1TE1A

Crystal structure of family 11 xylanase in complex with inhibitor (xip-i)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
274
Chain Sequence
b'AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase inhibitor protein I
molecule tags Hydrolase inhibitor/hydrolase
source organism Penicillium funiculosum
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
total genus 92
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1te1A00
1C8YA 3IK2A 2ESCA 4PUEA 1NWUA 1VJSA 2TAAA 4Z2LA 1XYZA 1PPIA 3BAXA 3BMVA 3U7VA 5HXMA 3WENA 2XUCA 3THCA 3UG4A 3LPGA 1W3JA 1UZ1A 4CU7A 1Q4NX 5ABHA 5JUVA 4PCSA 4ACYA 3AYRA 4GO9A 4B3KA 1W2VA 4ZXLA 4Z2JA 1VFMA 5A2BA 3QGVA 4NSBA 5FIPA 1SMDA 2ZWZA 3PZVA 4QCEA 1D7FA 2JEPA 2G3JA 1XCWA 2Y24A 4H41A 4GQQA 2C7FA 4UFIA 3DYMA 3VIPA 1UQYA 2VL4A 5A6LA 1UD6A 2GJPA 4C7FA 3SUUA 1KWKA 1FH7A 1ZBKA 4FLSA 5D8WA 4UZUA 4D6EA 1OINA 2VC9A 4DWSD 2WVSA 1UWUA 3VIOA 2NT1A 1TUXA 1V0NA 5BYWA 1G0CA 1LL7A 3W4RA 4NI3A 1XH1A 4AWEA 2BXYA 3N18A 3ZO9A 1QNOA 4AYSA 1AQHA 3FN9A 4UFHA 4PMVA 3GYCA 7TAAA 1XC6A 5I77A 1QVBA 3OBAA 1B3WA 2J7GA 5D9NA 3BC9A 1UKSA 1ESWA 3PZIA 3PBGA 1MW1A 1K6AA 1V6YA 1U33A 5A8NA 3WDIA 4IPNB 1XRVA 6A3HA 1QBAA 5EFFA 2W66A 5LA2A 1V03A 2D1ZA 3WF4A 2XWEA 2WLYA 4MNLA 4AEEA 3VGHA 1OIMA 4GQRA 1HJSA 1XGZA 3RM8A 1TVNA 2QMKA 4CU8A 2Y4SA 4NZCA 2EQDA 2CKSA 4IM4A 2W4XA 3VDBA 3CZKA 3FY1A 3O6AA 3SCRA 2BHUA 4HMDA 1WDPA 1JNEA 3ARPA 3D5HA 4YPJA 1UR1A 2X0HA 5HPOA 2G41A 1QI0A 4M81A 3VIKA 4A4AA 3WL1A 3W28A 5A1AA 2XSBA 2XFRA 1TCMA 2YLLA 1ODZA 1JYVA 3MMUA 3T0AA 1FFRA 4OBRA 3ZM8A 1E6QM 4J28A 4CVUA 3M07A 2VX6A 4B15A 1JL8A 4OUEA 2WMGA 2IXUA 3CHEA 1UWRA 1QW9A 4CD7A 5CJ5A 5GNZA 3F5JA 4WJXA 2WHLA 4Q7NA 1UG6A 1J0KA 1DWFM 1TA3A 1EOMA 5C71A 3W37A 3GH5A 1B3YA 4P7LA 3T0BA 2V3DA 1BVNP 3VX0A 1OD0A 1A3HA 2WHJA 3VD7A 4PTXA 1G9HA 3WF0A 2JF7A 3VMOA 2J7HA 4E4PA 3ZR5A 3AS2A 4E8CA 3WUBA 3AIVA 3WBEA 3AHXA 1JI1A 1ZBCA 1GJUA 1LWHA 3RIKA 4MJ4A 5LYRA 1HKKA 3KEHA 1OT2A 1EQCA 3K8MA 4UNIA 2EEXA 2A3EA 3W53A 2VO5A 2DEPA 3CBWA 1NP0A 2C0HA 2PI6A 1MYRA 3OGSA 4DM1A 3VVGA 4B9ZA 3A6OA 1BQCA 4V2XA 1QBBA 4M82A 2GUYA 2IUZA 3GNRA 1V3MA 3N15A 1B30A 3HJEA 2YDQA 1H3GA 5E09A 3WUFA 1CXIA 1E0VA 1QNSA 4CD5A 1VJZA 1K9DA 1HP5A 2DSZA 4DWSA 1HJWA 1PJ9A 5I6SA 5I5RA 3T2OA 1ISXA 5GNXA 2OWWA 1UA3A 1CECA 5DEZA 1VIWA 3AS1A 1G5AA 1V0MA 4XUYA 4UOJA 4W7WA 1MQQA 3POCA 4DWSC 4P7RA 2CNCA 1HVQA 2J8GA 1R87A 1M7XA 4WIWA 3CZEA 2EPMX 2BY2A 4JIEA 1H0IA 1QOXA 1MFVA 4P7NA 2O9PA 1KWGA 1JG9A 4H2CA 4PMNA 3BCDA 5A69A 2W92A 3WH8A 1WP6A 2GK1A 3L4XA 3EDKA 2NT0A 2ZWYA 3BLKA 4XX6A 1UR9A 3M7SA 2EO7A 2ZX8A 1C8XA 5F7UA 1MW0A 1R8LA 4WSJA 2DH3A 1JDDA 1E4IA 4W8LA 3VD5A 3GZAA 1MFUA 4M24A 2ZIDA 1KGXA 1UR2A 3IJ9A 4ZEPA 1FA2A 3GXDA 5CG0A 1E0XA 4X0NA 1NOWA 4TVDA 4D6DA 1AMYA 1GOIA 3O9NA 3F4VA 4QLLA 4UFLA 4AD5A 2E0PA 2WCGA 3N1AA 1CPUA 2WANA 4D6GA 3KE0A 1EO5A 3AMGA 1QI2A 2WZHA 3IAPA 4J3WA 1VEPA 4V28A 3UR7A 1WCGA 3CZJA 1N82A 3OB8A 2ZUNA 4HMCA 2WBKA 1QI5A 4B9YA 5CPQA 4DUVA 2CBVA 2G4FA 4WLCA 2ZICA 4M8UA 3WQVA 1FHLA 2JE8A 4TTGA 1B0IA 1PZ3A 4XB3A 3SUTA 3POHA 2G3MA 1GOKA 1GQIA 4GPNA 4HPGA 4AW7A 2CEQA 1MXGA 3WNNA 1W1YA 1E6ZA 2D2OA 1MVYA 3GBEA 3CH9A 1IT0A 3B9AA 4W8AA 1EGZA 4S3KA 2PBOA 7A3HA 1F4HA 3L4VA 5I3DA 1JXJA 2J7CA 3IJ7A 1CGUA 2J7EA 4BCEA 4ACZA 3SCUA 4ATLA 1EDQA 3B9EA 3TP4A 2CHOA 2DDXA 4FLOA 3WDQA 1U30A 4UQEA 2J7DA 5BWFA 1DP0A 3WMSA 2OWCA 1JIBA 2G3IA 2VVNA 4P8WA 3F5LA 1B1YA 3NUKA 4RE2A 3CIVA 3CHCA 3SCWA 1QNQA 4QP0A 3VIIA 5JBFA 3VIHA 4OOUA 5I79A 3WDJA 2AMGA 5BCAA 1J0HA 4PSRA 4H8VA 4DM2A 1MXDA 4TTUA 4MB3A 3ARQA 4LGXA 4TVUA 1EHNA 4RL3A 2XYLA 3MUY1 3L2LA 3AICA 3L4ZA 1UR0A 2Z1KA 4UCFA 2JIWA 1LLOA 3ZIZA 2VMFA 1ISVA 1R85A 5E0CA 4CCCA 4W85A 3WNKA 3LPFA 3FNDA 5FD0A 1VB9A 1H5VA 2D0FA 1I1XA 4W7VA 1DWIM 3BXWA 3UEQA 3LPPA 4RE4A 2GDUA 3AZTA 3AS3A 1EHAA 1CBGA 1DHKA 3MUIA 3ZSTA 2PF0A 5HNNA 2GDVA 3QOMA 3RO8A 2VJXA 3ARVA 5DO8A 3VGDA 3M6DA 5EBAA 1E6SM 2O9RA 2FHFA 1WZMA 2V5DA 2BHZA 4MJ2A 2GK1B 1GPFA 1V08A 4CN4A 1P6WA 4A3YA 1KQYA 4DWSB 3ARWA 3G6MA 1CIUA 2PWDA 1FHDA 2XGIA 1TR1A 3KL0A 2DT3A 2FH6A 5FOOA 1HIZA 2J77A 5ABEA 1JFXA 3GXIA 4GI8A 2WCSA 4UQDA 1E1FA 1GJWA 4AXNA 3TA9A 4PSPA 1CXFA 3WH7A 3WD0A 4LPCA 3VX1A 1ITCA 2W67A 1HJXA 4PUDA 3I3BA 3LPOA 3QHOA 3WFZA 2JF6A 3OGRA 1E6XM 1UHVA 3BGAA 5A2AA 2XVNA 1E4LA 4H7VA 4JHZA 1VFOA 3ARUA 4HA4A 3WQWA 3IAQA 1J0JA 3AMKA 3BMWA 4JFTA 4Z2GA 3WNPA 4ZXOA 4U2YA 4W5UA 1ITXA 1HVXA 2D0GA 3T09A 3MSGA 4RE3A 3OG2A 1DTUA 1H2JA 3SCNA 3PTKA 1ISYA 1FP8A 4CUCA 3CUHA 4XZWA 2X0YA 5FL0A 1TMQA 2D0HA 1NOUA 1UKPA 4CD6A 3APGA 3CTTA 4AD4A 5I78A 1GVYA 5KZ6A 1W91A 3RM4A 4DUXA 4AZ5A 4W84A 4W86A 2J74A 4WK9A 2BXZA 1PBGA 4WKFA 2WM0A 3U5UA 3W82A 1E15A 4HP5A 5CPTA 4ZE4A 1S46A 1EO7A 3AIWA 1UUQA 2XTKA 3MUZ1 1EXPA 2DPEA 4CD4A 1GORA 4PMUA 2WKLA 1NQ6A 4UQ9A 4MNJA 1MQRA 2CXGA 4QDMA 1VRXA 4PMOA 5A6JA 1W9DM 3G6LA 1C93A 5IDIA 1J10A 3QOKA 1UYQA 1C90A 3HU7A 1CYGA 1E43A 2J25A 1V0LA 3AJ7A 2VRQA 1G1YA 1TA3B 1H49A 4JCMA 3WEMA 3WD4A 1GCYA 2W62A 4QCFA 1E70M 1MW3A 4HOZA 5LA0A 3SEPA 5DT7A 2WZIA 4CD8A 2CETA 5D9OA 1QNPA 3W6LA 1C7SA 4PEEA 1XYFA 1G01A 4Z2KA 4TOQA 1SFSA 4W88A 5CLWA 4BA0A 2VVSA 5GQBA 2JEQA 5A6BA 1RH9A 2ZE0A 1HP4A 4L4PA 4BQ2A 4FK9A 3WL0A 1UKOA 3WD2A 1HJVA 1BPLB 4R5EA 3L4YA 3AHZA 4UTFA 4BZYA 3PZMA 4GI6A 2E40A 3VGEA 3ZJ6A 3WH6A 1TVPA 2YL9A 2O9TA 3BAJA 2XGBA 3JUGA 2OYKA 3WKZA 1BG9A 3BAIA 3N13A 1Q6FA 2D20A 1ECEA 3VDHA 5CSUA 5BXTA 1UWTA 1XH2A 3QR3A 4IISA 3ZJ8A 2CBIA 4YHGA 1R86A 3AZSA 4W87A 3CZGA 3L4TA 2OWXA 1QPKA 1V6WA 1BYDA 1JF5A 2CPUA 3DHPA 4KMQA 2O92A 2GJXA 2YBUA 3N11A 1CDGA 2ZXBA 1ZB5A 2WSKA 1CTNA 4FLQA 4AD0A 1NH6A 4AZ7A 4W89A 3WFLA 1ISWA 1IZJA 2CERA 3T08A 2DH2A 3MV11 4J27A 3TTOA 1BYAA 2OSYA 4JL2A 1WDSA 3WQ5A 3L4UA 3ZOAA 3BH4A 3ZMRA 4HPHA 2ZUUA 3AIBA 2D3LA 3OGVA 1KR1A 5TD4A 3UG3A 2DT0A 1JD9A 3AMDA 5AYIA 3RM9A 1UH3A 3VDCA 5A6AA 1JD7A 2D22A 4F66A 2XFYA 1RD6A 4UR9A 1J11A 1KCLA 3SUSA 1HXJA 1OIFA 3MV01 2GSJA 4J3TA 1B3XA 1VFUA 1VBUA 3T0DA 1TE1A 1LWJA 3SCQA 3SCPA 4J3XA 1ODUA 4AD3A 1VEMA 2ZXDA 4ZFMA 1CGYA 1UWQA 2BV9A 2DQXA 1OWQA 4MNMA 2AAAA 4KRTA 2VZSA 3UR8A 2PC8A 1O6IA 1EIBA 4GKLA 2XSAA 2XVPA 2AOSA 3MO4A 1XV8A 1SYTA 1D2KA 1J0YA 3AHYA 3PTMA 5M3WA 4LYQA 4PTWA 1E56A 2GJRA 2XWDA 2VX5A 1JAKA 2VOTA 1V3HA 2V38A 2D23A 3TTQA 3GH4A 3MANA 1HX0A 1DWHM 2FGZA 2V5CA 4D72A 2YA1A 2UY3A 2Y2WA 5HOSA 4QFUA 1UQZA 1PAMA 5EFDA 1UWIA 1GHRA 1PIFA 3U5YA 2VQTA 2BY1A 2WNWA 1WDQA 4CKQA 3II1A 2X1IA 3DHUA 4TXEA 1QW8A 2GFTA 1B90A 5IHSA 5A8MA 1C8QA 1JZ2A 2UWFA 3VM7A 3BAKA 2YDRA 3GTNA 1E5NA 1E40A 3AZRA 2YDSA 4UFMA 1J18A 1CLVA 3NSXA 2DSKA 4JKKA 4Z2HA 1VBRA 3CHDA 1WO2A 1FP9A 1X6LA 1JAEA 1MQPA 2DT1A 2WPGA 1HNYA 4PRWA 3QHNA 5I2UA 2DGAA 2X05A 4FLRA 3CUFA 2BNJA 1M01A 5A8PA 3VU2A 3W6MA 2JFEX 4GXPA 2WVVB 1UOKA 4BF7A 1NWTA 4H8HA 2OLHA 4V27A 2WMKA 1CXLA 4AC1X 2E3ZA 2ZX9A 3VNZA 1VENA 3GNPA 2XIBA 3WELA 3A4AA 2WBGA 3VMPA 3EDJA 3ZQ9A 1ZBVA 3K8LA 4JKLA 3TTYA 4B3LA 3TTSA 2GVYA 1WZLA 3FXYA 2OYLA 3SCVA 2DSUA 3GDBA 4JFVA 4U5IA 1NWRA 1QHPA 4XV0A 7CGTA 3W81A 2VNCA 4D71A 3KWXA 4Q22A 4PTVA 1GONA 2QHAA 1JZ6A 1CGWA 3VILA 5EMYA 4U31A 1BF2A 2FGLA 5ECUA 2BVTA 2J8FA 1RP8A 5DMYA 1R7AA 4NRRA 2F61A 5JIPA 2ZUVA 1C91A 2VZTA 1JYNA 1H09A 1H11A 4AIEA 1XSKA 1OM0A 3WBAA 5DF0A 1UKQA 1V3LA 5E70A 3E1F1 4HOXA 3UETA 2RGLA 2ZX7A 5I23A 3MKKA 3AIEA 2W63A 2GJXB 2CBJA 2E8ZA 4ZENA 5GNYA 3OLIA 4GI9A 4AIOA 3VGBA 1KQZA 3RPMA 3BSHA 2F2HA 3K8KA 4M29A 3UERA 1B3VA 2CHNA 4J3UA 2YL6A 4TX8A 2PWHA 3PZ9A 3MS8A 4MB1A 1UD8A 2OSXA 1E6NA 4LXFA 3FAWA 2EPOA 1Q6GA 4R27A 3NCOA 1CLXA 3W27A 2EPKX 3VDAA 1V02E 5IHRA 1FH9A 1H0GA 3PN8A 4P7QA 3WEZA 3MMDA 3D3AA 3L4WA 2ZX6A 3AIUA 1OGBA 4GZEA 4PBGA 1HL9A 2WC7A 3ZT6A 5AC5A 2Z1SA 2BVYA 5IFPA 2WYSA 4CGTA 1GOOA 2WWCA 3ALFA 1GHSA 2A3AA 3AMCA 1CEOA 4U5KA 4HA3A 2YLAA 2ZXQA 4UQCA 1BLIA 1H41A 2WW5A 2WKGA 1KFWA 3CO4A 3K46A 4YN5A 4X0VA 4MAZA 2W61A 3S2CA 1OBAA 4J7RA 1XSJA 1ZL1A 3A4WA 3VINA 4F8XA 1QI3A 1F4AA 1C92A 1JYWA 3AOFA 3FW6A 2ZXAA 3RMEA 2WWDA 3K4DA 1JZ8A 3WSUA 1KB3A 1HL8A 5IFTA 4QLKA 3AIQA 3SCOA 1HKJA 4IPLA 3KZSA 3VNYA 1Q6CA 2XG9A 4J3SA 2VX7A 3CUJA 2DSWA 3VGGA 4D6HA 4M80A 1I75A 3NJ3A 1W2PA 5E9AA 3K1DA 3MSDA 2ZOXA 1AQMA 1E4NA 1W1TA 5LA1A 1WB0A 4QLJA 3CGTA 1XD1A 4GO8A 4CU6A 1YQ2A 4L4OA 2WMIB 3WY1A 1JI2A 4OJYA 3B8SA 2D3NA 2WHMA 3WMBA 1ZU8A 1UH4A 3SCTA 2QPUA 1LJYA 4AEFA 4E2OA 3CLWA 3BAYA 1JF6A 3WH9A 2Y8VA 1W9UA 5AY7A 3IANA 4EKJA 1J01A 4LQ1A 3WQ8A 3WN6A 4OIFA 1B9ZA 2VZVA 5BROA 3I3DA 1E73M 1BYCA 3M46A 2X8RA 4MADA 3T2PA 3ZSSA 4D6IA 4AZCA 4ACZB 1W9PA 4C7GA 2WXDM 2WMIA 3PZTA 3CZLA 2E9LA 1HKIA 3AIRA 2VTFA 3ZJKA 5M03A 1EA9C 4TX6A 5C8BB 4PN2A 1GQKA 1W1PA 3GH7A 1ZBWA 3N9KA 3EYPA 1BGGA 1UWSA 4JHOA 4MNKA 1PZ2A 1CXHA 1LL6A 5HPCA 3MUAA 2WVTA 3S6TA 2FHBA 1EQPA 3AROA 2X09A 3O2LA 1QHZA 2BFGA 4K68A 1BAGA 1JFHA 2ZUSA 4BQ4A 1GOWA 4MDOA 2A3BA 3GNOA 1GQJA 2XM2A 2VI0A 2YA2A 4PMYA 2VRJA 4JZ5A 3BAWA 1J0ZA 5C70A 3WUEA 3K4AA 3VD9A 3NIYA 4KWUA 3SIMA 2XVLA 1RP9A 1V6XA 6CGTA 1B3ZA 4PMRA 4GZIA 3WQ4A 1EH9A 1EDGA 3AXHA 3DECA 4PYSA 1KCKA 3BLPX 4HZ6A 4TVCA 1K9EA 3AISA 2OSWA 3WDHA 1ZJBA 5ABFA 2YL8A 1C3FA 3CMJA 4OBSA 2OYMA 2BS9A 5A6SA 3DC0A 3ALGA 3EMCA 4WSKA 1ZS2A 1AVAA 1JGIA 4AZ6A 1BGAA 2X2YA 5FL1A 2EJ1A 3WEOA 1E3XA 4B16A 4F79A 1WZKA 2PWEA 5I24A 9CGTA 3PZQA 4MB4A 1VFFA 4OZOA 3QHMA 3WF3A 2VT0A 4XZBA 1X6NA 1XH0A 5A2CA 4YHEA 2VUYA 4U33A 2Y5EA 5HDRA 1E55A 1WPCA 4U3CA 2VR5A 4A3HA 2UY4A 2E4TA 3DYPA 5A95A 4D6FA 1QHOA 3W24A 4CN1A 4X9YA 3W38A 3VIJA 2WLZA 1KGWA 1HJUA 1LF1A 2QV4A 4AMCA 1CGXA 1VAHA 4P8XA 1UR8A 2WAGA 3ARYA 4TUFA 1DWJM 3WD1A 4WKAA 1E3ZA 1KBKA 3KL5A 3AYSA 2FDMA 2CITA 1L0PA 1GOMA 2V3FA 1JXKA 5FKYA 2PWGA 1HF6A 1A47A 2XJ7A 2XIIA 2E8YA 2VCBA 4AZCB 1KXQA 3VUPA 2W91A 1KBBA 2BHYA 2YA0A 1LG1A 4U3AA 2WC3A 2WCAA 3GBDA 4AZHA 4AZGA 1WKYA 1B31A 3OZPA 2J62A 4EK7A 1VF8A 1V3KA 4HMEA 2DIJA 4P8UA 2F8QA 3NSNA 3A4XA 3ZR6A 2WVVA 4LYRA 4BS0A 1E5JA 1UKTA 5D4YA 1J9YA 3PTQA 1JDCA 1J0IA 4CN6A 3RILA 2WZEA 1AQ0A 1UA7A 4AD1A 1TFVA 4AISA 4N0RA 4ZE5A 1RPKA 1GOQA 1JZ3A 3NDYA 2XHYA 2QPSA 3GXFA 3WD3A 2YL5A 2VX4A 4ATDA 4PTMA 4F9DA 1BHGA 1V6VA 4PMQA 4NRSA 5JIWA 3W25A 2VZOA 1WZAA 3THDA 1V3JA 4Z2IA 1KXHA 5D8ZA 2ZUTA 1HJQA 1BFNA 1E1EA 5JBDA 1ISZA 3NSMA 4W93A 4AIUA 1W1VA 1XD0A 3WF1A 1Z32X 1UD3A 3FHQA 3B9DA 3W26A 1EDTA 3CUGA 2PB1A 2QLYA 1O7AA 1DWAM 5ABFB 3ARSA 5GPRA 4EAMA 3UG5A 3AXIA 2VQUA 2WHKA 1LQ0A 3VM5A 3EMZA 1KXVA 4H8UA 1NM9A 3OLDA 1LG2A 4M1RA 4D1IA 5A6MA 5E6ZA 2HVMA 4PCTA 3FHAA 4AY1A 4CVWA 2QMJA 1FFQA 1PX8A 2EXOA 3ARTA 4AD2A 3N12A 1XCXA 3ARZA 3F5KA 3VPLA 3WMCA 3EBVA 3WDRA 1NP2A 2J79A 3AHVA 1E6PA 4J3VA 1WE5A 5A3HA 3PZUA 2BVDA 3UESA 2VRKA 5CGTA 3OLEA 1MWOA 1VEOA 4HTYA 1PX4A 1DEDA 4JAWA 2BY0A 4IUGA 4D1JA 1BYBA 2WC4A 4JL1A 2V3EA 4MB5A 3WNMA 4FMVA 2XPKA 2B31A 3CHFA 4URIA 1X1NA 1XSIA 2V3GA 4MTVA 3AMLA 2DIEA 2ZX5A 4PMDA 3OZOA 4F9JA 3SCSA 2FHCA 1E6RA 4FF5A 1HN1A 4UFJA 4HU0A 4PMXA 5A94A 1Q6DA 1E4MM 1IV8A 4CCEA 1GW1A 4KGLA 5A6BD 1E72M 4GZJA 1M04A 2ZUMA 3PHAA 1WNOA 2CYGA 2YOCA 8A3HA 5IXEA 1W32A 3CUIA 3RJXA 2DT2A 3N17A 1BG4A 1TG7A 2J75A 3L2MA 4BQ5A 2NW0A 4W5ZA 5ABGA 2CCRA 2CESA 2WVUA 3N04A 1NOFA 2NSXA 3I3EA 4P7OA 4GIAA 3CMGA 1M53A 4HZ8A 4ML4A 3SUWA 1V0KA 3HN3A 2EPLX 4MAVA 3EMQA 4KGJA 2J7BA 2JIEA 3NYDA 2EBNA 1OCQA 1CNVA 3WQ6A 2PBGA 2XFFA 1JDAA 3A47A 5BRQA 1UR4A 5CLTA 1JNDA 3VD3A 1CENA 1Q6EA 2EPNA 3AHTA 3EDDA 5CZKA 6TAAA 1DWGM 1KGUA 4PMZA 5AYBA 3ARRA 4S3JA 2YIHA 3ECQA 1JYXA 1FH8A 4WKHA 2J78A 1CZ1A 2J47A 1BSIA 4ATWA 5E0FA 4MDPA 2VURA 1QI4A 2E9BA 3J7HA 3WNLA 2Y8KA 4AZIA 2CBUA 1K9TA 3ZT5A 1W3KA 1BTCA 3OA5A 4WF7A 1W3LA 3OLGA 1IZKA 1UZ4A 3DYOA 2YBTA 3WF2A 3RCNA 5I0DA 4E8DA 4UOZA 1Y7VA 4AZBA 1H1NA 1K9FA 3SURA 4JFWA 4Y7EA 3OIHA 1UD5A 3VIFA 3AQUA 2A3CA 3VO0A 5A8QA 1GUVA 2CIPA 1J12A 1CWYA 4MPKA 8CGTA 2YJQA 1WDRA 3WUGA 1US3A 1G94A 1E9LA 3TOPA 5DFAA 3VTRA 4UFKA 2WMFA 3VOCA 2VZUA 2MANA 2WK2A 1ZJAA 4EE9A 1KR0A 4W8BA 3UCQA 1V6UA 1E0WA 1KXTA 1U2YA 1SR0A 2C8NA 4QAWA 2XVGA 3LMYA 1V02A 5JBEA 2A3HA 1PEZA 1NARA 1GNXA 3FAXA 5BXSA 3MMWA 3AS0A 3VKKA 3VD4A 4BQ3A 3IJ8A 5M17A 4HOWA 1CXEA 4HA1A 4OKDA 3VMNA 3WIJA 1NWSA 1CGVA 1PX3A 2O9OA 4CCDA 1I1WA 1SMAA 2HISA 3WH5A 5AC4A 2YKKA 3EDEA 1LL4A 1QNRA 4DUWA 2PWFA 5A8OA 5CXPA 4D6JA 1UD4A 3BCFA 1HT6A 2BY3A 1W9VA 1H4PA 5CSYA 2WSPA 4M56A 4N42A 1HKMA 2G8ZA 1C7TA 1MW2A 3GXMA 1OT1A 1R7OA 2VCCA 3HMCA 4W7UA 4P8VA 1B2YA 3A3HA 1M03A 1GZJA 4JFSA 1CXKA 2UY2A 2XM1A 4D6CA 3U57A 1JZ5A 4KH2A 3AFBA 4UOQA 3PZNA 5EB8A 3T2QA 5A6KA 2VCAA 1TZ7A 2JALA 1OGSA 3AI0A 3WNOA 4KRUA 3SUVA 3CZ8A 5E6YA 2W5FA 1L8NA 1BVZA 3ARXA 2WB5A 4JCLA 1OGGA 1UH2A 3VIMA 3MU7A 2IXVA 1W9BM 5M5DA 5FCZA 5CGMA 2UY5A 2E9MA 2CKRA 4HZ7A 2XVKA 2VR4A 5DT5A 5KEZA 3VGFA 2WMHA 1PIGA 1FOBA 5D9PA 1D3CA 2G3NA 2FH8A 3CPUA 4H04A 5D9MA 1US2A 1JZ4A 5BXPA 3RDKA 4OOZA 3KL3A 1XHGA 1YHTA 3AXXA 1E71M 5HBFA 3ZJ7A 3GM8A 3W29A 3PZGA 4UZSA 1OB0A 3WDPP 5BXRA 1GQLA 5CPSA 3VIGA 4HU8A 2DSVA 5BRPA 4LX4A 2J4GA 2WMJA 3PZOA 1EOKA 4JFUA 1GVIA 4JKMA 1W9XA 3ZT7A 1W3HA 3W0KA 2D24A 4EANA 1OD8A 1JZ7A 4U2ZA 4NF7A 1UD2A 2Q8XA 4UQAA 1V3IA 4C7DA 1OSEA 3NDZA 2J7FA 2RGMA 3TONA 1WAWA 4LYPA 3U7BA 4UQBA 2ZUWA 3EDFA 3BSGA 4GINA 1CGTA 5CQ1A 3RJYA 2QF8A
chains in the Genus database with same CATH superfamily
1P6BA 4RLIA 1LZOA 3UYCA 2ESCA 4PUEA 1NWUA 1VJSA 3H6OA 4JEJA 2GVEA 1PPIA 3NL2A 5C0QA 3BMVA 3TQKA 3UNTA 2Q71A 1IXNA 3LPGA 1H1YA 3SY8A 1ZNNA 1Q4NX 3W7HA 5ABHA 5JUVA 4PCSA 3P14A 2FLIA 7XIMA 1W2VA 1VFMA 5A2BA 2F38A 3QGVA 1SMDA 4LFYA 1IWBA 1LYXA 3LBOA 5DBUA 4JIQA 1D7FA 2JEPA 1M68A 2Z2AA 3UZYA 3OG3A 4WEVX 4UWMA 4XZIA 3DYMA 2PCQA 4GUJA 3LXAA 3QFEA 1PWLA 3QF0A 3S5SA 1SZFA 4FLSA 3CAQA 1H51A 1O66A 1Z6KA 5JQ9A 2VC9A 4DWSD 3QYSA 2QDDA 3W4RA 4KEMA 1X7FA 1XYCA 1IEXA 3F4NA 3N18A 3ZO9A 3UZXA 1XM3A 2NQZA 4QSHA 1QNOA 2CZEA 1K7EA 2NQJA 1KM1A 2HVOA 4NL1A 1UBPC 1XC6A 1V7YA 4DQWA 2YR1A 3AC0A 2PLJA 1QPOA 3SGGA 3BC9A 3BO9A 3I6TA 3PBGA 1TMHA 1ZRQA 3WDIA 1QOQA 3GXTA 1QBAA 4NI8A 4AWTA 1R2SA 1V03A 2HTMA 3THUA 2XWEA 4CNPA 4HD5A 4YTUA 4IMCA 1OIMA 2POZA 4GQRA 4WY0F 2PWUA 3NVTA 1TVNA 4CU8A 3SW6A 2Y4SA 4ZFCA 2W4XA 3VDBA 1HUVA 5D09A 1YBQA 4EWJA 3SCRA 2BHUA 1WDPA 1JNEA 3ARPA 3D5HA 3ZWTA 5HPOA 2X0HA 2WJEA 2QCGA 3RNDA 3VIKA 3A23A 1SFJA 1THFD 4HHMA 4K8EA 2XSBA 2XFRA 1TCMA 4JOMA 1GVEA 3MMUA 4OBRA 2YZRA 3Q67A 4J28A 2QIWA 2A1YA 5HULA 4OUEA 2IXUA 1F8MA 2A0NA 5GNZA 4MYXA 2W3ZA 2BB0A 1E51A 4Q7NA 4IJRA 5C7HA 3GH5A 1H7OA 2V3DA 1M41A 2RFGA 3V75A 1BVNP 1SO4A 4GJ1A 1A5OC 3C0QA 1DJNA 4ORIA 2J8TA 2Z25A 4O15A 1VHNA 3I7RA 2DIKA 1JI1A 3M6YA 1GJUA 3VAVA 1LWHA 3PB0A 1XQKA 2O4MA 3LSBA 3FDKA 1Z69A 1ITUA 5BU9A 1GW9A 2CLLA 1Y8BA 5LYRA 3W53A 2OEJA 2PI6A 1P0EA 4C6IA 1JPKA 2DU2A 1FHUA 3SDOA 2V30A 1YX1A 1H7PA 3LU2A 3NO1A 3F4CA 3UA3A 2IUZA 1V3MA 3N15A 4S3CA 1B30A 1NSJA 3E74A 1VPQA 1T6MA 1H3GA 3WUFA 1CXIA 2WPBA 1QNSA 3QN3A 3TYZA 1A50A 1P4CA 2QCFA 4L7ZA 1VJZA 1HP5A 3UY8A 3P80A 3CM4A 4HNOA 4X63A 1GJPA 5I5RA 3WQGA 5GNXA 4H9YA 1UA3A 1LORA 2VD9A 3V0SA 1VS1A 2J9XA 1AJ2A 1V0MA 4XUYA 3O16A 5FF3A 3POCA 3BVJA 4Z17A 4P7RA 2J8GA 1M7XA 3DFNA 5D2TA 3LK6A 2BY2A 2Z0IA 1HG3A 1MFVA 3UJ2A 3W22A 1JG9A 4I5XA 4HK6A 3TWBA 4PH6A 1F6YA 1WP6A 2ACQA 2ZWYA 3BLKA 4PTNA 2V68A 3EXTA 3BOLA 5M1TA 3TKFA 1LOQA 3PANA 1UUOA 1TIWA 1R8LA 1IF2A 2DZAA 3BZGA 2GGGA 3L5LA 4W8LA 1OJXA 2NWSA 2ACUA 3EPMA 4M3PA 3M0LA 4H01A 1EP1A 4B4HA 3CIXA 5LNRA 1GOIA 2PPGA 3W1UA 3GNXA 2WANA 1T5AA 1OG6A 3Q37A 3IAPA 2POTA 1VEPA 2NV2A 4A3RA 4HYVA 4C6OA 3MCMA 1N82A 2ZUNA 4HMCA 2ZDSA 1SPQA 4TMBA 2ZICA 3L0NA 1C29A 2JE8A 3WBYA 3POHA 1GQIA 1ZUAX 2RDWA 5AHLA 2CEQA 3CWOX 4OTKA 3QV7A 4BI5A 3GLCA 1EX5A 1E6ZA 4YWSA 3H7VA 3BZJA 4KCTA 1QJWA 3NEVA 4QS5A 2DZUA 3B9AA 2HBVA 4IIDA 4FNSA 4JQAA 4S3KA 4XTIA 2XH0A 3K30A 5I3DA 5CAHA 2J7CA 3M1ZA 4ATLA 3TP4A 2CHOA 2QJIA 4Y9MA 5F4WA 1MMFA 4GUHA 3TROA 3W1XA 3EEGA 3KOFA 3CT2A 4NAFA 1WX0A 3BWWA 4NP7A 1KRCC 3DXIA 2G3IA 4RE2A 3F5LA 3NUKA 3TC7A 3SCWA 3VIIA 1J2BA 3MWAA 1I2OA 3DZ1A 4I3GA 4JTFA 4GIEA 4OV9A 5G4WA 1N7KA 1J0HA 3DFTA 1G4PA 3ARQA 4TVUA 4IQLA 1EHNA 2Y88A 3C2VA 3MUY1 3L2LA 1O5KA 3LTPA 4F4RA 4R88A 3L4ZA 1UR0A 2Z1KA 4JN8A 3ZIZA 4ZQMA 2VMFA 3R94A 3WK0A 4E2DA 3FNDA 2F7FA 1DTNA 3PPGA 1VD6A 1VFHA 1CBGA 3WYZA 2PF0A 2G96A 2GDVA 3A9BA 1PS9A 4IPIA 3R10A 3TQPA 2VJXA 3ARVA 3WZ0E 3VGDA 3A21A 1M5WA 2O9RA 4MFDA 2PTWA 4M6VA 4CN4A 1P6WA 3W72A 4GIYA 2X1SA 3FEQA 2Q8ZA 3ARWA 4NJGA 1IWAA 5I3FA 2XGIA 2OZ0A 1X8FA 3UXAA 4HVXA 5XIAA 4DZ5A 4AYGA 1H7NA 1WYIA 4AXNA 3D6NA 3TA9A 3W70A 5AC8A 1J96A 3GD6A 2J27A 1CXFA 3BLIA 3VX1A 1ITCA 1XKYA 5HAOA 3MTWA 4DJDD 1RXOB 1UHVA 2QUMA 1E4LA 8TIMA 4BKNA 3IUDA 1KCXA 2ACRA 3RRAA 1OFAA 2OCZA 2GQ9A 4A6GA 1GVQA 1S1PA 3OG2A 1DTUA 2VFGA 3W7GA 4RZ4A 4QTGA 4UR7A 4GOAA 1SZNA 1NOUA 3OYZA 3YPIA 2Z2UA 3CIWA 4AD4A 1G7UA 3EXRA 3QM3A 4X60A 3NQEA 1W91A 5DXYA 4DUXA 3KS6A 4YTRA 4WK9A 4GE8A 1UP0A 3IVTA 4D2JA 3N25A 3MI2A 2J9ZA 3HGJA 3KAOA 4L4MA 1EO7A 3WLIA 1XRSA 1RJQA 2XTKA 4OFCA 2PRLA 3GTXA 3C56A 4CD4A 1MEWA 1KTCA 2YCIX 3W2JA 1IXQA 1VRXA 3NURA 1JCYA 5I07A 1XG4A 3QOKA 4B2DA 1R0MA 1C90A 3SQLA 4CEXC 1PYFA 2J25A 5SWUA 3R0KA 3AJ7A 3P84A 3MP3A 3DI0A 3WEMA 4LCRA 3VZZA 2ZRXA 4E6MA 3NL6A 1GCYA 5LA0A 1TZ9A 4ZQNA 2PTZA 2CETA 3KTCA 4R34A 3W1MA 1QNPA 1AL7A 1XYFA 3LEPA 4L4LA 3ABQA 4DXXA 3M5XA 2P53A 5GQBA 2ISWA 2GOKA 1SU5A 1K3UA 4O4VA 4IWWA 4L4PA 4BQ2A 3S47A 3WL0A 1WKEA 4Q4SA 4H7ZA 1W5QA 3WD2A 3EX2A 1G6CA 3AHZA 4BZYA 2ZRZA 3W87A 4AVNA 3VGEA 4O11A 4I8YA 3LHYA 1NF7A 3H8AA 2I16A 4JQ1A 1A4MA 3ZLGA 3JUGA 3PTDA 3RPTA 3EWBX 4MG4A 3BAIA 1XBZA 5I3KA 2C1GA 2AAMA 3SN0A 3N2BA 3QVQA 3KVJA 3VDHA 1EPXA 4HHHA 1UWTA 3HURA 4ZO9A 1KM3A 3CZGA 5BZAA 3QTGA 2GJXA 5A5WA 3A22A 2ZXBA 4AD0A 5REQB 1NH6A 4W89A 3WFLA 4JBRA 1QNVA 3HO8A 3EOOA 3EB2A 3LCWA 1WDSA 3P5ZA 3BH4A 3ZMRA 4O54A 3AIBA 1L6SA 3H70A 2YB4A 1KR1A 3OGVA 4NX0A 3UP8A 4QGCA 2DT0A 1SW0A 3C3UA 3RM9A 1UH3A 5A6AA 3CYVA 3RLGA 3MA8A 3FV9A 1KCLA 2PGRA 3P7YA 3MV01 4GK8A 2GSJA 1Q65A 2OLAA 1DL3A 1ZQ5A 4I8DA 1VFUA 1NY1A 1O5QA 4XTDA 3T0DA 1TE1A 3WLSA 4QJ5B 3SCPA 2JKEA 3RX4A 1VKFA 1JCMP 4AD3A 2ZXDA 3OBKA 2G3FA 1UWQA 3APYA 3HQ1A 2AAAA 4MNMA 3UR8A 5FJIA 3LG3A 4A2RA 3C52A 1TV3A 3MO4A 2VYOA 1XV8A 4RZ6A 1SYTA 5EBUA 1D2KA 4Q8TA 3EWDA 3WMLA 1E56A 2XWDA 3UY7A 1JAKA 2VOTA 4US5D 1GGOA 1HX0A 2R24A 1XLLA 1QO2A 4Z1AA 4D72A 3TZNA 1WV2A 2UY3A 1O68A 4Y90A 4QFUA 1UPPA 4RDWA 1GHRA 1PIFA 1S2WA 1S38A 5XIMA 1Q6OA 1EEPA 1PXGA 2V67A 2DFAA 5AECA 5IHSA 3QPEA 1C8QA 3DFSA 2UWFA 1JZ2A 1DKWA 2X30A 1E5NA 1QPQA 1E40A 3QTPA 3W7CA 4HTBA 4FAMA 3UXLA 3W7OA 1SW3A 3WLMA 2OTDA 4WOZA 1JAEA 4XKMA 4ZB5A 4RDZA 2WPGA 3QMTA 5KINA 1HNYA 1KRBC 3QHNA 2DGAA 4RXGA 3CUFA 2BNJA 5A8PA 1B54A 1ONWA 1NWTA 2OLHA 4V27A 2WMKA 3OVPA 5AC6A 4XO6A 3KRBA 4XK2A 1VENA 3GNPA 2XIBA 1FCQA 1VBJA 2MNRA 2F6KA 4WOQA 1WA3A 2P3ZA 4UXDA 3EX6A 3K8LA 3TTSA 2AKMA 3QKEA 3FXYA 4JFVA 1XFCA 1KM2A 4DHGA 1QHPA 4XV0A 4V33A 3W81A 4KIEA 3UVIA 4D71A 3KWXA 4DRSA 4LB4A 1KBIA 3DI1A 3ORWA 1LOSA 2J8FA 2B81A 4LS2A 1RP8A 5AFDA 5DMYA 1VYPX 2ZUVA 3OQ8A 1FWFC 1K4HA 1PDZA 1RUSA 4L5ZA 4HGXA 3WLHA 3NQ6A 3TNBA 4PEKA 2E5CA 2ZX7A 2Q02A 3S1XA 1ECQA 1WOBA 4ZENA 3OLIA 2L5HA 4GI9A 4LVDA 4Q8OA 3V4BA 3UERA 1B3VA 1XRFA 4S3GA 1EGMA 1Q6LA 1EJSC 4FXRA 3W00A 4GCXA 1TQJA 4ZQPA 3PZ9A 3NO5A 1WQ5A 2V69A 4K7YA 3T1GA 1GG1A 1E6NA 2NUWA 5AN7A 4R27A 1UIOA 3NCOA 4QNEA 3IJ6A 5IHRA 1H0GA 3L67A 2YBVA 3VE9A 4BWLA 3KCOA 2Z1SA 1TRDA 3VCCA 4MYAA 2WWCA 4KWVA 5C9WA 2A3AA 1CEOA 3UJEA 4HA3A 2ZXQA 1OFOA 3Q65A 5DMMA 4QG9A 1F76A 1GKPA 1W5NA 2WKGA 1KFWA 1LT8A 4MAZA 4GYJA 3DKLA 2AGKA 2AL2A 2DUAA 2HRWA 2ISSA 1DJIA 1Q5MA 1ONXA 4EACA 1MRAA 2IW0A 2DW6A 3A4WA 5IBXC 3FX4A 3Q45A 3BANA 3PWAA 1T96A 3FW6A 3S1VA 2DUZA 3BW3A 2NQ5A 1KBJA 3R4IA 4QAIA 5IFTA 2NLYA 3GYEA 4QLKA 3AIQA 1HKJA 3VNYA 1LM1A 2FB2A 2P3EA 2ALDA 9XIAA 4UNLA 5E5CA 4KWOA 4M80A 1YDVA 2P88A 5HMDA 1HO1A 1IIGA 3CEUA 4PTDA 2CZ5A 1W1TA 3CGTA 1RCQA 1XD1A 2VFHA 1F6PA 4K38A 2WMIB 3GXNA 3WY1A 4MWAB 4OJYA 4XKYA 3B4UA 3FKRA 4JY9A 1LJYA 2W6RA 5HQEA 1DORA 4AEFA 4E2OA 5CC5A 3XIMA 3LBMA 3WH9A 2Y8VA 1X97A 1W9UA 2WOQA 2QYGA 3GUWA 1AW1A 1OX4B 3WN6A 4RUBA 1B9ZA 4ZA0A 3I3DA 3T2PA 3EOUA 3E49A 2QUVA 4D6IA 2H9AB 2NQHA 3H7UA 5TQLA 2X42A 3NQAA 3TXZA 1HKIA 3B9NA 2VTFA 3ZJKA 1GQKA 5LNVA 3EYPA 4JHOA 3AYVA 3RF9A 4IIBA 1PZ2A 3CH0A 3M47A 1BF6A 4CNNA 2MUCA 2C91A 3W7MA 4QHRA 1OX4A 3G1VA 3S6TA 7REQA 2FHBA 3GTHA 1JFHA 1H7RA 4O0ZA 3FXGA 1GT8A 4HCDA 1RA5A 1S5VA 3GDKA 2XM2A 3S5OA 3ZLFA 3BW2A 3BAWA 4PRRA 1VPXA 3VD9A 3NPWA 3LHVA 3O06A 4H1ZA 3BG3A 1F07A 4KBXA 4Q4RA 4KRZA 6CGTA 1W3NA 2TODA 1M7JA 2VM8A 3A13A 3GUGA 1Z8AA 4EVZA 1UMYA 1EDGA 1XQLA 2A7RA 2D2JA 4PYSA 3V7PA 3R0UA 4MKSA 3TJXA 1LBLA 3UPMA 3AISA 4HCLA 1TPUA 4INFA 5CBJA 1V4YA 2BS9A 5F2GA 2R1LA 3MDUA 4YCPA 3MDWA 1GVSA 3BLOA 3L0KA 2DJLA 4L64A 1JGIA 3EKLA 4HK5A 1MNZA 1E3XA 3G1YA 4LNYA 4NASA 4IMFA 1WZKA 1QU4A 5I24A 1FUYA 1XGEA 2A7PA 3MZ2A 3WF3A 4LC8A 3LQGA 4ZO8A 4ADTA 4QEEA 4HN8A 4MJZA 1IXOA 1O60A 5HDRA 1HFBA 2V63A 2QT3A 5ECVA 4IGMA 4A3HA 2F9RA 1M1BA 3F4DA 3ZWSA 4X9YA 1RVKA 2YW4A 4XZHA 4K3ZA 1UR8A 1HGYA 4LF1A 3ARYA 5C2XA 4LUYA 3INPA 4Y8EA 3P60A 3ZLHA 4LY4A 4UUIA 1Q7MA 1X1ZA 5DY3A 2XN0A 3N3TA 2CITA 4DYJA 2QUNA 5BW6A 4H2HA 3C0JA 5FKYA 2QV5A 2XJ7A 3UZ5A 1DHPA 3BLLA 3KHDA 3O7UA 3PSVA 1POJA 1NIUA 3LV5A 3GDLA 4AZGA 1XF0A 4O53A 1B31A 2CLHA 1XIGA 1V3KA 4ZVJA 2DIJA 4P8UA 3NSNA 3ZR6A 1XLEA 4IJBA 3HGRA 3B8WA 2CW6A 4NJKA 2PU0A 2YXGA 2WNZA 4JTQA 5D4YA 4IFOA 3GX9A 4I9MA 2VDHA 4H7CA 1AQ0A 4AISA 3RU6A 1EFZA 1V8EA 1W0MA 1YDNA 1LLZA 3WD3A 4IIHA 4F9DA 1BHGA 5D2XA 1BXCA 3VOFA 5JIWA 3CYJA 1U5HA 2OGJA 1OY0A 1HJQA 1BFNA 3IUIA 3NGFA 4UTLA 5K9CA 3NSMA 5JBDA 2R8WA 3WF1A 3FHQA 2J66A 4CQDA 1AG1O 5CZTA 1EDTA 4B5UA 3LB0A 3SR7A 3G1DA 3JRKA 3NPVA 3AXIA 2P8BA 4AY7A 3NYZA 4L9XA 3ZVIA 3I7QA 3O6YX 4H8UA 1JCXA 3LX9A 3FA5A 1QR7A 2Y62A 1LG2A 2I56A 4IZGA 2HVMA 3OA3A 4GBUA 1T7LA 1SSGA 3FHAA 3UT0A 4DJED 1R3TA 4Q8NA 2EXOA 1KFEA 3RYSA 3N12A 1XCXA 3ARZA 1B4EA 3CEPA 1OC7A 2PDQA 3EA2A 3EBVA 4J3VA 4JNYA 3P61A 3EA3A 3NXLA 3PZUA 5A6TC 3UESA 1K1DA 3QR1A 3ERPA 5CGTA 1FWBC 3TEVA 1DIEA 2B0MA 3TJ4A 2DVUA 5C9RA 5C2GA 5GJPA 4H9UA 3GR4A 4JL1A 4H9XA 2B31A 4URIA 2C18A 1W37A 4LAUA 4RNHA 4PMDA 3NO3A 3SCSA 2FHCA 1GG0A 1OK6A 3RRXA 3T40A 3FOKA 4UFJA 3IACA 1Q6DA 2GQ3A 4E2VA 4CCEA 3R2GA 3C0SA 4KGLA 1E72M 3ICJA 4GY0A 5JVLA 2QKFA 1SSDA 1YPFA 1WOAA 2UBPC 1QW7A 2CYGA 1CB2A 1EGVA 2YOCA 5IXEA 1W32A 3RJXA 2CXEA 3H23A 1GYMA 1UZHA 1ZAHA 1RY8A 4HSHA 2ISVA 2PFHA 4JQ2A 2NSXA 3GRIA 4DVOA 5AVNA 4ML4A 2DZBA 1F5ZA 1XDMA 1V0KA 3B0VC 3EX1A 4KGJA 4LS1A 3W86A 5C7VA 3NYDA 2NVCA 1AQFA 4DJFA 3B40A 1DJWA 1JDAA 1D3HA 2VEMA 5LIKX 4HT3A 4S3BA 3EDDA 4P5UA 6TAAA 1KGUA 4GUIA 3ARRA 2R6OA 4GX8A 1TYGA 2YIHA 3ECQA 1FH8A 5HNRA 2J78A 1CZ1A 4F40A 1XPGA 4ATWA 4GHRA 1FQ0A 2O56A 3S9ZA 3E0VA 3UG8A 1DV7A 1QT1A 3KVLA 2Y8KA 4AZIA 3G1SA 3NR0A 1N8IA 1IZKA 2YBTA 3WF2A 4IG2B 1H1NA 3IGUA 2ZYFA 3EWYA 4Y7EA 2X1TA 3OIHA 3V35A 3ONBA 2A3CA 1AL8A 3WQOA 3KUMA 5A8QA 2VDIA 4C6JA 1GUVA 6REQA 5BNKA 3QFWA 1GK8A 4A3QA 1J12A 4QITA 2QULA 3BJSA 3CC1A 3NEHA 3PBYA 4REQB 1RSCA 4UFKA 2HE5A 2WMFA 1O4UA 2WK2A 1KR0A 1V6UA 3A9IA 4NT0A 4QAWA 1J8VA 1Q3NA 3GU9A 4G6CA 2PDMA 1AUSL 2QUTA 1NARA 3MMWA 3ZYZA 1SJAA 4O52A 4Y9OA 5M17A 2XZ9A 3WLKX 4N9EA 1NWSA 1Z44A 2VGBA 1SMAA 1K7XA 3WH5A 5AC4A 2YKKA 4O0KA 1QNRA 3LHWA 4JD4A 2HV5A 3VDGA 2QAFA 1HT6A 4RJEA 1W9VA 4M56A 1HKMA 2G8ZA 4N42A 5LNUA 3LTYA 3VNKA 1OT1A 1EZWA 1SUXA 4W7UA 3URAA 3RHGA 5DX7A 4H9ZA 4P8VA 1CXKA 2FMNA 2QJNA 4D6CA 3U57A 2RUSA 3AFBA 3P2VA 4MKNA 4UOQA 3UCDA 1DVJA 3T2QA 5TIMA 1DXEA 1OGSA 3WQCA 3BLEA 3WNOA 5FF2A 3WX7A 1F61A 3ZS4A 3WQFA 3N2CA 5CJMA 1BVZA 3H7RA 2YYTA 3VUSA 4H4IA 2QZRA 1Q85A 5CGMA 2UY5A 2XVKA 2QJHA 2VR4A 4Y2WA 1J93A 5KEZA 2PS2A 4KPLA 2PDFA 2FDSA 5D9PA 4PUWA 1M7PA 1PE1A 1O5XA 1KD0A 4H04A 2HXUA 1JZ4A 3RDKA 2J6VA 4JTHA 1YHTA 3AUOA 4B5SA 4Q8VA 2PC4A 1R9ZA 2BGQA 3VIGA 5ABTA 5BRPA 3G1RA 1K8CA 2BBFA 2J4GA 2WMJA 3PZOA 4ML9A 4CNOA 5KZMA 4JFUA 1GVIA 5L9FA 4C1NB 4N6EA 1W9XA 4G7EB 1DJGA 3TSDA 2JK2A 4DNHA 2O7SA 4EANA 2D24A 3BJTA 1A49A 4ZSUA 5HNTA 2W79A 4JS3A 2KZHA 1JCLA 3GNNA 3MO7A 1FXPA 4LYPA 2ZUWA 2VELA 4GINA 4M19A 1CGTA 3K4WA 3CHVA 2HBXA 3IK2A 4LVBA 3FKKA 2DY3A 2V0TA 1MDLA 4Z2LA 3UA4A 4JN7A 1PTAA 3BAXA 1VGAA 5HXMA 3WENA 2XUCA 4DJFC 1Q63A 4IMEA 1CT5A 2TMDA 3OIXA 4XD4A 1MZHA 5C55A 4ACYA 3NL3A 3P67A 3AYRA 3PC0A 1A5KC 1WBJA 3RN6A 3BQ5A 5FIPA 4IT1A 4LAOA 3IIOA 2Z2BA 3QGKC 1WKFA 1EZ2A 1OX6A 3HF3A 4LWWA 4CQ8A 1EXBA 1UD6A 4ORMA 3SUUA 1Y5VA 3P6LA 4Q4OA 3M0VA 1MRQA 3O8AA 4HKPA 4RXFA 2WVSA 2PDXA 4PB4A 1TUXA 1I2NA 1K70A 3CS2A 3N2XA 3RITA 1SO6A 3HQNA 4Q6XA 1G0CA 1LL7A 4NI3A 3DERA 1S2TA 5HMSA 3M44A 3MJYA 2BASA 3CK5A 1GWJA 5A8GA 4K6AA 3VNLA 3FN9A 1A80A 1GYLA 1L2UA 1QVBA 3OBAA 5LIYX 3KW3A 3DFQA 3PZIA 2H8XA 4JTTA 2Y5SA 1P1MA 3KTXA 5FI8A 3E9AA 5EFFA 2C79A 1KLZA 5LXEA 2D1ZA 3WF4A 4AEEA 4MNLA 4D8AA 1R47A 3GG7A 3S83A 1DIDA 1TWZA 4I9TA 4IFKA 3SECA 1FWHC 3G1FA 3HG5A 5I09A 2X0SA 4KWSA 1FWGC 5EMKA 1PSCA 3CZKA 4CQAA 4Z1BA 1DJZA 4GGHA 2E6DA 2G41A 4M81A 3L7RA 4NHVA 1GVOA 3WL1A 5LKYA 3PJWA 3VCNA 1FFRA 3ZM8A 3M07A 2V5KA 3UW6A 3TDFA 2WMGA 2P50A 4NXSA 4FA3A 1UWRA 1QW9A 3V16A 5CJ5A 2Y85A 3O3RA 2NVDA 1UG6A 1TA3A 2J24A 1N8WA 3MI6A 1DQWA 4R53A 4IQEA 2GJLA 1OD0A 1A3HA 2WHJA 4LEFA 4PTXA 3LLFA 4Q8WA 4KQNA 3WF0A 3BMXA 3B8TA 3HPZA 2J7HA 1ALDA 4E4PA 3GHRA 3ZR5A 3FYPA 4AMAA 1TTQA 3V1HA 3WBEA 1XYAA 4OHQA 3RIKA 3FS2A 2DUXA 5D2WA 4MJ4A 5LIXX 3C3NA 1EQCA 3K8MA 3TU9A 3USZA 1Q66A 3NFUA 4G9PA 5CAKA 3KCJA 4NAEA 3CBWA 1NP0A 1HKVA 1P7TA 4A21A 4S2CA 4DM1A 2A79A 4B9ZA 3B4YA 3A6OA 1F3EA 4JTEA 4PZVA 1TV8A 5T9CE 2I9EA 1V6TA 1TJ2A 3S6OA 1GKRA 3UWYA 1G67A 3KHJA 2NLIA 3W7RA 2ZZ6A 3KWSA 1K9DA 2R1MA 4WRHA 3T2OA 3CAKA 4RV8A 4LYKA 1CECA 1PCWA 1VIWA 2VENA 1G5AA 3Q58A 3M0JA 3QXBA 3CQHA 4UOJA 5G5IA 4W7WA 1EYEA 2EHHA 2QUUA 3RPDA 4EXAA 1XLBA 3W2LA 4JTRA 3T42A 1GVRA 4GYPA 3LGDA 3CZEA 4RX0A 2ZZ7A 3M5VA 4P7NA 4LUIA 2X40A 4H2CA 3BCDA 1NQKA 2W92A 3WH8A 4DY1A 1ZFJA 4AUBA 1JRCA 4XX6A 2ZX8A 5DQPA 4C6KA 2GWGA 1GEHA 5F2IA 4A35A 1MW0A 2R91A 3QPZA 2R1PA 4WSJA 2DH3A 4MY9A 1E4IA 3VD5A 3GZAA 1KGXA 1F7BA 1FA2A 4MLRA 3GXDA 5CG0A 4MMWA 2AQWA 4X0NA 4TVDA 3LXBA 4E8GA 3T0CA 2WCGA 1RPXA 3UWVA 3LYEA 2ZZ1A 4QR6A 3KE0A 3URBA 2E68A 4PR4A 1EO5A 2WZHA 3UR7A 3WG6A 5CPOA 4B9YA 4DUVA 4M8UA 2QCCA 3BJFA 3TMQA 4IFRA 4LBUA 4TTGA 4NG3A 2G3MA 3ME3A 4PUKA 3RK8A 4AC7C 5BMXA 3GKAA 3QMSA 4AIBA 1W1YA 3ABZA 2D2OA 1MVYA 2EG6A 4R7WA 3SAZA 3CH9A 1IT0A 2PE4A 5HANA 1XLKA 3MHFA 4HSOA 4UMBA 4W8AA 3W02A 2PBOA 3AXKA 4JDBA 4C6NA 7A3HA 1F4HA 3IJ7A 3I10A 1S1RA 2J7EA 4BCEA 1EDQA 3GC2A 4BF9A 4FLOA 3WDQA 1O12A 4JYDA 1RK6A 2QJJA 3UGVA 2ZA1A 2J7DA 4YL2A 3WMSA 3LERA 3BK0A 4X3ZA 2X16A 3BTNA 1B57A 3HFYA 5I79A 3WDJA 3CXOA 5BCAA 4GMEA 4UTHA 1EJWC 4LGXA 4MB3A 1OFRA 1FWEC 2Y8UA 2PP1A 1DE6A 3U2EA 2BZNA 2JIWA 1LLOA 4RW5A 5K9DA 4W85A 3PVFA 2FTPA 3LPFA 4FOKA 1VB9A 1H5VA 4IL0A 1I1XA 1J5TA 4HHLA 3BDKA 2IMRA 3GO2A 3LPPA 2GDUA 3AZTA 3AS3A 1FWJC 1EHAA 1VR6A 1IIHA 1WBHA 3ZSTA 1XRTA 5HNNA 5D05A 2JKPA 4S2BA 1RA0A 1DJYA 3M6DA 4RK8A 1E6SM 5G1YA 3GIQA 4MJ2A 4AVFA 2GK1B 4EAYA 5REQA 1BWLA 1OYBA 3W88A 4MOZA 3G6MA 2O55A 5G4EA 1CIUA 5CPLA 4M0XA 4JR5A 1RLCL 5ABEA 1NU5A 2XU2A 4UQDA 3VNDA 1GJWA 1FTXA 1T40A 1U22A 3IV8A 3EPOA 4FOJA 4NXKA 4PSPA 1OCBA 4C91A 3DENA 4GWEA 3WD0A 5T26A 3PJXA 1XBYA 4UTIA 1RV8A 2JF6A 3M43A 1ZCCA 4H6QA 3OW1A 2XVNA 3M64A 3LZ3A 1EA0A 1PO9A 4HMNA 3BGGA 3CL6A 4O12A 3IAQA 4H6KA 3WQWA 3DDMA 5LZLA 3TK7A 3S1UA 4JFTA 4Z2GA 3WNPA 1MZRA 4U2YA 1ITXA 1OEPA 1QMLA 3JVAA 2D0GA 4HB7A 3MSGA 3ANYA 4RE3A 1H2JA 3PTKA 1ISYA 3CQ0A 3B0XA 2VFFA 4LH8A 2PLMA 4XZWA 4G5DA 2D0HA 2B7QA 3M0IA 4K2SA 1KV8A 3KLKA 1P6CA 4AZ5A 2J74A 1W8SA 4R7JA 2BXZA 3HQOA 2QR6A 4WKFA 2WM0A 4LY8A 3U5UA 1E15A 4HP5A 2E28A 1PUDA 3KLLA 2GPTA 2R82A 3AIWA 2Q8LA 2DZXA 1EXPA 2DPEA 1GORA 6ALDA 1IGSA 2WKLA 1NQ6A 3LLDA 4JIHA 4XAFA 1MQRA 3OOQA 2QXWA 1ONRA 5A6JA 1W9DM 2E6AA 3VFLA 4NJJA 4UTMA 3LM7A 3LSCA 1BRLB 5HUPA 4YLWA 1J79A 1V0LA 4LC6A 1I60A 4L6DA 4IOTA 3WD4A 1KM5A 3T6CA 1MW3A 4HOZA 1TWIA 3SEPA 5H2ZA 5DT7A 4QQUA 4M6QA 2I5GA 1TV7A 1TWDA 5D9OA 3DX5A 3W6LA 1C7SA 4PEEA 4Z2KA 1SFSA 1BWKA 3DEQA 1ADOA 2VVSA 3QQWA 2A6LA 1POKA 1AA1B 1OFQA 3R79A 1UKOA 4R5EA 4C6PA 4GI6A 2E40A 2WZMA 1VLIA 3WH6A 4NZJA 3GG8A 2YL9A 4HJWA 4J40A 2O9TA 3LTSA 2H9AA 3TOYA 2XGBA 3DBNA 4IH3A 5H91A 2VGIA 1EJRC 3V5OA 1BG9A 4FNRA 3WKZA 3IVSA 3IARA 3N13A 3WJWA 3QEZA 3TQ0A 4GQ0A 3ITOA 2D20A 1ECEA 4I5RA 4ZSTA 1OZQA 1X6UA 1XWYA 2Z29A 2ZADA 3IRSA 4XAPA 2OKOA 3RX2A 3STGA 4DAIA 3L4TA 2OWXA 1QPKA 1V6WA 4QE5A 3T07A 3A5VA 4KMQA 3A5FA 3W83A 4GH3A 5HINA 1CDGA 4DELA 1TPFA 4FLQA 1CTNA 4AZ7A 1IZJA 2CERA 4IP7A 3T08A 8RUCA 2Z28A 3PPCA 4NNCA 3L4UA 1LLWA 3G0SA 4NU7A 3Q94A 1HW6A 3UG3A 4X61A 4XZ9A 1PZ1A 3VDCA 2D22A 1RD6A 3QY8A 3DBPA 3CO8A 5JH2A 1B3XA 1VBUA 2UZ9A 4B90A 3ITTA 3SCQA 1FWIC 1I2PA 3WJSA 3LLXA 1MUMA 1ODUA 1FWDC 3MWCA 5T9BG 3LUTA 4H6EA 3E0IA 1JJKA 3EGJA 2PRMA 2VZSA 4V1XA 2PC8A 2P5NA 4Z0SA 3DFHA 1X38A 4GKLA 2XSAA 3A3WA 2XVPA 1C9DA 1S3TC 1J0YA 1AMKA 3PTMA 5M3WA 4PTWA 1W1ZA 5I02A 1RALA 4LUTB 3H22A 1V3HA 2V38A 2D23A 1H61A 1VFTA 3LHUA 1GKQA 5HOSA 2GGEA 1QATA 2DZVA 2VC5A 2WNWA 3WBXA 3UCCA 2X1IA 3W84A 5HWNA 1B90A 3MCOA 1NF0A 3W75A 3VM7A 1Q7QA 3BAKA 3Q4DA 2YCJA 1BWVA 4I6KA 4NQ1A 2C13A 3HFTA 4OV4A 4JKKA 4Z2HA 3CHDA 1WO2A 3TYUA 2EAWA 5AZ0A 6XIMA 4JEQA 4DO7A 4HYRA 3W6MA 3S0CA 1EB3A 1NFBA 2JFEX 2BOEX 2WVVB 4H9VA 1VC4A 2C3ZA 4I9JA 4BF7A 4H8HA 1R3QA 2VWTA 4AC1X 2ZX9A 4ICCX 4D8ZA 1Q6QA 3UR5A 2OX1A 3UXIA 1TELA 2WBGA 3GS6A 1UJPA 4IIFA 3ZFHA 1TKKA 3TTYA 4AHQA 2PDCA 1XDJA 3W7IA 5EMUA 1WZLA 3B97A 4O19A 2DSUA 3SCVA 1NWRA 2JBMA 4Q22A 8XIMA 1FWCC 1CGWA 1K8XA 3JZEA 3KXQA 1BF2A 5K4ZA 1NDYA 1RJRA 5ECUA 5FF7A 2ZRVA 2ZE3A 4TV6A 4DO6A 1L6YA 2F61A 2YB1A 5JIPA 4HPJA 3IVUA 1C91A 4J9JA 1H11A 1BD0A 3N2MA 4QJ4B 1AODA 3GC4A 3IK4A 3VOHA 5DF0A 1UKQA 1V3LA 5E70A 5EPDA 5AHEA 3E1F1 4XISA 3N29A 3UETA 2RGLA 3MKKA 3AIEA 3S2NA 1AH3A 2GJXB 1F9CA 1H7WA 3QJAA 1R3SA 3VGBA 3RPMA 4LAKA 4M29A 3P0WA 2CHNA 1W54A 2YL6A 1R46A 4TX8A 3TIMA 2YXXA 2CC0A 3KM8A 4MB1A 3TYDA 4LXFA 2WQDA 3FAWA 3QRHA 1BQGA 1JDEA 3W27A 4TO8A 3VDAA 1FH9A 2B4GA 3PN8A 4KESA 3L68A 3V18A 3WEZA 3NPUA 3MMDA 4PA8A 4HU3A 3L4WA 2ZX6A 3AIUA 1F3WA 1YIXA 4GZEA 4PBGA 1TZZA 5AC5A 5HMFA 2WYSA 1GHSA 3N6QA 4BF5A 2WKJA 4U5KA 2YLAA 4UQCA 1MUCA 5I06A 4DPQA 1FHVA 4YN5A 3QY6A 3R89A 3LS9A 4FX8A 2QCHA 3M0ZA 1C8VA 3NGJA 1XFBA 1RJPA 5HR6A 4RZ5A 2PLKA 3VINA 2HE8A 1F4AA 1JYWA 3RMEA 2WWDA 4O1BA 3WSUA 3PFMA 2H8ZA 4B91A 1HL8A 3SCOA 3WJXA 1VZWA 5J5RA 3S5ZA 4LV4A 3VZYA 5MKGA 4LV9A 4ADUA 3PF3A 3OP2A 1MUWA 4JNMA 2VHLA 1I75A 1W2PA 3K1DA 3ID7A 1O1ZA 4GUGA 2TSYA 3MSDA 4HYWA 2HWGA 4FB7A 1E4NA 3MSYA 4EXBA 4FP1A 3P62A 3CASA 4CU6A 1U5JA 1JI2A 1U1UA 3B8SA 2D3NA 2WHMA 3WMBA 3OEXA 4C90A 1W17A 1ZU8A 1XLIA 3SCTA 2QPUA 5C5YA 2DVXA 3IGHX 5D30A 3A12A 4ECLA 4IHCA 2FPYA 5AKQA 2VC6A 1E0TA 1Q13A 4DLMA 5AY7A 3S1WA 3ZVHA 4EX4A 2PGFA 1J01A 5DMLA 3GG1A 1JDFA 2OOFA 3R58A 1Q45A 1E73M 2RDUA 3NXFA 2X8RA 3JW7A 2I9UA 1MDRA 3BLFA 3ZSSA 5CC7A 1W9PA 3L5MA 5AYYA 3PZTA 5EMLA 3SSJA 4TX6A 5C8BB 4PN2A 1W1PA 4IG2A 3GH7A 1YPIA 3W76A 5C54A 2PP0A 3CJPA 4M7TA 3ZXWA 3CWHA 3DC8A 4XVEA 4NVTA 5CJNA 2ABBA 2FIQA 5D33A 4LRSA 5HPCA 3TR2A 1NFGA 3MUAA 5DRIA 6XIAA 2WVTA 3AROA 1EQPA 2X09A 1EIXA 4IGNA 4REQA 1BAGA 1UROA 3I4EA 1XLJA 2A3BA 7TIMA 4PMYA 3C86A 4JZ5A 3UBPC 1J0ZA 5C70A 3K4AA 3M0YA 2EGZA 3NIYA 1XIJA 1EL3A 4KWUA 2HQAA 1RP9A 2Y70A 2OODA 2YCLB 3APTA 4GFSA 1R3WA 3BOXA 3T55A 4MM1A 1PCKA 1KW1A 3V1PA 2OEKA 4PUUA 3RR4A 1K9EA 2OSWA 3CWNA 5ABFA 3CMJA 3UQNA 2OLSA 1G4EA 3SQSA 5A6SA 3DC0A 2QJGA 3NOEA 1AVAA 2YGYA 4GFIA 4AZ6A 2X2YA 3UF9A 3WEOA 7ODCA 4L65A 1Q8AA 2PD9A 1JPMA 4V15A 4ES4A 4BHYA 1VRDA 3M0XA 4EF8A 1KM6A 3W2KA 9CGTA 3PZQA 4QJ1A 4BFAA 4LTSA 4ERIA 4XZBA 5FAGA 1XH0A 5A2CA 4YHEA 1WXYA 2CZVA 2VR5A 2UY4A 1XLHA 1FWWA 4WGXA 3W38A 3SGUA 1KGWA 1HJUA 1VBHA 1EX1A 3ITVA 4G2DA 1E9IA 3TLQA 2VOMA 2BODX 3PPFA 4TUFA 3UJSA 3NAVA 3G3MA 4QJ3B 4JXCA 2PSNA 1R3VA 4WKAA 1E3ZA 3KL5A 4H9MA 2FZDA 1OFDA 4P61A 1L0PA 3FDGA 4HZMA 1JXKA 3I68A 3H24A 2PWGA 1A47A 3TYCA 4GCAA 3PY2A 3W6YA 2EPHA 4QBXA 4AZCB 4R3UA 1KBBA 1SQ7A 3EXSA 3CV6A 1F6KA 5CKSA 2WV8A 1AZ1A 4XVDA 4ZGYA 1KO0A 4MWAA 2Y63A 1EUNA 3EZ4A 4EK7A 1TE6A 4F0KA 1OABA 4XSMA 4KW2A 4BS0A 3GKFA 3KP1A 3TFCA 5AZ1A 1UB3A 1IR1A 1J0IA 4TV5A 5KZDA 1XIEA 2WZEA 2Y0FA 3T44A 1RPKA 5FEXA 3OYXA 2XHYA 2QPSA 1TJRA 3GXFA 2VX4A 3R8RA 4PTMA 1TIMA 1UWAA 2OFJA 1V6VA 4NRSA 2X7WA 1WZAA 1V3JA 2BOGX 4Z2IA 1KXHA 5D8ZA 2ZUTA 1T8QA 1P0DA 2V81A 3XISA 4O13A 1Z32X 3HBLA 1UD3A 1FWRA 5G2WA 3W26A 3BQ6A 2AGTA 1GQNA 3MVIA 2ABAA 1DWAM 4C6MA 5ABFB 2G37A 2NV1A 4H83A 4IQDA 5GPRA 3VKDA 1IEWA 2PP3A 3LXCA 3PSWA 4O0QA 3EOEA 5CGQA 3EWXA 2PZNA 1GYNA 1IHIA 4X22A 2HS6A 5U4NA 1EJTC 1NM9A 3PJUA 1AFSA 2HS8A 3O15A 1XG3A 5E6ZA 4N6FA 4PCTA 4DF0A 4AY1A 2FTWA 3G1XA 1FFQA 2E6YA 1SJDA 2DZSA 3ARTA 4QIUA 4Q8MA 3I4KA 1YMYA 3ABXA 2NXIA 3N4FA 3VPLA 4DF1A 3WMCA 4HNNA 3P5YA 1XXXA 1EKOA 1DXFA 5HWJA 4WX2A 1WUEA 3CQJA 2VRKA 4RNFA 2R94A 4OE7A 1Z48A 4JAWA 1A53A 4HNTA 2AL2B 4MB5A 3WNMA 1Z9AA 1JCTA 1DQXA 4DJEC 2PODA 4MTVA 4O57A 4GX9A 3TZFA 5IRPA 3GY1A 3GVWA 3T4CA 2XIQA 4Y9AA 3QW4B 4YMZA 1JGMA 2BTMA 2Q3RA 4GZJA 3W3OA 3WCZA 2ZUMA 5CEWA 2QS8A 1GTHA 3GSMA 3PHAA 3GC5A 3CUIA 2DT2A 1TO3A 2Z7KA 1TG7A 2J75A 3THQA 2WQPA 4MWAD 1SW7A 1LBFA 2ZBTA 3T8LA 3N19B 5AVHA 4GIAA 3LCGA 3PM6A 3CMGA 4HZ8A 3R8GA 1Z41A 2CLKA 3O6CA 2ISDA 1SFLA 4MAVA 4HNUA 2JIEA 1LRQA 5KMYA 4JTUA 3GAYA 5DMNA 1ZAIA 3WQ6A 2PDWA 4M1BA 1TPWA 2VEGA 1K8ZA 3B04A 3A47A 4WJ8A 3EWWA 2FB3A 2Z4GA 1KFCA 1ZALA 3W2UA 5CZKA 3LN3A 3DESA 5D2VA 1TPVA 4QISA 3R5EA 4YTTA 1JYXA 3TN3A 1S3HA 2HK1A 3CLMA 1BSIA 1LOLA 2DQWA 3E0FA 3UJRA 2BSLA 4CCZA 5FJJA 4RR4A 2YCEA 1UC5A 4DIAA 3E96A 1K9TA 3MJMA 3ZT5A 3FCPA 4UBPC 3LOTA 3SN4A 4WXZA 3EAUA 1Y5WA 1UZ4A 4C6EA 3C4UA 2CLFA 1PWMA 2FGBA 2I7GA 3SURA 3RLUA 1XKJA 3EB4A 3AQUA 3RG6A 3DHFA 1YADA 3TA6A 3NQMA 1F74A 2CIPA 1NDZA 4QM1A 1CWYA 3LCIA 1H1ZA 1GPWA 1G94A 1E9LA 1OK4A 3LCHA 3VTRA 4H00A 2VR2A 3RMJA 4EE9A 3WJYA 3NZ1A 3WLOA 3KTSA 4LF2A 3C5QA 1GNXA 3AS0A 3VKKA 4BQ3A 4MKVA 4HA1A 3I6RA 5HK4A 1CGVA 1W6TA 3HG3A 2C1IA 2O9OA 4M51A 1KRMA 1LL4A 2G97A 3TW7A 2PWFA 4RNJA 4JTKA 2GGIA 2BLEA 3TX9A 2WSPA 4IMDA 4DNMA 1R7OA 1UZDA 1UASA 5GJNA 2VCCA 1EBHA 3LA4A 2C71A 3T78A 3ABSA 3HTWA 1ZSXA 1B2YA 3EEZA 2PDLA 2D2GA 3D46A 3F4WA 2XM1A 4YYCA 1FWSA 2G5WA 1YNPA 2GJNA 2V8ZA 3LNMA 1UBSA 3AI0A 1OF6A 3VNJA 3CZ8A 2W5FA 4XIMA 3SBFA 5TAOA 3QPYA 2Z1BA 3EOSA 4JCLA 4IX2A 1OGGA 1S5NA 2GWNA 2IXVA 4N4PA 3GXPA 4HHPA 1H60A 1KM4A 4MWAC 2E9MA 2CKRA 1XIHA 4DXVA 3RAOA 3C2OA 3VGFA 1CX9A 1FOBA 4Z1CA 4S3FA 1TWSA 2G3NA 2FH8A 3CPUA 4L80A 1UIPA 1H7XA 4ADSA 5D9MA 5BXPA 1MI3A 1K4GA 2IPFA 1IE7C 4E5TA 1E71M 4TR9A 1I45A 3W29A 3PZGA 4UCGA 1OB0A 5BXRA 1EP3A 1GQLA 3UWWA 2PUZA 5CPSA 4HU8A 1OC6A 2E7FA 5E93A 3SZ8A 3WLTA 3FJNA 3GFXA 5F2MA 2X7VA 1W8GA 1E0UA 3O05A 1UD2A 1M65A 1V3IA 3HGOA 1S2VA 4C7DA 3NDZA 2RGMA 3BSGA 3NQBA 2BOFX 3UWEA 1SZEA 1C8YA 3W1PA 3QBUA 3GAKA 1XYLA 1IWPA 3OTRA 3CPGA 1EC8A 1D8WA 1XYZA 3MT1A 3U3HA 4NZ5A 3I6EA 4GI4A 4J1OA 3THCA 3UG4A 2FZ9A 3TW9A 1W3JA 1P0KA 5K2ZA 1Q8JA 4WCJA 5FEWA 1Q6RA 4HCHA 4ZXLA 4Z2JA 5CZSA 1CI1A 2ZWZA 3U2ZA 4B3ZA 2G50A 3P0XA 3W1LA 3FFSA 2G3JA 1XCWA 3KCLA 2C7FA 4UFIA 1P1XA 1XPYA 2Z6JA 4LBSA 4FOUA 5A6LA 2GJPA 4WD0A 3W07A 1KWKA 1FH7A 4WUIA 4OECA 5D8WA 4UZUA 4IL2A 1OINA 2OB3A 4RPPA 1UWUA 5K9XA 2NT1A 3UWZA 3GZ3A 2WZTA 4FNTA 1EJVC 5AB3A 4G7FA 3WQEA 1PDYA 4PMJA 3C8NA 4L6HA 1XH1A 4ZODA 5AHMA 2BXYA 3BE7A 4ZZ9A 3MMTA 3G2GA 1RBOB 3HPFA 4DX3A 4AYSA 3G8RA 1EF3A 4UFHA 5AYZA 4WQ6A 4PMVA 4YXGA 3GYCA 1PIIA 5I77A 1ZP3A 1TPDA 1B3WA 2J7GA 3MKCA 5U7SA 3HG4A 4GH1A 1ESWA 2GGHA 1BSLA 3TFXA 2YCLA 1XRVA 2XDFA 6A3HA 4PC8A 5LA2A 1EF2A 4Q3MA 4F0LA 3ZZ1A 4D9PA 2WLYA 3GHTA 3VGHA 1R30A 1PTDA 4EIVA 3CT7A 2IPJA 1QPNA 2OZ3A 3RM8A 4WJEA 1S39A 1JCNA 3N4AA 1KFLA 4NZCA 5H8UA 2EQDA 3R1ZA 3WQPA 1V5XA 2CKSA 2OZ8A 1IXPA 2H3BA 5JH1A 3FY1A 4AF0B 3O6AA 2OXNA 2FVKA 4NZ3A 5JMUA 4HMDA 1UR1A 3CQKA 1QI0A 4WY0A 3URNA 1SGJA 1ZHAA 2F2KA 3EWZA 3W28A 5A1AA 4C60A 2YLLA 1ODZA 5AOUA 3UNDA 3GW0A 4IUOA 3T0AA 1EWDA 1H50A 3NNTA 4V1YA 4KEVA 3GDRA 3C2EA 1E6QM 4CVUA 2VX6A 4B15A 2VP8A 3QLDA 2OQHA 3CHEA 4CD7A 4WJXA 3UD6A 2HPMA 4OUIA 1EOMA 5C71A 1IQ8A 2QJMA 3T0BA 3R11A 2WO5A 3VX0A 3VD7A 1G9HA 3L9CA 4IPJA 2JF7A 3CL7A 1PKYA 2REQA 1F8IA 3AHXA 1E1CB 1TX2A 2H3DA 4XSLA 3KEHA 1W31A 4HQVA 2NQ9A 1K77A 2VO5A 2DEPA 4FNUA 1RQBA 3NQCA 2XH4A 2F6UA 1MYRA 3OGSA 3GE7A 2PGEA 3VVGA 1PL9A 4LCQA 4J2PA 1BQCA 1QBBA 4M82A 3H2NA 1OFEA 4KWWA 1LQ2A 4JX5A 2J6XA 2EKCA 3HJEA 3QC3A 5E09A 1D3GA 4O17A 1E0VA 4GYFA 2AL1A 2QDGA 2W9MA 3CV2A 4BEQA 1ME9A 4K39A 2DSZA 3NOYA 1HJWA 1PJ9A 2Z1XA 5I6SA 1XLFA 3GR8A 1ISXA 4ZTYA 5M2FX 1UP3A 3TAOA 4I6VA 4Y9NA 1MQQA 3KBSA 1GZ1A 3VI2A 4DWSC 2CNCA 1R87A 4WIWA 4J5NA 1J6OA 4JIEA 1QO5A 4QRNA 1JPIA 3W1QA 2O9PA 3NZGA 1A4LA 3TCSA 4PMNA 3UFYA 5A69A 1I4NA 3B03A 4FO4A 3QZAA 2EO7A 1XIMA 1YTKA 2ZVIA 2Y1HA 2PZ0A 2QCDA 3L23A 5DCDA 1XDLA 4JTCA 1MFUA 4M24A 2ZIDA 3ES7A 1J4EA 1UR2A 3B0YA 4N02A 4PUNA 2ZZ5A 1ZGDA 3B3DA 3PWGA 3O07A 1NOWA 2QQ6A 4GXWA 1AMYA 3F4VA 3N6HA 4QLLA 4UFLA 1TTPA 5TBOA 4DJDC 5H1WA 1R9XA 1FCVA 1QI2A 4J3WA 1FDZA 1KV5A 4V28A 3OB8A 4UB9A 1YE6A 3W2MA 1QI5A 2ZDRA 2E5DA 2CBVA 4WLCA 4YJ5A 3WQVA 1LCOA 5D02A 1B0IA 3SUTA 4JIIX 1GOKA 4GPNA 2GVLA 3NQ2A 4HPGA 1MXGA 3WNNA 1V7AA 4K8GA 1R3RA 3GBEA 4ZBCA 4KS0A 1JUBA 1FCUA 4C1LA 3S46A 4ZQCA 1OZMA 2KAUC 3WLJA 3BCJA 4U28A 1WAUA 3FIGA 4JHMA 1CGUA 2V2DA 4ACZA 3SCUA 3K2GA 1Q7ZA 4FS9A 3GG0A 2A6NA 1PKLA 3W1NA 4ZOCA 1EJXC 3G18A 4KETA 1REQA 1U30A 1HZYA 2Y7GA 1DP0A 5D2YA 1FKWA 1D9EA 2RDTA 1DIKA 2OWCA 4QE4A 4P8WA 3CIVA 3CHCA 1O95A 1D8CA 1QNQA 4QP0A 4Q4KA 5HMEA 1X7IA 4OOUA 1KCZA 1JQXA 3PK7A 2AMGA 4PSRA 4QDWA 2YW3A 1XUZA 2XYLA 4EPEC 2R1KA 3AICA 6ENLA 4EF9A 1TREA 4S3EA 4F0HA 4NAEB 3AWOA 2BXVA 1K7FA 4Q4QA 3QZ6A 5LIUX 1DWIM 2IPGA 3SB0A 5LGZA 3UEQA 1W56A 1A5BA 3W73A 5I3IA 4BY3A 4UMCA 4L6OA 4DXKA 2G95A 2PDBA 3PG9A 1DHKA 1X96A 1B5TA 1NDWA 3RO8A 5DO8A 2YYUA 3PBMA 3VK5A 3CV1A 2FHFA 2OZTA 4B5TA 1IGWA 1GPFA 3NDOA 3JR2A 4A3YA 2QAPA 3F7JA 4DWSB 2QCDB 1TR1A 3KL0A 4CQCA 1S5WA 2DT3A 2FH6A 4C6CA 5FOOA 2Z26A 2PRHA 3GXIA 4GI8A 2EJAA 1E1FA 1T99A 1FVPA 3UZWA 3NM1A 3CAWA 1ZLPA 3MSRA 3W7NA 3WH7A 2W67A 4MUZA 4R9OA 1HJXA 3MBFA 3RO6A 4PUDA 3LPOA 4C65A 4NY2A 3QHOA 3OGRA 4DBUA 1E6XM 5A2AA 3S9IA 5HJYA 2QGYA 1OYCA 2FFCA 4FSAA 1BVWA 1PHQA 4XD3A 3VOIA 3AMKA 3BMWA 3N9RA 5DCBA 1JVNA 2HEJA 4W5UA 1HVXA 4PBEA 1F3XA 4US6A 4BR1A 3CUHA 2X0YA 4CD6A 3APGA 4L9YA 4U10A 3PULA 4EPKA 5H8MA 1GVYA 3RM4A 2VGFA 4W86A 1CLKA 4E4FA 1A5SA 1O1HA 1PBGA 2QVHA 3WQDA 3E5BA 3W82A 1NJJA 4F2UA 5CPTA 1HQTA 2LLEA 3PBVA 1K03A 2ODOA 1KLYA 1RCXB 5K7JA 4PMUA 3IPWA 4XD6A 2DZTA 4QDMA 4DZHA 3SADA 1RR2A 3G6LA 1C93A 3E2VA 4KEZA 1XJBA 1CYGA 1E43A 5FAJA 1XLMA 4XIAA 2VRQA 1TA3B 1H49A 2ZZ4A 1IR2A 3TJLA 4MLJA 4QCFA 1DJXA 1XI3A 5IDZA 5FJOA 4CD8A 1VYSX 3TYAA 2PEVA 2VEIA 4IP5A 4Q4PA 1FY6A 4TOQA 3LY0A 1SJBA 1PB0A 1JPHA 1XBXA 2ZE0A 1HP4A 3HG2A 4LVFA 1LUCA 4Y96A 1XLCA 1QFEA 4DBSA 2CHRA 1J2WA 1HJVA 3L4YA 2XN1A 4UTJA 4UTFA 3BL3A 1NAL1 3ZJ6A 1YDOA 3CUZA 5D32A 4LUJA 3OPSA 3BAJA 4OQVA 1X98A 2OYKA 1XR2A 4UTKA 4TIMA 3AAMA 1EYWA 3CMFA 1Q6FA 2RH9A 3UXDA 1H5YA 2AQVA 2PDPA 4O16A 5CSUA 5AC7A 2FPVA 5BXTA 3DH7A 3PAOA 3HV8A 3QR3A 3TH6A 4LAMA 3ZJ8A 2CBIA 1MXSA 1Y65A 4W87A 4CNUA 2X1RA 1SJCA 1BYDA 1JF5A 3F03K 2CPUA 3VC6A 3CU2A 1OFPA 3CQIA 2GUUA 3N11A 1XIFA 4LSBA 1ISWA 1E9ZB 4O28A 3EPNA 2DH2A 2Y89A 4J27A 4JL2A 2CZDA 3WQ5A 3H2MA 2Z00A 4S39A 3JS3A 4HPHA 1ZCOA 2Y61A 2D3LA 5TD4A 3MKVA 2O4QA 3RCMA 2OVLA 1JD9A 1LQAA 2ZTKA 4O4WA 4LUSB 4F66A 2XFYA 2DORA 3TW6A 3S42A 2HK0A 1OIFA 4RCXA 4R9XA 1P5BA 4KCUA 4ROPA 1LWJA 4BI7A 3NZPA 4LT9A 1AJZA 4J3XA 2HSAA 1RHCA 5F1UA 1VEMA 1TUFA 3IGSA 4JTJA 4ZFMA 3V5FA 2BV9A 2DQXA 4KRTA 5TF0A 1O6IA 3DG6A 4C5ZA 2Y7DA 3TXVA 4WXYA 4DN1A 3P8JA 4FR1A 3C0LA 4MHBA 1DE5A 2HROA 2AOSA 4LUSA 2XFWA 4GC3A 3AHYA 1X39A 2P10A 4PBFA 4LYQA 3DGRA 3VZXA 2GL5A 2IKJA 3EB3A 2V82A 3TTQA 3GH4A 3MANA 5EMJA 1ONEA 2FGZA 4L56A 1A5MC 3GVRA 2V5CA 2YA1A 4GNKB 2Y2WA 4ZR8A 1XC4A 4WGHA 1PAMA 3L66A 1XW8A 3GU1A 3U5YA 2INFA 2OJPA 1WDQA 4CKQA 1Y0EA 4TXEA 1QW8A 2PU1A 3W9ZA 1VH7A 5A8MA 2ATSA 2J9YA 2YDRA 3E0WA 4A8LA 4X2RA 3AZRA 2YDSA 1J18A 1DPMA 3NSXA 2DSKA 2GVGA 1VBRA 1XICA 1FP9A 1X6LA 1RAKA 2DT1A 5BWAA 2C0AA 3IGXA 1SO5A 5I2UA 4A8NA 3PWIA 1LT7A 5FF4A 2ZRYA 4QSFA 4AY8A 1AD4A 4PFHA 1M01A 4WDTA 3GTFA 3VU2A 4GXPA 3GWQA 4Q7BA 3BV7A 1CXLA 2E3ZA 2QCEA 2NVAA 3M4HA 2J13A 3TWAA 3WELA 3VCRA 3A4AA 3VMPA 1S2CA 3UGRA 3ZQ9A 3F1QA 4JKLA 4B3LA 4ZO6A 2OQLA 5I7GA 3GDBA 4U5IA 5DCEA 7CGTA 2VNCA 3DUGA 3NQGA 2FVMA 1GONA 2QHAA 1HO4A 4HK7A 1EPVA 2CLEA 3VILA 4FALA 4ONVA 4IJCA 4U31A 2WNNA 2GQAA 2FGLA 4QG6A 2CFFA 1I9CB 2BVTA 3UZZA 1ZJHA 4NRRA 2GLKA 4I90A 4YU1A 2DV0A 1TPEA 1R2RA 1JYNA 4L1XA 4AIEA 1OM0A 5I3HA 2PDYA 4HOXA 1DXIA 4QROA 3MUXA 3CV7A 1T41A 5GNYA 3TSMA 4XAYA 4AIOA 3B05A 2F2HA 3PUOA 3W23A 3K8KA 3DHDA 1VPYA 2INZA 4J3UA 5EU9A 1M7OA 2PWHA 2EPOA 1Q6GA 3D0CA 1YPXA 1CLXA 4LBRA 3MB9A 3QKZA 3MVTA 4OVXA 4CQ9A 4P7QA 3G1AA 3O63A 3D3AA 3LGEA 2PA6A 3LRKA 4ZOAA 3G77A 1HL9A 2WC7A 3ZT6A 1XIBA 3MHUA