PMUA 4AZGA 3ZSSA 1TR9A 4BI7A 3LBMA 3U7VA 3UWZA 2FKPA 4IJCA 4CU6A 2BY1A 1JCMP 1W9VA 3VDHA 5AC4A 4XAZA 4XK2A 1GVOA 1RALA 2IPJA 2GLKA 3IVUA 4P8WA 3TKFA 2F38A 4KIEA 4JTFA 4CNUA 1W37A 3ZR5A 4GVHA 4YIWA 4C1NA 5FJJA 3ZIZA 2J24A 5FD0A 3OBKA 3VC5A 2G96A 1VB9A 1ZTVA 5JH1A 3A22A 2AGKA 3AU2A 1NJJA 3DXIA 4CQ8A 1JGIA 1S46A 2V3EA 3T0AA 3FJLA 3GM8A 2Y8VA 2PTXA 1MW0A 2OR2A 3GBDA 4CLMA 5AC8A 2ZUMA 1GVRA 1KCKA 3P67A 1DJNA 4M51A 4YCOA 3M0XA 1YTKA 5MKGA 5PTDA 2VFGA 3V0SA 1CECA 3TCSA 8XIMA 1XBVA 1FDJA 5FEPA 4XBSA 1TV5A 2ZXQA 3CL6A 4PMVA 2WPBA 4LYRA 3C2EA 2XGIA 2BLEA 2XU2A 1GOMA 2OEMA 2GVJA 4G7FA 2ZUNA 4H2CA 1Z48A 3PTKA 2D0FA 4DO5A 4JEJA 2CLKA 3QBUA 4QNEA 3WQDA 2BODX 4O11A 1K4GA 4DAFA 4PUKA 1A5MC 4MPQA 4V28A 3P74A 2YA2A 4YMZA 2DZVA 1XCWA 1RY0A 2BDQA 2EHHA 4YLWA 2ZXBA 3VZXA 3ARXA 3BV4A 3LV6A 1TTIA 3A21A 1EJWC 2JF6A 2PLCA 1V77A 5KZMA 4GX9A 5FJPA 2Y85A 1TMQA 3DHFA 4GYPC 2DSUA 3JZEA 1F3XA 3WQFA 3GG8A 2FPVA 4JTRA 5FACA 4GVGA 3IGHX 3QEZA 3S5NA 3M5ZA 1EPXA 1HKVA 2CETA 7REQB 2WVVA 5EMMA 1TRIA 4GQGA 1PV8A 3WQOA 4D8LA 4JDYA 5E1QA 3W0KA 9RUBA 1Z41A 5GVJA 3VIKA 1LBLA 1EDTA 3M47A 2WC4A 3IGXA 1CXIA 1CLXA 3CZKA 4F79A 2ISSA 1B4EA 2DSVA 3G1XA 3PUGA 1TJRA 2X7WA 1VR6A 3W86A 4I9TA 1ZJBA 2IS7A 4DZHA 3WDIA 1EF3A 4UOQA 5BW6A 1KXQA 1SJCA 4UB9A 1A3XA 1XPYA 1EGZA 3AYRA 3L4ZA 1IXPA 1JNEA 4MNLA 4UMAA 3MO7A 2ZYFA 4O52A 2P1FA 4UTJA 3UPMA 5LHEA 3BW2A 3BOLA 4ADUA 3BLIA 4I7WA 4O0QA 3GR8A 3W27A 2OZ3A 4W93A 2HNHA 1WYIA 4BQ5A 1WDWA 1HO4A 3NO3A 3TC6A 2D3NA 3H26A 3U8GA 1DWGM 2G8ZA 2J9XA 4RR4A 1KR1A 4GUIA 3TQPA 4LANA 4DF0A 3IIZA 2A1YA 5CGQA 2YCKX 1EBHA 3I6RA 3U3HA 4YTSA 3SZ8A 1UKSA 4HZ8A 4PODA 4NNCA 1ONEA 1NDYA 2QR6A 4QJ3B 1EYEA 3GB6A 1SSDA 5D9NA 2WSKA 1QBAA 3B4YA 3KFTA 1Q65A 2VO5A 1DHKA 1YMYA 3R7MA 4HPXA 4R3UA 1UR0A 4P7NA 1V3LA 2HK1A 4HP5A 4DO4A 2PZNA 4JQ4A 3YPIA 4X22A 3UXAA 5A6LA 5JIPA 2QULA 3LLXA 2ZZ5A 3V1HA 1DIKA 2Z27A 1GTHA 1JXJA 4OGZA 5EMKA 2W4XA 2NXIA 2F2KA 3U4AA 3M9YA 3C3NA 3MBDA 2ZA2A 3GTNA 7TAAA 3IANA 2WNNA 2O7SA 2BBFA 5AYYA 3GIPA 1OC6A 2XSAA 4J35A 5H91A 1T96A 3CV7A 1SU5A 3TMQA 1DKWA 1M01A 4QEEA 3AAMA 1VEMA 3EDEA 4DYJA 4CEXC 1IEQA 2YBUA 1W1IE 3GO2A 4S23A 5KZ6A 1RVKA 1I2RA 1XYZA 5FAGA 2J7BA 2QKFA 4DRSA 4HU8A 1UA7A 3FNDA 1RBLA 3QV8A 3H4WA 3WDJA 5EPDA 1OHLA 1XW8A 4M82A 4AD3A 2OOFA 2Y8UA 3G0UA 2WKLA 4IIFA 4M0XA 2YCEA 1QW8A 3O63A 3M6DA 2PDPA 4PMYA 2PSNA 3LHVA 4C6FA 3A12A 4MY1A 1DQWA 1JPDX 3IUDA 4LCRA 5I09A 5HUPA 4DJDC 1QWKA 1E3ZA 3WF2A 1MZHA 7REQA 1UD8A 1OQFA 3T4WA 4YCPA 4S3KA 3WMBA 4P8XA 1OFBA 4L1GA 2P50A 3RU8X 4A8NA 2VNCA 4NVTA 1W5MA 2DPEA 3OVGA 2C79A 4OKDA 2HDJA 3WQEA 2VGFA 4GO8A 2GSEA 4DYKA 4E38A 5IDZA 4RNFA 1Y5XA 3TLQA 3GG0A 3VIPA 2ZA3A 1OFDA 1E6NA 3OYXA 1O5XA 5CAKA 1FWAC 3ZSTA 3RMJA 1S5TA 4GNVA 3PBGA 3OLDA 3WQVA 4HU3A 2GDQA 4I9JA 1ITQA 1AW5A 2A85A 1JDDA 3WK1A 3M7SA 2CITA 1QK0A 4E8CA 4AWSA 2PDMA 1GKRA 3W1TA 1ZB5A 1QT1A 3TJLA 2RH9A 1AH0A 3AMCA 4PUNA 5I23A 5I7GA 2BY0A 3MDWA 2ZC8A 5ABEA 2WC3A 3RG6A 4CVWA 4NT0A 2WNWA 1Q6QA 4FXSA 3MVIA 2BHZA 4FEZA 3IUIA 3W83A 3LN3A 2BX7A 2WHJA 1V6WA 1UIOA 1D3GA 4KCTA 5FSDC 1CGUA 2WK2A 4TUFA 4IIGA 1Q63A 2PUZA 4JTKA 5FSEC 7PTDA 3L67A 4ZA0A 2XH0A 4MUZA 4NHVA 2TSYA 3LXAA 2P10A 1ISWA 4DY1A 5I3KA 3C2RA 1K7FA 4IISA 2DH3A 4G7EB 3S2NA 2BSLA 3NL6A 4G1NA 5U4NA 3VGGA 5D03A 3N14A 3WJZA 3TWBA 3GNXA 3VDCA 3LY0A 1GVEA 3PZQA 4H9XA 3P93A 2ZC1A 3GUGA 2H90A 2ACSA 1TTQA 1LT7A 3A64A 4FX6M 1S5NA 3GE7A 2QNEA 4X63A 2D2HA 3VIOA 5DMNA 4D6FA 2V68A 5GJPA 2A3BA 3QPYA 5CEWA 4NRSA 5A6JA 4EPKA 2DT1A 3L4VA 3V7PA 4TR9A 4B3ZA 4RNHA 3NZQA 2INEA 2EG6A 2Q3OA 2D2OA 4F9JA 2TAAA 4GY7A 5F2MA 4LUJA 3EEZA 3S4TA 5DCEA 4GIRA 2Q8LA 3SCPA 3NNTA 3E1F1 1NAL1 3GVQA 2WMIB 1QASA 3T78A 2JQXA 3P3BA 3L12A 2WQPA 3WFLA 1L6GA 1TWWA 3MUZ1 2ZZ1A 3SQLA 5BWAA 3WQ8A 2YYTA 3QPEA 1UHVA 4ORMA 4AMCA 1OD0A 3D46A 4Y6GA 4MZYA 3RM4A 3MJMA 1H7NA 1GJWA 2CU0A 5CSUA 2J66A 2WAGA 1U1UA 2R14A 3BSHA 3MI6A 1TPB1 1M3UA 4I5UA 3GW3A 3TZNA 4CCDA 4PUWA 1Z8AA 3MJYA 1OG6A 3AXMA 3U2OA 2X1IA 4ZB0A 2ABBA 3NSXA 1VFTA 5D2TA 3AYTA 1CENA 3VOFA 4PMJA 3NJ3A 1OT2A 3ARRA 1BG9A 5AYBA 3VABA 1A47A 3R0KA 3E6EA 1BXNA 3VX1A 1OGSA 3WLOA 3IK2A 3UR8A 4D6DA 3A5VA 1UBPC 4OTKA 1C8VA 1X6NA 3LQGA 1X98A 1SZNA 2R1LA 3LMYA 1DJYA 2OKTA 4O10A 3N9KA 1XR2A 1WPCA 2WM0A 3NQCA 4XTIA 3LNMA 5I3GA 1AFSA 3MUIA 4ADTA 3QMSA 1RJPA 3OZOA 4WXYA 5I3IA 1K1DA 5I00A 2H6RA 2PLKA 5FL0A 3COTA 1A0DA 1S5MA 5BOEA 4RV3A 5EFFA 3L4YA 4MY9A 1FWDC 4Y9AA 3EWBX 3KOXA 5J5DA 4H9TA 1M9HA 3RFAA 1NWUA 1TPEA 2G3JA 3MANA 2VENA 1NF0A 4XKMA 3VIGA 1UP0A 3QH2A 1U5JA 1J4EA 4MHBA 1Z6KA 3NFUA 1W9DM 3K4WA 2DUXA 2VL4A 2DT3A 2QW5A 3PPFA 1GK8A 1KFEA 1O94A 1XLCA 4HMEA 4W7WA 2RGMA 1UKTA 3TTSA 2WMJA 4O16A 2OLSA 1WOBA 4I6VA 2NSXA 4X0VA 1EWEA 4MGGA 2J4GA 5D37A 3EXRA 2OTDA 1VZWA 2ATMA 4HU4A 4G7EA 1H61A 5CBBA 2JKEA 1A4MA 3FEMA 5LZLA 1S2UA 3VMOA 3HGOA 3TV8A 4J3TA 4N7QA 1J5TA 1OYCA 3BPWA 1J01A 1L0PA 1QW7A 3ARWA 3QQ1A 2ZX8A 3N2MA 1J10A 2I9EA 3CUFA 2BXZA 1HZYA 3SN0A 1JJKA 2Z1VA 1V0LA 2YCLB 3PANA 4HT3A 1ZBKA 1RP8A 3MZ2A 4YL2A 3HMCA 1O68A 2YXXA 1XBXA 1TV7A 5T8GA 4IFKB 5CPTA 1JPKA 3MT1A 2DZAA 1RV8A 1TQXA 1Z9AA 2QJMA 3A4WA 3G18A 4DJFC 1IEIA 1BYBA 5DY3A 2NV1A 3NCOA 5K7JA 3NQAA 3Q58A 3B8UA 1Q6DA 1CLKA 1WKFA 2JF7A 3VD3A 3FYYA 1E70M 4BWLA 7XIMA 1BWKA 5T9CE 1GPFA 1S2WA 3WBAA 4YYFA 3LI0A 4QSFA 3GXNA 1XDLA 5M1TA 4NSBA 4UNIA 3AIBA 2ZZ2A 3N15A 1ME7A 3CLMA 5CXPA 1KQYA 3AALA 4ZMGA 3KBMA 1IZKA 3GSMA 4Q8MA 4ERGA 1CYGA 1U2YA 1RCXB 1JPIA 1JZ6A 3DHUA 4WZHA 4LV9A 4IIHA 3L0GA 4F0MA 1IQ8A 5JIWA 3W3OA 3EB3A 5HDRA 2QDDA 4JFUA 2BV9A 2POTA 4AYSA 1BF6A 1QNOA 1E5JA 1FCBA 4OZOA 2VOMA 5JUVA 4XSLA 2UV8G 1UJPA 4LJ3A 3SM0A 3KE0A 4PBEA 2VRQA 4MJZA 1AVAA 1PO9A 3PN8A 2R9RA 3TSMA 3BWWA 4DBWA 1CGXA 4HHPA 4ZXOA 2VUNA 4OUEA 1JYXA 4W7VA 5KMYA 3EGJA 1J12A 2HCVA 2QUNA 2HVNA 2X05A 1UZ4A 4PL2A 5CSRA 4N9DA 1PYFA 2EG8A 3M0LA 4O57A 1G7VA 3PBUA 1HUVA 3TP4A 3ZM8A 2YCJA 4CEUC 4UFLA 3W38A 4JCMA 2BVWA 1O12A 5AY7A 3U2CA 3GX9A 2J7FA 1AJ0A 3KVMA 2JEQA 4FIRA 4ZL1A 3CV6A 3RR1A 2QF7A 4L5ZA 3WG6A 4M6UA 3AMGA 1MQPA 5I07A 1X7IA 5EMLA 1JZ4A 1M7OA 1EA9C 4M8UA 4WJXA 3CL7A 4D6IA 1US3A 4W87A 1HW6A 3OHMB 5CCZA 3TU9A 3WD2A 3SURA 1KBBA 1OM0A 3HOJA 1QFEA 4NJIA 2VQUA 3DAQA 1Q4WA 1G4SA 3T0BA 2J6XA 1BRLB 2YLAA 3EOOA 2GPTA 3DECA 1V6YA 3VVGA 1JAKA 4C6QA 5HNRA 3QXBA 4MAZA 3QKZA 1OCBA 1OCNA 3CWHA 1KKRA 3HV9A 3DHDA 2HS8A 2J8TA 5G1TA 2R1PA 1J93A 1XL9A 4S2BA 3RAOA 3WF4A 1CXKA 2QV5A 3ONBA 4FF7A 4UMBA 2A7PA 3OZMA 3JR2A 4CN6A 3BAKA 2YCLA 4JFSA 4DF2A 2GVGA 1E71M 3T0CA 4NY2A 1NM9A 1QVBA 4IFKA 4OU1A 3ITGA 1I2OA 4RKAA 3OU8A 4OQVA 4C6CA 1CGTA 1T99A 2GDVA 3OBAA 1G9HA 3N12A 4LYKA 4EXBA 3TW6A 3OQ8A 1TX0A 5I6SA 3UFYA 1VRDA 3G1AA 3PTQA 1BPLB 1OC7A 3Q45A 2X1SA 3L4TA 3TC3A 1VFSA 3PJTA 3T7VA 1DE6A 2UWFA 1TZZA 2VUYA 3SB0A 4D1JA 1AUSL 1E73M 4X3ZA 2Q8ZA 4MZ1A 3VNDA 1A5CA 4R7WA 1K3UA 4RV8A 3ECQA 4XZLX 5C71A 4HA0A 2BGQA 5DMLA 1OVDA 4JHMA 1VAHA 2OLAA 2C13A 3VI2A 3A4XA 3QTPA 1JCJA 3RM8A 4MUPA 3L5MA 2F7FA 2PF8A 3H70A 1H1YA 4OWGA 4JICA 3KEHA 3WK2A 1HP4A 2NX9A 1MDLA 1E5NA 3ME3A 2Y1HA 4H19A 1FH8A 2DUAA 3ISIX 4XUGA 4W8AA 1BHGA 2QQ6A 4N9BA 1OB0A 1UUOA 3IJ6A 4IL2A 5CJNA 4QR6A 4PB4A 2CNCA 4H3DA 4KGJA 4QJ5B 2Y70A 4FAMA 1Q6OA 3W7HA 1FY6A 1OFOA 4H9VA 3E3HA 1XISA 3PJUA 2WWCA 3UR2A 1UR4A 1GG1A 4UXDA 4Y9MA 2DORA 2JFEX 3UZXA 1UC4A 5F1UA 5FF3A 3UG5A 3WLJA 1D2KA 2FJUB 1GQJA 5TF0A 1BXCA 4EF8A 2ESCA 2YFNA 1OADA 1OIFA 2IQDA 4MOZA 2GFTA 1WBJA 4ADSA 1UD3A 3UVAA 2J6VA 2Y5EA 5GJMA 4C6OA 2WKGA 4WGHA 1W1TA 2YA1A 3T42A 3DFYA 4JFWA 1PE1A 4ZR8A 3WFZA 1TJPA 4QCFA 1VHCA 1TPH1 2AL2B 1Q6LA 4CKQA 4HD5A 1ZY9A 4XZBA 2PD5A 1ISXA 2BS9A 1NOWA 2YDAA 2WCSA 4E8GA 2WHMA 1H5VA 1XQLA 2Y7EA 2FB3A 2Y8KA 1VFUA 1A5SA 3TFXA 1KCZA 5CPLA 1BRLA 4EF9A 3VIJA 1L2UA 1G5AA 5IRPA 2PDLA 2GJRA 3UXDA 1IGWA 4WLCA 9CGTA 5H2ZA 1BWVA 1Z44A 4UTIA 3TIMA 2PWGA 1DHPA 1QRQA 2D2GA 1KBLA 3BO9A 1ZAIA 2E1DA 3GR7A 3CV2A 5CPNA 4KGLA 2OSYA 3R58A 4AWEA 2QS8A 2VC9A 3Q67A 1MUMA 1E0TA 3R12A 1TV8A 1Q6GA 3KS5A 4IQLA 3AHXA 5DMMA 3PJXA 2FVLA 1FWRA 4W7UA 3SO7A 3AUOA 3SI9A 3G1DA 1SYTA 1TQJA 5KZEA 4IHCA 3PUEA 3A24A 1ZJIA 3E5BA