1TE1A

Crystal structure of family 11 xylanase in complex with inhibitor (xip-i)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Penicillium funiculosum
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords xylanase inhibitor protein I
total genus 92
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1te1A00
1E4LA 3CBWA 3PHAA 1E6QM 5CG0A 3NSMA 4DWSA 1EDTA 3F5LA 5LA0A 2J47A 4AISA 3CUGA 3SCVA 1QI4A 5E09A 2VZOA 2XVPA 1WZKA 1GQKA 4A3HA 3ZIZA 1GQLA 2BVDA 3DHUA 4U2YA 1ESWA 1LG2A 3MMUA 2FHFA 3K4AA 2W4XA 3ARTA 1G1YA 4TVCA 5A6BA 5I77A 1OB0A 2ZXAA 3RPMA 4PRWA 1Q6CA 3G6MA 1UD2A 4X0VA 1U2YA 2WMFA 3CLWA 3IAPA 1CBGA 2UY4A 4WLCA 3CUIA 3ZO9A 1GVYA 2VX6A 4CGTA 1PZ2A 3II1A 3CHFA 4QCEA 1JD7A 1NOFA 2DT0A 4JL1A 1MW0A 1FP8A 2ZIDA 4CD7A 1Z32X 2XVGA 3VIMA 1HKKA 1H0IA 1K9TA 1Q4NX 1XSJA 1BF2A 2WM0A 2NT1A 2V3FA 3ZT5A 2WHJA 2EBNA 2CKSA 1UH4A 2VVSA 4CD6A 1SR0A 4OJYA 5IFPA 4MJ4A 3VVGA 3WL1A 1UWIA 3L4VA 3WD0A 1W1PA 1UYQA 3W27A 3K4DA 1GW1A 3SCSA 4AD1A 3ZT7A 2JFEX 1H5VA 2VVNA 1FFQA 3VGFA 1XYZA 1C3FA 2DT2A 1JYXA 1LWJA 2YDSA 4JIEA 2J4GA 4HA1A 1W1YA 1CLXA 4WJXA 4JFWA 1VJZA 2CHOA 1EDGA 3CUJA 5A6AA 1LQ0A 2BXYA 1AQHA 4WIWA 1E40A 3BSGA 6A3HA 1CWYA 1UD5A 4L4PA 4S3KA 1BGAA 3PBGA 3GXMA 1B3VA 1TG7A 2AMGA 3GYCA 3M6DA 1O6IA 1JD9A 1VF8A 2WW5A 1I75A 5GNYA 3DC0A 1M03A 4FF5A 3ARYA 2X05A 1ITXA 2EPMX 3OLEA 1H1NA 4J3TA 3WQ5A 2G3IA 3GXDA 5BXRA 2WCGA 2XM1A 1F4AA 4OIFA 1OT2A 4AD2A 2WAGA 1JZ5A 3L2MA 1MXGA 3WNOA 1JZ2A 3NYDA 3WD2A 2E3ZA 4CCCA 1KCLA 5JBDA 5C70A 2PWHA 5I2UA 1ITCA 3DYPA 3VIJA 1UWSA 1DWGM 1F4HA 1VBRA 1UH2A 5A8MA 3IJ9A 2DT3A 4AZHA 1XRVA 4YN5A 1W9VA 4DWSC 1KCKA 4A4AA 2YBTA 1HX0A 2WYSA 4W8LA 3ZJKA 1QW8A 4EAMA 2J7FA 2DPEA 4MJ2A 3CIVA 5JUVA 3ARZA 3RM4A 3AHYA 1XH0A 1UUQA 1BG9A 5E0FA 2E9BA 2BHZA 3WDRA 5BXTA 4D6CA 1Q6FA 2VZUA 4WF7A 1K9EA 3ZJ6A 2X09A 4JKLA 1G01A 5IXEA 4YPJA 4UZUA 4CD8A 2DH2A 3AISA 4D6FA 2J7BA 4PSPA 5BWFA 2GK1A 2QLYA 1LF1A 2WB5A 3UETA 4M1RA 4MB5A 5TD4A 2DEPA 5GNZA 2BHYA 2ZUTA 4JHZA 3WF4A 3RJXA 3L4XA 3CMJA 2E9LA 4CN1A 4TTGA 4CU8A 2NT0A 4Z2JA 4Q7NA 1LL4A 2EPLX 2YL8A 3MMDA 1ZBWA 4E8DA 1C92A 1VEMA 3VILA 4PMOA 3BLKA 4BQ4A 1C91A 2PWEA 1H3GA 5IDIA 1J0HA 1HT6A 2YOCA 2PWFA 3UESA 2VNCA 2BV9A 1RPKA 5FL1A 2BY2A 2G3MA 2WZEA 4AZ7A 5I6SA 5KZ6A 3T0DA 4QAWA 3I3DA 4DWSB 1X1NA 1VEOA 4DM1A 1PZ3A 3WY1A 2BVTA 4UFJA 5E0CA 5FOOA 1HJQA 2XUCA 4WKAA 1ISZA 2RGMA 3VIGA 2J7GA 4JFTA 2XFYA 1VFMA 5AYBA 3BCFA 3WNPA 4JL2A 1GOWA 3WH5A 3KL0A 1B3YA 1PAMA 2D3NA 1V3JA 2ZUVA 6TAAA 4H7VA 3WQ6A 3M7SA 4TTUA 3S6TA 2XVNA 5DF0A 1MQRA 3BGAA 3OB8A 3T09A 3ARRA 1TUXA 3VUPA 1CGWA 3KL3A 1JI1A 3TA9A 3L2LA 3VMNA 4IUGA 5ABEA 3GBEA 4OBSA 1VJSA 3TTQA 1UWQA 2PBGA 6CGTA 1V6WA 1B30A 1E1EA 2BY1A 1XGZA 2YA1A 4UR9A 4PUEA 1WDPA 4FLOA 4LX4A 1OIMA 3WBAA 2YDRA 2PBOA 3A4WA 3I3BA 4HOXA 2J75A 4UNIA 4AD5A 2EPNA 1E15A 1QVBA 3B8SA 4HTYA 4QLLA 1FHDA 2WC7A 4AMCA 3SUTA 4P8XA 2FH8A 3FN9A 3N04A 2Y2WA 5M5DA 4MB1A 2W62A 2EEXA 4Z2IA 3NIYA 3MSGA 3WF0A 1E0WA 3LMYA 3CZKA 3WF2A 2ZX9A 2FH6A 4XZBA 3AIEA 4OKDA 4A3YA 3CH9A 1C93A 1QHZA 2A3HA 1XYFA 2W92A 4CU6A 2X0YA 5BRQA 4MNKA 3IAQA 4H2CA 3FAWA 5JIWA 4Y7EA 3VIKA 5CGTA 4NI3A 1JXJA 1GPFA 3PTKA 3WIJA 1UZ1A 1V3KA 3BAKA 3WUGA 3N13A 4CU7A 2VCAA 4R27A 3PZMA 5ABGA 2J8GA 1J18A 3OG2A 2FHBA 3OGVA 1W9BM 3LPGA 4BA0A 2D3LA 1QNRA 1UD6A 1JAKA 4EKJA 1YQ2A 2WBGA 1XSKA 1JDAA 1EDQA 4P8UA 1XH1A 1MYRA 2WANA 1QNQA 2X8RA 2VQUA 4HP5A 1J0JA 3PZTA 1V08A 1MXDA 1UR1A 4D6IA 1CPUA 3AHZA 5A2AA 1VBUA 5HBFA 1W3JA 2PB1A 3MV01 3WDHA 2WHMA 4E8CA 1WDQA 2D0GA 4PMVA 1V3LA 1SMAA 3GNPA 4GO9A 4GKLA 1BVNP 4PMNA 5M3WA 1MVYA 2DSKA 3ZJ8A 4V2XA 5A8OA 1ZS2A 3F4VA 1OD8A 1UQZA 4F66A 1E70M 3LPOA 1GOMA 1OSEA 1GOKA 1UH3A 4HPHA 1S46A 5DT7A 2J74A 4CN6A 2O9TA 4W5ZA 1OGGA 1ECEA 1V0KA 4PSRA 1J01A 1KFWA 4PMDA 4HMDA 1GOQA 3WBEA 1NP2A 5FIPA 3VM5A 3VNYA 3GDBA 3AOFA 1JYWA 2V3GA 4AD3A 4HOZA 3WD4A 2CETA 3OIHA 2WKGA 2YL9A 1GOOA 3WEOA 3MUZ1 3CHEA 4U33A 3UR7A 2XIBA 2G4FA 4GI8A 4E2OA 3ZQ9A 4PYSA 1V02E 3SUVA 1XCWA 3WNLA 3QHMA 4XUYA 3VIPA 2WVVA 5A6LA 4D1JA 4PBGA 5AC4A 2J79A 1CXEA 1I1WA 1C8QA 3RMEA 1B9ZA 2YJQA 2X2YA 3SCRA 1HP5A 2VX5A 4M8UA 1E6XM 5CSUA 4CCEA 2XGBA 3IANA 4W7WA 4ZE4A 3AZSA 3W6LA 1UR2A 4N0RA 2CESA 1UKPA 1TFVA 2VZSA 2OWWA 4LYRA 1CGVA 4JHOA 1IZJA 2D24A 4WSKA 1UWRA 3K8MA 1HJSA 4AZIA 1GHSA 3AJ7A 1UKOA 3AMGA 1CEOA 1KR1A 2CERA 2OLHA 2WZHA 2WSKA 1FH7A 4QLJA 3VGDA 4UFLA 4QCFA 5I3DA 1E56A 1BPLB 1OCQA 1OD0A 4J3VA 2QHAA 3UG5A 5HDRA 3AXHA 3AMCA 3POCA 5FKYA 4D6EA 3A4XA 5ABFB 1SMDA 1KWKA 5IFTA 1AVAA 3ECQA 1JI2A 3QOKA 1ZBKA 3ZMRA 4W7VA 2OSYA 2WMGA 2VCCA 3SCQA 2DIEA 2W61A 2WKLA 1MW1A 4U5KA 4J3SA 5A6KA 4RE2A 4AYSA 2J78A 4LXFA 1FH9A 5IHRA 4ATLA 4W87A 1WZLA 4PTWA 4GINA 3CZGA 3SUWA 3OLIA 2DIJA 2GSJA 4ZXOA 2CBJA 1KGUA 4BZYA 1L0PA 1IZKA 1I1XA 2PC8A 2WVVB 1E72M 1KR0A 1X6LA 3HJEA 4BF7A 3B9AA 4D72A 3M07A 1GONA 5LA2A 2PWGA 3VDCA 5BCAA 3NJ3A 4B9YA 2ZX7A 2PWDA 1R7AA 3PZNA 1QBAA 3ZM8A 4IPNB 1A47A 3LPPA 2WMKA 3OZOA 4W86A 3AZRA 3ZSTA 3WQ8A 3WDIA 1E6ZA 4UFKA 4YHEA 3MSDA 3SIMA 1UHVA 3ARXA 4V27A 2XYLA 2WSPA 2B31A 4GI9A 4TVUA 4K68A 2VQTA 1BSIA 1GJWA 1G0CA 1NOWA 2CCRA 1E0XA 3PTMA 1JDCA 2VMFA 3UCQA 4AIOA 5GPRA 5I0DA 2GDUA 3EDDA 3OGSA 5EMYA 2Y4SA 2ZWZA 2O9PA 3K8LA 2WMIB 2J7DA 4ATWA 2WCSA 2DSZA 1E5NA 2D0HA 5ECUA 4UQDA 3BAJA 1ODZA 3GNOA 4ACZA 2WMJA 2E8YA 3BAYA 3MKKA 4GZEA 3T2OA 3RDKA 2ZOXA 3BMWA 3VM7A 5I24A 1JZ7A 1E55A 2ZXQA 4W5UA 4DUXA 3KEHA 3NSXA 2CYGA 4RE4A 2NSXA 3BAWA 4D6GA 3GBDA 1FH8A 2GVYA 3QHOA 4HZ8A 5BXPA 2Y24A 4XV0A 1QW9A 2OWXA 3GXIA 3JUGA 2XGIA 1M7XA 1E6PA 2GDVA 5D9NA 3EMZA 5A6MA 2D22A 3HU7A 1TVPA 5CJ5A 3WD1A 4CUCA 1QNPA 4KWUA 1V6UA 4QFUA 1SFSA 5E9AA 1QI0A 2V5DA 1VFUA 1EQPA 3PZIA 1MQQA 3VPLA 3PN8A 2DGAA 2RGLA 1JL8A 5D8WA 2WC3A 4D71A 5A1AA 5F7UA 7TAAA 1KB3A 2JE8A 2VI0A 1UG6A 5JBEA 2EXOA 1JF5A 3IJ8A 4P7QA 3K1DA 2GUYA 3KL5A 4GI6A 4DM2A 5C8BB 2OYMA 1EOMA 4Z2HA 5M17A 4AIEA 2WXDM 1BG4A 2BFGA 3PZVA 3SUUA 1PX8A 2A3EA 3ARSA 3WN6A 2W91A 3PZQA 3WFZA 2UY3A 3MUY1 4HZ6A 3WDQA 4UZSA 2VT0A 1BYAA 4HPGA 2XM2A 1TMQA 1KXVA 4KH2A 1KWGA 1KGWA 2CKRA 4F9DA 3WUBA 4QP0A 2QPSA 4GO8A 3L4WA 1JFHA 1IT0A 4UTFA 5CZKA 4NSBA 4MDOA 1TA3B 2J7EA 3CUFA 1R85A 3WNNA 2D23A 1XC6A 1GOIA 5EB8A 5BYWA 1PX3A 1GUVA 4ZFMA 3RM9A 2ESCA 4AD0A 3BH4A 1ZL1A 4F9JA 1BYBA 1VFOA 3T0BA 4P7OA 1V03A 1OGBA 1PIGA 2VOTA 4GIAA 1B3XA 1E6SM 2WBKA 1CXIA 5A2CA 4W93A 3ZR5A 4AXNA 2DSVA 2D0FA 1LJYA 3AQUA 4MADA 3WNKA 1FP9A 1E4NA 2UY2A 1E5JA 1GQJA 3MU7A 2CNCA 1BLIA 2DDXA 4BQ3A 1E3ZA 2J25A 1TVNA 5DT5A 2J62A 4UOJA 4W85A 4BS0A 1L8NA 3PTQA 3AS0A 2IUZA 5D9MA 1FFRA 3NCOA 2CBUA 3VIOA 4RL3A 3KE0A 1DHKA 1HNYA 4C7GA 1XD1A 3AMLA 1GORA 4M80A 2W67A 3FXYA 5DO8A 3WH7A 4UQEA 2UWFA 1J12A 5HNNA 4UQCA 1WB0A 3QHNA 4JFSA 4CVWA 1BGGA 4H8UA 1DP0A 1US3A 3RIKA 2OSXA 3ZSSA 1J9YA 4TOQA 1E43A 4P7RA 1W9XA 4Z2GA 4IPLA 2GFTA 1E73M 2X0HA 3T2QA 5JBFA 3CTTA 1DWIM 4W8AA 5IHSA 2OYLA 5A69A 1WP6A 1CNVA 1M53A 3GXFA 1HKMA 2F8QA 1OINA 4MB3A 2VRJA 5DEZA 4AIUA 4KRTA 1IV8A 1XHGA 4MAZA 4FLQA 4PMXA 2ZX8A 3WSUA 4WK9A 3WQ4A 1X6NA 3MO4A 2W66A 1QNOA 1W3HA 3AMKA 8A3HA 2ZUSA 5A6BD 4EE9A 1J0ZA 1QOXA 1MFUA 4D1IA 3BMVA 2WK2A 2CXGA 4J3WA 4ACZB 1C8XA 4B16A 5A6SA 2Y8KA 2V3DA 4JAWA 2WWDA 4FLRA 4X9YA 1CDGA 3WL0A 2MANA 2XVLA 3W26A 5HOSA 4PCSA 2XSAA 3U7BA 1WDSA 5CPTA 2JEQA 4IISA 1E71M 1JZ3A 3VMOA 3W25A 1NOUA 2IXVA 1EXPA 3RJYA 4UQBA 5LA1A 2CBIA 1VENA 5CQ1A 2YIHA 1O7AA 3VU2A 5A94A 7A3HA 5CGMA 1TCMA 4V28A 5C71A 3TTOA 4JKKA 3A4AA 1QI3A 1QI5A 4EK7A 2HISA 4W88A 1US2A 3THDA 4MNLA 1QHOA 2BXZA 1TE1A 3WDJA 1C7SA 3WEZA 1DTUA 4M56A 3CO4A 2E9MA 2V5CA 2JIWA 1WNOA 3SURA 2WVSA 4PN2A 3SCWA 1MWOA 2XSBA 4H04A 4TX8A 1J0IA 4D6DA 5I5RA 3TTSA 2ZICA 4WKHA 3VMPA 3TTYA 3WUFA 1H41A 4JFVA 3W29A 4CVUA 4FMVA 4UFIA 5A8QA 5CPSA 1QBBA 1KBKA 4NRSA 1HVQA 1XCXA 1BYDA 2YDQA 1DWHM 5JIPA 3CZ8A 1HJUA 2VZTA 3AZTA 1WDRA 3W0KA 1JZ4A 1OBAA 1BTCA 1ISWA 2BY0A 1XD0A 3APGA 3CUHA 3W82A 4PMZA 4P7LA 3WQVA 3F5JA 4PMQA 3AXXA 2GJPA 1EOKA 1GJUA 4P7NA 2G41A 2XTKA 3VTRA 2QV4A 2WVTA 2X1IA 3W81A 2AAAA 4UOQA 5A8NA 3CHCA 5AYIA 2Z1KA 1B2YA 3N9KA 4WKFA 3WKZA 1EO7A 2GJRA 3EBVA 3F5KA 1E6NA 2ZUWA 1UR4A 5A3HA 5A6JA 4AEEA 2WPGA 5FL0A 4TX6A 4PCTA 3FNDA 2IXUA 2PI6A 3WNMA 4B9ZA 2JF7A 2OYKA 2C7FA 3SCOA 3GM8A 4NZCA 1W1TA 5LYRA 3J7HA 4PUDA 4F8XA 3OGRA 3DYMA 1KGXA 1W91A 3RM8A 4XB3A 2EO7A 2YLAA 2W63A 4ZENA 2J8FA 1KQZA 2DSUA 5D8ZA 2A3CA 1V6XA 3FAXA 4HMCA 2O9OA 2V38A 4RE3A 1E4MM 3VD4A 2YBUA 4MNJA 3OBAA 4HOWA 1AMYA 2F61A 3THCA 1EO5A 1J0KA 1H4PA 3B9EA 3IK2A 2VCBA 3N11A 1UD8A 3BAIA 2A3AA 3BCDA 1HXJA 1EGZA 4HMEA 2VR5A 3LPFA 4B3LA 5DFAA 4GZIA 2WMHA 4TXEA 3AIWA 3VIHA 1E1FA 1JAEA 4HZ7A 3VIFA 4Z2LA 1DWAM 4TUFA 3T2PA 1W2PA 4GPNA 1FOBA 2CIPA 3L4UA 3OLDA 3KWXA 2UY5A 2J77A 1H2JA 4J27A 1OT1A 1WKYA 1UKSA 3I3EA 3RO8A 1ISVA 4KRUA 5CSYA 3EMQA 1MW3A 1ZJAA 3WUEA 1W9DM 1ZBCA 1NWRA 3ARVA 1QPKA 3UG3A 1BVZA 1ISYA 3GTNA 4AZ5A 4AW7A 1B3WA 9CGTA 3VD7A 3E1F1 5E70A 1CXKA 2VX4A 4W84A 3AIVA 4R5EA 1HIZA 2WWCA 3DHPA 1C90A 4PTMA 1MW2A 1UWUA 5BXSA 1H49A 4BCEA 5D9OA 1JIBA 1OGSA 5I23A 1E6RA 2CBVA 2CHNA 2JIEA 4MPKA 2PF0A 2D20A 1UR0A 3AHTA 1UD4A 4YHGA 4PTXA 3VX0A 1MFVA 5FD0A 3AROA 3NDYA 3BLPX 4U2ZA 1V6YA 4CKQA 1W1VA 2VO5A 3WMBA 1JGIA 1KQYA 1P6WA 2XFFA 2VRKA 2VR4A 5EBAA 4PMUA 2AOSA 4H8HA 1EH9A 4QLKA 4U3CA 1J11A 3AS2A 2C8NA 3G6LA 4AZBA 1WPCA 5AY7A 3VX1A 3WDPP 3S2CA 3FY1A 1H11A 3VO0A 1R86A 3OLGA 1UKTA 1ZJBA 3QOMA 5E6YA 2VURA 3VDBA 3CHDA 1K6AA 2XG9A 2OWCA 1UR9A 1VEPA 1LL7A 4GZJA 1E0VA 3WH9A 4JFUA 5E6ZA 4MB4A 4CD5A 1LLOA 2CEQA 4AY1A 1UD3A 3PZ9A 4C7DA 2G3NA 1UOKA 1Y7VA 3T0AA 3WF3A 2VX7A 1R7OA 2O9RA 3AYSA 3T08A 3UG4A 1JYNA 2XWEA 2BVYA 4QDMA 1HJXA 4BQ2A 1HVXA 3UR8A 1HP4A 1B1YA 3MANA 1H09A 2ZE0A 1U33A 3AIBA 2WCAA 3SUSA 1LWHA 1EIBA 4MAVA 7CGTA 3WF1A 1G94A 2JALA 3VDAA 1JF6A 2E8ZA 1CIUA 5A2BA 1GHRA 4M29A 3DYOA 4W7UA 3U7VA 3UERA 3SCUA 3AS1A 5D9PA 1BYCA 4PMRA 2C0HA 1NH6A 2QMJA 2TAAA 3EYPA 4P8VA 1W2VA 2XWDA 4P8WA 2YA0A 4GXPA 3WEMA 1B31A 1TR1A 1XV8A 2BHUA 4Q22A 1CGUA 3W28A 2WC4A 4J28A 1CXFA 1XSIA 3WQWA 1NWTA 1VFFA 4U31A 1HJWA 5EFFA 3VKKA 3ZJ7A 1K9FA 2E40A 3MV11 1E3XA 2FDMA 3RILA 3GH5A 1HL9A 4AZGA 1RP8A 1XH2A 3AIRA 4NRRA 3NSNA 1PPIA 3A47A 1HF6A 3ARPA 1VRXA 4DWSD 1V02A 3EMCA 3OA5A 2NW0A 1KXTA 2FHCA 3EDEA 4KGLA 4X0NA 1VB9A 1TA3A 1BHGA 1NWUA 1V3HA 3AFBA 3UEQA 5HPOA 3VGEA 3ZR6A 3ARUA 1Q6GA 3VOCA 2YKKA 3VIIA 1EQCA 3W38A 3GH4A 1CYGA 1B0IA 1NM9A 4GQQA 2GJXB 2WZIA 1NWSA 1GVIA 2WHKA 2Y5EA 1EA9C 3FHAA 2BS9A 5HPCA 2XFRA 5CLTA 3L4ZA 2VUYA 5GNXA 1JYVA 2ZX6A 1C8YA 1C7TA 1NARA 1GZJA 2GK1B 4F79A 1OIFA 1JXKA 3MUIA 3HMCA 1R8LA 1JFXA 3MS8A 2VZVA 3K46A 2HVMA 4UQAA 2FGLA 1HL8A 4PMYA 1VIWA 1UA3A 1M01A 3KZSA 4HA4A 1DEDA 4S3JA 5I78A 4HU8A 2XIIA 2VTFA 4CCDA 4ZEPA 3B9DA 4HA3A 3AS3A 3WMSA 1CGYA 5CXPA 2XVKA 4J3XA 1CENA 1CZ1A 3W6MA 2WLYA 4MDPA 1CXLA 4D6JA 5HXMA 3AI0A 2A3BA 1W9PA 1V0NA 2ZUUA 3WD3A 1W9UA 2J7HA 2EJ1A 3ZT6A 4XX6A 3CZEA 3VGHA 3TOPA 1UA7A 4M24A 1G9HA 3N12A 1DWFM 4W89A 4LYQA 3EDKA 1JZ8A 1ISXA 3VD5A 3FHQA 4OOZA 1A3HA 5AC5A 1W32A 2GJXA 3VINA 2ZWYA 2E0PA 1UR8A 3SCPA 4IM4A 2ZXBA 3DECA 2WMIA 1D2KA 3N18A 1N82A 1HKIA 1KXHA 3ALFA 1CLVA 4PEEA 1B90A 4H41A 4JZ5A 3MUAA 2WLZA 4UCFA 3VNZA 1B3ZA 3BSHA 4LGXA 1JG9A 1Q6DA 1W3LA 2EQDA 1V0MA 4FK9A 3VD3A 2VJXA 1GNXA 1GQIA 3FW6A 1Q6EA 1WZAA 1ZB5A 3PZGA 4H8VA 4OUEA 3WELA 4FLSA 8CGTA 4C7FA 2ZUMA 1BAGA 3AHXA 3ARWA 1UWTA 2W5FA 3NDZA 1J0YA 4XZWA 1W3KA 4AD4A 1E9LA 3N15A 3HN3A 2DSWA 3TP4A 4CN4A 2D2OA 3W4RA 2CITA 4AC1X 2ZXDA 5KEZA 1VAHA 4E4PA 1BFNA 2YL5A 4WSJA 1CECA 5ABHA 1D7FA 4JCMA 1PBGA 1QI2A 3W24A 5I79A 4OOUA 2WNWA 3A3HA 3WH6A 1UKQA 3AIUA 4W8BA 4UOZA 1NQ6A 1BQCA 1FHLA 1JDDA 1CXHA 2E4TA 3SCNA 5BROA 2Q8XA 1G5AA 1UQYA 1UZ4A 3D3AA 4KMQA 4AZCA 5EFDA 5CPQA 3WMCA 1WE5A 1OWQA 2BNJA 1KBBA 3BC9A 3VGBA 3GZAA 2Z1SA 3WENA 1DWJM 1SYTA 3EDFA 1HJVA 4LYPA 4UFHA 2D1ZA 1FA2A 3MMWA 3CZJA 1JNEA 5GQBA 4ACYA 2BY3A 1PIFA 1V3MA 3PZOA 3BAXA 1WCGA 3K8KA 4OZOA 3QGVA 1CGTA 5ABFA 4LPCA 1ZU8A 1RP9A 3O2LA 5FCZA 5CLWA 2XHYA 4NF7A 3AMDA 1M04A 3N17A 3TONA 3PZUA 1TZ7A 4MTVA 1RD6A 4AEFA 1J10A 1EHNA 3AICA 2VL4A 2VC9A 2EPOA 4GQRA 4UQ9A 3VDHA 2WVUA 4DUVA 3CPUA 3IJ7A 3D5HA 4EANA 3W53A 2WHLA 1AQMA 1R87A 3CMGA 4PTVA 2J7CA 3ARQA 1AQ0A 3N1AA 1V6VA 4CD4A 1NP0A 2JEPA 3L4TA 4AZ6A 3O6AA 3A6OA 4MNMA 3RCNA 5A95A 2JF6A 3POHA 4AWEA 2XPKA 2DQXA 3SCTA 4L4OA 4HU0A 4UFMA 4TVDA 1PJ9A 1KXQA 2OSWA 2ZUNA 1PX4A 2YL6A 4OBRA 1MQPA 4LQ1A 1WZMA 1HKJA 1CGXA 1ZBVA 2XJ7A 2G3JA 3BXWA 4U5IA 2QMKA 5A8PA 4N42A 2QPUA 3CGTA 1D3CA 1V3IA 4URIA 3AXIA 3U5YA 2YA2A 1GCYA 2VRQA 3W37A 1QNSA 4BQ5A 1CTNA 2CPUA 4Z2KA 4JKMA 3GH7A 1HN1A 1WO2A 2EPKX 4D6HA 3U5UA 1E4IA 3GNRA 1PEZA 2DH3A 3AHVA 3NUKA 4U3AA 4ML4A 3AIQA 3WH8A 1WAWA 4M82A 4M81A 2FGZA 1JZ6A 2V3EA 3VD9A 4J7RA 3U57A 3ZOAA 4ATDA 1JNDA 2F2HA 3ALGA 5DMYA 1ODUA 3O9NA 2QF8A 3EDJA 4AZCB 3WFLA 5BRPA 4J3UA 4DUWA 1K9DA 3L4YA 1OM0A 4KGJA 3AYRA 3SEPA 3QR3A 1U30A 1LG1A 3M46A 1YHTA 2DT1A 1QHPA 1EHAA 4B15A 1RH9A 3VGGA 3CZLA 2Y8VA 1H0GA 4B3KA 2YLLA 5D4YA 2ZX5A 2G8ZA 1LL6A 2O92A 4ZXLA 3OZPA 4ZE5A 5M03A 1V0LA 4JCLA
chains in the Genus database with same CATH superfamily
4QQ3A 2C1HA 1EDTA 3H2CA 3EA1A 5AC6A 1U5VA 3NURA 5LGZA 1E9YB 3SCVA 3JZEA 2R1LA 1I2PA 4ICCX 4UR7A 3Q65A 4LW7A 1IXQA 1EP3A 3DCPA 3MHFA 1TWWA 1EUNA 1POKA 1XIFA 1TMLA 3VZZA 2QZRA 3DKLA 4MY9A 4QE5A 4TIMA 4QS5A 4LH8A 3BARA 3K4AA 3ARTA 4C6DA 1C9WA 4NX5A 3RPMA 3PSVA 1O1ZA 4E38A 4X0VA 5DN1A 1U2YA 2PDBA 4EACA 3H55A 1PTGA 3HQ1A 3W2LA 3ITVA 3CUIA 3ZO9A 2DVTA 3C4UA 4QTGA 4CGTA 1TIMA 2Y8UA 3II1A 4N9DA 1KRMA 3S1VA 1NOFA 3B8UA 1XIDA 3I7QA 2OPJA 5AYXA 4CD7A 1F74A 3ITXA 3RX4A 1XSJA 1IZCA 2WM0A 2NT1A 5DLCA 4IMCA 3D46A 1SR0A 4OJYA 4FX7A 2YCLA 2VXNA 2PEVA 2ZE3A 3W27A 3CL6A 4MKSA 1XJBA 2QDHA 3NQ7A 1H5VA 3T81A 3MCNA 3WJXA 1JYXA 2YDSA 4G5DA 4JIEA 2J4GA 4HA1A 4DZAA 5JXQA 5F2LA 1SFTA 4DJDC 3BG3A 3CASA 3L21A 4LS1A 3ME3A 3ZWTA 1EDGA 1Q7ZA 1GPWA 4Z42C 3UF9A 3P7YA 1EFZA 1VPQA 1E40A 3BSGA 2HBVA 6A3HA 3W2JA 3GXMA 4LC6A 1TJRA 3CXOA 4JGDA 5FJUA 2YX0A 3C5QA 5HMFA 2X7VA 1VF8A 2WW5A 2XN2A 3LYEA 5CBIA 2OU4A 4KCVA 2OKTA 4OU1A 4FF5A 3IGXA 1OADA 3T1GA 1ITXA 2RDWA 2P88A 2FMOA 3BSMA 3KBJA 3OLEA 3SY8A 4OIFA 3RLVA 1R3WA 3L2MA 1JZ2A 3NYDA 4DBUA 2XISA 2E3ZA 1W8GA 4CCCA 2XH4A 1KCLA 4H1ZA 4TO8A 5I2UA 3L5MA 2I5QA 3VIJA 3OQ8A 1TTQA 1DWGM 3ID7A 2A2IA 4O4VA 4K8EA 2XZ9A 3IJ9A 4S39A 4AZHA 5GJMA 4YN5A 5IDZA 2QJHA 4A4AA 3MZ2A 1M68A 2NLIA 4IGSA 4W8LA 5J5DA 3FOKA 2FVLA 1FTXA 2HPIA 4EAMA 1EB3A 2GQ9A 3ITGA 3AHYA 5AC8A 1FCUA 1RQHA 1BKSA 4P61A 3F03K 1X38A 3O05A 5AOUA 3W00A 4D6CA 2BASA 4WF7A 2H8ZA 3LSCA 1JCNA 4O1FA 1LUCA 2X09A 4E0CA 1G01A 3UZJA 3BL3A 4CD8A 4HNUA 1EP1A 2J7BA 1VS1A 1LF1A 2WB5A 3TN3A 4MB5A 3H2MA 1YLVA 5GNZA 4FOJA 3IIXA 1J96A 3WF4A 3PBVA 4FXRA 4QE4A 4EXAA 2ZDRA 5D09A 2PGWA 1LL4A 4V33A 3A64A 4IMDA 3R79A 1VEMA 1VQTA 4LV4A 3S47A 4I5XA 3AU6A 2NV2A 4JHMA 3B8DA 5DXXA 1J0HA 1EEXA 1O60A 4UMAA 3LU2A 2YOCA 2VNCA 1DJQA 2GPTA 5FL1A 2G3MA 2WZEA 3LGEA 2FFIA 2B0MA 3UWVA 1T40A 2VOMA 5KZ6A 4XTIA 4QITA 3M0VA 1VEOA 1PZ3A 4ADUA 3KXQA 5FOOA 4XVEA 2RGMA 3VIGA 1VFMA 5AYBA 1QUMA 4JL2A 1GOWA 3WH5A 1LYXA 2Y6ZA 3JU2A 1OYBA 6TAAA 3IUIA 3EXRA 4TTUA 4O1AA 4ADTA 1PS9A 3EB2A 5DRIA 3S2MA 2YCJA 2Y61A 2GVJA 2YBVA 4B90A 1FCQA 2XINA 4MZ8A 4WR3A 4XAPA 1A5OC 3ARRA 1TUXA 3SM0A 3VUPA 3W7DA 4INFA 3L2LA 1NFPA 1F3XA 3GX9A 3DFPA 3S83A 3GBEA 2DU2A 4LUSA 1VJSA 1UWQA 3BW3A 4DN1A 2YCLB 1E1EA 1EJUC 3G3MA 3HJZA 3FYPA 5EMUA 2AQVA 2G3FA 2VR2A 3EA3A 3G1FA 1OIMA 2W0UA 4DUOA 4GABA 4HOXA 4ZOAA 3KOZA 1E15A 2QCHA 2PWUA 1FHDA 1DIEA 5HQMA 3L23A 4YLWA 4EF8A 2MNRA 1TSIA 4GGBA 3W70A 4MB1A 1LRTA 4A8IA 1F05A 2WOQA 3MSGA 3QTPA 1UMYA 3UPBA 2ZX9A 2WJEA 2OT0A 3BGJA 1OF6A 1QHZA 7XIMA 2QCNA 1TPWA 2X0YA 2PLKA 4MNKA 5JQ9A 3FAWA 1GZ1A 1OFEA 1VHCA 4Y7EA 5CGTA 4NI3A 4WQ6A 1JXJA 1UZ1A 3SQMA 3W74A 3L65A 3L5AA 3N13A 2Y7EA 4R27A 5CCZA 2J8GA 3OGVA 1W9BM 2I5IA 4L1WA 1R30A 3KVLA 2CLKA 1YQ2A 1RZMA 1XSKA 2YCKX 4LUYA 1WKFA 3WMLA 1VLIA 3PZTA 3WO8A 4RR4A 2OOFA 3TC3A 3GDLA 3B0YA 4XO7A 1UR1A 3GAYA 1UPPA 4JN8A 4A2RA 3AHZA 3GR8A 3UJ2A 5HBFA 5FF4A 4I3GA 2PB1A 1O95A 2ATSA 3WDHA 2WHMA 1WDQA 4RZ4A 4PMVA 3L0NA 2QCLA 1V3LA 4GVHA 3TYZA 2VDIA 2ISSA 4PMNA 5M3WA 1MVYA 2DSKA 3S5YA 3R1ZA 4V2XA 3VNIA 3F4VA 4F66A 3U9IA 3KRUA 1BTMA 1JR1A 3HPFA 1RK5A 3IIVA 1UH3A 3Q4DA 1FWHC 3ENLA 4HPHA 1S46A 5FJJA 4W9TA 2O9TA 2J8TA 3PPHA 3EAUA 4PMDA 1J01A 1KFWA 4HMDA 3HPAA 4JIPA 1I2OA 3WX7A 4HD5A 1ELSA 2AMXA 3VM5A 1TV4A 4JY8A 1EXBA 4FHAA 2ZYFA 5G4WA 1MUCA 3WD4A 2CETA 3PF3A 5D2WA 1VBGA 1AJ2A 1GOOA 1SFJA 1K3UA 3GNXA 2NWRA 3ZQ9A 2YZRA 3WNLA 3QHMA 4XUYA 3YPIA 5HA7A 3K13A 4HNVA 1I1WA 1C8QA 4BF9A 3PS7A 1UUOA 5CSRA 5E5CA 4FO4A 1XIMA 3T8QA 2VX5A 3GHRA 2Q8LA 2XGBA 1H63A 1B3OA 3N73A 1JPMA 1TV8A 3BLDA 5H8UA 1IZJA 1OX5A 5HMDA 1TTPA 3BLLA 4AY7A 4C1LA 1CEOA 1TZZA 2Z6JA 1MSSA 2RAGA 4L4MA 1DVJA 1TX0A 3ELFA 3VGDA 4UFLA 3A23A 4QCFA 1THFD 1ZTVA 4PBEA 1QASA 4ZO7A 5HDRA 3NTYA 4X2RA 3POCA 3PB0A 1VHNA 1W1B1 3T4WA 3EOUA 3W87A 5ABFB 1SMDA 1DQUA 2YXOA 3WK1A 5IFTA 4M7TA 2QXWA 4B5TA 4M6PA 4W7VA 4ZO8A 2VCCA 4ZO9A 2QEZA 4LUJA 1QPRA 5A6KA 2L5HA 4W87A 2H8XA 1K7XA 3CZGA 3K2GA 4N9EA 2I14A 3P8IA 1EJSC 1QWGA 1AODA 3ES8A 4BZYA 5HATA 3D3FA 1K7FA 1QXLA 2PC8A 5I3JA 1LQAA 1AK5A 3GTFA 4HPXA 3HJEA 4BF7A 3B9AA 3QZAA 2Y1HA 5LA2A 3C2EA 2PWGA 3KCJA 3NJ3A 4K7YA 4KQNA 3OVRA 1U1JA 2EG6A 3OZOA 3NQAA 3AZRA 3E2RA 4C6OA 1ECQA 3WQ8A 1E6ZA 4UFKA 3SIMA 3NZGA 2ZA3A 3R0UA 2WSPA 2B31A 3QZ6A 1HO4A 1TV5A 4OQVA 3QMRA 4LB4A 4DNHA 1XRTA 4ASTA 3CK5A 3IVTA 1ZAJA 1A3WA 1QCWA 2OMAA 3BW2A 1FWDC 5MKGA 1Z44A 3QC0A 4DHGA 3EDDA 1JVNA 2Y4SA 3K8LA 2C91A 1FUYA 3QJAA 4NG3A 5ECUA 2PDGA 3KOXA 3GNOA 3E0IA 4RXFA 4MSSA 4ACZA 3M5XA 2E8YA 1CT5A 3VFCA 4GZEA 4B92A 4AY8A 1ONXA 5I24A 4C6FA 1HKVA 3KEHA 4PRTA 4MY1A 5A6TC 1FCBA 4D6GA 3WQCA 4ERGA 2G0WA 3G77A 3QHOA 4HZ8A 2Y24A 4XV0A 3GXIA 4Z1YA 3NL5A 4DBWA 3RNDA 2GDVA 3KBNA 2GYIA 2D22A 4Q7BA 3AUOA 1FWNA 4LALA 3FJNA 5LNRA 4CQAA 3VUSA 4Y9NA 4ZQMA 4KWUA 1EF2A 1SFLA 3CWOX 1NJJA 1AMKA 1R3VA 3DU0A 4NVTA 4WXYA 3VPLA 4I8YA 3N29A 2QUUA 2R91A 5AB3A 3E0WA 5JBEA 3FX4A 1YPXA 3DEQA 1B57A 1JF5A 1XLLA 3ZYZA 3K1DA 2GUYA 2PODA 4A3QA 3TJLA 3EOSA 2OYMA 1IEQA 4Z2HA 1DOSA 3BDKA 4ZB5A 3TW6A 3S5NA 3UZXA 1Y65A 2A3EA 5AZ0A 2W91A 5J5RA 4ZL1A 3MUY1 3H4GA 3LENA 3MVIA 4HPGA 1FKWA 1KXVA 4KH2A 4QS6A 1KGWA 2HTMA 4QJ1A 2GGEA 3WUBA 4WDTA 2QPSA 3GW3A 4XBSA 4HHHA 4B5WA 1YNQA 1JFHA 4UTFA 4QSFA 4MDOA 2PU0A 3O16A 3LSBA 3CUFA 3N6HA 5E1QA 4MUZA 5CC7A 2JGQA 4Y2WA 5EB8A 4ZFMA 2PGFA 3DI1A 1E0UA 4Y8FA 3QSTA 3RM9A 2ZRXA 4NJIA 1BYBA 3T0BA 4P7OA 2VOTA 5AZ1A 3N4FA 1R9YA 4H9TA 3TKFA 2WBKA 2ODOA 5A2CA 5EPDA 5TF0A 1IHIA 1FWSA 4CQBA 4R33A 4YJ5A 1NQKA 2D0FA 2O56A 3AQUA 4X60A 1I6NA 1AH0A 2WJZA 1BD0A 2P3EA 1PYMA 4R7OA 1AJ0A 4X2PA 3TOYA 1E5JA 4UB9A 3MU7A 1A5MC 2DDXA 4PODA 1E3ZA 4G7EB 1Y8BA 3TR9A 1TVNA 5DT5A 2J62A 4UOJA 1L8NA 3AS0A 4HCHA 4UTJA 2F2KA 3NCOA 3RCYA 3KE0A 3W2MA 1HNYA 4PUJA 4AXKA 1XD1A 2QCMA 4RPQA 3FXYA 4UQEA 5HNNA 3U48A 5LIYX 4UQCA 4LSBA 3SECA 3QHNA 1US3A 3RIKA 3TW9A 4FEZA 1Q65A 3ZSSA 1TPH1 3G18A 1PDZA 4H9VA 1Z3NA 3PANA 2ZRUA 4Z2GA 5H2ZA 5D2TA 4C91A 4X61A 2IQDA 2VWTA 1PZ1A 4DXXA 1L2UA 1CNVA 5HUOA 3PG9A 1EPXA 3IS4A 2PCEA 1OINA 4DNMA 4HNLA 2CZEA 4FLQA 2OZTA 3WSUA 4DBSA 4OFCA 5GJPA 1X6NA 4L7ZA 4REQB 1G6CA 2YYUA 2FTPA 3LY0A 2ZUSA 1V77A 1KM0A 4J4KA 1QOXA 1MFUA 3U2CA 4N4QA 2QIWA 2INEA 3DI0A 1C8XA 2Q09A 1DJNA 2PRMA 4JAWA 1U5JA 2XSAA 2QNEA 1S3HA 3NA8A 4FPSA 4LUTB 3RUBL 3SN1A 2AAMA 1NOUA 4LFYA 5JMUA 1LT7A 1YDYA 1EXPA 2REQB 2TSYA 4N6EA 2OLAA 3NR0A 5CQ1A 5A94A 3GG1A 1AG1O 3H54A 3W9ZA 2I7GA 4LRSA 4GNVA 3ZLFA 3VZXA 4UTKA 4LVAA 1TE6A 2PP0A 4JOMA 4MNLA 1QHOA 5BNKA 4MKVA 4KS0A 4LBSA 3KW3A 1BWLA 1IF2A 2E9MA 3E5BA 1Y5WA 1MWOA 2IQ0A 5D2VA 2PZNA 4TX8A 1J0IA 4GYKA 4D6DA 3VMPA 2WSQA 1A5SA 2FZDA 4FALA 2Z00A 2C16A 2A6LA 4FMVA 4KT2A 4UFIA 5A8QA 3CAKA 3M0LA 5HR7A 4GQGA 1XCXA 1JUKA 3WK3A 3W88A 1VCFA 2VZTA 3DERA 1FDZA 5FI8A 1W6TA 4DYEA 3CUHA 3W82A 5AHEA 4JTHA 3WQVA 3XIMA 3PJWA 3F5JA 4AH7A 1ZJHA 1IXNA 2GJPA 3AYVA 1LWIA 1D9EA 5T9CE 2HJPA 4MWAD 2G41A 1MDRA 1XIEA 3B04A 2WVTA 3T55A 1SW0A 3HPZA 4FNRA 4UOQA 4B5VA 1WQ5A 5A8NA 3L2IA 2VKZG 2Z1KA 1B2YA 2DIKA 4WKFA 4JTEA 4LCSA 1T6MA 3W7GA 2ZUWA 5A3HA 4AEEA 4JN7A 2TYSA 2WPGA 3FNDA 3CB3A 1RA0A 3TUUA 3GM8A 5GJNA 5A8GA 1W1TA 5IBXA 4HCDA 2ZDSA 3J7HA 4MZYA 3W7CA 2P0OA 3GVGA 1SZEA 4F8XA 3PJTA 1W91A 2F9RA 2YLAA 4DPQA 2J8FA 4HTBA 2OTDA 3OYXA 3G1VA 4ES4A 2V38A 4X63A 2IQTA 1E4MM 4S3EA 2F61A 3THCA 2DZUA 4PB3A 3DZ1A 4GIYA 1UD8A 1QK2A 1H7PA 1EGZA 4KEMA 1CW2A 5HR6A 1PYFA 3ZS4A 5C9XA 3EX3A 3DFQA 3MT1A 2DORA 5HULA 1NIUA 1E1FA 3B97A 1DWAM 3TEVA 3T2PA 4ZODA 4WEVX 1EX1A 1QOQA 1H2JA 1VCGA 3RCMA 3Q58A 3IARA 1OT1A 3LM7A 3GIPA 3EMQA 5CZ0A 4BWLA 3KS5A 3U2OA 1W9DM 3SBFA 4PA8A 4GGHA 1ISYA 2C3ZA 2GQAA 4LBUA 3W1MA 5E70A 4MJMA 1N8FA 3U2ZA 3UJRA 1S5WA 3PB2A 2NV1A 1AL8A 2ALRA 3ANUA 3PULA 4C6CA 3SFKA 4ZFCA 4RNIA 1AZ2A 1E6RA 3WK2A 3MCMA 2ACQA 1VBHA 4Q8TA 2PF0A 2VEGA 2D20A 1TV3A 4UTTA 3VX0A 1EZWA 4AVOA 3G0UA 3AROA 3RU6A 1OFRA 3NDYA 3BICA 3S1UA 4CKQA 1W1VA 1JGIA 1KQYA 5D38A 3HFTA 1RK6A 1AA1B 2GQ3A 4QLKA 3AS2A 4UCGA 1LBFA 2HVNA 1WXZA 3M0ZA 4IT1A 3IPWA 3S2CA 3VO0A 1UKTA 3UY7A 1PO9A 3ANVA 2Z24A 3BJTA 2XG9A 1UR9A 1VEPA 1LL7A 1WX0A 3WH9A 4JFUA 4B3ZA 2DY3A 4NJHA 3CQKA 2V63A 3EXTA 4MG4A 3WF3A 2I9UA 1R7OA 3AYSA 3UG4A 3KBSA 3SRHA 4QDMA 3LCXA 2YGYA 3QM3A 1HVXA 1H09A 2WCAA 4EF9A 3TK7A 1LWHA 1KRAC 2ZA1A 1S2UA 2P8CA 4Q6JA 3WF1A 3VDAA 4W4QA 5DCDA 3LXBA 1ONEA 1A5CA 4M29A 4W7UA 1PL9A 3TIMA 3DN5A 1XF0A 1DKWA 2TAAA 1W2VA 2XWDA 1HO1A 4QDWA 1HG3A 2NVAA 3MC5A 4DPPA 1TR1A 3V1PA 2BHUA 3S6DA 4Q22A 4JXCA 1K7EA 3LN3A 1G4TA 1XSIA 1NWTA 1VFFA 4U31A 1OFQA 2D69A 4HK7A 2E40A 3MV11 1E3XA 5C55A 1L6SA 4GJJA 5FF0A 3TJIA 3R89A 1WXYA 1PPIA 1HF6A 3S8HA 3XISA 4AB4A 4WGXA 2NW0A 1GVQA 1RXOB 1DJHA 1LDCA 3MWCA 3SRDA 5REQB 1H7WA 1DTNA 5DCEA 3ARUA 1Q6GA 3VOCA 3PBWA 1EQCA 3VXGA 3GH4A 1CYGA 4MFDA 1B0IA 1NM9A 3WLJA 2IKIA 2WZIA 4JTGA 4XZIA 3GO2A 4Y9AA 4D8AA 4J2PA 3URBA 1EA9C 3JRKA 3QGKC 2PD5A 2OEMA 3EWWA 4NZ1A 2Q8ZA 1HUVA 3K30A 2ZCGA 3FEMA 1LOSA 3L4ZA 2VUYA 1SSDA 2ZX6A 1A0DA 2GK1B 1ZP3A 1JXKA 3TLQA 3VKBA 4GD0A 2QGHA 5FACA 2WJFA 2HXTA 1HL8A 3S5SA 1UA3A 1M01A 3KZSA 4G8TA 3U4AA 1FDJA 4GI4A 4K39A 3IGSA 3PJUA 4HJFA 4XO6A 2GLKA 4DJDD 3HM7A 4ZEPA 1CCWB 3RLHA 5HINA 4J3XA 5BOEA 3NQBA 1EBGA 1CXLA 4NIRA 1W9PA 1V0NA 3TSBA 1W9UA 1FKXA 3ZT6A 5BOFA 3CZEA 5D33A 4IPIA 1JPKA 1JULA 4YTQA 4F4RA 4F0KA 1V4YA 4A8NA 1A3HA 2GJXA 2ZWYA 3RN6A 2E0PA 3SCPA 1LROA 3N2CA 1BRLB 4K1GA 4IFKB 1GVOA 2XIMA 1D2KA 4BHYA 3ALFA 4UC5A 4KFNA 3V1HA 4L64A 1XFCA 2DJXA 3WLLA 4NNCA 4JZ5A 2EF9A 3DFNA 4M6QA 4WY0A 4DO6A 1ONWA 5KITA 3UXLA 4DJDA 3NQ2A 2Z2BA 2NVDA 1JCTA 4GUGA 4FK9A 1Q6EA 1R47A 4LRTA 4HIBA 3PZGA 3WELA 4QG6A 4GQBA 4HNOA 4JTTA 1BAGA 1UWTA 3KRSA 1P5BA 3GSMA 2DUXA 1GEQA 4AD4A 1E9LA 3FKKA 2R1MA 3W2UA 4KETA 2DSWA 5AHLA 3CO8A 3BVJA 1SZNA 3W1QA 1M5WA 2B81A 5KEZA 5EA9A 2XU2A 2YL5A 4H7CA 2ZZ3A 3W24A 1QI2A 2WNWA 3R10A 1UKQA 3AIUA 3WH6A 3PUOA 1FHLA 3QVQA 3EKZA 3R6IA 1CXHA 2E4TA 3MUCA 3M64A 5BROA 4ZMGA 4NL1A 2ATMA 1SO3A 3D3AA 1FCVA 4KMQA 3RX2A 3WCZA 5EFDA 2PDYA 3BC9A 2Z1SA 4OGZA 1DWJM 4RZ6A 2VFDA 3OU8A 3MMWA 4F3HA 4R85A 5GQBA 3MKVA 5AKQA 3QN3A 4EOUA 3TA6A 4I6VA 1RP9A 1K8XA 1RLCL 3PAOA 1TPVA 4O0ZA 4H6EA 4NJGA 4H9ZA 4LANA 1XLHA 3N17A 4M1BA 2Z2AA 5HJLA 4B2DA 1PSCA 2FPVA 2CZ5A 4GQRA 1Z48A 2V9DA 4Q7IA 3CB8A 1UASA 4K38A 1Q5MA 4JBRA 1FQ0A 5FJIA 5JH2A 3TE9A 3L66A 4JTAA 1AQMA 3CUXA 4HHPA 6REQA 4LVBA 2GGIA 4PTVA 2J7CA 1XLAA 2H9AB 1FWGC 1V6VA 4JD4A 3OQEA 1F73A 1QWKA 3GE7A 2CZFA 2JEPA 2VD9A 3AC0A 3RCNA 3POHA 3SCTA 1KTCA 4TVDA 4IP5A 3T07A 4A6GA 5D2XA 1YE4A 1ZBVA 2DVUA 2G3JA 2XJ7A 2VP8A 4U5IA 5CZJA 1P0EA 3QBUA 1OY0A 1NF7A 2QPUA 2BB0A 3ZFHA 4CNNA 3P62A 3C8FA 3TQKA 4MZ1A 3CAQA 4JTLA 3KBVA 2CPUA 5H91A 4D6HA 3U5UA 3LBOA 3MO7A 1WKEA 2BODX 2QDDA 1PEZA 3KWSA 4U3AA 4ML4A 1PUDA 2E6YA 1RA5A 5T9BG 4M82A 1KW1A 5K9CA 3D47A 2FZ8A 3GR4A 4NZJA 1P0KA 4YVPA 3O6CA 2DQWA 3VD9A 3CNYA 5F2MA 3U57A 3ZOAA 1XS2A 1KTNA 4NU7A 5FAGA 3HG3A 4MY8A 1ODUA 1VC4A 4LAKA 1Q8AA 4IL0A 3O9NA 1W54A 4AZCB 4Q4PA 2D2JA 1FHVA 3AYRA 1XR2A 2DT1A 4LWWA 2NV9A 3TVAA 1QHPA 3TXVA 3W1UA 1EHAA 4DJEA 1OQFA 4B15A 1TJPA 1X39A 1X96A 2REQA 2Y8VA 2E6FA 3RGTA 1GVRA 1J4EA 1J5TA 2PF8A 2WNQA 1FVPA 2JK2A 1S38A 3DG7A 4JCLA 1E4LA 1FBAA 1E6QM 3SRFA 4G6CA 3EOOA 3FIGA 1W1A1 1MRAA 3CUGA 3RRAA 5XINA 2VZOA 2X16A 4E2BA 2A79A 3B4YA 1WZKA 1BXNA 4A3HA 1TYGA 5HQLA 1EJ7L 5LNSA 1VPYA 3DHUA 4U2YA 1LG2A 4HN8A 4ROPA 4TVCA 5A6BA 5I77A 3QYQA 1RJRA 1R0MA 3VKDA 3CLWA 4CNPA 3IAPA 5LGXA 1CBGA 4WLCA 5FJPA 5IOBA 2VX6A 1PZ2A 2PUZA 1XYLA 1JD7A 4Q8UA 4QJ3B 4JL1A 4Q8NA 5EYWA 3GQYA 2VEIA 1JPHA 2HV5A 1VJIA 2OQYA 1GVFA 3M16A 3IVSA 3GWQA 3B0VC 4F48A 1R9XA 3ZT5A 2WHJA 2QVNA 4Q8MA 1AW1A 1UH4A 3LQGA 1TMHA 3VC5A 2PA6A 3QV6A 3WL1A 1TIWA 3FA4A 3K4DA 4Z1AA 3N3MA 2VM8A 4AD1A 3ZT7A 1Q7QA 2VVNA 1FFQA 1XYZA 1IXPA 3UXIA 1EJTC 1V5XA 4RPPA 5SWUA 2DT2A 2TODA 4HZMA 4EX4A 4JFWA 5D03A 3LHTA 5CEWA 3CUJA 3H12A 3B06A 4WIWA 1IIGA 1TO3A 4S3KA 2GOUA 3PY2A 3PBGA 1B3VA 1EZ2A 2BGNE 2FZMA 4QE1A 4GIEA 3R7MA 5C9ZA 1I75A 4QR6A 5GNYA 1DJYA 3DC0A 5E93A 2GVLA 4M51A 4UTWA 3NXLA 1H1NA 1ZENA 3WQ5A 3QRHA 3K5XA 3BCJA 1F4AA 4AD2A 4RDYA 3U3HA 3W7NA 1MXGA 3GC2A 3WD2A 3LLXA 5C70A 4J2MA 2PWHA 3NOYA 1ITCA 4AYGA 3ANYA 1VBRA 1UH2A 4IOTA 4C1NB 5REQA 1W9VA 3W7QA 4DWSC 1HX0A 3M0MA 2WYSA 3HGJA 5I09A 1SUXA 4G1KA 3E74A 2E5DA 1XQLA 1AFSA 3CIVA 3IACA 2WSYA 3ARZA 3TH6A 2HS8A 4IIDA 1B4KA 3PWIA 2Y0FA 3DDMA 3B03A 4ENLA 2E9BA 2XGZA 1ME9A 3WDRA 4US5D 3WQPA 3HQNA 4FXJA 4HQVA 3ZJ6A 5J04A 4UZUA 4X9SA 4XK2A 3LRLA 3AISA 4PSPA 1XL9A 3DFTA 2GK1A 1ICQA 5BWFA 1CI1A 5TD4A 3T78A 2DEPA 4N7QA 2BHYA 3A3WA 4IGMA 2XZ7A 1S2TA 4U10A 3WFAA 4C6EA 1K8ZA 1OZMA 4YL2A 2E28A 3CMJA 4NAFB 3UGRA 3SN0A 4H01A 4CN1A 4CU8A 2NT0A 1DQWA 4Q7NA 2YR1A 4E8DA 2J66A 4DO5A 4PMOA 4B5NA 1C91A 2GUUA 3P80A 1HT6A 4C90A 5DMNA 4FNSA 1B4EA 1Z7AA 1GYNA 3KS6A 4AZ7A 3T9PA 4QAWA 1X1NA 2CXEA 3BGGA 1AH4A 3EX4A 4KCTA 1HJQA 3NPVA 4HYWA 4WKAA 1ISZA 4JFTA 4RUBA 4RNHA 1NF0A 1DV7A 2ZFAA 4GYPA 3KL0A 5CAHA 3TFXA 1B3YA 1Q7MA 1XIJA 4FF7A 3P3BA 3VNJA 5LIXX 1ALDA 1GOXA 1YDNA 3S6TA 2XVNA 3SY5A 2WZMA 3T09A 4BEUA 3QXBA 1K02A 3GVQA 5ECVA 1CGWA 3VMNA 3L67A 3N6JA 4UTIA 2E25A 3C2VA 3CIWA 1OEPA 6CGTA 2Y7FA 4H00A 1H62A 4NY2A 3LERA 1XGZA 2E5CA 4DLFA 4UR9A 2HE8A 2PDKA 3NVDA 4GA8A 3B9OA 2YDRA 1Q3NA 4CQCA 3KHJA 1HGYA 2PBOA 3A4WA 1FHUA 4JTFA 4AD5A 3LMZA 3LTYA 3B8SA 2C14A 4QLLA 4AMCA 3QQ0A 3MCOA 3F4WA 2PWVA 3SUTA 1KKOA 2FH8A 1TWDA 1AL7A 2AL1A 3P5ZA 2BGQA 2W62A 2X41A 3TNOA 1RQBA 3PUDA 1O68A 1H51A 3H2NA 1E0WA 2DZWA 3PSWA 1C93A 3PPGA 3UFYA 4MPQA 4H7ZA 1R46A 1LOLA 3W75A 2A1YA 3IAQA 4L6OA 3PVFA 4WX2A 1W5NA 3DGBA 3LI0A 3MTWA 2VC6A 2IS7A 2B7NA 1PWMA 3TN5A 4KBXA 1Q6OA 3V0SA 2TPSA 3UWWA 1L6YA 1S5NA 2OELA 5I3IA 2PAJA 3LEPA 4JYEA 4Y96A 3NO3A 1IWPA 2FLIA 4G9PA 4ZGYA 1DE6A 4KPLA 1J18A 4JIQA 3LPGA 2ZKMX 5CAKA 5FSDC 1JAKA 3Q37A 4OV4A 1EL3A 1BRLA 3C3NA 3PM6A 4OBTA 3SFWA 1W17A 2A7RA 2IPFA 2VQUA 1J0JA 2HZGA 1X98A 4AFYA 2XIQA 4D6IA 3NQ6A 4GX9A 2E1WA 5HNRA 1F76A 4E8CA 3QY7A 4TV5A 3ZWSA 4RV8A 3W23A 4GO9A 4N02A 3EKLA 1SQ7A 3H26A 5A8OA 1ZS2A 3LCFA 4LB3A 1OD8A 3W1XA 3VCNA 1PXGA 3MP4A 3L12A 4FX8A 3LPOA 1GOMA 4LAZA 4S3DA 3N2XA 3VE7A 4RCXA 2J74A 2A5HA 3DXIA 1OGGA 1G4PA 1V0KA 1IYXA 4PSRA 2NXGA 1GOQA 3P81A 5K9XA 3JR2A 5FIPA 3VNYA 2CLPA 3B8VA 3GDBA 3AOFA 1JYWA 4HNTA 3P5YA 4JQ1A 3AJXA 1XP3A 3ZXWA 2YL9A 5G4EA 3MUZ1 1ZAIA 1VGAA 3FEQA 3F4NA 2WVVA 4D1JA 4PBGA 2OX4A 2J79A 3CEUA 1B9ZA 3NQFA 1REQA 5I00A 2GJLA 1U1UA 2QUTA 3GKFA 3HMJG 1HP5A 1E6XM 5CSUA 4CCEA 3NL3A 4ZE4A 3AZSA 4S3CA 3W6LA 2CESA 3BLOA 1I60A 3R25A 4EPBC 3ABOA 4JNMA 2J24A 4NZFA 3APYA 4JHOA 3MY9A 3K8MA 3AJ7A 1UKOA 2VFHA 3NDOA 2CERA 3BG9A 3STGA 1W37A 5CJNA 1H1YA 5K7JA 2WSKA 2RKXA 1IGSA 5I3DA 1V7AA 1BPLB 4GLEA 4GACA 1IGWA 3UG5A 5F1UA 4UWMA 4D6EA 1K8YA 2VELA 3A4XA 2I9EA 4DJFA 1AVAA 1ZBKA 3ZMRA 3UJEA 2FKPA 3PPCA 3O07A 4ZTXA 1H7NA 3SCQA 2DIEA 4J3SA 5BU6A 4AYSA 2J78A 1YYAA 4LXFA 1FH9A 2B7PA 2ZZ1A 4AMAA 3I4EA 1GT8A 4Z1BA 2DVXA 1W1ZA 2CBJA 4O53A 2PTDA 4UNLA 1K8CA 2QDEA 1P6BA 1KCZA 2FZ9A 1HKWA 1KR0A 2OLSA 2QJMA 1GONA 4C6JA 3H4XA 3E2SA 3C61A 4H9MA 3VDCA 2ZX7A 1R7AA 3PZNA 3FYYA 1QBAA 4LS0A 1N7KA 2A7NA 1R9ZA 1MRQA 3ZSTA 4E5TA 5E9XA 3WDIA 3WLTA 1UHVA 4A3UA 4V27A 2YZ5A 2XYLA 3RR4A 2CHRA 4GI9A 1W0MA 4TVUA 3BV7A 2VQTA 2BZNA 1J8VA 2CCRA 2YFOA 1VLWA 4QHRA 3PUEA 3UCQA 4JY9A 5GPRA 5G4HC 2GDUA 4MGGA 2J27A 4XSLA 3OGSA 1QOPA 1DJIA 2Z7GA 2O9PA 2J7DA 4HHLA 2WCSA 2DSZA 2D0HA 4DF2A 4XAZA 1I0BA 3B3DA 3BAJA 1ODZA 3HV9A 1WAUA 4GVFA 5LHFA 1C29A 4L65A 3SZ8A 3RDKA 1CX9A 3V75A 4EAYA 3CV6A 3BMWA 1JZ7A 4MMWA 5LIUX 1EJRC 4BJHA 4ORMA 1MNZA 1OZQA 3PWAA 2XGIA 2QJGA 1A3XA 3EMZA 1DL3A 1DYSA 1J79A 4S2CA 5MF5A 1TVPA 5CJ5A 3WD1A 3S6OA 2ANUA 1GGOA 4CUCA 3HG4A 4AC7C 2GWGA 1SFSA 3JS3A 1DIOA 2J6XA 1N2VA 3AU2A 4CQ8A 1EQPA 2WQPA 3B8TA 3DHDA 3PZIA 3PN8A 1RY0A 1D3HA 2DGAA 1WV2A 2VDHA 3BG5A 3LTSA 4D71A 5F7UA 7TAAA 1Y5XA 4PFHA 2Z25A 3RX3A 2VI0A 3O0KA 4XKYB 3IJ8A 4ECLA 5C7VA 3I6EA 1EOMA 1UCWA 2DFAA 5M17A 4AIEA 1VCVA 2BFGA 1TWSA 3PZVA 2KZHA 1G69A 1UC4A 3AXMA 2ON3A 3DG3A 4QJ5B 3BK0A 4HZ6A 1T41A 3ZVIA 4RW5A 1TMQA 4ALDA 1D3GA 2OJPA 2DUAA 2CKRA 3ONCA 4O17A 4WDUA 4LUTA 1MXSA 2GZXA 4UTLA 5DELA 3DENA 1VD6A 3L4WA 3QH2A 4NSBA 3CYVA 2NQZA 4BWLC 1SJAA 1C9DA 5BOOA 4S3GA 3WNNA 3QFEA 2F6UA 5DRCA 1NTHA 3HG2A 1PX3A 4JNZA 4R88A 4GG9A 3W7HA 4QG8A 2ESCA 4NASA 4AD0A 1B9BA 3BH4A 2NUXA 1Q6QA 1VFOA 2HBXA 3GFZA 4HMNA 4NAFA 1LT8A 3OIXA 4AXNA 2DSVA 3WBWA 5KZEA 2VC5A 1FP9A 2BLEA 3EOEA 1SSGA 2V67A 2BBFA 4IQEA 2ISFA 2X2GA 4EIVA 1BLIA 4BQ3A 3URQA 3GS6A 4BS0A 4PZVA 4W85A 3PTQA 1W1IE 2EG7A 3BE7A 1FFRA 2OVLA 3UWUA 1UWAA 1GKPA 3L7RA 4L4LA 1DHKA 3SGUA 3TSDA 4M80A 1TWZA 5DO8A 4NJKA 3WH7A 1M7JA 2YXXA 2UWFA 3KBMA 3A21A 3UJFA 2OFJA 1WB0A 5I3FA 3G5EA 1TR9A 1W8SA 1UP3A 1DP0A 3PFMA 4HYRA 1J9YA 1VYSX 1UUMA 2O4MA 3STPA 2FB3A 2ASHA 2MUCA 1KFEA 3T7VA 2GSHA 3W2NA 4N6FA 3HZ3A 1U83A 2A4AA 2X0HA 2O7SA 3T2QA 5K3VA 4W8AA 5IHSA 2X40A 1UP0A 5IBXC 1BKHA 3EX2A 3GXFA 5AN7A 4AIUA 4PR4A 1KFCA 3VDGA 1IV8A 1XHGA 4PMXA 3MZNA 4L1XA 3IIOA 4YWSA 1PIIA 4IPJA 8A3HA 1GWJA 2PP3A 1FXPA 4EE9A 4WZHA 5ABTA 3BMVA 3E2QA 2CXGA 6XIAA 4MYXA 3UT0A 1JCYA 3UW6A 4B16A 5A6SA 3GG7A 4FLRA 1CDGA 3WL0A 4NKCA 4LF1A 4D2JA 1WDSA 5CPTA 4OT7A 2H9AA 2JEQA 4OVXA 3QKZA 3TW7A 2QPXA 3AWOA 1E71M 4AG0A 2UZ9A 3VMOA 3W25A 2GDQA 1KM6A 2IXVA 5LA1A 1F9CA 1M7PA 3VU2A 1J2BA 3TC6A 5C71A 1GKRA 3TTOA 4JKKA 1QI5A 3SDOA 4EK7A 2HISA 2Z26A 3THDA 5EMJA 1TE1A 4GXWA 1F8IA 4JTUA 4JEQA 2DZBA 4KWOA 1WNOA 3P93A 4MWAB 3O3RA 1GEHA 5I5RA 4XQ6A 4GWEA 2ZICA 4WKHA 2QJJA 1JQXA 3WUFA 1H41A 4AAJA 3V18A 3UPMA 1QBBA 4NRSA 1GTEA 1HVQA 1RUSA 1DWHM 3CZ8A 3AZTA 2FZNA 3APGA 2I16A 3N6QA 5CGQA 4K1WA 3WLQA 1EJWC 4HSOA 2QV4A 3PR2A 4JR5A 4Q8VA 3W81A 3ABRA 3DFOA 2Y5JA 1NDWA 3EBVA 5BZAA 1UIOA 1UR4A 4GCAA 3KOYA 4Q33A 4DXKA 3G1HA 5FL0A 2IXUA 4B9ZA 2OYKA 1Z69A 2C7FA 5GVJA 3SCOA 3H2FA 4FNPA 5FA5A 3EPMA 4NZCA 4O52A 4CNTA 4PUDA 2OODA 3SJ3A 3N9SA 4AWUA 4AVNA 3I68A 4C6QA 5HWNA 5F1VA 4KIRA 4H6QA 4JEJA 2EO7A 2J13A 4JTIA 1KQZA 1NVMA 4PC8A 1ZUAX 1TVLA 3R2GA 2RH9A 3EWCA 2PDNA 3A22A 1P48A 1YKWA 4NXSA 2QIIA 3KDNA 4HOWA 4AQLA 5DX7A 2E67A 2R14A 3UU0A 3B9EA 3GTXA 1GYLA 3IK2A 1F3WA 3BAIA 1S2WA 2A3AA 1YW1A 3OBKA 3CQHA 4IL2A 4QIUA 1ZCOA 3LPFA 3SIZA 4GZIA 1PCWA 3W1PA 1VBJA 1CB7B 4TUFA 4JDBA 4PMJA 2CIPA 2C6QA 3C3UA 4ZZ9A 1QPQA 4FXSA 3KWXA 4KFPA 2J77A 1IEVA 1RALA 4QM1A 3DHFA 1T8XA 4DZIA 3RO8A 3KFTA 5CSYA 2O4QA 1ZJAA 1ZBCA 1QPKA 2HXUA 3R5EA 7REQA 3C0QA 1B3WA 9CGTA 3VD7A 1WBJA 3E1F1 2OKOA 2VX4A 3AIVA 1HIZA 3VOGA 1OFOA 3DHPA 1C90A 3BW4A 1MW2A 3A13A 3V4BA 4MJZA 4BCEA 1YDOA 4MM1A 2PGRA 4RZ5A 2GVGA 3IV8A 1UR0A 1MFVA 2AKMA 3S2JA 1P0BA 3OA3A 1L6WA 3W85A 4ML9A 4U2ZA 1V6YA 3TC7A 3WMBA 2VR4A 4PMUA 2AOSA 1OVDA 3L9CA 1B54A 3G6LA 3WLRA 4AZBA 3FY1A 4H9YA 3QOMA 3OLGA 1ZJBA 3URAA 2OZ0A 3CHDA 1K6AA 2INFA 2IPWA 2PU1A 4M7SA 4RKAA 2E5BA 4GZJA 2OQLA 1XLKA 1Z8AA 1M1BA 5IM51 1LLOA 2CEQA 1UOKA 1Y7VA 3UA3A 2Y63A 4TV6A 1H50A 1JYNA 2XWEA 4IIGA 4FB7A 3LDVA 4BQ2A 3HQOA 3C52A 3CPGA 3NFUA 3SUSA 4MAVA 3AYTA 7CGTA 4M0XA 4J1OA 3QEZA 2RFGA 3PBYA 1CIUA 5A2BA 2E6AA 3AS1A 4FR6A 4IG2B 1BYCA 4PMRA 4P8WA 1RJPA 3B9NA 3W02A 1GYMA 5EL1A 3ITYA 4L9YA 2WC4A 2WNNA 3FGCA 1ZPTA 1K03A 2V69A 3OPSA 3WQWA 5HQEA 2IKHA 1HJWA 3VKKA 3ZJ7A 3U6WA 1EGMA 4IQJA 3UZWA 3RRXA 3V36A 1XH2A 3AIRA 1T99A 2GWNA 5K4ZA 1SJBA 3ARPA 3GDKA 3TQ0A 3FVMA 3LZ5A 3OA5A 3BOXA 5CZTA 1IR1A 2QUVA 3EDEA 3W07A 1VB9A 4S3BA 1BHGA 3UEQA 3PBUA 5HPOA 4HKPA 3GIQA 3VGEA 1HW6A 3FSUA 3M6YA 4LAOA 3VIIA 3LI1A 3OHMB 2E6DA 3NQMA 1MZHA 4MUPA 5HWMA 2WHKA 6PTDA 4TQTA 2BG5A 4K7VA 3V0TA 4ZO6A 2XFRA 1UMLA 1JYVA 1YPIA 4AX6A 1C7TA 3H7VA 2HVMA 2IKGA 4N2YA 4GK8A 4GCXA 2SFPA 2FGLA 1VIWA 2QCDB 4A29A 5MHBA 4H2HA 2HMCA 4HU8A 4IIEA 4RJEA 1F07A 4CCDA 3THQA 5AYYA 3B9DA 5LHEA 3LK6A 5CG7A 1CENA 3E0FA 1CZ1A 2FGBA 2JKPA 3W6MA 2WLYA 1XINA 3C86A 1ME7A 3AI0A 5HXMA 1UOZA 3LHYA 3F1QA 3WD3A 3N19B 1J6OA 3THUA 3GUWA 3TOPA 1UA7A 4M24A 2V0TA 1G9HA 3N12A 4WJ8A 2Z2UA 1DWFM 2OO0A 4W89A 4LYQA 3UJSA 1ISXA 3FHQA 4OOZA 1W32A 3VINA 5CPLA 5TAOA 1N8IA 2PCQA 1IR2A 4AF0B 3DECA 4G1NA 3R8RA 3M4HA 2P76A 1GG0A 1XYBA 4R9OA 3KVMA 3TYDA 4V15A 4LOCA 3UZ5A 3USZA 2ICSA 3MUAA 4LY4A 2WLZA 4UCFA 3RAOA 1B3ZA 1NDYA 3FYOA 4PUKA 1T8QA 3S0CA 3VOHA 3OTRA 3UBPC 1WZAA 1ZB5A 2JKAA 4GMEA 1QATA 3STCA 4FLSA 8CGTA 4TR9A 3TYUA 4XAYA 3AHXA 2PS2A 3MP3A 1ZP4A 3H24A 3N2TA 5DXYA 1J0YA 4PUWA 1XDLA 1O94A 3GDTA 2Y85A 4E4FA 2D2OA 8XIAA 1Q13A 4GKTA 4AC1X 4DO4A 1LLZA 4ONVA 3ABXA 5G1YA 4OOUA 4UOZA 1AW2A 1JDDA 1KFKA 1FDYA 2PDMA 5EY5A 4CNUA 2Q8XA 3W71A 1O5RA 3TYCA 4O50A 3WQOA 1V79A 1WE5A 1OWQA 2BNJA 3GZAA 4UFHA 4RX0A 1SW7A 1BXBA 4YWIA 1TRIA 1SJCA 1PIFA 1V3MA 1XIBA 1WCGA 3K8KA 3QZEA 2VFGA 3EWYA 1KBLA 3N2MA 3QGVA 3W7EA 1ZU8A 4GNJA 4R9XA 4DAIA 5FCZA 2XHYA 4NF7A 3AMDA 1M04A 4OECA 3NO1A 3Q94A 4UBPC 3P0XA 3TONA 4F0LA 5C0QA 5HMEA 1Q2SA 1Q45A 3PTDA 1EHNA 2VL4A 4O0KA 2VC9A 1PDYA 2B4GA 3BOLA 4XZMX 1XG4A 2R1KA 1KFLA 3HF3A 3IJ7A 3W1RA 1B5TA 4EANA 1KM5A 3W53A 5B7ZA 2WPBA 2EKGA 1R87A 4IMGA 1WBHA 1RHCA 3N4AA 3OO2A 3CQ0A 3QPEA 3N1AA 1SVDA 4M6UA 3UWYA 1AJZA 3GVRA 4CD4A 5DMLA 3FJLA 3MA8A 1YX1A 1KM3A 3A6OA 5A95A 3BLIA 3MUXA 5ENLA 3MI2A 2XPKA 1KRBC 4L4OA 1EBHA 1KXQA 1PX4A 3R43A 1MQPA 2XN1A 3TSMA 3QR0A 4N42A 3SW6A 3W86A 3CGTA 4HU3A 3RLUA 1R3YA 3AXIA 1P4CA 1FWWA 2VRQA 4O28A 1QNSA 3ABQA 4RNJA 3P67A 3GH7A 1HN1A 2EPKX 4L6HA 3AHVA 3OBEA 3WH8A 3C2YA 3UCCA 3UZZA 2Z1VA 1ICSA 4O1BA 1TPB1 2E77A 3G1AA 1GJPA 4FA3A 5DMYA 2NWSA 3BZGA 3GD6A 2PSNA 2QF8A 1K9DA 4UTWC 1DIDA 3E49A 3QR3A 4HPJA 3EEGA 1KFJA 1YHTA 3MP5A 4RLIA 1I2NA 4MWAC 2INZA 3GU2A 3VABA 3UVIA 4O15A 4JTKA 3O8AA 2YLLA 2PDXA 1TV7A 2HK1A 2G8ZA 2O92A 3GY1A 3T0CA 3QY8A 4JIIX 4ZE5A 5M03A 4AHQA 1RY8A 3P6LA 9XIAA 3PHAA 5CG0A 4DWSA 4ZQRA 3WLOA 1W56A 2J47A 3KCLA 4AISA 2QKFA 3GDRA 5AHFA 1QI4A 4ZBCA 3TJ4A 2YW3A 4I6KA 2XVPA 1GQKA 3DBNA 3ZIZA 5K9DA 1GQLA 4JQ2A 2OGYA 4JQ3A 5KETA 2QCFA 4C6PA 1DE5A 1DJZA 2W4XA 6REQB 2GGJA 3G6MA 1UD2A 1RVKA 2WMFA 3M0HA 2E7FA 2Y7DA 4XKYA 3HA1A 1RVGA 2NQHA 3TAKA 3U2EA 3MJMA 3CHFA 2OXNA 5CSSA 2DT0A 2WSRA 2PMQA 1GTHA 2Z27A 2X30A 1FP8A 2ZIDA 1Z32X 3VIMA 1HKKA 1Q4NX 2R82A 4NI8A 2F84A 3TJXA 2VWSA 2EBNA 2EPHA 4CD6A 1O12A 2VEFA 4JTSA 5IFPA 1Z42A 4MJ4A 1TZ9A 5FSEC 5K2ZA 3CJPA 1GW1A 1ADOA 3SCSA 2Y62A 2JFEX 3W01A 2ZVRA 3BWWA 4L6DA 3Q67A 1C3FA 1LWJA 2Y88A 4BI7A 3WLHA 6TIMA 1PKNA 1CLXA 4IIBA 4JTCA 5A6AA 5JH1A 3RXZA 2BXYA 1L2QA 1AQHA 3EX6A 1UD5A 4L4PA 2J9XA 1KO0A 1BGAA 1P1MA 1TG7A 2AMGA 1MNSA 3M6DA 1P0DA 1RAKA 1V93A 4Q3MA 4N4PA 1JD9A 3DH7A 3H23A 1W3IA 1M03A 1QK0A 3LGGA 1WYIA 2X05A 2EPMX 3KLKA 4EXBA 3CL7A 3VKJA 2CWXA 4ICMA 2G3IA 2ZC1A 2WCGA 3MMTA 1OT2A 1JZ5A 4HB7A 3WNOA 1S39A 1W3NA 4YCPA 3HGOA 2CFFA 4LBRA 1UWSA 2X1SA 5DANA 2DT3A 1XRVA 3VYLA 3VNKA 4IPPA 4LJ3A 2PDCA 3AXKA 1NFBA 3ZJKA 2J7FA 2A0NA 2DPEA 5JUVA 3RM4A 4HBKA 3UXKA 3V5CA 1PB0A 1UUQA 1BG9A 3GLCA 1RJQA 5E0FA 1NDVA 1RBLA 2BHZA 4EWND 3UCDA 2ISVA 5BXTA 2VZUA 1K9EA 4PCFA 5BRBA 4JKLA 5T91A 4YPJA 5IXEA 2DH2A 1SO6A 3TTEA 4NJJA 2ZZ2A 4D6FA 2QLYA 3UETA 3MVTA 4M1RA 4EPEC 4KFOA 1TB3A 4E3TA 3RITA 3D6NA 3LNMA 1QO5A 3RJXA 3L4XA 1XW8A 2E9LA 4TTGA 5I07A 3GXPA 2J9ZA 2YL8A 3MMDA 5XIMA 1ZBWA 1T0OA 1C92A 2QCCA 3QTGA 1XG3A 2AGTA 4KEZA 4H4IA 2PWEA 3ERPA 1H3GA 2P50A 2ZRWA 3CTLA 1ZNNA 2BV9A 1RPKA 2BY2A 2G5WA 2BXVA 4H83A 4DWSB 1HZYA 2QDGA 3A9BA 4JX4A 3WY1A 4HYVA 2BVTA 2NQ5A 2ZZ5A 2PTZA 2XUCA 4JPGA 5LIKX 4QAIA 5I06A 4QDPA 3BCFA 3ITLA 1VH7A 1PAMA 2D3NA 1KLYA 2ZUVA 3WQ6A 1JQVA 4K2SA 3M7SA 3GHSA 3S5ZA 4L9ZA 4QXIA 1LBMA 5DF0A 3P14A 3BGAA 3TLLA 3OB8A 1IWBA 1JI1A 3TA9A 1RSCA 5ABEA 1ME8A 3WLIA 1VFTA 3TTQA 3CV7A 5FF3A 4R7WA 4PEKA 4KF1A 2BY1A 3S1WA 2O0TA 1R2TA 1WDPA 3M47A 4O13A 5H8MA 2NSOA 3NPWA 4Q32A 1NY1A 3I3BA 1MDLA 5A5WA 3MQTA 4UNIA 5CPMA 4O57A 2EPNA 1S1RA 2HE5A 4GQ0A 4HTYA 2WC7A 4OWGA 4NYYA 1TTIA 2KX9A 4RE0A 3WLNA 3RLGA 2EEXA 2OG9A 3NIYA 4JNYA 1XCFA 1RV8A 2QCDA 1EYWA 4H6KA 3CZKA 4GY0A 1OFAA 3WF2A 2FH6A 4XZBA 3AIEA 3T42A 1GK8A 1A53A 2HQAA 4OKDA 4B91A 2ZRVA 1X1OA 2A3HA 2YW4A 3G8EA 2W92A 3I6TA 4DF1A 5BRQA 4H2CA 1F3TA 3RF9A 4DJED 5JIWA 2YB4A 3K1GA 1DXIA 3PTKA 1GPFA 1XIHA 1YDVA 3NZRA 2VFIA 3MSRA 2H90A 1V3KA 4DXVA 4F2UA 3BAKA 3WUGA 3KAOA 2A85A 4GRSA 2VCAA 3PNZA 2GOKA 4BI5A 5ABGA 1OX4B 3OG2A 2FHBA 1WKDA 1FY6A 4BA0A 2D3LA 1QNRA 3CAVA 4MKNA 4EKJA 1JDAA 5LXEA 1XH1A 1MYRA 2X8RA 4IX0A 4HP5A 4XIMA 2QW5A 1EYEA 3O6YX 4IJRA 1MXDA 4DEFA 2PPGA 3HIJA 1DQXA 4I5UA 4DIAA 5A2AA 2JGYA 3CH0A 1NSJA 1VBUA 2ZZ7A 3LTPA 2Q6ZA 1EEPA 4DRSA 2D0GA 1K6WA 1SMAA 3GNPA 3XINA 4GKLA 1BVNP 2V5LA 3WQDA 2YFNA 3GHUA 1FWRA 2GJNA 4GH1A 4ZCWA 2DZSA 1OSEA 1WUFA 1GOKA 2AL2B 1YNPA 1KKRA 4CN6A 4W5ZA 2GVEA 1PV8A 4DJFD 1EJVC 1R2RA 2QUNA 2X1UA 1LLWA 1QRQA 1A5NC 2PLMA 3CL8A 3WBEA 5G2HA 4KEUA 4A21A 4GIRA 2AL2A 4HOZA 1WOBA 2Y70A 1RBAA 3OIHA 5I3HA 3ZLGA 4U33A 3UR7A 4HN4A 4E2OA 4UXDA 4PYSA 3SUVA 3VIPA 2POZA 3SY1A 5AFDA 1IWAA 5AC4A 5EU9A 1ZHAA 3EWDA 1PHQA 4MWAE 4NP7A 5B80A 1R38A 1KM1A 4M8UA 2XH7A 2Y7GA 3IANA 3GKAA 5BMXA 2YYTA 4N0RA 1TFVA 2OWWA 3BANA 3I7RA 4LYRA 3GXTA 2XIOA 3SO7A 4US5A 2V8ZA 2D24A 1JDEA 1HJSA 1PE1A 3L0GA 4ICNA 3NZPA 1KR1A 1S1PA 1UBPC 4H6RA 3N14A 4QLJA 1FH7A 1XIIA 3L5LA 1J6PA 2JQXA 4R3UA 3REQB 1E56A 1EA0A 4J3VA 2BTMA 2ISWA 3W7JA 3NVTA 1DXEA 1TWIA 1ICPA 1GVEA 4H19A 1FWEC 3AXHA 3AMCA 3H70A 3GTIA 5IRPA 4PE8A 4YTUA 2FTWA 4AX7A 2QR6A 3ONBA 4IXHA 2QVHA 3WLKX 1JI2A 1J5SA 2OSYA 3HB9A 3LX9A 2W61A 1U5HA 1MW1A 4U5KA 2R6OA 4HSNA 3KTSA 4IG2A 4RE2A 1KBJA 1VRDA 1MUMA 2OB3A 4GYJA 1WZLA 4L5ZA 4GINA 3GFXA 4EPKA 1M65A 1TX2A 2DIJA 3VA8A 2PURA 1KGUA 1L8PA 1E51A 3BURA 1L0PA 2IPJA 1IZKA 1I1XA 3H6OA 4DJFC 3NXFA 1TELA 3WK0A 1RCQA 2RJHA 1IEXA 1M9HA 1R3QA 4D72A 3OODA 2QJNA 3R58A 1QAPA 1XRFA 3S9IA 4LEQA 5FF2A 4B9YA 1QO2A 2UBPC 3TR2A 3OJGA 1A47A 3CT7A 1KD0A 1RCXB 2FVMA 3HO8A 4W86A 4Y9MA 4KWVA 4WY0F 4YHEA 3ARXA 2ZRYA 1OC7A 4QEHA 4MLJA 1XQKA 1QT1A 2CZDA 1XGEA 2HDJA 4JS3A 4K68A 3LHWA 1JPDX 1BSIA 1G0CA 3V5OA 3W2KA 1E0XA 1XBXA 1F6PA 1JDCA 4F2TA 1D8CA 3COTA 5I0DA 1O4UA 4MYAA 2NUWA 3EWUA 2E09A 3L0KA 4LYKA 2ZWZA 2PRHA 4MFEA 3E5PA 3E6EA 9XIMA 4UQDA 3GYEA 4XD6A 5KMYA 2WMJA 3V3WA 3BAYA 3URNA 3LNPA 4YYCA 1E55A 2NSXA 4C6LA 2QJIA 3GBDA 4XTDA 1Q2RA 1FH8A 5KTLA 1QW9A 2X7WA 3SAZA 2FPTA 1M7XA 5D9NA 4Z17A 3NYZA 4GC3A 4XIAA 3W7IA 3TWBA 1JJKA 3HU7A 4O18A 1X6UA 3DFSA 5TNVA 4QFUA 1TUFA 1EP2A 2HSAA 2ZZ6A 3LM3A 2QYGA 1VFUA 4ORIA 1VIZA 1A80A 2CLFA 1TCDA 3IGHX 3LLFA 4YVXA 5D8WA 4JIRA 4Q4QA 2WC3A 1I9CB 1KB3A 2F6KA 1UZHA 1XLDA 3RR1A 1SU5A 4P7QA 1XLBA 1LOQA 2VGGA 1X7IA 1XPGA 1GKQA 4A8RA 3FSTA 1KBIA 5BMWA 1PX8A 3ARSA 2C19A 3ES7A 3PZQA 4P5UA 1OFDA 2UY3A 2PP1A 4UNKA 5AYZA 4UZSA 4UTHA 2WNZA 2OEKA 1BYAA 1PKLA 1F7BA 2J9YA 1KWGA 4JTDA 4LF2A 3GNNA 1YXCA 3O1NA 2DZVA 3THAA 2CZVA 1IT0A 2W27A 4J9JA 5CZKA 3DAQA 1H7RA 1BWKA 4BR1A 2J7EA 1R85A 1XC6A 4DY1A 1QTWA 1GOIA 1KM4A 3VC6A 4FOUA 1G7UA 4OHQA 1EUAA 1FWIC 3C8NA 4F9JA 1OGBA 4RK8A 4GIAA 2X1TA 1B3XA 4I90A 1E6SM 1H7OA 4C6IA 3OVGA 3MDWA 4W93A 3JW7A 4M6VA 4ERAA 4ZQNA 3WNKA 2P1FA 3MSYA 4IICA 3CPRA 1MI3A 2PD9A 3R8GA 4IMFA 1JCXA 2UY2A 5FJRA 3AUJA 1GQJA 2CNCA 3GUGA 1OYAA 1X97A 2IUZA 2QAFA 5D9MA 2CBUA 2Z4GA 5LNWA 5DBTA 4C60A 4NILA 3AMLA 4NQ1A 3EWXA 5G1MA 1Z9AA 1W31A 4GC4A 3F2CA 4MWAA 2C0AA 4H8UA 4CQDA 4XSMA 4GJIA 5KZDA 2OSXA 3R11A 3KRZA 4TOQA 4IZGA 1Y5VA 1WDDA 1W9XA 2HNEA 4IPLA 5FF7A 5G5IA 4XKMA 1XFBA 4LVDA 5JBFA 2OYLA 5A69A 1WP6A 3UYCA 2PTYA 1M53A 1HKMA 2F8QA 3N3TA 4JQ4A 4MB3A 5DEZA 3S5OA 4KRTA 2H6RA 3C0LA 4MAZA 2P3ZA 3ITCA 4FAMA 4N9CA 1QNOA 1KA9F 4PB5A 3UR5A 1W3HA 4LNYA 3WBYA 3VKAA 3EXSA 5A6BD 1J0ZA 3CHVA 4V1XA 2HRWA 2DJLA 4FI4A 4D1IA 1POJA 1TKKA 4J3WA 1AH3A 4ACZB 4QG9A 3UA4A 2Y8KA 2V3DA 2ZADA 5CBBA 2MANA 3PUGA 3W26A 5HOSA 4PCSA 5DMMA 1NDZA 2Y89A 2HPMA 2AGKA 1FWFC 2VENA 2VDGA 5AECA 2O55A 3RJYA 4GISA 2CBIA 1VENA 4FIRA 1O7AA 4QBXA 3UZYA 5CGMA 2XDFA 3A3XA 2P10A 3GNDA 1XX1A 3TDFA 3RMJA 1QI3A 3WZ0E 2NZLA 4GE8A 1US2A 4O4WA 2BXZA