1TE1A

Crystal structure of family 11 xylanase in complex with inhibitor (xip-i)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase inhibitor protein I
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Penicillium funiculosum
molecule tags Hydrolase inhibitor/hydrolase
total genus 92
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1te1A00
1BYBA 1G94A 2WLYA 4NI3A 1ISVA 4GI8A 1B31A 3AHTA 5EMYA 1GVIA 2A3BA 1VFMA 3GH7A 1AQMA 2WVVA 3WH6A 1H49A 3MU7A 4W5ZA 2QMKA 1UKOA 2W67A 3DECA 2GJXA 3WF4A 5A6BA 2VZOA 1CNVA 3ZM8A 1JD9A 2VTFA 2OYKA 2BY0A 1UOKA 4GQQA 4GKLA 4UQAA 2J74A 2DIJA 1G01A 4W93A 2J8GA 1NQ6A 4U2YA 4LYQA 1C7TA 2CBIA 2WHJA 1HT6A 1HJUA 1PZ2A 2ZUWA 2BVDA 1HKIA 1UR8A 1MQPA 4W87A 3OZPA 3D3AA 4Z2IA 4GZEA 3L4WA 1GOKA 2F61A 3PZMA 1EOMA 3TTQA 1XGZA 1VFOA 1HNYA 1Z32X 5HOSA 2PWDA 3GH4A 2W4XA 4XB3A 1CWYA 3ARXA 1FFRA 5ABHA 4KH2A 1VBUA 3WF1A 5C70A 3CH9A 1E6PA 3MS8A 1CLXA 5LA1A 4LYRA 4PMVA 5E0FA 3L4VA 1KXTA 1EO5A 2VRKA 3II1A 3CGTA 1JDDA 1OGSA 3KEHA 1UUQA 1LLOA 4AWEA 1GOQA 5GQBA 2WSPA 4S3JA 3QR3A 1EQPA 3MUAA 3UG3A 1HL9A 5CGMA 4CUCA 1W32A 3ZT7A 1OGGA 4DWSC 3VGEA 2DSWA 5JUVA 2Y24A 2FGLA 4KRUA 3PTMA 1V3LA 3O6AA 2DQXA 1H09A 1E6NA 3ZJ7A 2WWCA 4AD0A 3RJXA 2PWEA 1JYXA 3M46A 5E6ZA 3BXWA 1RH9A 1LG2A 4NZCA 2F2HA 4GI9A 3VIGA 4FLSA 4EE9A 1Q6EA 4AZIA 2Y4SA 4MDPA 1VAHA 3FXYA 4ACZA 3CHCA 1JI2A 3WD0A 4KGJA 1EDTA 9CGTA 4HU0A 2CNCA 3VGGA 1W3LA 1LF1A 1VFFA 3N17A 4Y7EA 2YOCA 2WB5A 3AZRA 3BAWA 2A3CA 1KB3A 3OB8A 5AYIA 5M17A 3VGHA 1Q6CA 4KGLA 1ISWA 3CZGA 4H2CA 4PMZA 2VUYA 1VJZA 2VURA 1E0VA 3MUZ1 4DM2A 3VX0A 1WKYA 1QNPA 3GYCA 1UH2A 5JBFA 2YKKA 4EAMA 3M7SA 4QP0A 1E4MM 4CKQA 1C90A 3UEQA 4FLQA 2X0HA 1DWGM 1IT0A 2VQUA 3O2LA 4YHEA 2ESCA 2WAGA 1MW1A 3K4DA 4WF7A 1GQJA 3U7VA 4C7GA 1RPKA 3A4AA 5M03A 1ZBWA 3CUFA 4PMYA 3THDA 2J8FA 3NJ3A 2XVNA 5BYWA 2VMFA 4QLKA 4CCEA 1CGWA 1Q6DA 8CGTA 5DF0A 4OUEA 4LPCA 2VX4A 2OYMA 1ZBVA 2NT0A 2YLAA 3OA5A 4CVWA 2J7HA 1DWFM 1CLVA 3ALGA 1W3HA 1SMAA 1PJ9A 2CESA 1WPCA 1XH1A 3VX1A 1EGZA 2VCAA 2QLYA 4GQRA 3I3EA 7TAAA 1QW8A 1NH6A 1E6ZA 2G8ZA 1HKKA 1HVQA 1FP8A 3ARQA 4TUFA 4NRSA 2FHCA 3AMLA 3BAXA 4X9YA 1QVBA 4PMOA 3GXIA 4WSJA 4FLOA 4D71A 2VX7A 3DYPA 2CPUA 1JAEA 3CUGA 4PMUA 1QPKA 1HP4A 3SCNA 1XH0A 1I75A 1OD0A 1BAGA 3AISA 3EYPA 1JAKA 1E43A 7A3HA 4CCCA 1KWKA 3PZQA 1GW1A 3WDPP 5E0CA 1BTCA 3RM4A 4L4PA 1UD6A 3ZOAA 1QW9A 3NSNA 3TTOA 2D20A 4GO8A 1DWIM 5ABEA 4PMDA 5A8PA 5FOOA 2IXUA 3VUPA 2WKLA 1W1PA 3CUIA 2EPMX 1CZ1A 1G0CA 3W81A 1MWOA 1JL8A 2DDXA 3BGAA 2NW0A 2EBNA 1M01A 1TE1A 1ITXA 3VPLA 2DT1A 3WQ6A 1M53A 4B3LA 2FHFA 4TX8A 1A47A 3AIBA 3ARSA 3GDBA 1OGBA 5LA2A 3T2PA 2ZIDA 5A6JA 5A1AA 4MADA 1GQLA 4CN6A 5KZ6A 2PBOA 5HXMA 3VILA 4B9ZA 1DP0A 3S6TA 3WEMA 1BPLB 2WHMA 1ZS2A 1OT2A 1W9UA 2JIWA 2WYSA 2EXOA 2OWCA 4HPGA 4CVUA 1GPFA 4ZEPA 3WUEA 3MMUA 5IXEA 2V3FA 3VNZA 5I3DA 5GNYA 1EDGA 4ACYA 3ARUA 1BGGA 3MANA 3VIOA 2UY4A 4F66A 5FKYA 3POCA 1I1XA 3GBEA 2WMKA 4C7FA 3T0AA 1BVZA 3VD4A 4PEEA 1UA7A 2E3ZA 1K9FA 2E9LA 2ZUTA 3W37A 1BYAA 1WP6A 1W9XA 1WO2A 1XV8A 4FMVA 4CD7A 1CXKA 4PMXA 2AMGA 5KEZA 1J18A 3AMKA 2XWDA 1M7XA 1VF8A 2PF0A 4J3SA 1EXPA 1WB0A 3TTYA 5A6MA 4MB5A 2O9TA 1BQCA 2YA2A 3GNRA 1W9BM 3BCFA 5I78A 2W66A 1OT1A 3CZLA 4KRTA 1TZ7A 3ALFA 2XVPA 1ODUA 3BH4A 2VJXA 3BSHA 3W24A 3WH8A 2WWDA 3UR8A 1RP8A 1JF6A 1KXVA 1NOUA 1H4PA 3UG5A 1E6QM 2EPLX 5BXRA 5BRPA 3VIKA 1JDAA 1PIGA 1KFWA 2CKSA 3VD9A 4NRRA 3PZOA 4BQ5A 3CHDA 3S2CA 4TOQA 4AMCA 2GJPA 1E55A 2ZE0A 1W1YA 4JFUA 3SIMA 1UWRA 1BSIA 4M82A 1B9ZA 3WDQA 5BWFA 4YN5A 8A3HA 4E4PA 2WCSA 1EA9C 4P7NA 2XVKA 3B9DA 3THCA 6A3HA 1VEPA 1WNOA 4CU8A 3UERA 1WZKA 3GM8A 1KQZA 4TX6A 1V03A 2W61A 3AFBA 1CGTA 3A4XA 1XSKA 4AZ7A 3NIYA 2JEPA 4M24A 5CPQA 4J3UA 1BG4A 4D6GA 3VOCA 3SUSA 3ZSSA 3AMCA 1GCYA 1QI0A 3VGFA 5D9MA 3CIVA 3WDJA 4JCMA 1H0IA 4GZIA 1KGUA 2WHLA 3PZTA 1W2PA 3G6MA 3WEOA 2BY1A 4W8AA 3WQ4A 2VCBA 2UWFA 2CEQA 2X8RA 1MQQA 1UQZA 3WNOA 3AYRA 2AOSA 1MYRA 2VI0A 3AROA 3PZNA 1ITCA 4J3XA 3N11A 2WMIB 1WZMA 2BY2A 1JG9A 4B9YA 1TVPA 4PTVA 4ML4A 3LPPA 1EHNA 2HISA 2O9RA 2ZICA 4PMRA 3BCDA 3WUGA 2FDMA 4AIOA 5IFTA 3W26A 4OJYA 1QBBA 3T09A 1O7AA 4OKDA 3WFLA 4N42A 3VTRA 5BROA 3AMGA 1XRVA 3SUVA 1ZBKA 4U31A 4UNIA 2RGMA 1E5NA 3KL3A 4BS0A 4QCFA 1RD6A 1Q6FA 5E9AA 1JXKA 3ARYA 1CXFA 1F4HA 4UZSA 4RE2A 1TUXA 5BXPA 3AS1A 1CXEA 2FHBA 3IJ7A 2IXVA 5A8NA 4N0RA 3VIHA 4JKMA 3CZJA 1KR0A 4R5EA 5C8BB 1H41A 3DYMA 5BCAA 4TVUA 1KCKA 1M04A 1W9PA 3QHOA 4JL2A 1FFQA 4K68A 3CTTA 2WC3A 2YDQA 4BZYA 1V3MA 3OGSA 1EIBA 2J7GA 4ZXOA 4AD3A 1JZ2A 2D0FA 3GNOA 1B3YA 4JKKA 2UY3A 2IUZA 2PWGA 3SURA 1J0HA 1UWIA 5E70A 2OYLA 4P7QA 2VZSA 2WM0A 4W7UA 2CITA 3EDEA 3SUWA 3UESA 2UY5A 1HKMA 1B3XA 1UD3A 2WKGA 3WD4A 1IV8A 1JZ8A 1CENA 1Q4NX 3SCSA 3OBAA 2OSXA 1JIBA 1R7AA 5AY7A 1V3IA 3W27A 3OZOA 1JD7A 3VGBA 1U33A 1KR1A 4M1RA 4GPNA 4IM4A 3BAYA 3FHAA 5CSUA 5A6BD 1NP0A 3WUFA 4A4AA 1C7SA 4HU8A 1UKPA 1H2JA 2VOTA 3FN9A 3LPFA 1KXQA 3VM5A 5BXTA 1UR1A 2Y8KA 2DT2A 1J0YA 2WZEA 3WNNA 1HXJA 3IK2A 4UQBA 1US3A 3GH5A 5I0DA 1G9HA 1QNRA 1UD8A 5ABGA 3AIRA 3VIMA 5A6SA 2BXZA 5JBEA 3WF0A 3AIEA 1DTUA 3EDKA 4UCFA 2XM1A 1QNOA 2XG9A 2QV4A 5EBAA 3NSMA 1YHTA 3AS2A 2XPKA 3F5JA 3WD3A 3RCNA 1H5VA 5AC4A 2Q8XA 3I3BA 1W3JA 3RM8A 1A3HA 2J7DA 3AOFA 3GBDA 2E9MA 2BVTA 3VDAA 2JFEX 1AQHA 3BSGA 2ZUNA 1TFVA 3AIWA 2GK1A 1CBGA 1L8NA 1K9DA 2WXDM 2J75A 1FH8A 3VMOA 1R87A 3BC9A 2GDVA 3AHVA 6TAAA 2VR4A 2O9OA 1WAWA 3W6LA 2OSWA 1V6YA 4HMEA 1OM0A 4M56A 4JFTA 1QI2A 1L0PA 2DPEA 3AIQA 2ZXQA 4W8BA 3ZJKA 2G3JA 1E6SM 2ZUVA 4D1JA 4HPHA 1HF6A 5E09A 2VVNA 2WVTA 3VM7A 4D6EA 4LYPA 3OLIA 3IJ9A 4JZ5A 1E4LA 3ARWA 4AZ6A 4P8UA 1HP5A 3VDHA 4P7OA 3GXDA 4M80A 4UFIA 1HVXA 3RILA 3WFZA 4F9DA 1JDCA 2DH3A 3VD7A 4TXEA 3AIUA 3ZJ6A 3SCWA 3U5UA 3CLWA 4D6JA 4MNMA 3N9KA 3NDZA 5BRQA 5A6LA 5D9PA 2ZUSA 5TD4A 1UZ4A 2G3MA 3ZR6A 4B15A 1JI1A 4CN4A 4WJXA 2XFFA 3GXFA 4A3HA 2D1ZA 3WNMA 2QHAA 1DWJM 1JZ3A 1CYGA 2WMIA 4QFUA 4J27A 4JIEA 1OCQA 1UWSA 1E4IA 3ARRA 3T08A 4W8LA 3WQWA 4J7RA 4RE3A 1FP9A 2X09A 3RPMA 4GI6A 1DHKA 2X0YA 3VNYA 3NYDA 1J11A 4DM1A 4PYSA 1G1YA 1UKQA 1NM9A 2TAAA 2XWEA 2XIBA 5CXPA 1TVNA 3CBWA 3QHNA 3W4RA 1LL4A 1BYDA 2CBJA 2C8NA 4P7LA 1C92A 2V3EA 3T0DA 4JAWA 3K8MA 3BAKA 2Z1KA 1S46A 4H8HA 1US2A 3ZJ8A 1E5JA 1V02E 2BXYA 2WC4A 1ECEA 5C71A 4IPLA 2JF6A 1SYTA 3WH9A 4AEFA 3KL5A 3CUJA 3RO8A 3QGVA 4H04A 4FF5A 1KWGA 3D5HA 4QCEA 1PPIA 4Z2GA 3I3DA 3OLEA 2Y8VA 4CU6A 3F5LA 4PMNA 3AS0A 4PUEA 5A2BA 4D6CA 1OIFA 1E3ZA 3AMDA 1E0XA 1BG9A 1XYZA 2EPOA 3FNDA 3VIFA 2VO5A 4M81A 4P8WA 1U30A 1CDGA 3SUTA 3CHEA 4TTUA 1UA3A 5D9OA 4AXNA 3B9AA 3OLGA 2BVYA 4EANA 5A69A 2G3IA 2WVUA 4PTWA 2E8ZA 3ZIZA 5GNXA 4XX6A 1GUVA 4WLCA 5E6YA 2E0PA 5LYRA 3BAIA 2BY3A 2ZX9A 3N18A 3L4UA 3PZVA 4MAVA 3SCPA 1H1NA 3NSXA 2Y2WA 4J3VA 1MFVA 2YL6A 3K4AA 4W88A 4PCTA 3FAXA 3WIJA 4EKJA 2A3AA 3ARTA 2X2YA 3KZSA 4AIEA 2G4FA 4MNLA 2XVLA 2CETA 2DT3A 2FH6A 2EO7A 4CD5A 2VZTA 3O9NA 3IAQA 1XCXA 5M5DA 1DWAM 4PMQA 1FHDA 4HZ6A 1W3KA 3SEPA 5AC5A 2ZX7A 2E4TA 4MB1A 1LL7A 1QI4A 4BA0A 1KXHA 4DUXA 1Y7VA 2BFGA 2EPNA 4TVDA 3FHQA 4NSBA 3TTSA 1MW0A 1WDRA 2CIPA 2BHZA 2D3NA 2FGZA 1J12A 2BNJA 5D9NA 3SUUA 4BQ4A 3AXXA 2V5CA 5I24A 1E72M 4AZHA 2J78A 2GFTA 4UOQA 4D72A 3RMEA 1B30A 1E1FA 1XHGA 4AD1A 1EOKA 1H11A 3W29A 2OSYA 1VJSA 4PCSA 1VIWA 1TCMA 3DC0A 4UR9A 3FW6A 1QHPA 3ZR5A 3QOMA 3SCQA 2ZX8A 5A8QA 3MKKA 3MUY1 1CGXA 1D7FA 1PIFA 3L4TA 1MW3A 2ZXBA 2CBVA 2XTKA 3AICA 3OLDA 4OIFA 3UETA 1BGAA 1XD0A 2JEQA 2W5FA 1N82A 1HJQA 4XZWA 4TVCA 1I1WA 3NCOA 4P7RA 2GVYA 5JIWA 2J7CA 1D3CA 1E70M 5FL0A 2EPKX 5FD0A 1H3GA 1UG6A 4B3KA 3WH7A 3RJYA 4AZGA 2BHUA 4QAWA 1JZ4A 2YDSA 1B3VA 1E71M 2BV9A 3OIHA 4AC1X 1NWTA 4ACZB 1QI3A 4JCLA 4D1IA 3B8SA 2ZXAA 2JE8A 4UZUA 1KBKA 4AY1A 3TOPA 1HJWA 4R27A 1ZB5A 4ATDA 5BXSA 1UQYA 5CQ1A 1HKJA 5HBFA 4ATLA 3UR7A 5DEZA 3AS3A 1MXDA 2RGLA 4DUWA 5DT7A 2OWWA 1BFNA 1UYQA 2J47A 1JZ5A 1CXHA 4UQEA 1O6IA 1MQRA 4CCDA 5A8OA 1W1TA 4QDMA 1LWJA 1B0IA 4GO9A 4UOZA 3MV11 3WDHA 4MAZA 2WMHA 1JYVA 4FLRA 1G5AA 1NP2A 4UTFA 2QMJA 1K9EA 1UD5A 1TMQA 1UR0A 1CXLA 3IJ8A 3MMDA 2WBGA 3PN8A 4W84A 4KWUA 1C8YA 1J0IA 3W28A 4U3AA 1BF2A 1ZJBA 4DWSB 3L4ZA 3N04A 1VEMA 4P8XA 2ZOXA 1J0ZA 5GPRA 2OWXA 1IZJA 3PTKA 1GOOA 4D6DA 1W1VA 4W7WA 4P8VA 3AHZA 1VEOA 2C0HA 1LL6A 4IISA 2D3LA 3RIKA 5CG0A 1MFUA 4HOZA 5IFPA 1B3WA 1E15A 3HMCA 4HTYA 1UH3A 1FH7A 1V6VA 4PUDA 1GOWA 4NF7A 3MO4A 3N12A 3OGRA 3WUBA 4GZJA 1GONA 3WSUA 2VRQA 3VDCA 3ZQ9A 3SCUA 4B16A 3ARPA 3QHMA 4HP5A 2CCRA 2WMJA 3KWXA 3RM9A 3ZT6A 3WNPA 3AI0A 3WQ8A 1J9YA 2EEXA 5A6AA 4MNKA 3L4XA 4D6HA 4HA4A 6CGTA 1GNXA 3K8KA 3MSDA 4URIA 1DEDA 1FOBA 3RDKA 2GUYA 3BMWA 4MNJA 1FHLA 1V6XA 2ZX5A 4BQ2A 4MB4A 4BQ3A 5CGTA 4AZ5A 1WDPA 4Z2KA 1NOWA 4UQCA 4Q7NA 2G41A 2EJ1A 1EQCA 5A3HA 3PBGA 2WCGA 1E40A 1B3ZA 4CD8A 3L2MA 1EH9A 1TA3B 1NOFA 4W5UA 2WC7A 1UKSA 2XHYA 1XSIA 2YL5A 1ISYA 3VU2A 4UFLA 4EK7A 3PZUA 5A8MA 4S3KA 3KL0A 2VRJA 4MJ4A 3WKZA 2V3GA 1QHZA 4XV0A 5CSYA 3BAJA 1Q6GA 1HJXA 5CZKA 3A47A 1C93A 3WEZA 1JGIA 1V08A 3AXHA 3L2LA 1LWHA 1MVYA 1UR2A 3VINA 1E4NA 5DO8A 4AYSA 4CD4A 4HMCA 2JF7A 2ZXDA 3VDBA 1KGWA 4MDOA 1VRXA 2WNWA 3PZIA 4AD2A 4AD5A 3MSGA 1E6XM 2XUCA 4OOZA 4PBGA 4WKAA 1LG1A 4XZBA 3CO4A 1J0KA 2J25A 1C91A 2D24A 3M6DA 1XH2A 1UR9A 4W7VA 1K9TA 3NUKA 3HJEA 1BLIA 2D23A 3WD2A 2W92A 5JIPA 1R7OA 3ZT5A 2ZWZA 1RP9A 4LXFA 2C7FA 1QNSA 1PEZA 2WBKA 3GTNA 2D2OA 2Z1SA 1ZJAA 2Y5EA 3WMSA 1WZAA 4ZE5A 2VX5A 3PTQA 4J3WA 1UR4A 4ZXLA 3U57A 5HPOA 1P6WA 1OWQA 3U5YA 2A3HA 1CGVA 4LQ1A 3WL1A 3EMCA 3W82A 1V3JA 5I6SA 3WH5A 5FL1A 2WVSA 1GOMA 4GXPA 4CD6A 2J7FA 2QPUA 2VNCA 4V2XA 1JFXA 3AHYA 4J28A 2O92A 1KQYA 1V0LA 1UKTA 5CJ5A 1E0WA 3M07A 4CGTA 1V0NA 3W25A 3E1F1 2QPSA 1NWSA 1HJSA 1W9VA 3CZ8A 3POHA 2BS9A 3APGA 2YBUA 4Z2HA 3EDDA 4UFJA 1QI5A 2WANA 4W86A 3WBAA 1E3XA 3F5KA 4C7DA 3WF2A 2UY2A 4HZ7A 4M29A 3VIJA 1SMDA 1TR1A 1ODZA 4CN1A 1FA2A 4GINA 4ZE4A 5IHRA 4FK9A 4HA1A 1E6RA 1EHAA 3LMYA 3WMCA 4OOUA 3UCQA 2X05A 3W38A 1IZKA 4PN2A 2J62A 3VIPA 2WCAA 4LGXA 4UFMA 3IAPA 2HVMA 4PTMA 1QOXA 3AJ7A 1CTNA 3EBVA 2WMGA 4QLLA 4X0NA 4ZFMA 3WMBA 2O9PA 2XFRA 1C8XA 4H8VA 2YIHA 1GJWA 1HX0A 1K6AA 3L4YA 1ZBCA 1JNEA 5I79A 2YL9A 1UWQA 1WCGA 2XGIA 3VVGA 3EDJA 3WL0A 3BLKA 2D22A 3WQVA 1UD4A 3BLPX 2ZWYA 2XJ7A 2NSXA 3W53A 5EB8A 2YBTA 3VGDA 3T2QA 3WF3A 5M3WA 4DWSA 1AVAA 1C8QA 4UFHA 1JYWA 2PB1A 4U33A 3ZMRA 2FH8A 4JHZA 1J10A 4AZCB 3BMVA 1KCLA 4JHOA 1BHGA 1XD1A 2J77A 3OG2A 1W9DM 2V3DA 2J79A 1HN1A 1R8LA 4U2ZA 1PX3A 2XM2A 3N13A 1GVYA 2PC8A 3OGVA 2OLHA 1R86A 3PZGA 4M8UA 1W91A 4WIWA 1HIZA 4MPKA 2PWFA 4DWSD 2EQDA 5ABFB 4PTXA 1OINA 2CKRA 2VVSA 1JNDA 1J01A 4JKLA 1LJYA 3ARVA 4AEEA 4HZ8A 3TONA 3A3HA 3CZEA 3ZSTA 3AZTA 1GZJA 4IUGA 3LPGA 2WW5A 3AQUA 3ZO9A 3FY1A 2BHYA 3CHFA 2YL8A 2DGAA 2GJRA 4WSKA 5HPCA 1GHSA 4D6FA 2W62A 4HA3A 1V0KA 2PI6A 3A4WA 4KMQA 4WKFA 3VKKA 2NT1A 5JBDA 5D8ZA 4HMDA 2XYLA 4DUVA 3N1AA 1HL8A 1AQ0A 3A6OA 3WDIA 2CYGA 1B2YA 1CXIA 3NDYA 1JF5A 1QBAA 2VX6A 2ZX6A 1M03A 1TA3A 3N15A 5CLTA 1V6WA 1VBRA 5I23A 3B9EA 1CEOA 2YA1A 3K46A 4JL1A 3WQ5A 4AD4A 1XCWA 1DWHM 1QNQA 5DMYA 1OBAA 3ECQA 3EDFA 2WMFA 5CPSA 1UHVA 1B1YA 1E56A 1TG7A 1F4AA 3VIIA 5I2UA 1PAMA 3VD3A 2F8QA 2VL4A 2G3NA 4WKHA 4UOJA 2J7BA 5IDIA 4ZENA 4U3CA 4RE4A 4AZBA 3SCOA 3VD5A 4HOWA 1WDQA 2WVVB 5EFDA 4MB3A 5D4YA 2DH2A 2GJXB 2V38A 1OIMA 5A2CA 3G6LA 3CUHA 1EO7A 2PWHA 1PZ3A 1ISXA 1YQ2A 1XYFA 1V3HA 3UG4A 3DYOA 1GQKA 2PBGA 7CGTA 4W85A 4A3YA 4PRWA 3JUGA 2DSKA 3CMGA 1GQIA 5FIPA 5ECUA 2JALA 5EFFA 2DT0A 4V28A 3AIVA 2AAAA 4F9JA 2X1IA 4ATWA 3EMQA 1UWTA 1W2VA 2XSAA 2W63A 2J4GA 1NARA 1UH4A 1H0GA 3LPOA 2YJQA 3WBEA 3VMNA 1OD8A 4D6IA 2GSJA 3CPUA 2W91A 1UD2A 3IANA 2DSUA 2D0HA 2J7EA 2YLLA 3AHXA 2XFYA 4YHGA 2VR5A 2WHKA 2VQTA 1X1NA 4H41A 3AXIA 2ZUMA 4AIUA 3GZAA 1V02A 5CPTA 3DHUA 1GHRA 4YPJA 2CHNA 3VO0A 1VB9A 1PBGA 1V0MA 4OZOA 2QF8A 5I77A 3WNKA 4OBSA 5AYBA 1U2YA 3EMZA 1XSJA 1PX8A 2DSVA 3SCRA 2CERA 5DFAA 1J0JA 4E2OA 2CHOA 3ARZA 4HOXA 2YA0A 2VC9A 1JZ7A 1ISZA 1GJUA 1BVNP 1V3KA 1WZLA 4U5KA 2GK1B 3MUIA 5GNZA 3WD1A 4E8CA 4W89A 1D2KA 3MMWA 1CECA 4JFSA 1NWUA 3U7BA 2CXGA 2CBUA 1X6LA 5CLWA 4PSPA 3WELA 4QLJA 1CGUA 1HJVA 1ZL1A 3FAWA 1R85A 2XGBA 2WZHA 2B31A 4F79A 1ESWA 2YDRA 1JFHA 2V5DA 4H7VA 1E1EA 1VENA 4UQ9A 3K1DA 1E73M 1V6UA 4X0VA 1EDQA 1JXJA 2WSKA 4OBRA 2VZUA 4L4OA 5HDRA 3PZ9A 1NWRA 4JFWA 4IPNB 3VMPA 2VZVA 3KE0A 3GNPA 1GOIA 1OB0A 3QOKA 1KGXA 3WDRA 4UQDA 2DIEA 1MW2A 2XVGA 1LQ0A 2D0GA 4Z2LA 2JIEA 3CMJA 5HNNA 1AMYA 4MJ2A 2WPGA 1WE5A 2ZUUA 5F7UA 4AZCA 3CZKA 2VT0A 1VFUA 4Z2JA 1XC6A 4CU7A 1FH9A 4UFKA 5A6KA 2A3EA 3WENA 3J7HA 1PX4A 4AW7A 3K8LA 5A2AA 3F4VA 4F8XA 4GIAA 3HU7A 3TA9A 3W0KA 2XSBA 3SCTA 4V27A 2DSZA 3DHPA 1KBBA 4AISA 1SFSA 2E9BA 5ABFA 2E40A 4H8UA 4Q22A 1GORA 1BYCA 1CIUA 4LX4A 3AYSA 1X6NA 4MTVA 4J3TA 3SCVA 1WDSA 1JYNA 1OSEA 3WNLA 5A95A 2WZIA 1CGYA 2GDUA 2WLZA 1E9LA 2DEPA 4TTGA 3HN3A 2VCCA 4XUYA 1ZU8A 5A94A 5I5RA 1MXGA 1JZ6A 2E8YA 3T2OA 1UZ1A 4E8DA 1C3FA 3AZSA 5D8WA 3T0BA 2XIIA 4JFVA 3W6MA 3MV01 2WK2A 4BCEA 4WK9A 3WN6A 3PHAA 3GXMA 3WY1A 2MANA 5DT5A 1SR0A 5IHSA 5FCZA 3TP4A 4U5IA 1CPUA 1QHOA 4RL3A 4BF7A 4PSRA 1B90A 5LA0A 1UWUA
chains in the Genus database with same CATH superfamily
4E2DA 1BYBA 1REQA 1EFZA 4NI3A 1B31A 4WDTA 1ZJHA 3ATYA 3THAA 1F76A 1ZFJA 1AQMA 2WVVA 4W5ZA 3ITTA 1T6MA 1M5WA 4I3GA 1CNVA 4NYUA 2OYKA 4IFOA 4O0QA 1UOKA 3ZVHA 3W01A 5HMEA 3WLQA 1O5RA 3PG8A 1WX0A 1G01A 2J8GA 2NV1A 1C7TA 3M6YA 3W1QA 2WHJA 1HT6A 3NO3A 1UR8A 4Z2IA 4D8LA 3TTQA 1OFDA 1XGZA 4BI7A 3RX3A 1HNYA 3FSTA 5HOSA 4RZ4A 1BWVA 1AH3A 3GNDA 1CWYA 3REQB 2B7OA 1GKQA 3QLDA 3WF1A 2FMNA 3NPXA 1KM4A 3MS8A 3OW1A 4A05A 2BGQA 3S1UA 1HO1A 2QKFA 3LCHA 4Z1YA 3WLMA 2VRKA 1W54A 3KEHA 4CQAA 4F48A 4C6DA 4IMCA 3TQKA 4KCWA 1IE7C 4GOAA 4RNIA 4S3JA 6XIMA 3QR3A 3P6LA 4ENLA 1W32A 3ZT7A 2SFPA 2J9ZA 4QITA 2EHHA 2DSWA 3EB3A 5JUVA 2ZVRA 1XXXA 3N9RA 4WOZA 1K1DA 4FOKA 2F9RA 4BEUA 2NV2A 2BXVA 3EPOA 5CZ0A 4CQDA 1W56A 3M46A 4JTJA 3B0PA 3OIXA 1WBJA 3QPEA 2FVMA 4JDBA 5BNKA 1VKFA 1TTJA 4FLSA 3T8LA 3L7RA 2VENA 4EE9A 1HZYA 3DN5A 1ITQA 4RUBA 3MJMA 4R88A 1KFKA 4KEVA 3PP7A 3WD0A 3LCXA 2F38A 4QXIA 4PRRA 4M51A 2NVDA 4LAZA 1W3LA 3RO6A 3V35A 1SM9A 1VFFA 3LB0A 2WB5A 2FZ9A 5AHFA 1LP6A 5HJLA 5M17A 2EG8A 3FS2A 1Q6CA 4TV6A 2ISDA 3HO8A 4S38A 1TPFA 4E6MA 2VUYA 3TJXA 2E09A 1PHQA 1E0VA 1H61A 3MUZ1 1WKYA 3ABXA 2J13A 4ZGYA 1YDOA 3UXIA 3ZLGA 3L68A 4IH3A 2HQAA 3CPGA 3FLUA 4CKQA 4IGSA 1A53A 3PF3A 1ME9A 1ZZMA 2X0HA 3CV2A 2VQUA 2PDQA 2OGJA 3L9CA 3QTGA 4YHEA 3TJ4A 1SGJA 2PWVA 3A4AA 4A21A 2J8FA 3NJ3A 2XVNA 5EBUA 6XIAA 3G1AA 4MWAA 1XR2A 4MKSA 2VX4A 2OYMA 2ISVA 2PUZA 2B0MA 2NT0A 2OZ0A 3F4NA 1YBQA 5HULA 3OVQA 3AWNA 1CLVA 3ALGA 1BD0A 3BO9A 3DG7A 4JQ3A 3M0ZA 7TAAA 2G8ZA 1DYSA 4GH1A 4GYKA 1PZ1A 1IWAA 2FHCA 3UW6A 4MWAD 3RAOA 5FF2A 5A8GA 5FESA 1OC5A 2G3FA 4WSJA 4YYFA 1Q3NA 2VX7A 3SCNA 2FZMA 2OJPA 1BAGA 3EYPA 5KZDA 2GGIA 1ZP4A 1BTCA 5D2TA 1AODA 3MVIA 3U4FA 4FB7A 3LQGA 1XIFA 3UFYA 2D20A 2FPTA 4IIDA 4GO8A 4K8EA 1IEVA 2Q01A 4PMDA 4GHRA 5A8PA 2IXUA 1AH4A 3LM7A 1G0CA 4UUIA 3W81A 1MWOA 1ZCCA 3TLQA 1YADA 3VPLA 1X7FA 2DT1A 1GVEA 3WQ6A 4B3LA 4I9JA 4Z08A 5A6TC 1TTQA 4TX8A 3S9IA 2ZFAA 3T2PA 4FXSA 3AWOA 4CN6A 4I9MA 2OLSA 3HPXA 4Q4RA 1A4MA 3LHWA 5LHFA 4B9ZA 1A0CA 1EC7A 3SIZA 3GHUA 1ZS2A 1W9UA 2JIWA 2WYSA 4JIHA 2MNRA 1UP0A 1GPFA 4CCZA 1IXOA 2EPHA 4N9EA 4XKMA 3BDKA 4AU0A 1BGGA 3GY1A 3VIOA 2UY4A 3S2NA 1PWLA 3GBEA 1ZALA 2WMKA 4WDWA 3T0AA 4PEEA 1R38A 4E0CA 1RK5A 3P84A 3SI9A 1WP6A 3UD6A 4UTMA 3DU0A 2H3BA 2EG7A 1WAUA 5EMMA 1TELA 1J18A 1W5NA 3AMKA 1M7XA 4KERA 1EXPA 1NDWA 1WB0A 4LAKA 1B3OA 1R3YA 3N2TA 3NNTA 3ELFA 3W2JA 4RDWA 3QGAC 2Q3RA 3IJLA 5I78A 3V0SA 2W66A 1LRTA 4FNTA 4KRTA 3ANUA 4GY1A 4G1NA 1ODUA 3BH4A 1RZMA 1Q7QA 3W7KA 2GQ8A 3WH8A 2WWDA 1H50A 3UG5A 4HYWA 3G1RA 4O15A 5B7YA 1PIGA 1BF6A 1KFWA 3VD9A 3S2JA 2QT3A 5DCBA 3JS3A 1RAKA 2YCKX 3LHTA 1UWRA 1BSIA 1FCVA 1FWBC 4XSMA 3KZPA 5BWFA 4YN5A 2RJGA 1F05A 2BG5A 3SZ8A 3B9DA 4Y8EA 3AFBA 3A4XA 1XSKA 3URQA 4AZ7A 4M24A 1BG4A 4Y90A 1DJNA 3TDFA 4CNSA 3FVDA 1G6CA 3H6OA 1GCYA 1QI0A 4EXQA 4WX2A 1XQKA 3KRSA 3QZEA 1KGUA 2VGIA 2ZYFA 3WYZA 3G6MA 3UWZA 4RNHA 4ADSA 2BB0A 2CEQA 1UQZA 3RUBL 4LS2A 1FWIC 2VI0A 3LENA 3UCDA 3N11A 1TE6A 1I6NA 1TVPA 5L6UA 3GIYA 3H23A 2L5HA 7TIMA 4H83A 2Q6ZA 3OG3A 3A5VA 2QUNA 5IFTA 4NUWA 1QBBA 4OKDA 1GZGA 4I6VA 4N42A 3SW6A 4IMEA 4Q8NA 4XG1A 1EJRC 1FDYA 3CASA 3DDMA 3WLHA 1RD6A 4FPSA 3R0UA 3W75A 1V51A 3ARYA 1CXFA 1F4HA 3N4EA 4UZSA 4RE2A 1TUXA 2VC6A 4O1BA 3TEVA 4J3ZA 1W37A 3L65A 2C1HA 3I4KA 4JKMA 3CZJA 1KR0A 3AU6A 2RDXA 4TIMA 4HQVA 3H2EA 1TV3A 2CZVA 2W9MA 1W9PA 4P2VA 2YDQA 3N9SA 3OGSA 4ZXOA 2D69A 1EJUC 2G37A 1JZ2A 4JGDA 3TZNA 3SURA 1J0HA 1EJSC 1AA1B 2R1KA 4ZSUA 4W7UA 2CITA 3UESA 1HKMA 1B3XA 2JGQA 4HTBA 3WD4A 4NJKA 1EGMA 2I1OA 3SCSA 3RYSA 1SO4A 2ZQ0A 3S83A 5HMFA 2OSXA 1R7AA 3OZOA 1S5WA 3DBNA 4LTSA 6REQB 4ZOEA 5DELA 2BGNE 3W7HA 3BAYA 5CSUA 3R4IA 3BLFA 1H5YA 1PTGA 1TPEA 5EMKA 5H8MA 2PE4A 4Q4OA 1B54A 2VOTA 1KM1A 1VP5A 2ZZ3A 3UJFA 1IF2A 2Y8KA 1YXCA 1QFEA 1J0YA 4IGHA 2ZZ5A 4UQBA 1G9HA 3G3MA 1TV5A 4M1BA 3C4UA 5ABGA 3AIRA 3E0VA 3VIMA 4B5WA 2BXZA 5JBEA 3WF0A 3AIEA 1R3QA 2XG9A 4MSSA 5EA9A 5BW6A 1ALDA 3FV9A 3O8AA 3RCNA 4DY1A 4H1ZA 1A3HA 3AOFA 1WXJA 5CGQA 2E9MA 3LZ5A 2BVTA 3VDAA 3EA3A 2ZUNA 3AIWA 3MJYA 1YRRA 1S2UA 3BC9A 3W1XA 3BWWA 3GFZA 2O9OA 4ASTA 1WAWA 3W6LA 4OVXA 1V6YA 2WPBA 4HNOA 1QI2A 4I8DA 1EWDA 3WLOA 2IQDA 4RCXA 1DIKA 2GOKA 2ISWA 1E6SM 3TR2A 2X7VA 1QXLA 2WVTA 4S1FA 3DI0A 2PLMA 4AZ6A 4P8UA 4FAMA 1PYMA 1HP5A 1YXYA 3GXDA 2ZZ1A 4UFIA 3B06A 1A5AA 3RILA 5SWUA 1P1XA 3SJNA 2QYGA 1PIIA 2NUXA 4M5PA 3EWZA 3UZXA 1DOSA 3N9KA 3LNPA 1PKMA 3I68A 2G3MA 3CNYA 3T7VA 1PYFA 2XGZA 3RPTA 1P4CA 2PD9A 4CN4A 3LLDA 1LQAA 4V1XA 3W1AA 3SSJA 1XCFA 5U4NA 2AKMA 2QVNA 5KTLA 3VC6A 5IBXA 4IXXA 3UZ5A 2ATMA 1FBAA 2PU0A 2VGBA 3NGJA 3GKAA 3MB9A 1UWSA 1QOQA 1E4IA 3K5XA 1P0NA 1EBHA 4MFDA 4W8LA 3HV9A 1FP9A 3LOTA 5BWAA 4GI6A 4QDWA 4IPIA 3TTEA 4AWTA 3NYDA 3UCCA 1WDDA 4Z1CA 2TAAA 1Q8JA 4QAIA 1LL4A 3WJSA 1BYDA 2WJZA 2OXNA 5CG7A 4N6EA 3KWSA 2V3EA 1JQVA 1XLCA 1V4YA 3CV1A 4GXWA 1M7JA 1A5OC 3BAKA 4US5A 1G4PA 4YWSA 3TQ0A 4PCFA 4E4FA 4K36A 4IIBA 7ODCA 4IPLA 2JF6A 3KOWA 1YW1A 3WH9A 3CUJA 3QGVA 4H04A 3TYUA 1R5YA 4A3UA 3QQWA 4CU6A 3AS0A 3CL7A 1PKYA 4LCSA 4JICA 4D6CA 1R3WA 2XIJA 1TPH1 1KFCA 1OIFA 1SZRA 1FWWA 4US5D 1XYZA 3FNDA 3GTHA 3M7WA 2VO5A 4P8WA 1WYIA 4OE7A 1MDRA 3QGKC 2P88A 1UA3A 3E3HA 4AXNA 3TU9A 4HNNA 4M6PA 1HKWA 4TU1A 1XIEA 3E96A 4L4MA 5D2VA 4PTWA 3GW0A 4O4VA 1FWAC 4XK2A 2DU2A 2X42A 1SFJA 5HR7A 2BY3A 1TRIA 2V82A 3ONCA 2DVTA 4ORMA 1NJJA 4AWSA 2CLEA 1K8YA 3NSXA 1V6TA 2VFFA 3HTWA 1TMLA 2Y2WA 4GQ0A 5KZMA 1EZ2A 2YL6A 3K4AA 1CI1A 3LZ3A 1AQFA 2O7QA 2D2JA 1EXBA 1OC6A 3E49A 4EKJA 4GJIA 2WQPA 1Q6LA 1TV2A 3W1UA 2DT3A 1K3UA 1P43A 4YVVA 1RSCA 3SN0A 5HATA 3CTLA 1XCXA 3CMFA 1FCQA 1Q4WA 1QPQA 4ONVA 4DJFC 4LS0A 5M5DA 1DWAM 3U6WA 5AC5A 2E4TA 3W02A 1QI4A 1KBIA 2OGYA 2OZTA 3BLIA 1MEIA 4JTKA 1XLFA 1Y7VA 5I3FA 2EPNA 1TV8A 4TVDA 5DANA 1MW0A 1WDRA 2CIPA 2BHZA 4IF2A 5CJMA 3LGDA 1G67A 2XN0A 4GY0A 2WM1A 2V5LA 5FEWA 1D8WA 1Y65A 2NX1A 3OBEA 4AD1A 2OSYA 3RPDA 5FEZA 3G24A 4I8YA 2Y6ZA 3DC0A 3FW6A 3ZR5A 3QOMA 3HOJA 4J4KA 5TF0A 3LA4A 2XTKA 3ABQA 2PP3A 1EX1A 3OLDA 5BOEA 2W5FA 1SZFA 2QVHA 4Z1AA 3E5PA 2PEVA 5FL0A 4NY2A 1OYCA 4B3KA 1TTPA 1ICSA 4MZ1A 4PEKA 4Q4PA 3EB2A 4AZGA 2CLKA 4QAWA 1B3VA 1OX5A 4TX9A 4ZCWA 4XZHA 4PUKA 1ZJIA 4C1LA 1I2OA 3FEMA 1Q2SA 2UBPC 3N6JA 4O53A 2CWNA 1UQYA 5HBFA 1XLGA 1FDZA 3AS3A 1FTXA 2RGLA 4DUWA 4ZOCA 4K1WA 1Q6OA 1S2VA 1O6IA 3LXCA 1NFBA 5EL1A 4QDMA 4V15A 4HNLA 4XWUA 1B0IA 4GO9A 5U7SA 1LT8A 4LT9A 4JTRA 4UOZA 3MV11 3P7YA 4HK6A 1NP2A 1QJWA 1TMQA 2H9AB 3IJ8A 2WBGA 2C1GA 2Z4GA 4KWUA 4IQDA 4EACA 2CU0A 2ZRXA 2IKHA 1XLKA 4HCLA 4P8XA 3R1ZA 1IZJA 1AUSL 1DQUA 1WV2A 4ZQMA 3S5ZA 4LBUA 4W7WA 2PU1A 3AHZA 3T6CA 1SVDA 4IISA 2D3LA 3RIKA 1MFUA 4HOZA 4QX4A 2OQYA 5GJNA 1UH3A 1Y5VA 3OGRA 1GONA 1ML1A 1UP3A 3WSUA 1JPIA 2VRQA 3ZQ9A 1NTHA 4TMBA 2PDGA 4F3HA 3BZJA 4QEEA 4NZ5A 3KWXA 4ZSTA 1RLDA 4JYFA 3ZT6A 3R2GA 3CL8A 2EEXA 3APYA 3L4XA 3M0XA 3K8KA 3QZ6A 3EX6A 4XO6A 5K9CA 4QHRA 2V9DA 1FHLA 1Q8AA 2ZX5A 4ECLA 5CGTA 3WLPA 4Z2KA 3TE9A 2Y7DA 3UT0A 3UJEA 3IEBA 4WEVX 5A3HA 4O8AA 3PBGA 3L2MA 4MVAA 2HCVA 3BW2A 3OA3A 1UKSA 2V8ZA 4KRZA 1UPMB 3R43A 4UFLA 3GC4A 3P67A 3NQFA 3PWIA 3QPYA 4PH6A 2C91A 3WKZA 1QHZA 4NJHA 1HJXA 3LMZA 3A47A 5LIWX 4DJDC 1JGIA 4RW3A 1LWHA 1RCQA 1MVYA 3G8EA 3WQEA 2QUMA 1DE5A 2C16A 4UC5A 3U2ZA 4FXFA 4YIWA 2ACRA 1FXPA 3V0UA 5C9ZA 4IGNA 4Y8FA 1J2BA 3HQNA 2XUCA 2GSHA 3BV4A 4OOZA 4PBGA 1P48A 4GX8A 2C6QA 1C91A 2D24A 3M6DA 2YCEA 1FQ0A 1NDVA 4MWAE 1BLIA 3GE7A 4DI9A 2W92A 2J6XA 3E0IA 2C15A 3F7JA 5I07A 1R7OA 1UPPA 1W5OA 1F8MA 3W2MA 1QNSA 1Q7MA 3E02A 3E0FA 1ELSA 1VCFA 4DZIA 3CT7A 1WDWA 1J5SA 1UR4A 4GWEA 1P6WA 2A3HA 4DO6A 4LQ1A 1ZHAA 1GOMA 1A5SA 4G8TA 4R9OA 2AQOA 4JTUA 1LLZA 1VFTA 3B40A 2ISSA 2P53A 3AHYA 3C0LA 1LOSA 2VFHA 1UKTA 3R0DA 3M07A 4H6EA 1V0NA 2QPSA 1ME7A 3VKDA 4I7WA 3OO2A 1HJSA 2W79A 2OX4A 2WANA 4DWDA 3WBAA 1ICPA 2UY2A 2HPIA 1XLDA 4LUSA 1FA2A 1JCTA 4UTKA 3QJAA 4WD0A 4FK9A 2HK1A 4HA1A 3LMYA 1SO6A 4LSBA 1OX4A 4LS1A 4O52A 3MPGA 4S3AA 1Q66A 3P62A 2V0TA 1IR1A 4UFMA 1S3TC 1LOQA 3IAPA 3NL3A 3RLGA 1CTNA 4QLLA 3QSTA 3QMTA 3WMBA 1SFTA 3HG2A 4C6OA 4H8VA 1SUXA 1HX0A 3L4YA 1K6AA 3VVGA 3WL0A 5K9DA 3LNMA 1ZRQA 3BLPX 3S4TA 2E6DA 1G7UA 4H9ZA 5DMNA 4TR9A 2G97A 5IRPA 3VGDA 5T91A 3WF3A 4RXFA 5AC7A 1Z44A 1LDCA 4XAZA 1GVRA 1C8QA 2XISA 4U33A 3ZMRA 3E38A 3BMVA 1H7NA 2E28A 4PB4A 4FX8A 2VUNA 4ICMA 4O1EA 3VKJA 3BG5A 3HG4A 2XDFA 1HN1A 2R82A 4QR6A 4UTUA 1XBVA 2CZ5A 3D46A 4O17A 4M8UA 4JTIA 1KRBC 1OINA 2CKRA 2VVSA 1J01A 3TONA 2O0TA 3UA4A 3UZYA 1TX0A 3V18A 2NVCA 1GZJA 3LPGA 3I7QA 3I7SA 3LTSA 2BHYA 1NFPA 1NFGA 4IPPA 3EKLA 1V0KA 2PI6A 3TN5A 3VKKA 4FI4A 1WOBA 2V67A 1YDNA 1TWWA 1P1MA 3WDIA 1R9ZA 1CXIA 3M1ZA 3CC1A 4KIRA 3QV8A 1V6WA 2QIWA 5I23A 1CEOA 3K46A 4WXYA 3B9NA 4US6A 3WQ5A 1RY0A 1QNQA 1OBAA 2Z6JA 4O1AA 3EDFA 2CLFA 3PUDA 4RKAA 4DYEA 5CBJA 5I2UA 1PAMA 3EWUA 4C6EA 4PTDA 1LRQA 3AAMA 2G3NA 5FF7A 1REQB 3GB6A 5LHEA 4WKHA 2J7BA 1A5LC 3QC3A 4PFMA 4U3CA 4RE4A 3OVPA 3M47A 3CH0A 4AZBA 3SCOA 2WVVB 3KOZA 2YYTA 1H62A 1G7VA 1Y5WA 2V38A 4GC4A 5C7HA 3SGGA 1Q2RA 3ZVHB 3DC8A 5CZSA 3ABZA 2PWHA 1PZ3A 2GWGA 4GJ1A 1V3HA 3IIOA 3KHJA 3NQ8A 4W85A 3GVVA 4M7SA 5CZTA 3QQ1A 3LLXA 2DSKA 3O07A 2ZVIA 3CMGA 4LUIA 3M5YA 3G1VA 2JALA 3AIVA 3UWWA 4XZ9A 4AMAA 2X7WA 2XH0A 1WA3A 1H7PA 3QY8A 4DELA 2QCHA 1XLIA 3USBA 1XG3A 1WKDA 3BLLA 1UH4A 3KBVA 4ZOAA 3FCPA 4DVOA 3FKKA 1SSGA 3C56A 3GC5A 2GSJA 5LSMA 2DSUA 2D0HA 1Y5XA 3AHXA 5TBOA 1OC7A 4YHGA 3P93A 2WHKA 2C13A 4AIUA 3GZAA 1IZCA 2GGHA 3PG9A 1EF2A 3DHUA 1RQBA 1MSSA 2CHNA 4BK9A 1MNSA 4DO4A 3AXKA 2G96A 3E0LA 5I77A 1MRAA 2FKPA 1OFRA 2QJGA 5DRIA 4RPPA 3SCRA 1J0JA 2CHOA 4R3UA 1TV7A 1ISZA 3A12A 1BVNP 1WZLA 1OCJA 1TB3A 2GK1B 4GYPA 4WSHA 3TNOA 5DCEA 1CECA 3C2RA 4JFSA 1A3WA 2CXGA 2PP0A 2VFDA 1X6LA 1U83A 4G7FA 4ZQRA 2V69A 4ZB5A 1YNPA 5HUPA 4JX6A 5AFDA 1A4LA 1B9BA 2GOUA 5A5WA 2ZA3A 2V5DA 3GSMA 4H7VA 3RLHA 3FGCA 1R6WA 1SZGA 1VZWA 4D8ZA 1H51A 1V6UA 2NX3A 4DRSA 1GT8A 1EDQA 4UR7A 4KIEA 1YDVA 2VZVA 1O4UA 1Z41A 1P0BA 4PL2A 3QOKA 1KGXA 1LQ0A 4Z2LA 3DFTA 5HNNA 4JHMA 3QF0A 4HYRA 4E38A 2CFFA 1GG0A 5C2XA 1TX2A 2FPYA 2PTDA 1GVFA 3K13A 4UFKA 1UWAA 2XU2A 4QISA 3K8LA 1K4HA 3ES7A 3W0KA 5KITA 3SCTA 4DX3A 3GTXA 1HG3A 5FSDC 1UBSA 1W1IE 3DHPA 2HMCA 1QK2A 4AEOA 4UNLA 3W2LA 3UY7A 1RBLA 4H8UA 3W86A 5AECA 3E2QA 1TR9A 2WSYA 1BYCA 4MWAB 3H2OA 3NQEA 1OCBA 3SCVA 1WDSA 4JEQA 4GABA 2WZIA 1CGYA 3GYEA 2WLZA 1E9LA 1Z6KA 2DEPA 4TTGA 4XUYA 4FOJA 4OECA 1JZ6A 3K30A 2X16A 3HQPA 2FZ8A 1QW7A 1JRBA 1UZ1A 4V33A 4E8DA 4YU1A 3PSVA 2VEIA 2WK2A 4RLIA 1JPKA 4KF1A 5D38A 2Q8ZA 2NV9A 3GR4A 2PDLA 3GXMA 5D2YA 2MANA 3SGUA 3TMLA 3KOYA 1VHCA 3W23A 1C9WA 5FACA 4U5IA 1CPUA 2HROA 4PUJA 3W1RA 5LA0A 3SY1A 3TAKA 1G94A 2FMOA 1ZAHA 3DEQA 4ZO8A 4HKPA 2NUWA 3NURA 3AHTA 2QXWA 5I06A 4LCRA 1H49A 3MU7A 2A79A 2W67A 3T07A 3A24A 1XP3A 4K1GA 3ZM8A 1JD9A 1SPQA 1Q6QA 1XG4A 2BY0A 4GQQA 4KFOA 4GKLA 1BVWA 3DERA 2E25A 2J74A 2DIJA 3M9YA 2JK2A 2ZTJA 2H3DA 1KM2A 3M0IA 3OYZA 2CBIA 4O13A 4JTTA 4DUOA 1F9CA 1ONXA 2YFNA 1HJUA 2ZUWA 2BVDA 4IMFA 2ZRZA 3QKEA 1MQPA 3LSCA 3ZZ1A 4W87A 3PZMA 1GOKA 1G4TA 1EOMA 2FVLA 3BGGA 5HNUA 4O28A 3BLDA 3D6NA 5B80A 5CC3A 2PWDA 4XB3A 2OZ8A 3BE7A 3APTA 3CH9A 3GDRA 1E6PA 1AMKA 1A5UA 5CBBA 1X39A 3PBYA 3H21A 3TZFA 3W6YA 4I5XA 1ZCOA 3II1A 1UUQA 4AWEA 1GOQA 4QQUA 4MKNA 2P3ZA 2WSPA 2IPGA 1EQPA 4AXKA 4CNOA 5C7VA 5FJPA 2RDWA 2E5BA 2Y24A 1DJHA 4TV5A 3VI2A 1HO4A 2FGLA 4KRUA 3PTMA 1V3LA 1XIHA 3T0CA 4RZBA 1H09A 1FWEC 4HJFA 2PWEA 3IJIA 1JYXA 4QROA 5K4XA 4NZ4A 2QCDA 2W27A 3BXWA 1RH9A 3I6EA 4NZCA 2F2HA 1DL3A 4LBSA 2CLPA 4DPQA 1Q6EA 1K7EA 4MDPA 2VR2A 1VAHA 4INFA 2VXNA 4O1CA 1G4EA 3CHCA 1JI2A 3E12A 4JQAA 4S3DA 3SRDA 3OEXA 1LOLA 4HU0A 1GZ1A 3OYXA 1LF1A 2YOCA 3KBWA 3RN6A 5G2IA 2A3CA 1KFEA 4NVTA 4HGXA 3WLJA 1LBMA 4JTAA 4YMZA 4G2DA 1ISWA 3R8HA 2ZRYA 5D2WA 1U5JA 4DM2A 9XIMA 2O55A 4C6BA 5JMUA 2QR6A 1E4MM 1C90A 2Z1XA 3UEQA 1TJ1A 3SGZA 3G1HA 3ITVA 3K4DA 4WF7A 5M03A 1ZBWA 3CUFA 4R7OA 2P0IA 4NAEA 1Z9AA 5BYWA 2VMFA 4QLKA 4CCEA 2I9EA 3H2AA 1Q6DA 2VFGA 8CGTA 5DF0A 1FCBA 1ZBVA 2YLAA 4CVWA 3O16A 3C2OA 2R14A 3WLKX 1YMYA 4OV4A 5LIKX 1WPCA 4QQ3A 1XH1A 4GIEA 1T96A 1W8SA 2FLIA 4HU4A 3H4XA 2DZSA 4GQRA 3I3EA 1IQ8A 1GPWA 3VFCA 4DBUA 1HKKA 3OOQA 4Q8MA 3WQCA 1HVQA 3L23A 4NRSA 3G18A 3UVAA 2QDDA 4X9YA 1QVBA 4PMOA 1Z42A 4XTIA 2ZC8A 1A3XA 3O7UA 1AZ1A 3DYPA 4QE4A 4LVDA 1KLYA 1XH0A 1I75A 1PS9A 2Z1WA 1JAKA 1E43A 1KWKA 1GW1A 3G0UA 2GVEA 4K7VA 4H6QA 5E0CA 1O5KA 5K2ZA 4OUIA 3BSMA 1EYWA 1N55A 4GC3A 3KAOA 1V7AA 2WKLA 3ITYA 1CZ1A 4PR4A 5F2LA 5F4WA 1JL8A 2XH2A 1ITXA 3HMJG 1M53A 1SU5A 2FHFA 1A47A 3AIBA 3C3NA 5IOBA 3ARSA 3CQ0A 3GDBA 4DEFA 1SO5A 1OGBA 4H6RA 2BX7A 3ORWA 5C9WA 5A1AA 4BHYA 1GQLA 2QCLA 5KZ6A 2PBOA 3STEA 5HXMA 2YCIX 1VFSA 2ZDSA 1DP0A 1S2WA 4E8GA 2Z6IA 4WOQA 1BPLB 2WHMA 3WBYA 3MYOA 4GD0A 1JCJA 3RITA 3GHTA 2RUSA 1BXNA 4GZ7A 4CVUA 2OO0A 1TWDA 3QBUA 2QAPA 5HINA 1TV4A 3WUEA 2QW5A 3C52A 3GTFA 5I3IA 2YFOA 5IXEA 5I3DA 4KESA 1EDGA 1FHVA 1OYAA 1TPC1 4F66A 5FKYA 4A8NA 1W8GA 1I1XA 4UXDA 4OV9A 3U9IA 3VD4A 1QPRA 4NXKA 4C6PA 2HSAA 4I5RA 3HJZA 4Q8TA 4WY0A 5EPDA 2ZUTA 4FALA 1BYAA 1WO2A 1H63A 4NL1A 4FMVA 3R10A 5AZ0A 3M44A 2AMGA 1QO5A 2WZTA 5CZJA 1WKFA 2XWDA 2X41A 5DMMA 3HM7A 1YPXA 2PF0A 4GBDA 4DHGA 2PGWA 1YE4A 1MUMA 2HS8A 1BQCA 2O9TA 6TIMA 5D02A 3KTCA 4U10A 2VC7A 4OQVA 1W9BM 2GYIA 4G7EA 2XIOA 3BCFA 3CZLA 4CEUC 1PZ0A 2XVPA 3H53A 3S8HA 3BSHA 1JF6A 1KXVA 3VNLA 1NOUA 2IKJA 1GJPA 1PKNA 3H4GA 2EPLX 2TRSA 3KFTA 1WXZA 4MUPA 5FF0A 3LUTA 2BOEX 3VOIA 3S2CA 4E3VA 4ZZ9A 1US0A 1EEPA 2GJPA 3MTWA 4HHMA 4IX2A 3SIMA 4LEQA 3B8DA 1EP2A 4L9YA 2O4QA 4REQA 2NQLA 3THCA 6A3HA 5EMJA 3V1HA 1VEPA 1WNOA 1WZKA 2BODX 4EF9A 2QCFA 3GVRA 1GYNA 3NIYA 5CPQA 4J3UA 3HIJA 3U3HA 3VOCA 5CEWA 3PANA 3MUCA 5HQEA 3UGRA 3ZSSA 5D9MA 5D30A 4UWMA 2NXIA 3WDJA 1H0IA 3N3MA 3CYJA 3K2GA 3WEOA 1GWJA 1QK0A 2UWFA 2X8RA 3WNOA 3QY7A 2LLEA 4MGGA 4L56A 2ICSA 3MCMA 3WLLA 2ODOA 4N2YA 5AKQA 4PTVA 4ML4A 3UR5A 3UPMA 1EHNA 3BUVA 3TA6A 4AIBA 4F0LA 5K4ZA 3V5CA 3WUGA 3N2BA 2V6AA 3P8IA 4NT0A 2QIIA 2Q09A 3MSRA 3T09A 1FWTA 3NQVA 5DMLA 2FJUB 3E2SA 5AHMA 4IFKA 4UNIA 4BS0A 2ZE3A 1K02A 1F6PA 2VWTA 3G0SA 4CQBA 3GW3A 5E9AA 2FDSA 2OCZA 1R0MA 4GVIA 4ORIA 1TPDA 3HZ3A 2Z7GA 3JW7A 1CXEA 2PRMA 2IXVA 5A8NA 4MZ8A 1UASA 1PTDA 2CLOA 3W72A 3VIHA 4OFCA 2FZNA 4FX7A 5C8BB 4DPPA 3DYMA 4S3CA 4TVUA 3E5BA 3MMTA 3GG8A 1E1CA 1N8WA 5CSSA 3GZ3A 2HE8A 3W7EA 3AXMA 3R8RA 1TZ9A 1OX6A 3GNOA 2IUZA 2PWGA 1AH0A 4A2RA 4B91A 4ZODA 2VZSA 3CB3A 3DFSA 2WM0A 4GYJA 3ZLHA 2OZ3A 3A3WA 4LF2A 1I2QA 4WR3A 3DH7A 2TYSA 1V3IA 1XS2A 1F73A 4XBSA 1JD7A 3EX4A 3VGBA 3LD5A 3V0TA 1TKKA 4PTNA 5A6BD 1NP0A 2R9RA 3WQGA 3MT1A 2O4MA 3BLEA 4HU8A 3M0VA 4Y96A 4LVBA 3B4UA 3VM5A 4HPJA 5BXTA 2DZUA 3N2CA 4R7JA 1M6JA 2XN2A 4DZHA 1QWGA 1HXJA 3W7DA 4B5TA 1QNRA 1I2NA 5A6SA 3PAJA 3S2MA 2XM1A 3VFLA 3W7OA 5ECVA 3KTXA 3NSMA 1XYBA 2XPKA 3WD3A 1QWKA 1VS1A 2W3ZA 5AC4A 3AYTA 2Q8XA 3MSYA 3I3BA 1XISA 2FIQA 2JFEX 2A7RA 1TFVA 3HFTA 3W1TA 3NXLA 1W1B1 1Z89A 2J75A 4YNGA 3VMOA 1R87A 4MM1A 4OBTA 3W3OA 1DXIA 3AHVA 6TAAA 5FJUA 1VFLA 5AB3A 4O19A 1OM0A 1VLWA 4YLWA 4HSHA 3UJ2A 5PTDA 4H9UA 4DJDA 1QAPA 2HXTA 3CWNA 4W8BA 3ZJKA 2CLLA 5G4EA 4QDPA 3H2MA 1HF6A 2VVNA 5DBTA 4Z0SA 4BWLC 3FYPA 3L67A 4PUUA 4F2UA 3OLIA 1WKEA 1E4LA 3A5FA 2Q71A 3LSBA 4YCOA 2OT0A 3VDHA 4M80A 3VNIA 3GU2A 3VOGA 1NEYA 1HVXA 1JDCA 4M6UA 3GNNA 3VD7A 1SO3A 3ZJ6A 2DY3A 3SCWA 4E2VA 3CLWA 4D6JA 1L9WA 4B5SA 4DI8A 2VEKA 4UTWC 4JNYA 4WJXA 3VOHA 3GXFA 4ZB0A 4A3HA 3LY0A 3KUMA 1XBYA 2EF9A 1L6GA 3GDMA 4CQ9A 4HCDA 1UJQA 1R3TA 4LFYA 1A5MC 1JZ3A 2PTXA 1CYGA 2WMIA 3ES8A 4QFUA 4J27A 4NI8A 1NAL1 5HAOA 2IQTA 2F6XA 5H6HA 5C6MA 4RE3A 1M9HA 3TROA 3MI6A 3RPMA 3WFAA 1GKPA 4NAFA 2VWSA 4PYSA 4GYFA 3LHVA 1NM9A 2XWEA 1TVNA 3CBWA 1NSJA 2CBJA 3H8AA 3R58A 4P7LA 3T0DA 5BOFA 3GVGA 2IKGA 4JAWA 1TVLA 1FXQA 2POZA 2RKXA 3QW4B 4H8HA 2Y5JA 5JH1A 3UNDA 3W7LA 2WC4A 1O60A 3UJRA 5C71A 3HB9A 4AEFA 3KL5A 4Q8QA 1BSLA 2PURA 5XINA 4IIHA 3NQBA 4Z2GA 4JNZA 3I3DA 3M43A 4GVHA 4AQLA 1G69A 3OLEA 4GXMA 4PUEA 1J96A 1CB7B 1BG9A 3KXQA 3VIFA 4M81A 4E5TA 4LVGA 4CNNA 3P61A 3WQPA 3CHEA 1RCXB 3N6HA 4TTUA 3LTPA 3I4EA 2I5GA 2PFHA 3OLGA 4AHPA 1D3GA 3EXSA 2WJEA 4F0RA 3TX9A 3NM1A 3O63A 2E8ZA 3P2VA 4IPJA 5GNXA 4XX6A 1OK6A 2PTYA 2VM8A 1GUVA 3TOYA 4LJ3A 3R5EA 2J66A 3BAIA 3DKLA 2AKZA 3URBA 1KRMA 4PULA 3KW3A 4IJBA 2C0AA 2PGEA 1OZQA 1P5BA 3VA8A 5E0KA 4F0MA 4I7UA 3GUGA 4W88A 1FWGC 2X40A 2A3AA 4RV3A 2G4FA 1GG1A 3TQPA 4PCPA 1MNZA 1ME8A 2FH6A 4C60A 2GVJA 2OODA 2EO7A 1YIXA 1H1ZA 3HFYA 3QY6A 5D37A 4HZ6A 1W3KA 2YGYA 1H7RA 1LL7A 5XIAA 4FR1A 4Q32A 2BFGA 4XIAA 3UJSA 3TTSA 4L65A 2D3NA 1J12A 2BNJA 5D9NA 3SUUA 4Q7IA 3WK0A 3AXXA 5FI8A 1E72M 3G1XA 2J78A 1OFEA 1FRBA 4UOQA 3IJDA 1S2CA 1B30A 2ZTKA 2RJHA 1L6YA 1EOKA 3BL3A 3DENA 1O5XA 1KBJA 2P1FA 4UR9A 1S38A 1QHPA 7REQA 1BRLB 1JCLA 3SRKA 1LWIA 3E6EA 4NJJA 1CGXA 5F2GA 3L4TA 3EWCA 1GVSA 2CBVA 3LBMA 1PTAA 4L6HA 3WK3A 1UZHA 3UETA 1BGAA 4PGLA 4XZWA 4P7RA 3NVDA 5JIWA 1D3CA 1E70M 3RMJA 2EPKX 2Y8UA 3WH7A 1IEWA 3MA8A 1GW9A 1JZ4A 3IIZA 4QNWA 1MRQA 2BV9A 1E0UA 5XIMA 3QFEA 4LUSB 4AC1X 3RRAA 3S5SA 4ACZB 1QI3A 4JCLA 3B8SA 5ABTA 2JE8A 3CL6A 4UZUA 1HJWA 4FNSA 2TODA 3C0SA 3BANA 1OX4B 3W2UA 3PFMA 1UOZA 5DT7A 4UTTC 3RCYA 3V3WA 1CXHA 1I0DA 5A8OA 3KP1A 4UMAA 3E0WA 4C6IA 2V30A 4A6GA 4DF0A 1B57A 3NL6A 3PWAA 1EX5A 3WDHA 2VEMA 1G5AA 2NQ5A 4R85A 4LVFA 3QMSA 4QSFA 4MFEA 1CXLA 4LUTA 3O3RA 3TYCA 1C8YA 3PVFA 3W28A 4B5UA 4U3AA 1ZJBA 3AALA 4ML9A 3N04A 1VEMA 2ZOXA 3MCNA 2E6FA 1GOOA 2PDNA 1WUFA 1HFBA 4D6DA 1W1VA 3UU0A 2YDAA 4P8VA 3BJSA 4GJJA 4AFYA 1OCNA 4S2CA 3Q65A 4N9BA 3HMCA 4BR1A 4HTYA 3E2VA 1TIMA 1GOWA 4NF7A 3URNA 3KBJA 3NZPA 4H6KA 2AAMA 3VDCA 3SCUA 4JIIX 3QHMA 5EMLA 1AJZA 3GLCA 4HP5A 3EOEA 2WMJA 2YBVA 3W7GA 4UMBA 3TYBA 1HUVA 2OLAA 2JBMA 3NWRA 1FKXA 3AI0A 4MNKA 4D6HA 1Q45A 3GTIA 6CGTA 1LUCA 3LHUA 3UF9A 3HURA 3MSDA 3FJNA 1DEDA 4EF8A 2GUYA 3BMWA 4MHBA 3HPSA 1NOWA 3G0XA 3GD6A 2G41A 3GQYA 5FF3A 2WCGA 2QJJA 1EH9A 4HNUA 1GVOA 1XINA 2VDIA 2O56A 2XHYA 4E3TA 4CQCA 2YL5A 3TFCA 4PC8A 1ISYA 1ECQA 3VU2A 4EK7A 2VGGA 4O16A 3B05A 4C1KA 2NVAA 3PK7A 4MJ4A 2A6NA 5CZKA 3WEZA 2JGYA 3L2LA 3NQ7A 2XZ9A 3T55A 4G5DA 1UR2A 1E4NA 3AU2A 4AYSA 1KGWA 4MDOA 5EYWA 3TCSA 2WNWA 5H1WA 4AD2A 2Y61A 2PTWA 3MSGA 3T40A 4CQ8A 1R9YA 3WLRA 1LG1A 2Z00A 4YTQA 2J25A 4MY8A 5I09A 1JUBA 3AUOA 4L6OA 2D23A 1DXEA 3ICJA 1MUWA 1VCGA 3B04A 1BKHA 2DZAA 4LXFA 2WBKA 3NL2A 3W1MA 3Q94A 1ZJAA 1VBHA 4WQ6A 3KOXA 3WMSA 3NZQA 1UC4A 5C54A 2VX5A 3FSUA 4JPGA 2PDIA 3A21A 4ZXLA 5HPOA 4L5ZA 3U5YA 2D73A 3MO7A 3MHUA 5I6SA 1XFCA 5FL1A 2WVSA 3PNZA 2AGKA 2FTYA 4GUIA 3SQLA 3DG3A 3Q67A 3W73A 4JIPA 2VNCA 3ANYA 1JFXA 2O92A 1IYXA 3W87A 5HNRA 5CJ5A 4AX6A 3CZ8A 3POHA 2BS9A 2IS7A 4JD4A 2YBUA 1UJPA 1RLCL 1YXDA 3IPWA 3F5KA 4IL0A 4X60A 3GDKA 8TIMA 3LN3A 1ODZA 4GINA 3CJPA 4QM1A 3TIMA 2VFEA 2YCLA 1Y8BA 3I65A 1RVGA 4GCAA 1XKJA 1EF3A 3QKZA 3VIPA 1JDEA 2WCAA 3IVTA 4JNMA 3EBVA 4X0NA 1SZEA 2J88A 3OVGA 3KCLA 2XFRA 1C8XA 4KEMA 2Z29A 4GG9A 1BXBA 2XGIA 4YTSA 3FGCB 3EDJA 3KRBA 4NNBA 3G5EA 2XJ7A 3CPRA 5F2MA 4IP7A 5HK4A 5EB8A 3TXVA 4AG0A 1EGVA 4LUYA 1ZY9A 4X63A 3ANVA 4KKXA 2PB1A 4JHZA 4O14A 1KCLA 1BHGA 1XD1A 1ONWA 3B97A 3GRIA 2G5WA 1W9DM 2V3DA 2CW6A 4KCTA 4RJEA 1R8LA 3TJIA 3M5XA 4L1GA 3E9AA 3N13A 1GVYA 1EJ7L 3SFKA 4MPKA 5K3VA 4BJHA 3EEZA 3W1NA 4JKLA 3ARVA 2YCJA 5J8LA 3BK0A 1W1A1 1DJXA 1EPXA 4IUGA 1T8QA 4FSAA 3ITOA 4QG9A 3AQUA 3ZO9A 4IT1A 3DCPA 5I00A 1M68A 2YL8A 1PUDA 2DGAA 1XX1A 3BQ5A 1FWJC 4GCXA 4H2HA 4UCGA 2W62A 4POCA 4AH7A 2ZKMX 4WKFA 4F40A 2NT1A 5M1TA 5D8ZA 4HMDA 4DUVA 1AL7A 3CEUA 1HL8A 1AQ0A 5AC8A 1I4NA 2PTZA 4FNPA 3QTPA 3NDYA 2VX6A 2ZX6A 1TA3A 5CLTA 3BJFA 4OT7A 1KM5A 3BOXA 3TC3A 3UWUA 4JL1A 1TJ2A 4AY8A 4JTEA 3MHFA 3W2KA 2WMFA 2Z0IA 1B1YA 1E56A 2V2CA 1F4AA 4LC8A 2I57A 3CWOX 2GL5A 1L2UA 2H6RA 4IJRA 4ERAA 8XIMA 4HOWA 3HGRA 3ENLA 3DFQA 4MB3A 5KINA 2DH2A 5C2GA 4O0ZA 1A0EA 1OIMA 4GYPC 5A2CA 3G6LA 1JUEA 3H22A 1EO7A 3G2GA 2BOGX 3COTA 1YQ2A 2VELA 3GK0A 3INPA 3UG4A 5LNWA 3DYOA 3CQHA 3QC0A 1GQKA 4UIOA 4A3YA 2YZRA 2GZXA 1IEXA 3WJXA 4I5UA 1GQIA 2P50A 5FIPA 3NO1A 2DT0A 1Y0EA 2J27A 2X1IA 4KW2A 4WGHA 4ATWA 3EMQA 1W2VA 2XSAA 3EX2A 1FX6A 3LDVA 1H0GA 3LPOA 3T4CA 3OTRA 4HK5A 4D6IA 3IANA 2J7EA 2YLLA 2XFYA 3LI0A 2PDYA 3S6OA 2CLHA 4MLRA 3S3GA 2ZUMA 1J6PA 2E6YA 4O12A 5CPTA 2A4AA 3S5YA 3DFPA 4U28A 4ROQA 4XAGA 1GHRA 4YPJA 3CIWA 4HN4A 3VO0A 5HMDA 3S6DA 1DJYA 4OBSA 3FA3A 3EMZA 3STGA 3LV6A 2DSVA 2CERA 4HOXA 2YA0A 4L80A 3KTSA 3PPGA 1CW2A 2RHGA 1T5AA 2ABBA 1SW7A 3WD1A 1H60A 3LCGA 2QCDB 4MYAA 1NWUA 4M19A 4NZ3A 4XO7A 4GMEA 3S5OA 4KBXA 4WDUA 3FAWA 3TNBA 3OU8A 4F0KA 5HWMA 2VDHA 4IX0A 4ZO7A 2YDRA 1E0TA 4KETA 4XKYA 5D2XA 1JFHA 3CV7A 4LALA 1E9ZB 1BQGA 1SW3A 1VENA 3WBWA 4XAPA 4XAYA 4WY0F 3WG6A 4X0VA 2VZUA 4X22A 4L4OA 5HDRA 4FXJA 5LXEA 4JFWA 4JTSA 4IPNB 3KE0A 1GOIA 1QPOA 1MW2A 2OEJA 2D0GA 2JIEA 3CMJA 5DXYA 3N34A 1T0OA 1W1ZA 4MJ2A 3FK4A 4TMCA 1WE5A 1QO2A 4AZCA 3CZKA 2HWGA 3R12A 1IR2A 3W85A 1FH9A 1TPUA 4AAJA 2CZEA 4TQTA 4AW7A 4AVNA 1R2RA 5TIMA 2GUBA 3H2FA 1YYAA 2QJMA 2XSBA 1JUKA 1CLKA 4GE8A 4GFSA 4AISA 1SFSA 4DXXA 1S5NA 1OVDA 5ABFA 4WJEA 4NAEB 1F3TA 1VCVA 4J5NA 1X6NA 3UXKA 3BICA 5IM51 4J3TA 2AMXA 5TNVA 1C29A 3NQMA 3HN3A 5AHIA 4L4LA 5I5RA 1MXGA 3T8QA 2E8YA 4IQJA 3SECA 1NDZA 1TRDA 1C3FA 2ABAA 5D8WA 3T0BA 4S3EA 4MJMA 1O94A 1RHCA 3MV01 4YVXA 4WK9A 1EJWC 3PHAA 4H9MA 3HA1A 1KV8A 5DT5A 1P0KA 1MDLA 3KBMA 1MO0A 4O4WA 3TP4A 3BW3A 1QHOA 4QIUA 1GTHA 1J8VA 3ZR4A 4PSRA 1W5MA 1UWUA 1PDYA 3TW6A 2R91A 4ILSA 3RLUA 2PLJA 3F03K 4XD3A 4GI8A 3TH6A 5FAGA 5EMYA 1GVIA 1VFMA 1HGYA 2V5BA 5AYZA 2QMKA 3WF4A 2GVGA 1ONRA 1TQJA 4Z42C 2PZNA 4IIGA 2HNHA 3EXRA 4LNCA 3CK5A 2FPVA 4W93A 4K8HA 2QCNA 3ABOA 5I03A 2VYOA 4Q8PA 4C5YA 3NAVA 4IWWA 1QASA 2BASA 1HKIA 5LGXA 5D33A 3L4WA 2Y7EA 3LS9A 2REQB 1KM3A 3ARXA 2E6AA 3NL5A 2JKPA 2PDWA 1VBUA 2C14A 3CYVA 2NUYA 4IP5A 1S5MA 3L21A 2YXGA 4XZLX 5K7JA 1OEPA 4LYRA 3H70A 3BMXA 4PMVA 7XIMA 5E0FA 1KXTA 1EO5A 4WY0B 4IL2A 3RF9A 1OGSA 1KC7A 1LRNA 4JQ4A 5AZ1A 1Q5MA 3G1FA 3NA8A 3MUAA 1HL9A 1XF0A 2PDMA 3GR8A 3HPZA 4DWSC 3VGEA 1RUSA 4LAMA 2ZZ4A 2VKZG 4RDZA 3TJLA 4JEJA 2DQXA 3UXDA 5HUOA 4AD0A 2WWCA 2Z2BA 2QGYA 2QJIA 5T9CE 5LNRA 4EVZA 4G7EB 2A5HA 5D05A 4HPXA 4RPQA 1LG2A 2NX9A 2ZA2A 1YEYA 4GI9A 1KBLA 4Q8OA 2PRHA 3H24A 1RV8A 4AZIA 5EY5A 4NXSA 2C3ZA 5J5DA 4HIBA 1PHWA 4L9ZA 2PDXA 3KM8A 4KGJA 4N9DA 3T78A 1DXFA 1EDTA 4EWND 2CNCA 3VGGA 3N17A 3R6IA 3GNXA 2J6VA 3AZRA 1M7PA 1KB3A 5AYIA 4S23A 5HANA 4KGLA 2EAWA 1AW2A 4REQB 3STCA 3CZGA 4H2CA 4PMZA 2V68A 1ADOA 1VJZA 3U8GA 3N29A 1R2SA 4PBEA 3VX0A 3M0HA 1UH2A 4RR4A 4S3BA 3MZNA 5JBFA 3M0KA 2YKKA 4EAMA 6ENLA 4QP0A 1IT8A 1VLIA 3W1LA 2H9AA 1W3TA 3RGTA 5J04A 3R11A 1DWGM 4XSLA 1DHPA 4O1FA 1I60A 3P80A 2ESCA 1GYMA 4PL1A 1GQJA 3U7VA 4C7GA 1RPKA 3CT2A 1VYRA 1JPHA 4PMYA 3THDA 3VDGA 3LI1A 1CGWA 1JEZA 4OUEA 4QE5A 4KFNA 4ICCX 2VHLA 1MMFA 3S9YA 1DWFM 4ZFCA 2VP8A 1LCOA 1EA0A 1R3VA 4NQ1A 1SMAA 2CESA 4F0SA 1CB2A 3VX1A 1EGZA 1TJRA 2PLCA 4GQBA 2CZDA 3B0XA 1E6ZA 3RU6A 4JTGA 1FP8A 4BWLA 4HBKA 3W22A 3AMLA 8XIAA 3G1DA 4LANA 4IFKB 4MOZA 4FLOA 4IUOA 2QUVA 1JAEA 3CUGA 1FUYA 4Z0JA 4QG6A 3NQDA 4ZO6A 1OD0A 1X7IA 3UZWA 4Q7BA 2ALRA 2UZ9A 3WDPP 3N14A 4UTWA 1VBJA 3I6RA 3TTOA 1EP3A 4AY7A 4LY8A 5ABEA 4C6NA 3HF3A 3VUPA 1W1PA 4XZIA 1J93A 4UTLA 3NZ1A 1HKVA 2DDXA 1SFLA 4JTFA 3EKGA 1TE1A 5AC6A 1M7OA 4BF9A 1OY0A 1E1CB 3LV5A 3T44A 4R7WA 4X2RA 5FJJA 5LA2A 5A6JA 2ZIDA 3PNUA 4MADA 1O1ZA 3OODA 3C0QA 3W88A 1W3IA 3VILA 3OHMB 2QJHA 1L6SA 3A22A 1XPYA 1VPYA 1OT2A 3V5FA 2OO6A 1GEQA 2QDHA 4HPGA 4GI4A 3QV7A 1QRQA 4J35A 3XIMA 5GNYA 3GAKA 1GQNA 4ACYA 1Z3NA 3ARUA 3I6TA 5E1QA 2DIKA 4Q8WA 1VYPX 4C7FA 1IGWA 5EGRA 1BVZA 5G4HC 1UA7A 4GRSA 1K9FA 2E9LA 4Z1BA 3W37A 2NLYA 3C2EA 4GUHA 4CD7A 3WJZA 2FJKA 3A64A 1V7YA 5I3KA 4NNAA 4LB3A 1H7OA 2CZFA 3TTYA 2PCEA 5A6MA 4RX0A 2QS8A 1X96A 4QG8A 4KEZA 3SQSA 1TTIA 1OT1A 3ALFA 5CAHA 4ERGA 5HJYA 5LIXX 1XC4A 4KWVA 4N02A 2VJXA 2PAJA 2AL2B 2EG6A 4ZBCA 1FDJA 1H4PA 4CNTA 3BURA 4RNFA 4Z17A 1XLMA 2GPTA 4L1XA 3UPBA 5BXRA 5BRPA 2DUXA 1K7XA 4NRRA 3PZOA 3R94A 4JR5A 4AMCA 2ZE0A 1E55A 2YXXA 3DX5A 4JFUA 1XJBA 4M82A 3OBKA 1FY6A 4P61A 1B9ZA 1K4GA 1XYLA 4Y9OA 1A5CA 2IMRA 5FAJA 4E4PA 3C5QA 1EA9C 4A35A 2XVKA 3CEPA 2BGSA 4CU8A 3OZMA 4H4IA 1KQZA 3SY8A 1V03A 2W61A 1CGTA 4LY4A 4PUNA 1LTDA 3SUSA 3HPFA 2YXOA 3KP0A 3VGFA 4PBFA 1DORA 3CIVA 3L0NA 4JCMA 4GZIA 4S2BA 2WHLA 4LAUA 1IGSA 3MDWA 3PZTA 2PP1A 3VZXA 4AWUA 1N8FA 1L8PA 2BY1A 3NO5A 3RXZA 1UW9A 3ITCA 2VCBA 4FS9A 2AOSA 4UR8A 1MYRA 3AROA 3PZNA 2Z7KA 3THQA 4J3XA 2WMIB 1WZMA 3LG3A 4HD5A 3L12A 2YW3A 1JG9A 3IJQA 3GWQA 2OEKA 3IIXA 3RLVA 3KS5A 2HPMA 2IQ0A 2HISA 2O9RA 2RFGA 4PMRA 2FDMA 4NAFB 3WJWA 2C19A 4AIOA 4U4MA 1EKOA 3C8FA 1EP1A 3GAYA 3W26A 4OJYA 4XBKA 4TO8A 3LCFA 2ZADA 1O7AA 3WFLA 3VTRA 3WLIA 1TPVA 5C9UA 5BROA 3F2BA 3SUVA 4U31A 1EUAA 2RGMA 4Q8UA 2PDCA 4QNEA 1WOAA 1Q6FA 3G1YA 1JXKA 5FJIA 2KX9A 3IK4A 1QMLA 5BXPA 3QEZA 2ADAA 3PBVA 4Q3MA 1Q63A 1XLEA 3AS1A 3EX1A 2FHBA 4C65A 3IJ7A 3TW9A 1F74A 4N0RA 2B81A 3KVJA 4WXZA 3U2OA 4F0HA 4N9CA 4JIQA 4R5EA 5CC7A 1W3NA 3F4WA 4UTTA 1H41A 2QEZA 5BCAA 1KCKA 4YCPA 4ZTYA 5D04C 1FFQA 5HJXA 3CTTA 2IW0A 2WC3A 3TVAA 4BZYA 4EAYA 2OOGA 1V3MA 1JULA 3A3XA 3M5VA 4AD3A 4YL2A 5T9BG 2D0FA 1B3YA 4JKKA 2UY3A 4KS0A 1UWIA 5E70A 2OU4A 4P7QA 1D9EA 1RALA 4H19A 4A8RA 3LHYA 3SUWA 3EDEA 2HXUA 1K8ZA 2UY5A 1UD3A 3H54A 1IV8A 3FJLA 1CENA 1Q4NX 4GNVA 4PUMA 2D2GA 5AY7A 4QEHA 1U33A 4M1RA 4GPNA 3FHAA 1S5TA 2PLKA 3V7PA 3DUGA 4Q6JA 3WUFA 5FEXA 4A4AA 2Q3OA 3ISIX 3W71A 4ZTXA 3DZ1A 1H2JA 1HL2A 4ICNA 4Q33A 3T05A 4MYXA 3OJGA 2DT2A 3RFAA 5I3JA 2QCCA 2WZEA 1N7KA 3PBMA 3PPFA 2QCEA 4GUJA 1RBAA 3KDOA 1UMYA 3VCRA 2I14A 2HS6A 1I2PA 1QNOA 2HDJA 3NPUA 4XZMX 1EJTC 1MEWA 3WBXA 2EKGA 3PBWA 4I9AA 4GGHA 1AD4A 3AS2A 3F5JA 3TN3A 2DZVA 3B0YA 3SO7A 5T26A 3GBDA 3DI1A 1AQHA 4JYDA 3BSGA 4EOUA 2GK1A 1CBGA 1L8NA 1K9DA 2WXDM 1FH8A 1AJ0A 2GDVA 4EIVA 3PUGA 3FDKA 2WSQA 2VR4A 4R53A 4DNMA 2OSWA 7REQB 3EA2A 3B4YA 4JFTA 1L0PA 2ZXQA 2G3JA 1O1HA 2BOFX 3P5YA 4EXAA 4D6EA 4NASA 1X1ZA 3HGSA 4MY9A 2V2DA 3IUDA 3AJXA 1M3UA 2R1LA 1NQKA 2DUZA 2HV5A 1F3XA 1RBOB 2QUTA 1RVKA 2DJXA 2DH3A 4TXEA 3AIUA 5BMWA 3U5UA 2Y85A 3NDZA 5BRQA 5A6LA 1OFPA 5TD4A 3IJ6A 4P5UA 5L9FA 3ZR6A 1RJQA 4B15A 1JI1A 2JKAA 4K6AA 2GSEA 1XWYA 4FP1A 3NZRA 4O8RA 2D1ZA 4AVFA 3WJYA 1W17A 5RUBA 3WNMA 2JKEA 4IQLA 4X61A 1UZDA 2QHAA 1DWJM 1LBFA 3L0KA 3EKZA 1OCQA 4NIRA 4IIFA 3ARRA 2HVOA 3SB0A 3WO8A 4Q4KA 3WQWA 4J7RA 2AL1A 4ROPA 2X09A 3RNDA 3H55A 5C5YA 1DHKA 2X0YA 1XIBA 3VNYA 3LERA 1J11A 4DM1A 2G0WA 1G1YA 2WKJA 1UKQA 2XIBA 5CXPA 1F61A 3QHNA 3W4RA 2YSWA 4JY9A 3W1PA 2J24A 4LUTB 1KRAC 1POJA 1M65A 1NELA 1C92A 1M1BA 3HQ1A 3K8MA 2Z1KA 1S46A 4HU3A 2P5NA 2NQHA 1US2A 2PCQA 1E5JA 4LV9A 2BXYA 1XRSA 4DYJA 3PFRA 1P7TB 1YLVA 4EPKA 3ME3A 1K7FA 3UNTA 4BY3A 4XVEA 4NZJA 4BEQA 3D5HA 4QCEA 4ZL1A 3VAVA 2I5QA 2Y8VA 4PMNA 1A5NC 1RPXA 3O0KA 5A2BA 2HE5A 1NF7A 2EPOA 5C9RA 3MWCA 3T42A 1CCWB 2Y70A 3NOYA 1U30A 1BWLA 1CDGA 2G50A 2X1SA 1XYMA 1RA5A 5D9OA 5CC5A 2A1YA 2DJLA 3B9AA 1O5QA 1LUCB 3DOPA 4EANA 5A69A 4H7CA 2G3IA 3KHDA 4IG2A 4JQ1A 2HBXA 2Z27A 6ALDA 4WLCA 4JYEA 5E6YA 3EWDA 5D09A 3G77A 2ZX9A 3N18A 3PULA 4MAVA 3DIPA 2F6KA 1S1PA 4J3VA 1MFVA 4C1NA 1FWSA 1DV7A 3PBUA 2A0NA 3WIJA 5AHEA 2X2YA 4L9XA 4B3ZA 3D0CA 4AIEA 4AF0A 3CB8A 4MNLA 2HEJA 1UIPA 1LYXA 1OG6A 1ZLPA 1B4KA 1JCNA 1SR9A 2QZRA 4FF7A 1EYEA 2QGHA 3SEPA 3TK7A 2ZX7A 4MB1A 3T0TA 3Q58A 2HJPA 2IPFA 4DUXA 3FHQA 3PUEA 1K77A 4IMDA 5GVJA 3E74A 1TYGA 4O50A 2FGZA 4MKVA 2Y88A 1LZOA 4B5NA 3GR7A 3W74A 2A85A 3GIQA 4JS3A 4MIMA 1VRDA 3P74A 2V5CA 3U2CA 5I24A 4AZHA 3N73A 1HGWA 1MI3A 4PFHA 3RMEA 3FIGA 4J1OA 4PMJA 2INZA 1H11A 1X98A 3W29A 4XBJA 1XGEA 3H26A 1VJIA 3LCIA 3TFXA 3Q4DA 1U5VA 3NDOA 1RCOB 3ZWSA 4CNUA 3B8UA 5FJOA 2R94A 3F1QA 3V36A 3VE7A 1MEHA 5A8QA 3MKKA 3SR7A 2VDGA 2P76A 3A9IA 3SN4A 1XUZA 3N6QA 4QS5A 3C2FA 3VK5A 3IV8A 2JEQA 3FJ4A 1N82A 1HJQA 3FFSA 1EBGA 2GVYA <