1TE1B

Crystal structure of family 11 xylanase in complex with inhibitor (xip-i)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
190
structure length
190
Chain Sequence
QSITTSQTGTNNGYYYSFWTNGGGEVTYTNGDNGEYSVTWVDCGDFTSGKGWNPANAQTVTYSGEFNPSGNAYLAVYGWTTDPLVEYYILESYGTYNPSSGLTSLGQVTSDGGTYDIYSTQRVNQPSIEGTSTFNQYWSVRTEKRVGGTVTTANHFAAWKALGLEMGTYNYMIVSTEGYESSGSSTITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dual Nature of the Wheat Xylanase Protein Inhibitor XIP-I: STRUCTURAL BASIS FOR THE INHIBITION OF FAMILY 10 AND FAMILY 11 XYLANASES.
pubmed doi rcsb
source organism Penicillium funiculosum
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords xylanase inhibitor protein I
total genus 45
structure length 190
sequence length 190
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1te1B00
1QH7A 1H4HA 4S2DA 3VHPA 1UU4A 1KS5A 3WP4A 3VL8A 2NLRA 4XPVA 3VHOA 1UU5A 3LB9A 3VGIA 1REDA 5K9YA 3MFAA 3RI9A 1IGOA 3VZLA 5HXVA 3VZKA 2JEMA 4S2FA 1H8VA 4HK9A 3AKPA 2B46X 1XNCA 3WP3A 1HIXA 1H1AA 2BWAA 3VLBB 3VZNA 2QZ2A 1UKRA 1C5HA 3WXPA 4HKWA 3WR0A 2BVVA 3AMMA 1F5JA 1OLQA 1XYNA 2F6BA 1H0BA 2DCJA 4XQDA 1QH6A 1YNAA 3AKRA 2DFBA 2D98A 3MFCA 1REFA 2JICA 1BVVA 2C1FA 3VHNA 3AMQA 4HKOA 1H4GA 1C5IA 1XNKA 3WQ0A 2VUJA 4XQWA 3WP6A 1HV0A 1PVXA 2NQYA 3B5LB 2JENA 1ENXA 1XYPA 4HK8A 3WP5A 1REEA 1TE1B 2VULA 3VZOA 3VL9A 3VZJA 1OA3A 2BW8A 2VG9A 2DCKA 1XNDA 3WX5A 2D97A 2VGDA 3O7OA 1W2UA 4HKLA 4H7MA 3HD8B 3AKTA 2QZ3A 1XYOA 5EJ3A 1T6GC 3WT3A 1OA2A 3M4FA 4NPRA 3AKQA 2B45X 1OLRA 1BCXA 2DCZA 3AMHA 3EXUA 1KS4A 3ZSEA 1OA4A 1M4WA 1BK1A 1HV1A 3B7MA 3AKSA 1XXNA 3MF6A 3WQ7A 5K7PA 3WY6A 4IXLA 4XQ4A 3AMNA 2DFCA 3VZMA 3AMPA 2B42B 3WQ1A 1XNBA 2Z79A 2BWCA 1UU6A 1NLRA 3MF9A 4S2GA 3RI8A 4S2HA 1AXKA 3LGRA 2DCYA
chains in the Genus database with same CATH superfamily
5FPXA 4N7UA 2RM21 5F32A 1H4HA 3WNKA 3ZSMA 3CDZB 4HN0A 3KCCA 1VIWB 4PIZA 5ACA1 2RS53 2Z2SB 3SH5A 1Y7BA 1NT0A 2QE3A 5CEHA 1QNWA 5IAXA 1S1AA 4R9CA 2CY6A 1UIJA 5DAXA 5FBJA 2K46A 4BE3A 1W99A 2DBNA 3H3UA 1FPN3 3I8TA 1IKQA 3IMMA 2XJQA 2VNRA 4XFAA 5G04L 1XQNA 1YFUA 2HEVF 4Y5SA 5A7PA 1YCIA 2C24A 3OB8A 5T50A 5A6ZA 2DUOA 2WA3A 3VZLA 3J26N 1H8VA 5FYIA 3T2OA 2WZ8A 3LEIA 3W5MA 5BYNA 4LIUA 4OQ8A 1OUXA 5LA9A 1BLZA 1IG0A 3PJYA 2QZ2A 3OG2A 1VALA 4ONUA 3JD72 1S0GA 5FYZA 3WOGA 3ON7A 3PURA 5KXCA 1BBT1 3BOPA 1KJRA 2HWF3 3AP6A 2EIBA 4YFZA 2AH2A 1UL9A 1S2EA 1V00A 1V9U3 1HN1A 3U37A 5F37A 1DYOA 2XHNA 3LIGA 4Q4Y1 3MLKA 4FFGA 4PCRA 2VPVA 1H6YA 2BPA2 2XUEA 4XJUA 3RZJA 2ZOEB 2WO7A 2LW8A 1U5ZA 3NKTA 1HXS1 5JPNB 4N90A 2HBTA 3VV1A 4MXWA 4DRRA 5FOBB 5GLZA 3VDDC 2WFF3 5JMOA 5FO8B 5KHKA 4U36A 4XIOA 3C3VA 3LF7A 2GH8A 1HRV3 2R063 5LA0A 4XJWA 4LBKA 1TZOA 4LO5B 2V09A 2QQMA 1IZ3A 1GZCA 3DECA 5DAVA 1RUNA 2CGNA 3OYWB 5FMBA 4CCCA 3LEGA 2IXHA 1PM7A 3K4ZA 5SV5A 4BDVB 2C4XA 2QFEA 1VBB2 4JV4A 3O5SA 2H0BA 3ROUA 3O7OA 3LEMA 5JZGA 3RZMA 2H6BA 3HD8B 4XETA 3KB5A 5DAWA 5A6QA 1DGWX 2VH9A 4LE4A 4Z2WA 1FX5A 2NM1A 2ZTNA 2WO1A 1F5FA 2QQNA 3HEIA 4FXGB 4IEZA 3ZX7A 3ACLA 1JYIA 1VBB1 1VBE2 3LA7A 4LOTA 4JGYC 5A6YA 2DCZA 1MEC3 3EXUA 3I59A 1RUJ1 4LITA 5JXGA 5FYYA 4XTPA 1AYN3 3G7DA 4LHKA 3N9LA 2ZX3A 1EV11 2ARCA 3OBZA 1RUH1 4QPIB 4GMP0 4NOTA 4YVSB 2VXJA 4W6YA 1ZBE3 5CFDA 1XSRA 2W1WA 2WT1A 3AZZA 3IAQA 2GN3A 3UNPA 4AFDA 3J7NA 1TMF1 1W39A 3ZFEC 1RUJ2 4P9LA 3ZXEA 2WINB 4I0BA 1F9KA 1WMXA 2AEZA 2GC0A 4NVPA 4O9EA 1F4HA 5E16A 3ZKUA 5BNPA 4CP0A 4GXLA 4WZFA 1UU6A 1DGRN 3NAPB 4XDOA 5L19A 4JGZB 2WQ8A 3I2OA 3IZOA 3T1MA 1AXKA 2BGOA 1ZRRA 5IWFA 1NXMA 4CCNA 3WF4A 5LEJA 2VUDA 1PNFA 1QH7A 2R49A 3B01A 3POIA 4YZ2A 4NIDA 1JTZX 2BP6A 3NWKA 1UU4A 1KS5A 4JTNA 2HBUA 2R0HA 5FK8A 3RDIA 4FOWA 4AQTA 2OUJA 2E6VA 1GNHA 1B35C 1ULEA 1UY3A 2VNOA 4QB2A 5LY2A 5A80A 2JKBA 1OI6A 3BGAA 3JQWA 1D4M2 4K8FA 3N7LA 1Q43A 4M00A 5K9YA 1AL0G 4GZ9A 3RI9A 4S2FA 2VCAA 1BJQA 4UT5A 3BCWA 5IAVA 4AVVA 3M7AA 1C8M3 1G86A 2ZEWA 4QM9A 2JIJA 3QOPA 3NNLA 3CIHA 5CISA 3PDQA 1CD3G 3FBMA 3KVAA 3OGGA 1POV3 4DUXA 3EBRA 4FCAA 2ADDA 4N43B 2IFWA 3IKWA 5H9QA 2YGMA 3H8UA 4YSFA 4R52A 1QJFA 5H9PA 1NZIA 5DUVA 4GWNA 4NHLA 4FPEA 1HQLA 4LO7A 2Y6LA 3FLRA 4GJZA 3I3BA 3USSA 3GXUA 1CIWA 5ANNA 1GQPA 2C26A 2VW0A 1DLLA 3FLTA 4MHRA 5D8AA 2VAUA 3LDBA 1MZEA 3H0OA 2CAUA 4JQTA 4QHBA 1KEXA 5IVVA 4FQZA 4R8HA 1NLSA 4DFSA 2C5DA 4J25A 4OCTA 2GH2A 2QQVA 3O1VA 2IXIA 3T1LA 4ZPIA 3WUDA 4EWAA 5BUVA 5F1RA 5F3CA 4CYDA 3L9JT 1GP5A 2VBDA 3U4SA 1HDKA 5DQ0A 4WVWA 5J1XA 1W6QB 2P5BA 3HR9A 3LA2A 2OPKA 2VVEA 4QKFA 1JZ6A 5AC92 4B8EA 3ZSKA 4Q5OA 2ZEYA 3A22A 3NQHA 5C3OA 2QVSB 1H30A 3GYDA 1YQ8A 2ZX0A 4ZXKA 5FXWA 4ZZ5A 5A7WA 2PHWA 1HRV1 2R061 4LBLA 2ZGQA 5J7MA 5D8AC 3CZUA 3LZZA 5FZGA 4UBHA 1QJU2 1O8PA 5JUVA 4URTA 1PHMA 1UX7A 4J6GA 4N53A 4KG0A 3FFQA 3DV8A 3OTFA 2FDFA 2D6LX 2BQPA 4BQXA 1VBE3 3UL2A 3ABZA 3W58A 1O4ZA 3WDXA 1OF3A 3TEZA 3ZSEA 2VZVA 5IK5A 3VDDA 1BQPA 1UZWA 2YYOA 4MGIE 5C3QA 2XGXA 1HV1A 2HWC3 4JKMA 2QDRA 5J09A 5FZLA 2WNUB 4I3GA 2BBVA 3HQUA 4WBBA 1W8OA 3JB4C 3VDBA 4PIXA 2ZGUA 1K5MB 3OPTA 2BOIA 2W87A 2ZHMA 1KFXL 1C3HA 3SLIA 3VZMA 4ZU5A 4ISQA 4E4HA 5I0TA 3OEAA 1JZ2A 2YU1A 5FY9A 3NNMA 5LW9A 4BPZA 5FY8A 1W8UA 3KV9A 3PUHA 5BXXA 5CG8A 1S0EA 1YJLA 4IGPA 2VZQA 3WG4A 4Y26A 1COV3 5E1RA 2GMPA 3R4UA 1NG0A 1K5MA 1DYKA 1ZZ8A 4X6RB 2HEWF 1Z78A 3J8F2 3U14A 4CDXA 2E63A 1DBNA 3KSCA 4YGDA 5D8AB 5APAA 4B29A 1W6QA 4FI9A 1NA1B 3HPNA 4JRAA 2BNMA 2R073 3B93A 5IVEA 1RC6A 3IDCB 2J1UA 5FZ3A 1UXXX 3ITQA 1LKNA 4KNCA 4QU1A 1FNZA 4NIIA 3ENRA 1XU1A 1WW5A 2ZHLA 1GOHA 1IGOA 1EV12 3AP7A 3MFAA 3POWA 4H7LA 2IVJA 3M3CA 3T4VA 2VZTA 4D6RA 1WCUA 4GULA 4MX3A 4YW7A 1OF4A 3AVRA 1H2MA 4DY5A 2JDUA 1HIXA 4DXZA 5LBBA 4XZPA 2Z5WA 5DUUA 1VMJA 3B9CA 5E88A 5SV8A 5FMDA 2IXKA 2Y6FA 1GKBA 5FK7A 2Q0AA 1WLTA 2A6ZA 3IB3A 5A1FA 3M1HA 2V5YA 2B5HA 1NCQA 3WLUA 3GZTB 5IUQA 4XQDA 2RM22 3IBMA 5K4LA 2CGPA 2W95A 4CA9A 1YYNA 2A75A 1BKZA 4Q4Y3 3VBRC 2VW2A 1DIWA 3OBRA 3BTZA 5ACA2 3ZM8A 3AKRA 2JICA 4RD7A 3RZZA 3URFA 3G6JB 1YLLA 5CFCA 1J59A 3MGUA 3AMQA 4BU2A 5ABJA 1H4GA 3OPWA 2BYVE 3UV9A 3ZXJA 5HBAA 3FMGA 2EXIA 4LKDA 4I01A 3WP6A 4C91A 1HV0A 1PVXA 3HOBA 1KGYA 4A4AA 5JXHA 1ZRDA 5CBLA 1FPN2 1GNYA 3WNMA 1J83A 2DVBA 2X53S 3APBA 3QH6A 2DURA 4CCLA 5GJ6A 3AX4A 3S7EA 2AACA 2CNAA 3DPRA 4EWDA 2WKKA 3JB8A 3VZJA 2XLAA 4Y20B 1PVC2 3CKHA 1I9RA 1PK6C 1FPN1 1OOPC 2JWPA 1OOPA 1OQ1A 4LOSA 1BBT2 2WAOA 4FTBA 3LIHA 2J22A 5T52A 3SCFA 1VMHA 1SDWA 4NAOA 3KD4A 5BNQA 2AEYA 1PM4A 1WW4A 2HWD1 4XTMA 1O5UA 3BIWE 4Y1YA 5L7OA 3IDEA 1X8MA 2X29A 2PYTA 4LNVA 1JW6A 3ZPYA 2NN8A 4ZHNA 4DZGA 4KGGA 1PO22 2MPFA 2XWJB 1MQTB 4MO3M 5FRAA 3V56A 3NMBA 2GSYA 3ILFA 2DVFA 2Y60A 5JI9A 2D93A 2VW1A 3OBTA 1W9FA 5E6HA 2D6PA 5I91A 2A73B 4FO9A 4YW5A 5BNNB 3HJRA 3ZFGB 4DO0A 1PO21 1NX9A 2HWB1 1LULA 1AJOA 3VBHC 1OURA 1IHMA 3UGGA 5KR7A 2GZWA 1W8NA 3POJA 4L2NA 2ARXA 4KI5M 2DU0A 2KA3A 3UK9A 4NRPA 5CFDC 3K4DA 2YC0A 2LUWA 3S6PA 2XVGA 2E7QA 1CX4A 2WFF2 1DGWA 3OOXA 4WVZA 1MS0A 1U0AA 3FLPA 4IQPA 1PGL1 4KWJA 2YFZA 3D8CA 1L7LA 5BV6A 2ZXQA 3I54A 1OVSA 3VHOA 2Y34A 4AEJA 5FZ1A 2VXRA 3PMSA 3HT2A 4XFGA 1VR3A 1Q3EA 2EIDA 1WA4A 3AYEA 1U5IA 4HVOA 2ZACA 2A3XA 2FDGA 1AHSA 2E53A 3HIFA 2QQUA 3PUAA 1PO12 3IDAA 5F8PA 2J42A 4LR4A 4J1XA 3H9AA 4M4PA 3DL3A 4QB6A 4QKNA 2YB7A 4GD4A 4I09A 2HKXA 4MH0E 5JMCA 1NOVA 1SLIA 1Y4WA 4CDXC 2B9VA 2GMEA 4GAZA 1G9CA 2VQAA 2VOWA 4QGMA 2QQWA 4HKWA 2O1QA 1LOBA 1GANA 3H3LA 3BU0A 3JBG2 3AP4A 5HXMA 2CAVA 2ZGNA 4GWJA 5JLVA 2W46A 3WW3A 5CYYA 1US2A 1QQP1 4J1WA 1O8SA 4XFBA 4NE9A 5JPMB 2OXBA 1UKGA 2LROA 2QTWB 2AGSA 3I7DA 3PLQA 1FATA 1LHNA 4YVSC 2IXLA 3AM2A 4LO8A 4OHYA 5IK8A 1XU2A 1C8NA 2PQSA 1OH3A 4CCMA 3IAPA 3DKWA 3VBSA 1J58A 3V0BA 3U0ZA 5FZFA 1Q56A 2ET7A 4LEJA 1W8FA 4NWWA 4R9AA 2JXAA 1DCSA 3WINE 4E4DX 4NIGA 1WCDJ 5GZEA 5A7NA 5C3PA 1LOFC 1Z7S1 1UOGA 1ULDA 1XYPA 1PGW2 4RL7A 2BTVC 1GQGA 1GWKA 2HYKA 3ZYJB 4GJYA 1UD1A 1VRH2 2WO3A 5C9AA 1SLTA 3PJQA 1SDDB 1W6PA 1SCRA 3FHIB 5CFCC 2A6XA 4Q0PA 4AEDA 5A3UA 4IGOA 2V72A 5JOWA 1R083 2A7AA 2GN7A 1MS9A 2ENRA 3AKTA 4QHZA 2RDQA 1QNYA 1GOGA 1TVGA 2BFUS 2YC4A 3ACFA 1LOCA 2VTXJ 4CEWA 3DGTA 1H9WA 4Y33A 5KHGA 1A8MA 2RV9A 3B69A 1ZRIA 2DF7A 2AZ5A 1QHDA 2VO5A 3KV4A 2ZGMA 3WNXA 3NJYA 1VAMA 3U1XA 2VZUA 3MIFA 2LM3A 5FXXA 5GLVA 1JYWA 1WMFA 4AGGA 1BVP1 1VB2A 1E57A 1ZZ6A 1W28A 1I3HA 2BUKA 4N43A 4MGQA 5KWRA 1K3IA 3RG0A 4BLIA 3S57A 5I0DA 1F4AA 1N47A 4FTSA 5F5CA 3WDTA 1OVPA 2DV9A 3MIEA 3I49A 5LRSA 3H8RA 2W1SA 5JR2A 4LT5A 1RUG3 2OS2A 4YM0A 4XJ8A 4MUVA 1LHVA 4ATFA 1K5JA 1DQ5A 4W6WA 4YGBA 5F3IA 4AK3A 4ZU7A 1UOJA 3Q8CA 1OD5A 1YI7A 4OULA 1HW5A 4ORFA 2UWCA 3S7IA 3ASIA 2BU9A 4TZDA 3M8LA 1URXA 1PK6B 2ZCWA 5A7SA 3EO6A 3R0RA 2TNFA 4QPYA 5CZKA 3NVCA 1N3PA 2B39A 2XBO2 1PX4A 3MV01 1AR93 4DOUA 1NE4A 4KWKA 4L9BA 2KXLA 5FPUA 1VB4A 4UFIA 3TEYA 1DHKB 2PHFA 4ARXA 1CAWA 1YFXA 4XAEA 5A1LA 4I2OA 1WUVA 1UZZA 4JGZA 4AHWA 5FQ0A 3BPSA 5FOJB 4CUAA 1QXPA 2DDUA 3MDPA 2JIGA 2WT2A 3D0JA 1TNFA 3D5OA 4Y1UA 2J1EA 1FOD3 5GZFA 3BODA 4QDQA 3ORJA 1AVBA 1BXHA 4RN5A 4XUNA 5C9AB 2VZ1A 2YGLA 3U4XA 3SMHA 5C7GA 4ITCA 1HLCA 1QXRA 3WHUA 1ZZCA 2W1UA 4Q0UA 4E27A 3QBQA 3ZXDA 3GHNA 3VD7A 2PHDA 3RQ0A 3WG1A 2QJVA 5LA1A 4Z82A 5C71A 2J1TA 2ZEXA 4HBNA 4LO4B 4QPIC 4IE7A 1NY72 1OLME 4YVWA 4HKOA 4L0PA 4XDQA 2NP0A 1HXS3 3J8F3 3BTYA 1W2OA 4HSLA 5AFBA 5GLUA 1JZ5A 3HQRA 4BK4A 3BALA 2AC1A 3B5LB 1OFNA 4RSUA 5DXDA 1ODMA 1ENXA 1X9PA 1RUF3 1W0PA 2D3SA 1SLCA 3NJXA 4HK8A 3ZDVA 4MGYE 4OMCA 1PIV3 1MS5A 2ZMLA 4COUA 2ZZJA 2OA2A 4NIHA 1DQ4A 4I0AA 1AR72 1PZ8A 1H2LA 2DCKA 2VBPA 4IUGA 3BIEA 1RVF3 4AGVA 1OT5A 2D97A 3WX5A 2GU9A 4IEYA 4KH9A 4UW5A 3TWIA 1B35B 2WSVA 3AJYA 2OQ6A 4Q1RA 5A32A 1G7YA 5EJ3A 4FPCA 4PDWA 5GALA 3VBOC 5AC93 3SITA 1PMIA 3VDCA 2BBAA 3THPA 5BNOC 1D2SA 1W3VA 1W03A 2GNBA 2WL1A 4YZ1A 1DQ0A 1O5LA 3FHAA 2RVAA 3FBYA 1OA4A 3LOBA 2QQKA 4DPNA 2JDZA 3N4MA 1SACA 2P3KA 1BHGA 2XPJA 4AVBA 1CIYA 5EPAA 3L2YA 3ZXGA 5D2AA 3HN1A 5IFPA 3WW1A 1ULGA 3LWCA 2WR9A 5T5JA 5FJKA 4XUQA 2Y6JA 3RJRA 5CVRA 4RHV2 3WF3A 3U07A 2W08A 5JOYA 1J1TA 3O0XA 1UZYA 3LFMA 4IETA 1QJY1 4KL1A 1JYTA 2A6VA 1YFWA 3DKQA 2WN3A 1CAVB 3N3HA 2F17A 3C7OA 2JDYA 3BU7A 1NXD1 2YBPA 2W52A 5A3WA 3SH3A 4CP9B 1UO9A 1NLQA 4EJRA 1HN0A 2ZX4A 2WNOA 2YY1A 5IVFA 1HQNA 4LE3A 2XLGA 4JRLA 1ULCA 1EAH2 4K7JA 3T2PA 5IT6A 1SLAA 1CAUA 4PBOA 4WM7A 4P02B 4CXWA 4D69A 4QPGC 4F7ZA 3OJBA 4FQ4A 3JD71 1UXZA 3GALA 4XMIA 1OKOA 1S0CA 2D6KA 3SEPA 5GLWA 4IEVA 1AJKA 3HMYA 4B3NA 4A7KA 5LWBA 3VLBB 4YGEA 4OHWA 1DYPA 2X5IB 5C6CA 4LBQD 2XKPA 1JN2P 4OFGA 2BERA 1VJ2A 4RQPB 4BQ4A 4CE8A 5CKMA 1LGCA 2FZ2A 4JC1A 1W6OB 4X8PA 5LRRA 1O91A 4AQ2A 1MQTC 4BQ5A 3I2DA 2JDKA 1RB8G 4MGSA 3W21A 1GZWB 1A78A 3OPZA 4RR3B 1C5IA 2WA4A 3PMEA 4JQRA 2C9AA 3KT7A 1N1TA 1C1LA 1QJX3 3PU3A 3TN91 1CAWB 3I3QA 3VBHB 5LK7B 4BQ1A 1FMD3 2NMOA 3K4AA 1RUC1 3VKNA 1HRI1 4KWLA 3AFKA 1A3KA 1W6PB 2YU2A 1QDCA 2ZZQA 4L8QA 1AL23 4DS0A 3O1RA 1UF2C 3I4IA 4DEVA 5ISLA 1SEFA 3K75B 5C5UA 5FZ0A 3PIJA 4CDWB 1UCXA 2RHPA 5JXIA 1OKQA 3VBOA 2WLQA 3RWKX 4GH4A 4N9HA 4WM8A 2BW8A 1UY2A 3DYMA 5C33A 1MR5A 1I1EA 3UJOA 2RS31 5F5AA 1RUOA 3R4DB 1K12A 5A3LA 3RSJA 2ZGKA 3KVBA 4N43C 4XCAA 1QQP2 2G1MA 3CU7A 3WT3A 4CEYC 4AL9A 2VOTA 1CPMA 2BNOA 4FPKA 3OGJA 3OY8A 3P3NA 4JVAA 3N9PA 5T54A 4YVWB 1GP6A 1N3OA 2O14A 2CWSA 1JUHA 2E51A 5FTTC 3GZAA 1Y9MA 3ZLIA 4Z92B 1UMHA 4FAHA 1W6OA 1OUSA 1RHI3 1VBD1 1AR82 2WT0A 3USUA 4IEUA 2XWBB 2HWF1 5C70A 5FKCA 4CDXB 3EHKA 4EWEA 4CEWC 1OD3A 2PQQA 4YM1A 1ACCA 4F8AA 3WQ7A 3AVSA 4I3PA 2XJSA 1DGLA 1J1LA 4XBQA 3T08A 5A3PA 1Z7S2 5BY5A 3DXUA 3JU9A 2R041 4FTEA 1PNGA 3WQ1A 1W2AX 1Z7S3 1ONAA 1Y9QA 4QPWA 3UGFA 5HCAA 3ZYHA 1H1MA 1YHFA 5FMOS 2JG9C 4AHXA 2Q30A 3MUY1 5FPVA 1HQWA 2WIIB 4LKEA 3TYJA 4AOCA 3ILNA 2RJLA 2OZ6A 3GBFA 1XPWA 3MLJA 3VN4A 4KGQA 5F2SA 4AHYA 4AXOA 4ZKTB 4QX2A 2GNTA 5L9VA 3AFGA 3PIGA 3UETA 2CL2A 2GNMA 2G9GA 1NE6A 4FOVA 1CX1A 2PXJA 2ID4A 5BNNA 1MS1A 5L9RA 1H8TC 3H8XA 4XXPA 1YO8A 1MVQA 1BK0A 1ND3C 1NQDA 1ODNA 3BVCA 3MBWA 1I5PA 5GZDA 3MEPA 4OUEA 3JCIA 4G9SB 2P3YA 5HXVA 3ATGA 4OMDA 4RA0A 5EWSA 2A71A 4F83A 4IEWA 1PMHX 4AI2A 1DP0A 5HV0A 2AYHA 4P9GA 3AKPA 2HWD3 1RITA 3N9QA 1XNCA 4W8JA 2GNDA 2D3PA 1FOD1 2MEV2 1ZBA1 2QKDA 4QT6A 4IE6A 1GMMA 3LA3A 4XCBA 1UKRA 4Q4Y2 3POYA 5DDJ1 1GLHA 1IKPA 2BVBA 2JX9A 4AE2A 2QCSB 4ET7A 4YW6A 1OLQA 4MADA 4P14A 1WGPA 1ULPA 2G4IA 2CV6A 2LTNA 1QJU3 1QJX2 3E5QA 4GWMA 4XDPA 5I0SA 5D1IA 4Z2AA 3QACA 1YRZA 3NJVA 1UOBA 4JX0A 2PHTA 2VQTA 2Y6HA 1K45A 2C1FA 2I45A 3RNSA 5CAZA 4NO4A 1NZCA 5LASA 2ZGRA 2VM9A 2DVDA 2IUWA 1SLBA 3KCYA 2VCMA 3NW4A 2FDJA 4B7EA 3J7HA 5JOZA 2XONA 2VUCA 4FPOB 5FYVA 2ZGOA 3TEWA 4QX1A 5IHRA 1DFQA 1IS4A 5KXDA 2Y6GA 4DXSA 1STMA 3ZYPA 4BZ4A 3K51A 4OVEA 2VZPA 3H7JA 5ERLA 5C8CC 4LK7A 3MYXA 1SCSA 3POBA 4IERA 5FY1A 4G4FA 4LUKA 1IPJA 4K3UA 1W2UA 5K0UB 2A5ZA 3HNYM 4HKLA 1KJLA 1RXGA 2QDNA 4AEDC 3TEXA 4P9YA 5IJRA 2HWC2 2EIEA 2PHLA 4JHZA 4EN8B 4Z8BA 1GR3A 5C8WA 3E6BA 4EZHA 4RQPC 3S30A 4M01A 3M4FA 3MHZA 3PVOA 1DU3D 5FY4A 3O12A 1F31A 3D3AA 5DG2A 3VBRB 1MEC1 1O3SA 2V4VA 3NKGA 3PNAA 5F5IA 4YW1A 3GGLA 1LB2A 1AYN1 2AUYA 3VD4A 2PAKA 2P17A 1RUI3 4KG8A 4HPKB 2XKOA 1OPOA 5FJHA 3MF6A 1RJ8A 4NMIA 5HI0A 1V6JA 4RR3C 1GFF2 1WCSA 1PO23 3OYWA 1DZTA 3RJ2X 1WZXA 3OCPA 1RUE2 5HPOA 4QGNA 5FP4A 4C1WA 1PZ9A 4G3YC 1U5YA 1JI6A 1GP4A 2ZA9A 5FPBA 5JVVA 3QLQA 4DNYA 2VVFA 1QJY3 2R072 2BGCA 2ZHNA 4DEQA 1AX0A 1UY4A 4OI1A 5C4WA 2IWGB 4META 4HVQA 5JZGB 2YMZA 1PIV1 4DY3A 5JSOA 3WG2A 4CUBA 1J3PA 1QEXA 3IWZA 4PDWB 2P6CA 3VBFC 3NV4A 1CGPA 1BEV3 1AR73 2RMU3 4YZ3A 3ST7A 2Q1MA 1RVF2 1WBFA 4UFJA 4XACA 2R6QA 4PLMA 4XUTA 3VHRA 4F3JA 3MW3A 3UKVA 2RS11 5FZ7A 4XPVA 3ZYBA 1PIV2 4XOGA 1XSQA 1A8DA 2ETEA 2ZGTA 1PX3A 3FN9A 1Q5OA 4FP3A 1GICA 2EIGA 2Q8OA 3SCGA 3WVJA 4BHPA 1W8TA 1KITA 1RL3A 2BFUL 1VPHA 2JE9A 1CZSA 2BV4A 4EZ4A 4W65A 3K46A 2UYBA 5T55A 1ZRCA 3CZJA 3U78A 2OIIA 3ZMOA 4FPFA 1S2BA 3VDAA 2V73A 2G19A 1UYYA 4AFMA 4CRQA 3T0DA 2J1VA 4D7YA 3WP3A 1JMUB 4YM3A 5CA6A 3B94A 2GP3A 2NMNA 4ZXEA 3UT0A 3AP9A 1ZNPA 1O3RA 4EYUA 3WDUA 2QNKA 2WNUA 3C7EA 5F39A 1XB9A 3IM0A 4B1LA 4OUMA 2WNVC 4CEYA 5EV7A 3AMMA 5A7WB 5FYTA 3V64A 1O4YA 1ZVFA 3WSOA 4NUBA 1QJEA 5JIUA 3Q9OA 3SKJE 1MZFA 1E5HA 4HG6B 3NL1A 1W04A 5DDJ2 3ZOIA 5FDBA 4B7KA 3CJXA 5KXBA 4N53B 1CESA 2OT7A 4QDRA 4BLJA 2YBKA 4XVHA 1BYHA 2L9LA 3HBKA 4Q4W2 1LOEA 1D7PM 4B4QA 3MV11 2YROA 4QXBA 4B1MA 3I3DA 1D0GA 1VLNA 1COV2 4K21A 4TLGA 3E6CC 3U75A 4CCJA 4HANA 4IV3C 5H9RA 4AFAA 2ADEA 1ND3B 3B3QE 1HRV2 2R062 1NYWA 4HFSA 1DQ6A 1X9TA 5C4WC 3WP5A 1VBA1 4OI4A 4CXXA 1DZRA 4BQWA 4Y24A 3LSDA 3THDA 1POQA 1L7RA 4HONA 2OYZA 1UZ0A 5FZCA 3WW4A 1XNDA 2W0XA 4E2SA 3DYPA 5EJZB 2R1BA 3THTA 3KS7A 4QX7A 2E31A 4XAAA 3VBSB 1VBA2 4AI1A 1XYOA 4C8DA 4OHVA 1OQDA 3VBUA 1OA2A 3WD5A 4BMEA 2ERFA 4LHLA 3MIHA 2R7EB 5F7UA 1CZTA 1KS4A 3BOWA 1CQ9A 3WDVA 2P4EA 4PJYA 5EQUA 5B4NA 4H2AA 3NSTA 2BEOA 4YPJA 4N53C 1UYZA 3ZO0B 4MYEA 4D6QA 4XHXA 1C57A 3O1MA 3INAA 1WWYA 2WYSA 4A44A 2JKXA 3P6BA 1MEC2 1W6MB 1VMFA 2JB4A 4MGZE 4O9GA 3W20A 5FZEA 1YQCA 2ET1A 3N9NA 2VBBA 1ZREA 3Q8BA 5C8CA 5CKNA 1R092 1AF9A 1X8EA 2XXZA 4IV3B 3J8F1 5B2GB 4HVRA 1NLRA 3RI8A 1V9U1 3WEZA 4D0QA 2A6WA 2VY0A 1ND2B 4KBBA 3LFIA 4JZRA 2JECA 2JD4A 3VKOA 2RS52 4Q29A 5JSRA 2W91A 3QD6A 4UFKA 5FQ0B 5FFOC 1WA6X 4A7ZA 4D7TA 4TYSA 3I97A 1C28A 5A6XA 1R1A2 1C4RA 1GOFA 3LD8A 5A7OA 3T30A 4COZA 2J1RA 1AYN2 2B9UA 3RRDA 3ZYIB 4HSJA 1KRIA 3NNJA 1Q8OA 5D21A 2KM2A 1AYM3 1SQ4A 3AYCA 2A70A 4YG0A 2XJPA 1AR71 2QUOA 1SPPA 5K8SA 1AX1A 1POV1 4Y1XA 3C7GA 3KT4A 3RZKA 4QQPA 1MZ6A 2XG3A 1DG6A 4XFHA 4BA6A 1VBD3 2WQZC 3AJZA 4Q0VA 4IEQA 5FR3A 2D5FA 3KCXA 2AR6A 1DDLA 2JG8A 1R64A 2BWAA 5EJ1B 5FZ4A 5IVCA 2QQOA 1WMEA 1DQ1A 3ZFGA 5DDJ3 5DZGA 3VBFA 1OBNA 5DG1A 5C3SA 3VBOB 1SFNA 4COWA 4K20A 3P5BA 4PT6A 3ZKYA 4DMIA 1V6KA 4MGKE 1AR62 4JGYB 2LS6A 3VB9A 4KBZA 4R9BA 4AW7A 1IS5A 3H42B 2E26A 4BMBA 3M3IA 3FZ3A 5EXOA 4I02A 3VD9A 4AR2A 4FT8A 3WCRA 1YQ6A 2DVAA 3WQBA 1VE0A 3OUHA 4RR3A 4BWOA 3H50A 2A6YA 1RUI2 5DPNA 1VRH3 2WUHA 5FV3A 3ACIA 3ES4A 1TMF3 2IXJA 1Z0HA 1I5ZA 2A3YA 4Q4V2 4Y4RA 3VBUB 1O4TA 2JDNA 4UF0A 5CKQA 3SKVA 3AZVA 5F3EA 2BRTA 4PI2A 1H6XA 5DZEA 2X09A 3I2HA 1ZZ7A 4COYA 5IATA 2QQIA 3PVEA 3DYOA 4RQPA 2OKXA 4FAGA 5JWPA 3NNFA 1OA3A 1FI2A 3OSDA 1P8JA 3PVBB 2HWD2 4CCKA 3THCA 5JSPA 4CDQB 3CO2A 1M06G 3RYKA 1BEV2 4M0HA 4YYOA 3LAGA 1JH5A 1PO13 3I2GA 3K3NA 3O0WA 4Z07A 1QJY2 1GUIA 3MIGA 3FE5A 1TNRA 4LA3A 1YIPA 5FLIA 2PMWB 1U12A 3VKLA 2OX0A 1RYYA 3AMHA 4H3WA 4IE0A 4P08A 4XZUG 5FXVA 4ASLA 2WS92 1EP0A 1H1IA 1UYXA 1BZWA 1NUKA 1W9WA 1WD3A 2VCCA 4Q4X1 4BQ3A 2GMMA 3CJIA 4C0BA 4LHSA 3OF1A 2WZPP 2F4PA 2IVIB 2XJTA 1HJGA 2ZABA 5FZBA 2N7GA 5FWJA 1LU2A 2ZPXA 1W9YA 2WFF1 2YFUA 3TB0A 1VAVA 5A3TA 4R4ZA 4MVTA 3V0BB 3B9IA 5FPAA 2YBSA 3WDWA 1QGLA 2VQUA 2B8MA 3JBG3 2UU8A 4GALA 4KU8A 4CUGA 2VMIA 4LBMA 4U2AA 5FP3A 3WF0A 4W50A 4PIYA 4K9SA 3IPVA 5FREA 1W2TA 4FXKB 4CP2A 1SG3A 1FV2A 1S55A 1XRUA 2JB8A 3ME2A 2P37A 3GHMA 4QAWA 2GC3A 3MPBA 5BNOA 1XOYA 3LPGA 2WDBA 4LKFA 1O3TA 2YDEA 4EN9B 3IDBB 3LB9A 4N8MA 4NR1A 3ZIWA 2ZKNA 2WC2A 3FHQA 5FYCA 5I8TA 4QMAA 5JXJA 1W9TA 1D4M3 2E9QA 4PF1A 1RUH2 4FFFA 4ZZ8A 3SC7X 2JEMA 5LA2A 5JCTA 2EVXA 2PA7A 4AGRA 1BBT3 3MW2A 4RGKA 2R071 3ZN6A 3GDBA 1CJDA 4IEOA 1JU3A 1HB3A 2AREA 5AVPA 3X29B 3O1PA 2VMGA 1WCQA 3V0AB 1KQRA 1JZ7A 3HAGA 4D8MA 3CF6E 3OD0A 3WXPA 3S0MA 1LEDA 2A3WA 4GB33 4LK6A 2CDPA 1YXWA 3CQOA 3ELNA 1I6XA 1L3JA 3J9SA 4QKBA 2HWB2 4YVWC 5I8YA 1MS3A 2YV8A 3E1F1 2HEYF 4A41A 3IPVB 4Q27A 4Y22A 5ANQA 4JAAA 4FBFA 4YLZA 4MLOA 1R1A1 3OGSA 5IVBA 2FZ1A 5H9SA 3VKFC 1AXZA 1SFPA 1XNKA 4IW3A 4AFCA 4XQWA 5CB7A 2V5DA 3LQCA 1ASJ1 3SHRA 2WNVA 4I0WB 1LU1A 2XMLA 3N7MA 3Q8AA 4LJHA 3HQXA 4FOYA 4KU7A 2OQ7A 2Y38A 2JE8A 1D4VB 3IIAA 3HT1A 2R0FA 2NZ9A 3UYJA 1KDKA 2W39A 1AR81 2ZKLA 2HYXA 2TBVA 4Y4YA 3IMNA 1LHWA 1VRH1 4HLTA 1G8WA 1SHWB 2VULA 1JS9A 3AZYA 1UPIA 1PMJX 3GBGA 1SBFA 1RUD3 4Q2FA 3VBFB 3T2TA 3M3QA 1AR61 4A7YA 4QU2A 4DRVA 2E7AA 2GP5A 3VBHA 2XOMA 3FFZA 4JKKA 4XBLA 5FZ8A 2XLFA 5L7OB 2X5IC 3KF5A 4TXWA 3MIBA 5C9AC 4JDMA 1V6OA 4UFMA 3SNMA 4Q4W1 2BJSA 4FP2A 4IV1B 3ETPA 3NRUA 5BPXA 1ZBA3 3AKQA 4CDQA 2WRAA 5DABA 2B45X 1LOFA 3DUIA 5ABJB 4YG6A 4CZSA 1X50A 2VU9A 4Y20A 1RHI1 1LCLA 4NJ4A 4N7IA 1ZRFA 3SXWA 3DPRB 1G6NA 1R1A3 3AYDA 2Q1ZB 4P5YA 4DUVA 2K2SA 2WYFA 1EAH1 4UF0B 2R1DA 3TOJA 5IVJA 5K7PA 3N9MA 2WS91 1Y43B 1RHI2 3GM8A 5J96B 3KHBA 1QKQA 4X6QB 4A42A 1KDMA 5CIRA 5KBFA 2XH6A 4BIOA 2TUNA 4HXCA 3KQ4B 1JU4A 1BMV2 2O8OA 3HVDA 2RE9A 3NV2A 1LOAA 2ES3A 2DCYA 2YC2A 1AZDA 2IZWA 3AZXA 3DXTA 3KZ4C 1YIFA 4GWIA 5FPZA 4LBQB 1WLDA 3WUCA 5F9TA 1GSLA 5T5LA 5I0RA 2D44A 5FO9B 1O3QA 1JZ8A 3OBAA 1S4CA 3GCXA 2PAMA 1OFSA 1REDA 3EMRA 2JG8B 2ZAHA 1FMD2 3N9OA 2Q4SA 1WKYA 2O8QA 1TQ5A 4BK5A 5A3MA 3KM5A 4GB32 2D7FA 5FZOA 1UIKA 1GV9A 1OXCA 2B46X 2C0ZA 2VL4A 3P3PA 1QOOA 5K0UC 2R16A 2XQRA 1YWKA 3OGVA 4NRQA 4QX0A 4OQ9A 2PTMA 4AEDB 2XJVA 3SCHA 3EJKA 5HCFA 5FYHA 1ULOA 1UX6A 3BTXA 1X7NA 2I2SA 3F2ZA 2Y0IA 4CDUB 3KV6A 3TRSB 4ASMB 1UOFA 5T5OA 2OW4A 3SQOA 1IQDC 4JGZC 4TLFA 4YRDA 1G9DA 3V0AA 4MXVA 4FPYA 3TN92 4V1PA 1CVNA 2GAUA 2W1QA 3A7QA 3KGLA 5F3GA 4INDA 5IFTA 1LAJA 2QQJA 2JDPA 4Q0SA 5FZIA 3NJZA 4TN7A 3ZFFB 1YC61 5ACA3 5KC5A 5KXEA 4AVCA 2RR11 1OQEA 2YG0A 4A3ZA 1IS3A 4Y3OA 4OLLA 4Y22B 5LB6A 5JDBA 3RYPA 4BH9A 4UBGA 4XF1A 1HB4A 3CMGA 1LR5A 1RMU1 1FYUA 3M70A 4NAMA 4LA2A 4A6SA 4M0NA 1V70A 5FYUA 2ZGLA 1ULFA 3T0BA 4QPGB 3ZSLA 1ND2C 2XBO1 1HX6A 3USUB 3M2MA 4XILA 3BUCA 4PDWC 2ARAA 2CTVA 4Q4W3 4UW3A 3ZXFA 5LCWL 2WABA 4FPJA 3ZN5A 1AR83 4N9IA 1PVC3 2DCTA 3CNAA 1PGSA 4Y5TA 2VUAA 4Q8KA 3H3ZA 1SLLA 3MW4A 2WBKA 2HWC1 5HCBA 4EROA 4KQ7A 4OYUA 5FLHA 1EAH3 1IQAA 4E9KA 3S5AA 1BCXA 1OSGA 3JQXA 4LUMA 4ZU4A 3ALQA 4AI0A 1RUI1 1LGBA 4EN7B 5K0UA 5C3RA 2RDSA 3PU8A 2EALA 2SBAA 1L7QA 2Q8CA 4JDOA 1JOJA 2XL7A 1V0AA 4HL0A 3A0KA 4EN0A 2BOJA 4RS5C 1N1SA 1ENSA 4QPIA 4XQ4A 1Q8SA 2R30A 5EYXA 1UMZA 3AMPA 3OEBA 5CG9A 5FMOL 4UYBA 5JIAA 4D7SA 2BWCA 2Q8DA 1RUG2 5FKBA 5A70A 1E5IA 1QXJA 4XBNA 2XHKA 2QQPA 4S2GA 3CLPA 4YNIA 5JOXA 2VMDA 1NCQC 3W59A 3ZPOA 1TMF2 3C7HA 4YW3A 2I07B 3SEEA 3GBWA 2WZR3 3PUSA 2W92A 5FUIA 1BEV1 3NO8A 1AL21 5FIXA 1OOPB 1RUG1 2RDNA 1JODA 2Y26A 2XUMA 1WLWA 2Z69A 3HBZA 2EAAA 2JE7A 3I2FA 3VL8A 5L7OC 4YG3A 2VZ3A 4P9XA 4Q4X2 5FUPA 1QJX1 1FNYA 3TN93 1MPXA 3FC0A 3BI3A 2X8KA 4MSVA 2WSUA 1D2QA 5FZMA 3U10A 3UKTA 2FD8A 3T09A 2WWSA 2Q1FA 1D4M1 4H55A 2PLV1 2H0VA 2SLIA 4NHKA 5EYYA 1XBFA 1KXGA 2EXHA 2EF6A 4OI2A 1ENRA 3AC0A 1YFYA 4M3CB 4PF5A 2TEPA 4LKSA 3DPRC 4HZFA 3RVHA 2VMEA 5CFCB 1FT9A 3HN3A 3LKJA 3D6EA 1SBEA 4W4ZA 4WM7B 5FYSA 1GYKA 4ZY9A 1JHJA 4MZUA 3LOIA 4RFT0 1JHNA 2DWRA 2VC9A 3NAPA 5A7QA 3VZNA 4CEWB 4FVVA 1IOAA 4GB31 4QX8A 5DUWA 4GKYA 1S0FA 2XVLA 3IT8A 3ZR6A 4PHZA 1G9BA 1XYNA 5FCCA 5IK4A 4O61A 4E2QA 2DCJA 2J1SA 1MZ5A 3MZHA 1CPNA 5EP9A 4HMZA 2DU1A 4ZONA 3BKZA 3BPZA 5GZGA 2VCBA 4YVSA 5CFDB 3BTAA 1A6CA 1AR92 1YNAA 2DFBA 1R082 4QQOA 2PN5A 1BVVA 4AAXA 1YI9A 1O59A 4XURA 1UN1A 3BN6A 3KLSA 1EYBA 1GZ9A 1V6NA 2WWUA 2VMHA 4KMQA 4DXTA 5HV4A 3LDRA 3TAYA 1DF0A 2J7MA 2UWAA 1H8TB 5J3UA 1FMD1 4DINB 1Q8VA 5DMYA 2CGOA 4JHTA 3ZN4A 1ENQA 2RS32 3B02A 3NAPC 2JG8C 3I2JA 2K9ZA 3JUUA 1WW6A 4YM2A 3VD5A 1REEA 3VZOA 5EFUA 1VBA3 4YW2A 5AC91 2GALA 2OUHA 1XE8A 2O0OA 5DUXA 3I59B 3O0VA 1X36A 3UESA 3PTYA 1RMU3 4WM7C 2WN2A 2VGDA 2DUQA 4BQYA 4P5HA 4H7MA 4LMFA 1UNBA 2VE1A 3CL1A 3PTRB 5FZ9A 2FCVA 4BM8A 4XF0A 2D3RA 1V9U2 1RIRA 2W3JA 4NPRA 5FYMA 1ZM1A 2KR2A 3ZXAC 4BISA 4IESA 5C5TA 3D0SA 3FWEA 4RGAA 3ZFFA 1C1FA 5LZ6A 1UMIA 3DCQA 2QBXA 4FFHA 1G9FA 4BIFA 2RS12 4GIQA 4XYXA 3DN7A 5A33A 3T2QA 4JKLA 1VRBA 3WF1A 4GH4B 4WM8B 5J98B 3LCPA 5LATA 3WF2A 3H8OA 2KD7A 4CDWA 1F15A 4LBNA 5T5PA 3WY6A 1V6IA 3ZMNA 1TME1 4AYUA 4MGTA 4K6BA 1AXYA 4E4SA 1V6LA 4WVVA 3RZGA 1IG3A 5DAQA 3NV1A 2DVGA 2P3JA 4YZ5A 4IE4A 3AYAA 1DQ2A 2YUEA 2VECA 4NHYA 1XE0A 4XHBA 1RUC2 3LGRA 5C4WB 1TEIA 4Q4V1 4W6XA 3GCWA 1YQ2A 3D4KA 2CDOA 2DYCA 4ASKA 3AB0A 4OZOA 4AAPA 4O65A 4PLNA 1XC6A 3FUQA 1XJAA 2J1AA 1UQXA 2W94A 4ISRA 2XQXA 1AUYA 1FXZA 3VBSC 3VDDB 5HCHA 5LEKA 4TTGA 5GZCA 3CJIB 3VGIA 2D5HA 1ZYBA 1MS4A 3J4UH 4HPKA 3WCSA 4TWTA 3O1TA 3RZHA 1ZBA2 2PHUA 1SBDA 5IK7A 4OUSA 1MQTA 2ZEZA 3VBRA 1RUF1 4SBVA 3DF0A 1QY4A 2WAAA 4L92A 4XUOA 3VZKA 1W8ZA 1H8TA 1LENA 3FX3A 1FOD2 2MEV1 2XL9A 2VZOA 4Q26A 1LJ7A 4XF4A 3MO4A 1OLMA 1H9PA 4L11A 4QXHA 4WVMA 4XXAA 4CP1A 1W6NA 3ZFGC 1A34A 2FDKA 1CR7A 1C5HA 1QDOA 3WR0A 1LNSA 2BVVA 4CEYB 4RFRB 3C2UA 3L2HA 4DQAA 3WNPA 1VBC3 2D6NA 3IIIA 4Q1PA 2YPDA 4CPBD 2F4LA 5T3NA 1WCKA 5ABJC 2ZMKA 3ZSJA 5I0UA 2CWMA 3F95A 4Q4V3 1WW7A 2OVUA 1APNA 2ZGPA 1LHUA 1REFA 3MFCA 3N7JA 5KHIA 2VMCA 2PLV2 5F2WA 2FCTA 2VUJA 2RJKA 2D6OX 3ZFEB 2C9KA 3RYRA 1AR91 1JUIA 4XABA 2LRPA 1XNAA 2NQYA 3GZEA 3FL7A 3LPFA 1S0BA 2G9FA 2RS33 2YZ4A 2XVKA 3HNBM 3C8XA 1IS6A 1CZVA 2JENA 4D94A 5IYYA 1Y9GA 4RHV1 2D40A 2JG9B 1JOBA 1B09A 3TBDA 4LXLA 4K40A 2Y0OA 2MEV3 4QHOA 1W0OA 1OPMA 3JXSA 4PI0A 1W90A 2CHHA 3EYPA 1HRI3 1AYM1 2ATFA 4JDNA 5CNAA 3RGBA 4AVAA 5J37A 4K8RB 1PVC1 2ZX2A 5FZKA 2YXSA 1YJKA 4A3XA 1W6NB 2VNVA 4AHZA 5LBFA 2RS13 1PO11 3H1WA 1ALYA 1W3XA 2WNVB 1KFUL 4E8CA 3C7FA 2RDRA 1LEMA 1X33A 4RYDA 2FCUA 2RG4A 4AZZA 1HB2A 5FXZA 2ZHKA 1R081 1H2NA 1YUDA 5KC6A 5EIYB 4LQRA 5CADA 2ZGSA 4UFLA 1CN1A 5FZ6A 2G9ZA 2RR12 2R043 1J3QA 4OZXA 2OPWA 3W5NA 3ZR5A 1R091 2BDRA 3AXDA 5J36A 4XE9A 4P9JA 2RR13 5EZWA 2OZJA 3IN9A 4EN6B 2X10A 3M3OA 1HRI2 1V6MA 4BYYA 1UAIA 2VOVA 4CTEA 1N1YA 4YARA 4AEMA 2DTYA 5F5QA 1ZZ9A 1QWRA 1NCRB 2ZJCA 5E89A 3BYWA 4RHV3 5FYBA 1GZWA 1DLCA 1WBLA 1NAEA 2Y8KA 3WG3A 4ZS2A 4QXKA 2UY8A 1EPZA 1TME3 1T6BX 3VHPA 2VD7A 1RTVA 3ZFFC 4XF3A 1W0NA 4CDQC 4D3WA 1NY71 2YPJA 3AL6A 4LULA 1ST8A 3VD3A 1W2NA 1UU5A 2WFPA 1VP6A 1JYNA 4QPGA 4R9DA 4YW4A 1S0JA 4XW3A 1UPSA 4LPLA 2PHRA 4LTAA 4C1XA 5BNOB 2GC1A 2FDIA 5FMCA 2P1BA 4HN1A 3AK0A 1SZBA 4LLFA 3ZFEA 5KHJA 4XFFA 5DZFA 2VZSA 3FJSA 3MIDA 3ECQA 3OY8B 4NPMA 5FZAA 1D0HA 4BXSV 4GMP1 4QDSA 5C8CB 3N36A 2B7YA 1EY2A 1VBE1 2JDAA 2XJUA 3KGZA 1RJ7A 4K1ZA 5L9BA 3CHXA 1TME2 1RUF2 3KMHA 2HWB3 3QH7A 5DN2A 3PVNA 1LODA 1T2XA 1GWLA 3PUQA 4FPGA 1EV13 1EUTA 1W05A 1ZA4A 2F6BA 1H0BA 1QOTA 3POGA 4YGCA 3WZ1A 2WNEA 5M0TA 3J7LA 4UI9L 1UY0A 1HJFA 2B4KA 1GZTA 4I30A 3TNQA 4LBOA 4CCDA 4DUWA 2CU5A 4WV8A 1CAVA 1PZ7A 2WZR1 5FUNA 2P6HA 1WD4A 1Q8PA 2UY9A 1PK6A 1O6UA 2HH9A 4QGLA 4XFCA 5JI7A 3A21A 3A23A 2Z4FA 1VBC1 1RXFA 3T0AA 3WQ0A 1S2KA 2FMDA 4LIVA 1MACA 4AWDA 4CVUA 2RM23 2Y6KA 1ASJ3 5FZOB 2EA7A 2P2KA 2WZR2 1RINA 1CAXA 2VNGA 4LO6B 4OHXA 4XF9A 1XE7A 2D6MA 2IXCA 5F6KA 1GU3A 3J7MA 1RVF1 4QKDA 4QQLA 5J48A 2ZS6B 3MPPG 4UAPA 4CDUA 3I2IA 2X05A 4E2GA 4M3CE 4E8DA 5EHDA 3ACHA 1W8WA 2EXJA 1RUD1 3MUZ1 1PGW1 1H2KA 2BNNA 1MVEA 3QCWA 4AVTA 4QM8A 4A2UA 4OI0A 2E7TA 1LESA 2GC2A 2RJ2A 2BZDA 4HOOA 4ZS3A 3FUOA 2VTFA 1G9AA 3TNPB 2EAKA 2QZ3A 4PLOA 1JZ3A 3O1UA 4MV2A 1XNTA 4A45A 1R093 1AYM2 4NHMA 4LHNA 2GDFA 5KHHA 4YFWA 5FY0A 5CU1A 4M3CA 3K2OA 2HWE3 5L73A 4FSJA 4CU6A 3LEKA 4GA9A 4LORA 1OC1A 2ORXA 1QOSA 3WW2A 4QB1A 3BB6A 3WHTA 3CEWA 3AKSA 5AFEA 3PL0A 3AXEA 3PHMA 4AVSA 5JR7B 1C8M2 5LBCA 4EV0A 3OUIA 1IPKA 4OHZA 4COVA 1POV0 5BNPC 5E8AA 3AMNA 3RPQA 3M3EA 5GM0A 4MHUA 4RS5A 4NIAA 3PUIA 1F35A 4MOAA 3LDKA 1QJU1 2IC1A 1W9SA 2CYFA 1COV1 2A1XA 1BMV1 2WLPA 4NHXA 2W5FA 2PHXA 3ZYFA 1E5RA 3AZWA 2RMU2 3WP4A 3E97A 3EQEA 4IDZA 5TSWA 1RMU2 5GLTA 3R6SA 3ZYRA 4CSWA 3ZVXA 2EICA 4E4ZA 4AQSA 3HNMA 3RZLA 4XC9A 1W8HA 2ARBA 4AI9A 4Y1VA 3NV3A 2VOKA 4BQ2A 2RMU1 1CJPA 4NROA 3WV6A 1AR63 4SLIA 5A3OA 2HWE1 4IEXA 3RMXA 1DZQA 4UOJA 2D43A 5FP8A 3ZIXA 1O7FA 4DIQA 2XR4A 1ASJ2 1HXS2 4HK9A 2BGPA 1F2NA 4Y1ZA 1ND2A 3POFA 3K48A 3A4UA 1VBB3 1JYCA 1SPPB 1TG7A 1ZA7A 1H1AA 4QD2A 4UW6A 2WQ4A 3WDYA 4AG4A 3O1OA 1JZ4A 2R042 3EB7A 2DTWA 1K5MC 3LE0A 4X8NA 3MI8A 3VKMA 1QJZA 4ES9A 1WMDA 1W06A 2WJSA 3O14A 5LY1A 4QX5A 4A6OA 1LOGA 5A1AA 2ILMA 4WZCA 4NPLA 4NRMA 3K3OA 4UWDA 3UJQA 2EXKA 1YEWA 4M4RA 3SISA 1RUJ3 2CSGA 2WWJA 2XDVA 2FMYA 3GF6A 3V65A 1ZX5A 4Y5Z0 2LALA 4Q8LA 4CU9A 1YQ5A 4Q4X3 4B4RA 3JBG1 4QQHA 2JDMA 4RGGA 2FQPA 1VBD2 1EPWA 2Y33A 3RWNA 5BNNC 4RS5B 1CWPA 2MHFA 4FFIA 4CCOA 1JOPA 3MLLA 4KWUA 1HB1A 1W6MA 2HLEA 3GJAA 4L97A 4AF9A 1FV3A 4ES8A 2QQLA 5FLJA 1RUE1 2WO2A 3AP5A 3ILRA 5FY7A 4IGQA 4C90A 3KHCA 2Q5TA 4DXRA 2VTXA 3E5UA 4CXYA 5JAXA 1TE1B 2XBO3 1K42A 3KT1A 3VL9A 1E5SA 1OHFA 2UURA 2VG9A 3I3MA 1ZBE2 4IE5A 3T3YA 2PLV3 2V4AA 4LLOA 4PBPA 1ZZBA 1UYPA 4YZ4A 1IPSA 3ZN6B 3GZUC 4XJZA 4PQ9A 1J84A 3CJIC 4IL7A 1VBC2 3OGRA 1LHOA 1US3A 2H6CA 3GNEA 4GKXA 1OLRA 4CDWC 1S0IA 2VMFA 3K77A 4UFHA 1BK1A 2P3IA 4O7XA 3ZXLA 1SFYA 1RGSA 2JJ6A 2W47A 3B7MA 4Z1VA 1XXNA 2VZRA 2DBIA 1OH4A 3UKNA 1HKDA 4YWAA 1SMVA 4WVMB 4BCUA 1Y3TA 1CAXB 3DEMA 4IXLA 4M3CF 4QX3A 2DFCA 5I93A 2JD9A 2B42B 2PAEA 1U5XA 1XNBA 1X82A 3I3EA 1FAYA 4L99A 1RUE3 5FAXA 5I8SA 2I74A 3MF9A 3H1MA 5DAPA 5AVAA 4S2HA 3OD4A 5A32B 3JZVA 3MICA 4JCKA 2Z42A 2NPIA 4PQQA 1KD7A 5F6LB 3WNNA 4C0HA 4EQVA 4S2DA 3KWVA 3U11A 4NN0A 4DB5A 1LRHA 2MNGA 3E5XA 3Q8FA 4BJ0A 3OUJA 2NLRA 2FDHA 3VBUC 1JYVA 4UW4A 4CU8A 1UY1A 3NNGA 3AL5A 4LBQA 2UWBA 2W2IA 1DGRA 2FBEA 3WNOA 3H7YA 4IV1C 4XIKA 1VAKA 2VVDA 2VQ0A 5FO7B 5FZHA 1MS8A 5LK5A 3E6DA 3R05A 1N1VA 4GMP3 4H14A 2W68A 4Q0QA 4ARYA 1GQHA 1C8M1 1B35A 2VOXA 3W9AA 1R1ZA 3ZDSA 1QF3A 3SH4A 3Q8EA 1S0DA 2WNUC 4FPLA 4AQ6A 1NCRA 3I2KA 3RS6A 3LSEA 1UZVA 4JGYA 3KV5A 5BNPB 1N3QA 2IFRA 3D82A 2Y64A 5FWEA 4P9WA 1NQJA 2FHRA 1PGL2 3VUOA 1OMIA 4GQ7A 1F5JA 5IVYA 1QIQA 5LBEA 2HWF2 3N35A 5A3NA 1QQP3 2UYAA 1QH6A 3ETQA 2P34A 1LGNA 4BOWA 1NCQB 3N7KA 3A0NA 5JZGC 4MG2A 3RFRA 2D98A 3H1YA 2NYYA 4IV1A 2PELA 3ACGA 2JDHA 1NKGA 1J3RA 1JXNA 4GH4C 4WM8C 3VHNA 4D6SA 2E32A 3P1IA 3POSA 5FBZA 1UWWA 4V2VA 4URAA 5FP7A 1EUUA 2K0GA 1UW8A 2C6SA 5B4XA 4BB3A 1CONA 1NA1C 2HWE2 2ZBJA 4AI3A 1WLCA 2XB6C 1NCRC 4P9IA 2DUPA 3WNLA 4IEPA 5IW0A 3R4SA 2WZEA 2AENA 3JD73 1AX2A 3KF3A 2YHJA 3CBNA 1LTEA 2ZAAA 4B4PA 4CUCA 2Q8EA 1Q8QA 4QWNA 3RMYA 4XJAA 4CCEA 1GBGA 4R4XA 2ORZA 5FP9A 2RS51 3T4HB 1GNZA 4AI8A 2PFWA 3KQRA 4XMAA 4LBJA 3ZYGA 3S5QA 1T6GC 4QQ2A 1RUH3 4MXWB 3ES1A 1ZBE1 3HWJA 4K1YA 2VR4A 2XJRA 4XJ9A 5G05L 4CDUC 4HT1T 4FPHA 5L36A 3POEA 5FPLA 2R32A 1QU0A 4EE2A 4XEZA 1QMJA 4CPBA 4IV3A 4AEKA 4XUPA 1NA1A 1M4WA 2E33A 4AFBA 1LECA 2JG9A 5FY5A 4HETA 4FOQA 3ZXKA 1RUD2 3GJBA 4QXCA 2X5IA 4ATEA 4BXFA 4P00B 5A33B 1RUC3 4CP9A 2WS93 4V2WA 1ND3A 5GKAC 1AL22 2ZMNA 1GWMA 3B00A 2VJXA 2Z79A 2ZX1A 4NWVA 4TSVA 4XFIA 3UGHA 4UXAA 1JYXA 5FZDA 4CU7A 3O1SA 2W9XA 1F8VA 2HJIA 4JTOA 1CAUB 1JBCA
chains in the Genus database with same CATH topology
5FPXA 4N7UA 2RM21 1H4HA 3ZSMA 4HN0A 3KCCA 1VIWB 4PIZA 5ACA1 2RS53 2Z2SB 3SH5A 1Y7BA 2QE3A 1QNWA 1S1AA 4R9CA 2CY6A 1UIJA 4BE3A 3H3UA 1FPN3 3I8TA 1IKQA 4XFAA 2XJQA 2VNRA 1XQNA 1YFUA 2HEVF 1YCIA 5T50A 2DUOA 2WA3A 3VZLA 3J26N 1H8VA 5BYNA 3PJYA 2QZ2A 1VALA 4ONUA 3JD72 1S0GA 3WOGA 5KXCA 1BBT1 3BOPA 1KJRA 2HWF3 3AP6A 4YFZA 2AH2A 1UL9A 1V00A 1V9U3 4Q4Y1 3MLKA 4PCRA 2VPVA 2BPA2 4XJUA 2ZOEB 1U5ZA 3NKTA 1HXS1 5JPNB 4N90A 3VV1A 4MXWA 4DRRA 5FOBB 5GLZA 3VDDC 2WFF3 5KHKA 5FO8B 4U36A 4XIOA 3C3VA 2GH8A 1HRV3 2R063 4XJWA 4LBKA 4LO5B 2V09A 1IZ3A 1GZCA 1RUNA 2CGNA 3OYWB 2IXHA 1PM7A 5SV5A 2QFEA 1VBB2 4JV4A 3O5SA 2H0BA 3ROUA 3O7OA 5JZGA 2H6BA 3HD8B 4XETA 3KB5A 1DGWX 2VH9A 4LE4A 4Z2WA 1FX5A 2NM1A 2ZTNA 4IEZA 1F5FA 4FXGB 3ZX7A 3ACLA 1JYIA 1VBB1 1VBE2 3LA7A 4JGYC 2DCZA 1MEC3 3EXUA 3I59A 1RUJ1 4XTPA 1AYN3 3G7DA 4LHKA 2ZX3A 1EV11 4EN9B 1RUH1 4QPIB 4GMP0 4NOTA 4YVSB 4W6YA 5CFDA 1ZBE3 2WT1A 3AZZA 2GN3A 4AFDA 1TMF1 1W39A 3ZFEC 1RUJ2 4P9LA 3ZXEA 2WINB 4I0BA 1F9KA 4NVPA 2GC0A 4O9EA 5BNPA 5E16A 4CP0A 4GXLA 4WZFA 1UU6A 1DGRN 3NAPB 5L19A 4JGZB 3T1MA 1AXKA 1ZRRA 1NXMA 5LEJA 1PNFA 1QH7A 2R49A 3B01A 4YZ2A 1JTZX 3NWKA 1UU4A 1KS5A 4JTNA 2R0HA 3RDIA 4FOWA 4AQTA 2OUJA 2E6VA 1GNHA 1B35C 1ULEA 2VNOA 2JKBA 1OI6A 3JQWA 1D4M2 4K8FA 3N7LA 1Q43A 4M00A 5K9YA 1AL0G 3RI9A 4S2FA 1BJQA 3BCWA 4AVVA 3M7AA 1C8M3 1G86A 4QM9A 3QOPA 1CD3G 3FBMA 3OGGA 1POV3 3EBRA 4FCAA 4N43B 2IFWA 3IKWA 5H9QA 2YGMA 3H8UA 4YSFA 4R52A 5H9PA 5DUVA 4GWNA 4NHLA 4FPEA 1HQLA 4LO7A 3FLRA 3USSA 1CIWA 2VW0A 3FLTA 1DLLA 5D8AA 1MZEA 3H0OA 2CAUA 4QHBA 4FQZA 4R8HA 1NLSA 4DFSA 2C5DA 2GH2A 2IXIA 3T1LA 3WUDA 4EWAA 5BUVA 5F1RA 4CYDA 3L9JT 1HDKA 4WVWA 1W6QB 3HR9A 3LA2A 2OPKA 2VVEA 5AC92 4B8EA 3ZSKA 2QVSB 1H30A 3GYDA 2ZX0A 4ZXKA 2PHWA 1HRV1 2R061 4LBLA 2ZGQA 5J7MA 5D8AC 3LZZA 4UBHA 1QJU2 4URTA 1PHMA 4J6GA 4N53A 4KG0A 3FFQA 3DV8A 3OTFA 2D6LX 2BQPA 1VBE3 3UL2A 3W58A 1O4ZA 3WDXA 3ZSEA 5IK5A 3VDDA 1BQPA 2YYOA 4MGIE 2XGXA 1HV1A 2HWC3 2QDRA 5J09A 2WNUB 4I3GA 2BBVA 4WBBA 3JB4C 4PIXA 2ZGUA 1K5MB 2ZHMA 1KFXL 1C3HA 3SLIA 3VZMA 4ZU5A 4ISQA 5I0TA 4BPZA 5BXXA 5CG8A 1S0EA 1YJLA 3WG4A 4Y26A 1COV3 5E1RA 2GMPA 3R4UA 1NG0A 1K5MA 1DYKA 1ZZ8A 4X6RB 2HEWF 1Z78A 3J8F2 4CDXA 2E63A 1DBNA 3KSCA 4YGDA 5D8AB 4B29A 1W6QA 1NA1B 4JRAA 2BNMA 2R073 3B93A 1RC6A 3IDCB 1LKNA 4KNCA 1FNZA 3ENRA 1XU1A 1WW5A 2ZHLA 1IGOA 3MFAA 1EV12 3AP7A 3POWA 4H7LA 3M3CA 4GULA 4MX3A 1H2MA 4DY5A 4DXZA 1HIXA 4XZPA 2Z5WA 5DUUA 3B9CA 5E88A 5SV8A 2IXKA 1GKBA 2Q0AA 1WLTA 2A6ZA 3M1HA 2V5YA 2B5HA 1NCQA 3WLUA 3GZTB 5IUQA 4XQDA 2RM22 3IBMA 2CGPA 1YYNA 2A75A 1BKZA 4Q4Y3 3VBRC 2VW2A 1DIWA 3OBRA 5ACA2 3AKRA 2JICA 4RD7A 3RZZA 3URFA 3G6JB 1YLLA 5CFCA 1J59A 3MGUA 3AMQA 5ABJA 1H4GA 3UV9A 2BYVE 5HBAA 3ZXJA 3FMGA 2EXIA 4I01A 3WP6A 4C91A 1HV0A 1PVXA 1ZRDA 5CBLA 1FPN2 2DVBA 2X53S 3QH6A 3APBA 2DURA 5GJ6A 3AX4A 3S7EA 2CNAA 3DPRA 4EWDA 2WKKA 3JB8A 3VZJA 2XLAA 4Y20B 1PVC2 1I9RA 1PK6C 1FPN1 1OOPC 1OOPA 1OQ1A 1BBT2 4FTBA 5T52A 3SCFA 1SDWA 3KD4A 5BNQA 1WW4A 2HWD1 4XTMA 1O5UA 3BIWE 4Y1YA 5L7OA 3IDEA 1X8MA 2X29A 2PYTA 4LNVA 1JW6A 3ZPYA 2NN8A 4DZGA 4KGGA 1PO22 2MPFA 2XWJB 1MQTB 5FRAA 3V56A 2GSYA 3ILFA 2DVFA 5JI9A 2D93A 2VW1A 3OBTA 2D6PA 5I91A 2A73B 4FO9A 4YW5A 5BNNB 3ZFGB 1PO21 2HWB1 1LULA 1AJOA 3VBHC 1IHMA 2GZWA 4L2NA 2ARXA 2DU0A 2KA3A 3UK9A 5CFDC 2YC0A 2LUWA 3S6PA 2XVGA 2E7QA 1CX4A 2WFF2 1DGWA 4WVZA 1MS0A 1U0AA 3FLPA 4IQPA 1PGL1 4KWJA 3D8CA 5BV6A 3I54A 3VHOA 4AEJA 2VXRA 3PMSA 3HT2A 4XFGA 1VR3A 1Q3EA 1WA4A 3AYEA 1U5IA 4HVOA 2ZACA 2A3XA 1AHSA 2E53A 3HIFA 1PO12 4LR4A 4J1XA 3H9AA 3DL3A 4I09A 5JMCA 4MH0E 2HKXA 1NOVA 1SLIA 4CDXC 2GMEA 1G9CA 2VQAA 2VOWA 4QGMA 4HKWA 2O1QA 1LOBA 1GANA 3JBG2 3AP4A 2CAVA 2ZGNA 5JLVA 3WW3A 1QQP1 4J1WA 4XFBA 5JPMB 1UKGA 2AGSA 3I7DA 3PLQA 1FATA 1LHNA 4YVSC 2IXLA 3AM2A 4LO8A 4OHYA 5IK8A 1XU2A 1C8NA 3DKWA 3VBSA 1J58A 3V0BA 3U0ZA 1Q56A 2ET7A 4LEJA 4NWWA 4R9AA 3WINE 2JXAA 4E4DX 1WCDJ 5GZEA 1LOFC 1Z7S1 1ULDA 1XYPA 1PGW2 4RL7A 2BTVC 1GQGA 2HYKA 3ZYJB 1UD1A 1VRH2 5C9AA 1SLTA 3PJQA 1W6PA 3FHIB 1SCRA 5CFCC 2A6XA 4Q0PA 4AEDA 5JOWA 1R083 2A7AA 2GN7A 1MS9A 2ENRA 3AKTA 1QNYA 2BFUS 4CEWA 1LOCA 3DGTA 1H9WA 5KHGA 1A8MA 3B69A 2DF7A 2AZ5A 1QHDA 2ZGMA 3WNXA 1VAMA 5GLVA 3MIFA 2LM3A 1WMFA 4AGGA 1BVP1 1VB2A 1E57A 1ZZ6A 1I3HA 2BUKA 4N43A 5KWRA 3RG0A 4BLIA 1N47A 4FTSA 3WDTA 2DV9A 3MIEA 5LRSA 4LT5A 1RUG3 4YM0A 4XJ8A 4MUVA 1LHVA 4ATFA 1DQ5A 4W6WA 4YGBA 4AK3A 4ZU7A 1OD5A 1YI7A 4OULA 1HW5A 4ORFA 2UWCA 3S7IA 3ASIA 4TZDA 3M8LA 1URXA 1PK6B 2ZCWA 3EO6A 3R0RA 2TNFA 4QPYA 3NVCA 1N3PA 2B39A 2XBO2 1AR93 4DOUA 1NE4A 4KWKA 4L9BA 2KXLA 1VB4A 1DHKB 2PHFA 1CAWA 1YFXA 4I2OA 1WUVA 1UZZA 4JGZA 4AHWA 5FQ0A 5FOJB 1QXPA 3MDPA 2WT2A 3D0JA 1TNFA 3D5OA 4Y1UA 5GZFA 1FOD3 3BODA 1AVBA 1BXHA 5C9AB 2YGLA 3U4XA 3SMHA 4ITCA 1HLCA 1QXRA 3WHUA 1ZZCA 4Q0UA 4E27A 3QBQA 3ZXDA 3GHNA 3WG1A 2PHDA 3RQ0A 2QJVA 4Z82A 4HBNA 4LO4B 4QPIC 1NY72 4YVWA 4HKOA 2NP0A 4XDQA 1HXS3 3J8F3 4HSLA 5AFBA 5GLUA 3BALA 3B5LB 1OFNA 4RSUA 5DXDA 1ENXA 1RUF3 1W0PA 2D3SA 1SLCA 4HK8A 4MGYE 1PIV3 1MS5A 2ZMLA 4COUA 2ZZJA 2OA2A 1DQ4A 4I0AA 1AR72 1PZ8A 1H2LA 2DCKA 1RVF3 4AGVA 3WX5A 2D97A 2GU9A 4IEYA 4KH9A 4UW5A 3TWIA 1B35B 2WSVA 3AJYA 5A32A 4Q1RA 1G7YA 5EJ3A 4FPCA 4PDWA 5GALA 3VBOC 5AC93 3SITA 1PMIA 3THPA 5BNOC 1D2SA 2GNBA 2WL1A 4YZ1A 1DQ0A 1O5LA 3FBYA 1OA4A 3LOBA 4DPNA 2JDZA 3N4MA 1SACA 2P3KA 2XPJA 4AVBA 3L2YA 3ZXGA 3HN1A 3WW1A 1ULGA 3LWCA 5T5JA 3RJRA 5CVRA 4RHV2 5JOYA 3U07A 2W08A 1J1TA 3O0XA 1UZYA 4IETA 1QJY1 4KL1A 2A6VA 1YFWA 1CAVB 3N3HA 3BU7A 1NXD1 2W52A 3SH3A 4EJRA 2ZX4A 2YY1A 1HQNA 4LE3A 2XLGA 4JRLA 1ULCA 1EAH2 4K7JA 5IT6A 1SLAA 1CAUA 4PBOA 4WM7A 4QPGC 4F7ZA 3OJBA 4FQ4A 3JD71 3GALA 4XMIA 1S0CA 2D6KA 5GLWA 4IEVA 1AJKA 3HMYA 4B3NA 4A7KA 3VLBB 4YGEA 4OHWA 1DYPA 2X5IB 5C6CA 4LBQD 2XKPA 1JN2P 4OFGA 4RQPB 1VJ2A 1LGCA 2FZ2A 4JC1A 1W6OB 4X8PA 5LRRA 1O91A 4AQ2A 1MQTC 3I2DA 1RB8G 1GZWB 1A78A 3OPZA 4RR3B 1C5IA 2WA4A 3PMEA 4JQRA 2C9AA 3KT7A 1N1TA 1C1LA 1QJX3 3TN91 1CAWB 3VBHB 5LK7B 4BQ1A 1FMD3 2NMOA 1RUC1 3VKNA 1HRI1 4KWLA 3AFKA 1A3KA 1W6PB 2ZZQA 1QDCA 4L8QA 4DS0A 1AL23 1UF2C 3I4IA 1SEFA 4CDWB 1UCXA 2RHPA 1OKQA 3VBOA 2WLQA 4GH4A 4N9HA 4WM8A 2BW8A 5C33A 1MR5A 1I1EA 3UJOA 2RS31 3R4DB 5A3LA 3RSJA 2ZGKA 4N43C 3WT3A 1QQP2 3CU7A 4CEYC 1CPMA 2BNOA 4FPKA 3OGJA 3OY8A 3P3NA 4JVAA 5T54A 4YVWB 1N3OA 4B7EA 4Z92B 2CWSA 1JUHA 2E51A 5FTTC 3GZAA 4FAHA 1W6OA 1RHI3 1VBD1 1AR82 2WT0A 3USUA 4IEUA 2XWBB 2HWF1 4CDXB 3EHKA 4EWEA 4CEWC 2PQQA 4YM1A 4F8AA 3WQ7A 4I3PA 2XJSA 1DGLA 1J1LA 4XBQA 1Z7S2 5BY5A 3JU9A 2R041 4FTEA 1PNGA 3WQ1A 1Z7S3 1ONAA 1Y9QA 5HCAA 1H1MA 1YHFA 5FMOS 2JG9C 4AHXA 2Q30A 1HQWA 2WIIB 3TYJA 3ILNA 2RJLA 2OZ6A 3GBFA 3MLJA 4AHYA 3VN4A 4KGQA 4AXOA 4ZKTB 2GNTA 3AFGA 2CL2A 2GNMA 2G9GA 1NE6A 4FOVA 5BNNA 1MS1A 1H8TC 4XXPA 1YO8A 1MVQA 1ND3C 1NQDA 5GZDA 3MEPA 3JCIA 4G9SB 5HXVA 3ATGA 4RA0A 4F83A 5EWSA 2A71A 4IEWA 4AI2A 2AYHA 4P9GA 3AKPA 2HWD3 1RITA 1XNCA 2GNDA 2D3PA 1FOD1 2MEV2 1ZBA1 2QKDA 4QT6A 3LA3A 1UKRA 4Q4Y2 3POYA 5DDJ1 1GLHA 1IKPA 2BVBA 2JX9A 4AE2A 2QCSB 1OLQA 4P14A 1WGPA 2G4IA 2CV6A 2LTNA 1QJU3 1QJX2 3E5QA 4GWMA 5I0SA 5D1IA 3QACA 1YRZA 2PHTA 2C1FA 2I45A 3RNSA 5CAZA 4NO4A 1NZCA 2ZGRA 2DVDA 1SLBA 3KCYA 3NW4A 5JOZA 4FPOB 2ZGOA 1DFQA 1IS4A 5KXDA 3ZYPA 4BZ4A 3K51A 4OVEA 3H7JA 5C8CC 3MYXA 1SCSA 4IERA 5K0UB 4G4FA 4LUKA 1IPJA 4K3UA 1W2UA 2A5ZA 4HKLA 4AEDC 1KJLA 2QDNA 4P9YA 2HWC2 4Z8BA 2PHLA 4EN8B 5C8WA 1GR3A 3E6BA 4RQPC 3S30A 4M01A 3M4FA 3PVOA 1DU3D 3O12A 1F31A 5DG2A 3VBRB 1MEC1 1O3SA 3NKGA 3PNAA 4YW1A 1LB2A 1AYN1 2AUYA 2PAKA 2P17A 1RUI3 4KG8A 4HPKB 2XKOA 1OPOA 3MF6A 1RJ8A 5HI0A 1V6JA 4RR3C 1GFF2 1WCSA 1PO23 3OYWA 1DZTA 3RJ2X 3OCPA 1RUE2 4QGNA 4C1WA 1PZ9A 4G3YC 1U5YA 2ZA9A 5JVVA 3QLQA 4DNYA 2VVFA 1QJY3 2R072 2BGCA 2ZHNA 1AX0A 4OI1A 5C4WA 2IWGB 4META 4HVQA 5JZGB 2YMZA 1PIV1 4DY3A 5JSOA 3WG2A 1J3PA 3IWZA 4PDWB 1CGPA 3VBFC 3NV4A 1BEV3 1AR73 2RMU3 4YZ3A 3ST7A 2Q1MA 1RVF2 1WBFA 2R6QA 4PLMA 3VHRA 4F3JA 3MW3A 3UKVA 2RS11 4XPVA 1PIV2 4XOGA 2ZGTA 1A8DA 2ETEA 3WVJA 1Q5OA 4FP3A 1GICA 2EIGA 2Q8OA 3SCGA 4BHPA 1KITA 1RL3A 2BFUL 2JE9A 4W65A 2UYBA 5T55A 1ZRCA 2OIIA 3ZMOA 4FPFA 1S2BA 2V73A 4AFMA 4CRQA 4D7YA 3WP3A 4YM3A 5CA6A 3B94A 2NMNA 3AP9A 1ZNPA 1O3RA 3WDUA 2QNKA 2WNUA 3IM0A 4OUMA 2WNVC 4CEYA 5EV7A 3AMMA 3V64A 1O4YA 1ZVFA 5JIUA 3Q9OA 1MZFA 3NL1A 5DDJ2 5FDBA 4B7KA 3CJXA 5KXBA 4N53B 1CESA 4BLJA 1BYHA 4Q4W2 1LOEA 4B4QA 2YROA 1D0GA 1VLNA 1COV2 4K21A 4HANA 4IV3C 5H9RA 4AFAA 1ND3B 3B3QE 1HRV2 2R062 1NYWA 4HFSA 1DQ6A 5C4WC 3WP5A 1VBA1 4OI4A 1DZRA 4Y24A 3LSDA 2OYZA 3WW4A 1XNDA 2W0XA 4E2SA 2R1BA 3THTA 3KS7A 3VBSB 1VBA2 4AI1A 1XYOA 4OHVA 1OQDA 3VBUA 1OA2A 3WD5A 4BMEA 2ERFA 4LHLA 3MIHA 1KS4A 3BOWA 1CQ9A 3WDVA 4PJYA 3NSTA 2BEOA 4N53C 3ZO0B 4MYEA 4XHXA 1C57A 3INAA 1MEC2 1W6MB 4MGZE 4O9GA 2ET1A 1ZREA 5C8CA 1R092 1AF9A 1X8EA 4IV3B 3J8F1 5B2GB 4HVRA 1NLRA 3RI8A 1V9U1 2VY0A 2A6WA 1ND2B 4KBBA 2JECA 2JD4A 3VKOA 2RS52 4Q29A 5JSRA 3QD6A 5FQ0B 5FFOC 4A7ZA 4D7TA 4TYSA 1C28A 1R1A2 1C4RA 4COZA 1AYN2 2B9UA 3RRDA 3ZYIB 4HSJA 1KRIA 1Q8OA 2KM2A 1AYM3 1SQ4A 3AYCA 2A70A 4YG0A 2XJPA 1AR71 2QUOA 5K8SA 1AX1A 1POV1 4Y1XA 3KT4A 4QQPA 1MZ6A 2XG3A 1DG6A 4XFHA 4BA6A 1VBD3 2WQZC 3AJZA 4Q0VA 4IEQA 2D5FA 3KCXA 2AR6A 1DDLA 2JG8A 2BWAA 1WMEA 1DQ1A 3ZFGA 5DDJ3 5DZGA 3VBFA 5DG1A 3VBOB 1SFNA 4COWA 4K20A 4DMIA 1V6KA 4MGKE 1AR62 4JGYB 4R9BA 4AW7A 1IS5A 4BMBA 3M3IA 3FZ3A 5EXOA 4I02A 4FT8A 3WCRA 2DVAA 4BWOA 4RR3A 3H50A 2A6YA 1RUI2 1VRH3 1CAUB 3ES4A 1TMF3 2IXJA 1Z0HA 1I5ZA 2A3YA 4Q4V2 3VBUB 1O4TA 3AZVA 5DZEA 4COYA 1ZZ7A 3PVEA 4RQPA 4FAGA 5JWPA 1OA3A 1FI2A 3PVBB 2HWD2 5JSPA 4CDQB 3CO2A 3RYKA 1BEV2 4M0HA 4YYOA 3LAGA 1JH5A 1PO13 3O0WA 4Z07A 1QJY2 3MIGA 3FE5A 1TNRA 4LA3A 1YIPA 5FLIA 1U12A 3VKLA 3AMHA 4H3WA 4ASLA 2WS92 1EP0A 1H1IA 1BZWA 1WD3A 4Q4X1 2GMMA 3CJIA 4C0BA 3OF1A 2WZPP 2F4PA 2ZABA 2XJTA 2N7GA 1LU2A 2ZPXA 2WFF1 3TB0A 1VAVA 4R4ZA 4MVTA 3V0BB 3B9IA 3WDWA 1QGLA 3JBG3 2B8MA 4GALA 2UU8A 4KU8A 2VMIA 4LBMA 4U2AA 4PIYA 4K9SA 3IPVA 5FREA 4FXKB 4CP2A 1FV2A 1S55A 1XRUA 3ME2A 2P37A 3GHMA 2GC3A 3MPBA 5BNOA 1O3TA 2YDEA 3IDBB 3LB9A 4NR1A 3ZIWA 2ZKNA 2WC2A 5I8TA 4QMAA 1D4M3 2E9QA 1RUH2 2JEMA 5JCTA 2EVXA 2PA7A 4AGRA 1BBT3 3MW2A 2R071 3ZN6A 1CJDA 4IEOA 3X29B 2AREA 5AVPA 2VMGA 3V0AB 1KQRA 3HAGA 3CF6E 3OD0A 3WXPA 3S0MA 1LEDA 2A3WA 4GB33 1YXWA 3ELNA 3J9SA 1I6XA 1L3JA 4YVWC 2HWB2 5I8YA 1MS3A 2YV8A 2HEYF 3IPVB 4Q27A 4Y22A 4FBFA 4JAAA 4YLZA 4MLOA 1R1A1 2FZ1A 5H9SA 3VKFC 1AXZA 1XNKA 4AFCA 4XQWA 5CB7A 1ASJ1 3SHRA 2WNVA 4I0WB 1LU1A 3N7MA 3HQXA 4FOYA 4KU7A 2Y38A 1D4VB 3IIAA 3HT1A 2R0FA 2NZ9A 1KDKA 2W39A 1AR81 2ZKLA 2TBVA 4Y4YA 3IMNA 1LHWA 1VRH1 4HLTA 1G8WA 2VULA 3AZYA 1UPIA 3GBGA 1SBFA 1RUD3 4Q2FA 3VBFB 3T2TA 3M3QA 1AR61 4A7YA 4QU2A 2E7AA 3VBHA 3FFZA 5L7OB 4XBLA 2XLFA 2X5IC 3MIBA 5C9AC 4JDMA 1V6OA 3SNMA 4Q4W1 4FP2A 5BPXA 4IV1B 5CG9A 1ZBA3 3AKQA 4CDQA 2B45X 1LOFA 3DUIA 5ABJB 4YG6A 4CZSA 1X50A 2VU9A 4Y20A 1RHI1 1LCLA 4N7IA 1ZRFA 3SXWA 3DPRB 1G6NA 1R1A3 3AYDA 2Q1ZB 2K2SA 1EAH1 2R1DA 3TOJA 5K7PA 2WS91 1Y43B 1RHI2 5J96B 1QKQA 4X6QB 1KDMA 5CIRA 5KBFA 2XH6A 4BIOA 2TUNA 1BMV2 2O8OA 2RE9A 3NV2A 1LOAA 2ES3A 2DCYA 1AZDA 2IZWA 3AZXA 3KZ4C 1YIFA 5FPZA 4LBQB 1WLDA 3WUCA 5F9TA 1GSLA 5T5LA 5I0RA 2D44A 5FO9B 1O3QA 2PAMA 1OFSA 1REDA 2JG8B 2ZAHA 1FMD2 2Q4SA 2O8QA 1TQ5A 5A3MA 3KM5A 4GB32 2D7FA 1UIKA 1GV9A 2C0ZA 2B46X 3P3PA 1QOOA 5K0UC 2R16A 1YWKA 4AEDB 2PTMA 2XJVA 3SCHA 3EJKA 5HCFA 1UX6A 1X7NA 2I2SA 2Y0IA 4CDUB 3TRSB 4ASMB 5T5OA 2OW4A 1G9DA 4JGZC 4TLFA 4YRDA 3V0AA 4MXVA 4FPYA 3TN92 4V1PA 1CVNA 2GAUA 3KGLA 4INDA 4Q0SA 3E6CC 3NJZA 3ZFFB 5ACA3 5KC5A 5KXEA 4AVCA 2RR11 1OQEA 1IS3A 4OLLA 4Y22B 5JDBA 3RYPA 4BH9A 4UBGA 4XF1A 1LR5A 1RMU1 1FYUA 3M70A 4LA2A 4M0NA 1V70A 2ZGLA 1ULFA 4QPGB 3ZSLA 1ND2C 2XBO1 1HX6A 3USUB 3M2MA 4XILA 4PDWC 2CTVA 4Q4W3 4UW3A 3ZXFA 4FPJA 3ZN5A 1AR83 4N9IA 1PVC3 2DCTA 3CNAA 1PGSA 4Q8KA 2VUAA 3H3ZA 1SLLA 3MW4A 2HWC1 5HCBA 4EROA 4KQ7A 5FLHA 1EAH3 1IQAA 4E9KA 1BCXA 1OSGA 3JQXA 4LUMA 4ZU4A 3ALQA 4AI0A 1RUI1 1LGBA 4EN7B 5K0UA 2EALA 2SBAA 4JDOA 1JOJA 2XL7A 4HL0A 4EN0A 3A0KA 4RS5C 1N1SA 1ENSA 4QPIA 4XQ4A 1Q8SA 2R30A 5EYXA 1UMZA 3AMPA 5FMOL 5JIAA 4D7SA 2BWCA 1RUG2 1QXJA 4XBNA 2XHKA 2QQPA 4S2GA 3CLPA 4YNIA 5JOXA 3W59A 1NCQC 1TMF2 4YW3A 2I07B 3GBWA 2WZR3 1BEV1 3NO8A 1AL21 2Y26A 1OOPB 1RUG1 3VL8A 2Z69A 2XUMA 1WLWA 3HBZA 2EAAA 2JE7A 5L7OC 4YG3A 4P9XA 4Q4X2 1QJX1 1FNYA 3TN93 3FC0A 2X8KA 4MSVA 2WSUA 1D2QA 3U10A 3UKTA 2WWSA 1D4M1 4H55A 2PLV1 2H0VA 2SLIA 4NHKA 5EYYA 1KXGA 2EXHA 2EF6A 4OI2A 1ENRA 1YFYA 4M3CB 4PF5A 2TEPA 5CFCB 3DPRC 4HZFA 1FT9A 3LKJA 3D6EA 1SBEA 4WM7B 1GYKA 3VZNA 4MZUA 3LOIA 4RFT0 1JHNA 2DWRA 3NAPA 4CEWB 4FVVA 1IOAA 4GB31 5DUWA 4GKYA 1S0FA 2XVLA 3IT8A 1G9BA 1XYNA 5FCCA 5IK4A 4E2QA 2DCJA 1MZ5A 3MZHA 1CPNA 4HMZA 2DU1A 3BPZA 5GZGA 4YVSA 5CFDB 3BTAA 1A6CA 1AR92 1YNAA 2DFBA 1R082 4QQOA 2PN5A 1BVVA 1YI9A 1UN1A 3KLSA 1EYBA 1GZ9A 1V6NA 2VMHA 3TAYA 1DF0A 2UWAA 1H8TB 5J3UA 1FMD1 4DINB 1Q8VA 2CGOA 3ZN4A 1ENQA 2RS32 3B02A 3NAPC 2JG8C 2K9ZA 3JUUA 1WW6A 4YM2A 1REEA 3VZOA 5EFUA 1VBA3 4YW2A 5AC91 2GALA 2O0OA