1TETH

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
210
structure length
209
Chain Sequence
QIQLVQSGPELKTPGETVRISCKASGYTFTTYGMSWVKQTPGKGFKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARRSWYFDVWGTGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 209
sequence length 210
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetH02
2HKFL 3MLUL 5I1LA 2WWMD 5EH1A 5E5MA 2CR6A 4G7VH 1OGTB 5C6PB 1LO4H 4OQTA 2BNRB 5I8OL 4PJ5E 25C8L 5F70A 4HIEB 1HXYB 4JG0H 4MXQC 4WHDA 1CE6A 4K7FB 3ECBA 2NYYC 2ICES 5JIHA 4TRPH 1BECA 4QHLB 4KQ3L 2FECL 4K7PY 1LO0H 1AP2B 1I7ZA 2F5AH 3QEHB 5ICYA 3KJ4C 4RWYL 5KSAD 2VLKE 3G08A 3L3KB 5MI0C 4L8CA 3RWFA 3W9EB 5JHDA 3G6JB 43CAA 4HDIB 1I85C 2Z91B 3M17B 2EXYD 4OZIA 4ZFZB 5LGJA 1HKFA 1KIUA 5HYSB 5M7QA 1YDPB 1UJ3C 4N0FB 1VFAB 4QCIA 5IB2A 4OV5A 4OCRH 5DRXB 4MB5A 1IAIM 1ES0A 4MA1B 5DRZA 4OGYL 2J1KA 1CL7L 4CKVX 3BRGC 4NGHH 1BFVL 4PLKD 2YWYA 2W1NA 4ESKA 4HMDA 3AFLA 3Q6FA 3EO9H 5DR5H 3KPMA 3QA3B 4FXGA 2R9HC 4MXVE 4LNVA 5INCB 5IB3A 4ZPTB 3SHSA 5FDWA 4MNQE 5E2WH 1D5IH 5ESAA 2EDQA 2CK0H 4S1QH 5HI5D 1IARB 1K6QH 4RIRB 4J3VA 1AO7B 1VEOA 5IM7B 1IMHC 5EUOB 3H9SE 1JF6A 1UM6L 4G43A 1OP3K 3O2DA 1XGQA 3QUYA 3VWJD 5DHYA 1BHGA 3QFJA 1MCPL 2F53D 4KH2A 3VFOA 3HMWH 3LKQA 2JJWA 4OGAC 4Y88A 4LOUC 3VXOB 3QXAB 2NY5C 2IANE 3BZ4B 3RUGA 4I9WD 5E94B 1OSPL 2VDLH 4FQPA 1CIDA 5IWLC 3G5VB 1Z3GL 4YFEA 5F1IA 5F6HJ 1A7OH 1K8DA 1LO5B 3PHQA 3RHWK 5K9KB 3KPQA 3WUWB 4F7EA 5EU6E 1KELH 4NUJA 4C56D 1FVEA 2VLRE 5IJKC 4U6YB 1FL3B 1YMHA 2FEEL 2RFXB 5H2BA 3CK0H 1I1YB 4R7NA 4BZ2H 3OAYH 3BKML 3NGBB 3AMKA 2GEEA 1DFBH 1KACB 4X6EB 4O02L 4L9DA 1YY8A 3TC9A 5I0DA 3BQUD 3D25B 2HLAA 4G6FD 4WEBL 1TTUA 2X9XA 3SBWC 4TUOA 1Q8MA 1SYSB 5DI8A 5I16A 3ARSA 2BNRD 3ALWA 1S7XA 4YIQA 2A6KB 4ZAKB 1EBAA 4KK6D 4WWKB 3TBWA 3ALPA 3QRFM 4AEHH 4JRYB 3LIZH 5J13B 1BP3B 1ZVSB 2MMXA 1VDGA 4NHUB 3C5SB 2CIKA 4LHJB 2E5EA 1TZHA 3OKOB 5DJ6B 2VKXA 1T1ZB 2A0LC 3MLYH 2IADA 3GRWA 3L3GB 4U1GC 4MCYA 4Y5VC 5HHMB 4PB0L 3FT3B 1SJVA 3O6ML 5DO2D 4D9QE 2H1PH 1CGVA 4GW4A 1UH3A 2IPKA 4LGRB 2CD0A 1D9KC 1F11A 3VI3E 2GK0A 2OL3H 1S5HA 4NO2B 4E41B 1FNAA 5CEYB 2QADC 5C08E 1T2QL 3F7VB 4KFZC 2D3VA 4N5UA 1KLUA 5C0FB 2WIIA 4IOFD 2PF6A 1LO2H 1CLCA 2OR7A 5TPWH 1T3FA 5DJ2A 2OM5A 3TNMB 4MJ5A 3PWVB 3FO1A 1OP3H 5CGYD 3MLXH 3RTQB 1FNFA 4S1RH 5TQ0H 1K4CA 5LWYH 2ICWI 3GNML 3WEXB 1NMCB 2EZ0D 5GGRY 2IGFH 4ZPVB 2VSDA 3DRQB 2Y6SC 3MLSH 3QNYB 1RZIA 3QDGA 4RMRA 4OZ4B 5IROA 3LCYA 1AO7D 2ZUUA 4LSVH 5CGTA 3DO7A 4OTXL 1F90L 3MRMA 4DCQB 2I24N 2WWKT 2XIDA 1CZ8L 4F9PA 2XWJB 4YDJB 2ESVE 1NANH 3LS4L 3UZQA 2YPLE 5GGSA 2P24A 1RULL 3BYYA 2QQQA 3CSPA 3EOBB 3DRTA 5CJXA 1U8OB 2P5WB 4JFEB 2IMMA 2D7NA 5TDOA 5J56B 3V4PL 2DBLL 1XH3B 5L7XL 1U8MA 3GSNL 2L0DA 5IK3A 3SDAC 2FD6H 2H9GB 4M93C 4GAYB 4XNYH 5HDBF 4PRPB 1N2RA 1MFAL 1UFUA 3DV6B 2KQMA 1WV7T 2Q20A 5DD5H 4FFVC 3C87A 4PG2A 3G9VA 4IRSC 1CGSL 3MRKB 2FWOA 3NZHL 1LP9E 2IFFH 2VDMH 1CLYH 2C1OA 1S5IH 4BH7A 5F8RC 4JM2F 3GHBH 3HB3C 2BRRL 1U41A 3MV8A 4UOW0 5CSZA 4Y5YA 1KTRL 3BT2H 3GO1L 1NAKL 4GAGL 3QUZB 1RI8A 4I9WE 1BBJB 2Z0BA 1RURL 1P4BH 2I60H 3HG1B 5D5MB 4BQ9A 1JV5B 2FSEB 4ONGH 1UC6A 4ZOEA 4M7ZC 3VXSA 1XGPA 4JR9L 4ZAKD 4Q97A 1S7UA 5MEQB 4WWKD 2IFGA 1N26A 5I74C 4CUCA 2B2XL 3CGTA 4JRYD 3ARBB 4KROC 3HZYA 4EQ2A 2VZUA 3MOAH 4PJCA 3DGGA 1VERA 2P7TB 4GFTB 4Y16A 3GMOB 1S7RA 4TSCH 1OD9A 5J57B 4J1UA 5HHMD 5IESH 3ULUH 5KSBA 1HILA 4F7PA 4JDZB 5CINH 2KDGA 4ELKB 2C1PB 4P5TA 1OHQA 1JGLH 1F4WH 1OM3L 1ONQB 1I8MA 1KOAA 4E41D 4NQDA 2ZSVA 1JHKH 1FZJA 2ICCA 4OFYA 3RZWA 5DHXB 2HAZA 3TH3T 3PP4H 1JYVA 2DICA 4DN3L 3MJ6A 4XCCH 3RWJB 3VH8G 4Z8FL 4LSDA 3OXSB 5DJXA 4P2RE 4KVCH 3B3IB 3KYMA 2P8LB 4LIQE 4HKBB 3RTQD 3VFTB 1QFPA 5MEPB 1IEAB 4E5XA 4G5ZH 4N8CL 4K71B 4R26H 1YA5A 2GI7A 4XP1H 4N1EA 4IHOB 3HE6A 4J3XA 3HNVL 3OJDB 1OB1B 1CQYA 3I50L 4ODVH 1U9KA 1V7ML 5ENWB 3BUTA 4NQUA 2D4FA 1IKFL 5CZVL 1FQ9C 5DD0H 1TVDA 3VD3A 5T1LB 4L8BA 1AGEA 5L2KB 1KCSL 1WFNA 1CGTA 1DN0B 3UTOA 3V52L 4ODSL 4LHUA 5SX4I 3WCYA 1NCCL 4U1LA 1P7KA 1ZTXH 1GJIA 1AFVH 1NSNL 3JTTB 2XZCL 3F58L 4PJBB 3NFNA 2P5WD 3MACL 4JFED 3VDBA 3LKRA 1BZ7A 4JFQA 3HPJB 1KYOJ 2FATL 4MDJA 4RZCB 5D4QA 1NEZA 4PRPD 4WTXA 5CCKH 3VMNA 4F7MB 3GSXB 1AXSB 4NQXA 4Z7NE 5JXAL 1FZKA 3D48R 1PYWB 4JJ5B 4NKIL 4LF3A 5IVZB 4I8DA 4H1LA 5EUOE 2QSCL 5I75B 3RWEA 5E9DB 4X98B 1MI5E 4ZUUB 1GAFH 1N64H 1SM3L 3U2SA 4YBQC 5E5MB 2ADGA 2J8HA 4JPKL 5KS9B 2OZ4A 1CE6B 3QUZD 3ECBB 1DSFL 1FFRA 3HG1D 4LSTH 3O6KH 5FUZH 4WV1C 3VFRA 4WUUE 4F9LC 1I7ZB 4MMZC 5F9WB 5ICYB 1I85A 3TJHC 2JE8A 3G08B 2YK1H 3JWDL 4BJLA 4L8CB 4M9PA 3RWFB 2BY1A 2VDQH 1IGTA 1R6VA 2O5XL 2OR8A 3OG4B 43CAB 3QDJA 3UJIL 3QUXA 3ARBD 4OZIB 4POUB 4M6OH 2E9WA 4PJAE 2R23A 5TDNA 3WFEL 3QDAA 5BOZG 3QIBB 4QCIB 5IB2B 1KXVC 3A6BL 2DJUA 4RMSA 2EH8H 1UA6L 1FO0A 4R0LC 5DHVH 5DK3A 1ES0B 1YEDB 5DRZB 5EPMA 1CLOH 4B7IA 5DMJB 1B90A 3CVIH 3MRBA 1JVKA 3MJGX 4YFLF 4KRPB 4TUKH 3Q6FB 5IMOA 1F3DH 3KPMB 4H8WH 1I1RA 1JGEA 5DMGC 3MPCA 4FXGB 2D9CA 2Q8BL 1K85A 5IB3B 4YK4C 5E7FA 1W8NA 5FDWB 4D0CA 2BVEA 5ESAB 2PETA 4UDUB 1F8TL 3G5ZA 5EORL 4PYHA 4BZ1L 4YC2C 2YD6A 4X6CF 4XVTH 4EIZC 3EOTH 5EO1A 5A1AA 3CZJA 4G43B 4PBWD 4KRLB 4CJ0A 3DURB 3QUYB 3GUTB 1WQVT 5DHYB 3QFJB 2HKFH 3MLUH 3VFOB 4X9BA 4CDGC 3LKQB 4E41E 1NBVL 3DYOA 4K55A 5T1LD 3RU8H 1ZK9A 3RUGB 1MWAL 5I8OH 1MAML 5L2KD 5SX5K 25C8H 4M7LT 5CD5C 3PWPA 4WW2B 5F1IB 3RIFK 1G0YR 3EGSA 4ZO8A 2Q3ZA 4Y4FC 4JFFA 5HGAA 2V5MA 3K4ZA 3KPQB 2GCYB 4KQ3H 5C09A 4O51A 3W9DA 5IJKA 4NUJB 1FVEB 5JOEA 1CD8A 2Y4SA 5HGBA 2HJKA 3IDXH 1MVFA 2F19L 4RWYH 2JELL 1YMHB 4ENED 4R7NB 2GJ6B 5GISL 4F15B 2ZUWA 3O3AA 3UCRA 1YY8B 4WY7L 1WAAF 5HI3C 2HLAB 4OGYH 4QXTA 1MRCL 5E9DD 1CL7H 2VRAA 3I2CL 1QBLL 3GJFA 4LLQB 1BFVH 1CDIA 3S88L 4TUOB 2OSLA 4PY7A 5DI8B 5I16B 5DVNA 1S7XB 1JE6A 2Y5TA 4MVBC 2OJZL 5E2JA 5DUBA 2ICEA 4WEMB 4QO1A 1P5UA 3VFUA 3SJVB 1Z5LA 4PJEF 3UTSA 4PRPE 4DZBB 3TZVC 1NBZA 1WZMA 2LAGB 2IADB 4MCYB 4EDWL 1D9KA 2V9TA 4GW4B 2DQHL 5ESVB 2IPKB 5E2UL 5TQ2L 1UM6H 1F11B 2CR3A 3O3EB 4NBZB 3QIBD 3U4BH 4NZTL 3ZT5A 3BOVA 1MCPH 3AC0A 4M7JH 4DFIA 1RZKC 2E6JA 3DROA 3EYSL 5DVMA 1KLUB 5FYJE 2WIIB 4JRWA 2PYEE 1OSPH 1W72A 4YXKL 1Z3GH 4KRPD 1T3FB 3ISWA 5DJ2B 5ERWA 1HH9A 4MJ5B 4ZMAT 3FO1B 3VXNB 2YS4A 4L3AA 1PSKL 5CLTA 5IMLA 5KSUA 1K4CB 4U1NA 1MIML 4PJIA 1BJMA 2EYRA 1NUDA 4XVUD 4AT6A 3AM8C 2QEJA 1RZIB 3QDGB 3GBML 1P2CA 2GTZA 3IETA 4LHQB 3BKMH 1EEYA 2F54A 2NMSA 4LCCA 1NGWA 5F3HB 4O02H 5I1DA 3QZWG 3MRMB 4PJXB 3MLPA 3LRSA 4KGLA 3EDJA 4QRQB 2X1XR 2YZ1A 4TUJB 5ITBL 3MRLA 3QUYD 4WEBH 3VGGA 4FQ1L 3QFJD 3S5LG 5GGSB 2P24B 4G8IA 2C3GA 3K3QA 4JO4L 4XHQA 5TDOB 2VWEC 1F13A 3VRLE 2NY1C 4RRPA 1F4YL 2FZ3A 1U8MB 1J0KA 5IK3B 3U7WL 2FX9L 2H26B 3AGVA 1A1OA 4NN5B 4OF0A 4UIKL 1JL8A 4WENB 1RJYA 5HYIA 3CH1B 3SCMC 2H2SC 1ACZA 5BRZA 4NHCL 1N4XL 5D7IE 4XP5L 2FWOB 2AAVA 4PB0H 3NPZB 2GJ6D 1S9WA 3O6MH 3H3KA 4JFOA 3SO3C 5JUEL 1QRKA 5CZXD 4LVNB 1BGXL 5C8JA 4PJGF 4BH7B 3FB6A 3PE9A 5M95B 1D3CA 1BX2A 5C07A 2MOVA 3MV8B 1YEKL 5DVKA 5LQBL 4JE4B 2DL9A 3QJFB 4L9LA 4Y5YB 5CSZB 3TIDA 1XEDA 1T2QH 5L2KE 1HHKB 3TFKD 5E8OA 4WTWA 4LP4A 4FP8L 5JW4Q 4JPWL 4Z7UA 3VXSB 2DTML 3VXPA 1XGPB 5LG1A 1P1ZA 1QRNA 1S7UB 3E6HA 3ZDYE 3QPQC 4BSJA 3PNWA 3GNMH 4XGZA 2C26A 4UI2A 1KTDA 4HZAA 3SJVD 4O4YL 3DGGB 4ZQKA 1AH1A 5F9OL 4Y16B 1A14H 1S7RB 4UT7L 5FM5M 1FP5A 5KSBB 1HILB 1F90H 1QVOA 4OTXH 4F7PB 2ZG1A 1HQ4A 2VTFA 1CZ8H 4P5TB 1EXUA 1FL6A 2YBRA 1I8MB 3PABA 3LS4H 4LEXL 4NQDB 3HI1B 2ZSVB 2H45A 3R4DA 1MLBA 1AHWC 4Q6YA 1LMKA 3IJYA 1FZJB 1RULH 1DANU 4LIQL 1DN2A 4JDTL 4UMGA 3B9AA 3WUWG 4EKXA 4U2ZA 3V4PH 4XPFL 2DBLH 4M02A 3THML 1F6FB 1NC2A 5L7XH 5KVGL 3GSNH 5DJXB 3FAXA 4M8QA 1EA9C 3KYMB 1F3JB 5HHOE 4MD4A 3ZKXB 2FO4A 1MFAH 4YHYB 4E5XB 4Q0XH 4PJFF 4Z76A 1JYWA 5MERA 1T0NB 3HE6B 3KS0J 5JHDE 3V7AE 4J2XA 3MRRB 4HX1A 4G8FB 4APQA 1CGSH 3QDGD 3NZHH 1VESA 3HPLA 1WITA 2DJSA 3DUSA 3AU1A 3Q5TA 1KCLA 5LVEA 4L8BB 5F96L 5JHLL 2BRRH 3DWTA 1AGEB 1NGZA 4HJ0D 4XNXL 3GO1H 1NAKH 4GAGH 5FUOL 4LHUB 1RURH 4LVOC 1P7KB 1QSEA 1QLFA 3S4SG 3NFNB 4ZTOH 2H32H 5LXGL 2WINA 4KY1L 3OB0K 3LKRB 4WRLA 3ZYJA 4JR9H 4HC1L 1BZ7B 4JFQB 1CG9A 5B39G 4NJAL 4MDJB 2MPAL 1Q72L 4X4XA 1FIEA 2B2XH 3TVMC 4PYGA 4ELME 2R1WA 5H8DA 1MH5A 4XPAL 3JXAA 3KPLA 1FZKB 3AS3A 5EDXA 2IQAA 4LF3B 1KEML 5D6CA 1U3JA 3RWEB 5JOFA 2JJSA 1W0VA 3WS6C 3U2SB 1J0YA 1Q9LA 5SWSA 2ADGB 1OM3H 3MV8D 3F7YA 1CVSC 2OJEB 4DN3H 4AIXA 2XOTA 2R69L 4Z8FH 3VFRB 2RR3A 1KLGA 3VW3L 1PD6A 3VXUB 3VXSD 4PG9B 2H2PD 3QIWA 2YHGA 3PL6C 2AV7A 1AGDA 2X05A 1IGTB 4N8CH 2G2RA 3JVGC 3W2DL 3IYLW 3QUXB 3HNVH 4P4KB 1CFSA 3TYFB 3I50H 1HHGA 2QSTA 1DVFA 1V7MH 2R23B 4R0LA 5TDNB 3OJVC 1RUKL 5FIEA 3X17A 3FQWA 2ITCA 4OV6F 4Y16D 2NCMA 1FO0B 3D9AL 1IKFH 5CZVH 5F7UA 3K2UL 3W0WB 5I71C 1DUZA 2LQRA 2VAAA 4Z18A 1KCSH 3UBXB 4P5TD 3MRBB 2DLEA 3V0AC 1RV6X 2X1QA 3V52H 5L0QB 4ODSH 2ATPA 1NCCH 5IMOB 4NQDD 4JFDA 2B4CL 3HTLX 4CW1A 1NSNH 2X40A 2XZCH 2QBWA 3F58H 4OFYD 5KOMC 3MACH 4UILL 1F6AA 2Y9RT 4CMHC 2DIJA 2XA3A 3AY4C 4NOBA 4D0CB 2FATH 1CDBA 2ZUSA 1ZMYA 3SKMA 3P0GB 2IPUG 1JF5A 2OX5A 4IJ3B 5JXAH 2IH3A 3HE6D 4NKIH 1MCRA 5EO1B 5FO8A 2QSCH 4JY6A 3RJQB 3EAKA 3WJJC 1SM3H 4GKZB 2BHUA 1A4KA 4UDTA 1RHHA 4IBLT 1AD9A 1INEL 4JPKH 3AMLA 5FDYA 1EVTC 3LEVL 4P3DA 3NCJL 3PWPB 3EGSB 4LHUD 1DUYA 2V9RA 1DSFH 4JFFB 5HGAB 5C09B 4O51B 1EX0A 3W9DB 4U0QB 3LDBB 3CFEA 3U36A 1MVUA 4G9FE 5HGBB 4MAYC 1X5FA 2HJKB 4TNWF 4DQOL 3DUUA 1J9CT 2Q86B 1CCZA 3JWDH 3K4AA 2IAMA 3PGFL 3V7MA 2YD9A 1PX3A 2O5XH 3OKEA 1P4LA 3QDGE 2A74A 1SJEA 3WFEH 4PY8I 5HVWA 5F7YC 2F9BT 3DECA 3O3AB 3UC0L 3A6BH 4Z7VF 1UA6H 2A2QT 4XC1L 1N7ML 1JGVL 4QXTB 3O41A 4OD2A 4MDIB 1F2QA 4JO2L 4RFEB 3PUCA 4WHTA 1L7IL 2OSLB 4PY7B 4MXQD 5GRVK 3AREA 3UP1A 4NRYA 2I27N 2EXWC 2Y5TB 1FORL 5DUBB 3IKCA 1BLNA 2EYSA 2ICEB 2ZKHL 4MB3A 3ILPA 2X4QA 2FHCA 5A2JH 4RX4D 2Q8BH 4M1GL 2UVEA 5IB4A 2GFBA 1Z5LB 3DI3B 3UTSB 3VXUD 1F8TH 1NBZB 3N1FC 2R2BA 1U2HA 1TFHA 5DFWH 1A6VL 1A1MA 4FQIL 5A2FA 5EORH 1T04B 4BZ1H 5I9QC 5HDOA 2XN9B 4P4KD 3QUXD 5FYJL 2AV1A 3MTRA 1NFDB 1GZQB 4PP1D 2DLFL 3M1BA 2BY0A 2ED8A 3QIUB 2VDKL 3VCLA 4FG6C 3RDTA 1GOHA 1NBVH 3W0WD 3VXMA 1EHXA 1MWAH 1W72B 1MAMH 4OFVA 1PVHA 4HZLA 3WNKA 1WLHA 2E7BA 4LASL 5LAXA 5ERWB 2DQGL 1XGUA 4Z0BL 3EHBC 2C5DC 4YHNA 3C8KB 3MRGA 1U42A 5IMLB 2UYLA 5KSUB 2OR9L 4U1NB 3FCTA 5KVDL 4BFGA 3W39A 4PJIB 2EYRB 2F19H 5BQ7A 2JELH 1ZT4A 4ZO9A 5JQ6L 1P2CB 3LHPL 2GTZB 3IETB 4PJCE 5CJQL 1EEYB 2F54B 5FV2A 4LCCB 4JHWL 1NGWB 3WFZA 1REIA 3IU4L 4F33A 1E4XI 5I1DB 2LTQC 1R3LA 3RGHA 4WY7H 3LRSB 2HLFC 3ULVD 1D6VL 4WNQA 1OL0A 3ZZ1A 3K4DA 5DRNA 3EFFA 5F7LB 2FCBA 3I2CH 2VXSL 1QBLH 4L5FL 5F6IC 5DFVD 3BPNB 3VFSA 3S88H 3GI8L 4G8IB 4JREB 3PXHA 2CMRL 4HFWA 5SWZE 2OJZH 3PWPD 2FZ3B 4U7MA 3EYQD 2R56L 1F02I 4JFFD 3ZL4L 1U2CA 3O0RL 3OR6B 1A1OB 2YRZA 4ZUSA 5C09D 3EOYG 2B8OT 5L9DL 3HE7B 1RJYB 2YPVL 4RGMC 2O93L 1CXKA 5BRZB 1QLEL 2X5PA 4CADA 4EDWH 5E00A 3KXFA 2K9UA 1S9WB 2OQJA 4JFOB 5DZOA 5I1CL 2DQHH 5C8JB 5IVOA 4AK1A 4DVBA 5E2UH 5TQ2H 1OY3B 4XPTL 1BX2B 5C07B 1WFTA 4NZTH 1MHCA 3MUGA 4L9LB 3TIDB 4X8XA 3AUVA 2HJFB 3EYSH 3W81A 5CAYB 4OGXL 3VFGL 4M7ZB 5E8OB 4MA3A 1CDYA 2DOCA 4YXKH 4I3RL 3V6BR 4Z7UB 5I74B 4I13B 5AD0A 1TCMA 4P49A 1QRNB 4ZOAA 3E6HB 3RWCA 4M7KL 1PSKH 2I9LA 3PNWB 3HRPA 5DD1L 3MRJB 4M5ZL 1TQCC 1MIMH 1KTDB 3QFDA 4L4VA 5IQ7L 3ABZA 3UTSD 3GBMH 1ZXQA 4ZQKB 5DF0A 1QHPA 4GRMA 4XTRC 1MRFL 3L1OL 1J1OL 2Y7QA 4OQTL 1BQHA 1HQ4B 2XN9D 1I3VA 4LPUA 4BSWA 4N5ED 3RIAF 1SBSL 1EXUB 1FL6B 2YBRB 5C0NC 3PABB 5ITBH 3NVQA 4FQ1H 3QIUD 1MLBB 1L0YA 2M2DA 2BVUA 4JO4H 5J3HD 4X80L 4P2YA 4OUUA 3HFML 3L3DA 2V5SA 4OQ1A 1NC2B 1F4YH 3QAZB 2XZQL 3U7WH 3HN3A 2A9ML 4M8QB 2FX9H 2O26U 2VOTA 4RFNC 2FO4B 1RJZA 4EI5B 4XNZB 1U8IB 4Z5RB 4Z76B 2EIDA 5MERB 4A2LA 1FGVL 4EDXA 3EJZC 4NHCH 1XR8A 1N4XH 3QDJE 1TNMA 4APQB 4XP5H 2AGJL 1DEEA 3J8F7 3HPLB 3DUSB 4HS3A 1JTPA 5JUEH 3P30L 3MRDA 2F54D 3AU1B 3ZDZF 4GRWF 1BGXH 1QP1A 4YLQT 4UT6L 4I2XE 3NCMA 5E99H 1YEKH 1NGZB 2J5LC 5LQBH 4YQXL 4HJGA 4M9OA 3DMMC 3X3GL 3AROA 5GGVY 1QSEB 1QLFB 3G6JF 4JO3L 3NIFF 1G0XA 1R3KB 2OTUA 3BZEA 4FP8H 2WINB 4JPWH 5SX4H 2DTMH 4HWEL 1XF5B 3TVMA 1CG9B 5C7XL 1MY7A 4QOKA 2EDRA 3NH7L 1KNOA 1PY9A 2GJZA 1D5XA 4PJDE 4RGNB 4YHOL 4IMKA 3SGDH 4NT6A 2R1WB 1MH5B 1W8OA 5C0GA 3B9EA 2Z8WC 3HE7D 2X10A 4PGBA 1SEBA 4O4YH 3KPLB 4J8RB 4PJHE 4C55A 1KIRA 2DWDB 2IQAB 3WS6A 5F9OH 1JWMA 4XZUA 4UT7H 5BRZD 5D6CB 4FQCL 4X6DA 4I0PC 5JOFB 3EW3B 4N68A 1W0VB 4UUJA 1ZGLP 2LABA 5IVNA 1SHMA 4U1JA 4ZS6D 1GGIL 1Q9LB 4IM8A 5SWSB 1JPGB 3FRUA 3TA3C 5C07D 4M5YL 4TSBL 2VQTA 3D0LA 3F7YB 5HYQB 3WLWD 5I73C 1IC5L 4NQEE 3O3DA 1EEUA 2W0FA 4XX1G 4LIQH 3LMJL 3WMSA 5BOPA 4JDTH 2VXUL 3PWPE 4POZC 5F9JA 4XPFH 3THMH 2Y06H 5SV3A 3PL6A 5AZ2L 1J7VR 1KLGB 5KVGH 2NTFA 1L6ZA 4L4TA 1X5AA 3U46A 1J8HA 1QRND 2WQ8A 3QIWB 1HHIA 5JW3L 1KJ2B 1AGDB 3T1WA 1X5YA 3HR5A 1NDMA 3GZKA 3P0YL 1FL5B 4OZHA 4GRLC 3QWRA 5HVHC 4XCYA 3EZ8A 1HHGB 2JLLA 1DVFB 4DGYL 2F5BL 4XXDA 3NFPA 2UZYB 2MQ3A 3FQWB 2ITCB 5DJ8A 2P1YA 5D1XC 2B0SL 5DJCA 1XIWC 1RPQA 5FYKD 1DUZB 4C4KT 1JZ7A 4J7RA 5F96H 5JHLH 2VAAB 4GG6A 4ONHA 4XNXH 2CDGA 3T3ME 5FUOH 3BP4A 1OD7A 1CBVL 2VR5A 4FQHA 2C3WA 5LXGH 4GS7C 4CU8A 4KY1H 1F6AB 2RGSA 5DURB 4UBDC 5J12B 4HC1H 1NC2D 3MA9L 4NJAH 2MPAH 3I6GA 1Q72H 4BUHA 5E24E 3WUZA 2YUVA 1VFBB 4XPAH 5D6DA 2C7UB 4EI5D 2ARWA 2X1WL 2AQ1A 1OOAA 1KEMH 5E2VL 4JY6B 4LP5A 5IBTL 4APQD 4HLJA 2X4NA 4JZOA 1UH2A 1RHHB 5I19L 1AD9B 3BHBB 2PW1A 4Y19E 1H5BA 3RFZC 3W82A 1B3JA 2GITA 3P9MA 3S3JA 3ZE2F 2F58L 1DUYB 1CF8L 5FYLE 1QSED 5J1AA 4LU5L 4MAYA 2EDLA 2P5EA 4PD4J 1MCLA 2EDNA 2R69H 3CDYA 1NAML 5HY9B 1X4XA 3CFEB 3U36B 1BD2A 3VW3H 1MVUB 4RAVA 1F4XL 3FFDB 1F3RB 3DUUB 1SMAA 2IAMB 4RGND 2SEBA 2BCKA 1ZE3C 3W2DH 3OKEB 1AE6L 5CIPB 3FZUD 2A74B 4NQTA 2VL5B 5B4MC 5C3LD 1SJEB 1RUKH 1KG0A 3VGEA 3D9AH 2ORBL 4LFHD 3K2UH 2ZP0T 3O41B 5DS8A 3MZTA 4QHUA 4WHTB 1ZV5A 4JZJC 4KK8D 5SWSD 3I02B 2WBKA 3AREB 4ZOCA 2HT2C 2B4CH 3BGAA 4U3CA 5DD3L 3IKCB 4P46A 4K9EL 2EYSB 3EKCA 4QXUL 1S7TB 3ILPB 4UILH 2X4QB 3N1QC 3CSBA 1JGDA 5IB4B 2GFBB 4FFWC 2L4OA 3RA7L 3FJTA 3KAAA 2WBJA 2UWEB 1ED3A 2AK1L 4Z7OF 2R2BB 3QIWD 1A1MB 2ZUQB 1X6NA 4Y5XC 5HHNA 2GYSA 2IBGA 2G60L 4XHJD 1IM3A 3F6IA 1DVFD 4HIIA 3QT2A 3M1BB 1AR1D 4HUVB 3VCLB 3WL9A 3RWIA 2ED9A 3RDTB 5C07E 3OJMB 2FX8L 3VXMB 1UZ8A 1GGYA 1INEH 3QPXL 4OAWA 3KHQA 1BOYA 1A9EA 3LEVH 4HZLB 5E7BA 3NCJH 2C4XA 2V2XA 4YDVB 3T3PE 5AUMA 2OYPA 5LAXB 2CO7B 5JO5A 1XGUB 4BUGA 3B4NA 3MRGB 4Z7UE 1GOFA 5F44A 3O8XB 4PB9L 3FCTB 5DURD 2APTA 3W39B 1LVEA 4TNVF 5IFHL 5BQ7B 3FQRB 4DQOH 1ZT4B 5JDSA 5SV4A 3PGFH 1BJ1J 4HUUA 1EIBA 4N0CC 4HK3N 4LEOA 5KSVA 5CJOL 1FGNL 5D5MF 2OTWB 5E8DL 2D7TL 1V5JA 3UC0H 4WO4C 1S9KC 4LQ1A 1I9JL 5FYKE 4XC1H 1N7MH 1JGVH 5DRNB 3EFFB 1ORSA 4JO2H 1QLRB 4TQEL 1L7IH 1GC1L 3B5TA 3RBGA 4OFKA 4R4FL 3UYPA 3VXRA 3CU1A 1I9RL 1UENA 4HFWB 1FORH 2HA1A 3UDWA 1GH7A 1VPOL 2ZKHH 4HLZH 4NFDA 3CDGA 4LLWA 4ZUSB 4GXUN 4M1GH 1INDL 2MCG1 4AIZA 4KK9D 3P4NA 1EBPA 1S9VB 1TCRB 5DDHB 2AW2A 1C8PA 4NN7B 3P73A 3HA0A 3M8OL 4FQIH 3GKZA 3VRLF 4CADB 2IAMD 3BPLC 3KXFB 2OQJB 1T22A 1U0QA 5FYJH 4EJ1C 5D7JC 5FO7A 3ES6B 3UBXG 4PTUB 2MTPA 2DLFH 3EJYD 3OWEA 3MQIA 2VDKH 4N0RA 1FPTL 5FOJA 5IR1A 4YHIB 1WIPA 1S78D 2HT4C 4MA3B 3P77A 1E27B 1DR9A 3ARED 1QSEE 5EU5B 4LASH 2YN3A 5MHSD 2DQGH 1JGUL 5GS0L 4Z0BH 4QRRB 1YPZA 3QWQB 3RWCB 2I9LB 3RWHA 2OR9H 5ALBL 5KVDH 3DVFA 1JZ6A 3MBXL 1HK6A 5I6XC 3NA9L 3QFDB 3PV6B 4NC0B 5JQ6H 1WVZA 3LHPH 3V9FA 3ARVA 4JY4A 5CJQH 4PJBF 3MYJA 4JHWH 4GRMB 4FNLL 1S3KL 2OP4L 2Y7QB 3IU4H 5F1NA 3VD9A 1A6UL 1BQHB 1OAYL 5GGSY 2A6JB 4BSWB 2OZ4L 4X99A 1DQJA 3OKLA 1D6VH 3DXAA 4Y4KC 1O7SA 5A40E 2ILLA 3CJJA 2VXSH 4L5FH 3RDTD 4PV8A 2I07A 3GI8H 3VXMD 4OUUB 2PW2A 4OBSA 4PUBL 2CMRH 1K4DA 2NY0C 4XT1C 2R29L 4KZEL 1ZS8A 2R56H 3CFJA 3O0RH 1NL0H 1RJZB 3O8XD 5L9DH 1QFOA 3FT4A 1VGEL 4YEEA 3L5WA 1ZHNA 3WJLC 2YPVH 4YHLL 4YR6B 4EDXB 5KS9F 3F7PC 2YUZA 1FFQA 1QLEH 1G7LA 1DEEB 4WGWB 5I1CH 4HS3B 5B3JF 3MRDB 1DZBA 3MGTA 5F7KC 5JR1L 1MJJB 3U7YL 3GK8L 1AI1L 3HC3L 4XPTH 4B53A 3U0TA 5EBWB 4OLXL 4HJGB 3RKDD 3RL2B 3MJ8A 1AGCA 4OGXH 4YBLB 2W9DL 3VFGH 3DIFA 2BNQA 1I1CA 4CNIA 3JUYA 4OZIF 2OTUB 4FHBD 1CICD 4I3RH 3P4OA 4JFDE 5FA3B 2D0GA 1T21A 4QNPE 2JB6A 5D96B 3LAFA 3S9DB 1KNOB 1QA9A 4M7KH 2GJZB 1A0QL 4C58B 5DD1H 1J0JA 3HC0A 4NT6B 4M5ZH 3V4UL 1Z0MA 2VAJA 2OL3B 2BVQA 4PGBB 5IQ7H 2Y36L 2X4SA 3C2AL 4I0PA 3NAAL 2NY5L 1KIRB 3VGAC 3BGFC 1PQZA 2QSVA 5GRXG 4XZUB 1KCRL 5T1MB 4X6DB 3RVVC 1MRFH 3L1OH 4HJJL 3RZCC 4JRXE 1J1OH 3VE0A 2YA1A 3HZMB 3KXFD 4OQTH 1PEWA 2MNUA 4UUJB 4D0BA 4D94A 4U1JB 2MHAA 1WTLA 1NGYB 1ZA3B 1SBSH 1KLFA 3CX5K 3HC4L 3MODL 1ZLVH 3FRUB 5FHAH 4KTDL 3D0LB 3OX8B 5B38G 1VA9A 3KYKL 3I3DA 3O3DB 2VDRL 4R2GC 5FKPB 1CLZL 1YQVL 4X80H 3HFMH 2DD8L 5F9JB 4W6XB 4CVUA 1E4KA 5A3IC 2XZQH 4PS4L 2A9MH 4L4TB 4DOHE 1FBIL 3GIVB 4Y0GA 3U46B 2EIEA 4QRRD 1HHIB 3T0WA 4QWWD 4AH2B 4OCNC 4OLEA 1U3HA 4HF5L 1I75A 1NDMB 3RUGF 4OZHB 1IAII 1FGVH 2DMBA 3HZKA 4IS6A 5L88L 3UYOD 4WW2F 1Q0XL 1E4WL 2AQ2A 4XXDB 4YHKL 2AGJH 4YPJA 2P8PA 2WNGA 3P30H 3H7LA 4D2NA 4UT6H 2IF7A 2DLGA 4X9GA 4DEPC 3T0EC 1DL7L 4QXWA 3L7FA 4KKBC 5CZKA 5ECJE 4YQXH 2CDGB 1FCGA 3X3GH 5KVFL 2KBGA 4JO3H 3WHXA 1JNHA 4FQHB 4QHKI 5MHSE 5IVXB 2AS5M 2E7HA 3TBYA 4HG4J 4O00A 5HPMB 4Z78A 4PRNB 4HWEH 1DANT 5C7XH 5BS0B 1QPXA 4WIQA 1H3TA 3MYZA 3NH7H 5EC2B 5EG6C 3TH2T 3HUJA 5ICXA 3I6GB 5DRWA 2Z92B 3EDFA 4YHOH 3KHOA 4Y2OA 4PJ9C 3SGJC 4M8VA 2VN7A 3D85A 3B9KC 4KJPD 4JCLA 3MNWA 2JKXA 3L95A 4FQCH 4ODTL 4UQ2B 4LQFL 4UB0L 3DYPA 2X4NB 3FONB 4JZOB 3S35X 1W72L 1VGKA 3NCEB 3L3OB 5FYLL 1GGIH 3ROLA 1ACYL 2WP3O 3KLHC 4M5YH 2PW1B 5E70A 1H5BB 2YPKA 5BZWA 4TSBH 4U7KA 1AQKL 1PEZA 1HEZA 4ZOBA 5ALCL 3VXME 1IC5H 3EO0A 3LMJH 5L6YL 2VXUH 5J1AB 1CFBA 4MAYB 2P5EB 5AZ2H 3EO1A 4X6FB 4KKLC 5EUKA 4KU1A 4N9OB 5JW3H 3IDJA 3P0YH 2GUOB 3HNTL 3KPRE 3O81A 4DGYH 2F5BH 5I1EL 1WSST 1I8LC 1M05A 2B0SH 2P46B 3QQ3A 5HVGB 1KB5A 3LEYL 2EE6A 1CU4L 5DS8B 1CFQA 2NY2C 3GSNA 5SWQA 1FVDA 3UPRA 1ZWIA 2VWEE 1RQ5A 3DPBA 1PG7X 1CBVH 1FYTA 5JQHC 4P46B 1G7MA 4XNQA 1OVZA 1ADQA 2ID5A 2O61A 4PJXF 4B0MM 1T89A 5I1AA 3MA9H 4Y5XA 2WBJB 4L4TD 1ED3B 1XF3A 2ZUYA 1F00I 5LKNA 1H3VA 4MA8L 1A21A 3VI4E 3MRFA 3QISA 4BK4A 3ELAT 1IM3B 3QWRD 1HDMA 4NZJA 4PFEA 2E27L 4HUWA 5E2VH 4HIIB 5IBTH 2X42A 5ACLA 3C08L 3WL9B 3RWIB 3U30B 2R2EA 4Q9BA 1G9NC 1TPXC 1UZ8B 5I19H 3QNXA 4ISVA 4XBGA 4KHXL 2XKSA 4OAWB 4YO0A 4MZ3A 1A9EB 1I1AC 2EDJA 1A6AB 2V2XB 5AUMB 3DHJA 2F58H 1CF8H 2EKSA 4NKMB 5JO5B 1QQDA 5E8PB 4LU5H 3IDIA 5FAAA 1L0XA 1NAMH 3OHXA 4RWHA 3QH3A 1HSAA 1MCKA 3QQ9C 5BS0D 1J5OL 1T66C 2XTJC 5JDSB 4NPYA 4X4ME 5FYKL 5HD8C 1WZKA 4HUUB 5D2LB 4L4VE 6CGTA 4LFHG 1KFAL 3KPSE 4WO4A 5KSVB 1AE6H 4KJWC 2QSQA 3VGHA 3VG9B 3GMMA 3MBEC 3G6DL 1NJ9A 3CLFL 4ETQB 2E7CA 2ORBH 4F2MB 1IAKA 1ORSB 4ZO6A 2MQ0A 2X1OA 1FDLL 4MSWA 4MJ6A 1N0XL 4HCRA 1CE1L 4ZXBB 4KV5F 1LD9A 3SDXA 3CPLB 3VXRB 4J4PC 2AVGA 3ZE1F 5DD3H 4K9EH 4QXUH 1IL1A 5D7LA 5I2IA 5KSBF 4LLWB 5CLWA 3PQYE 5TDPA 4MAYD 4K8RC 1KPRA 2P5ED 4AIZB 1ERNA 5EZOL 4OZFA 3RA7H 1IAOA 3O6LL 4X9HA 4OI8A 5IF0A 2AK1H 3ULUD 4EOWL 3QXDA 5K33A 2N1KA 5D7JA 4P2QA 1T22B 2G60H 3VA2C 5FO7B 1MF2L 3LKPA 4X7CC 3WS3A 12E8L 2BHYA 5IR1B 3PGDA 4LKXA 3UAJC 3KWWA 4QXGL 1YEFL 3QB7C 2FX8H 3EUUA 3S8WA 5IEKA 3QPXH 5TGBA 1C12A 3IDNA 3P77B 3VG0L 1AGBB 4DZ8B 5DWUL 4PJ8B 3MLVL 4WGVB 4TNWK 5D7KD 4P46D 4AM0A 4KKAD 4PB9H 4V2CB 3F12A 4QOKE 1XF1A 2WZPD 3QCTL 5IFHH 3V6OC 1EMTL 1YMME 2DLIA 2WBJD 2OLDA 3MCKA 5C0CB 4JY4B 3RVUD 3HCVA 3PDGA 3A0OA 3C09C 5CJOH 1FGNH 3MYJB 3TNNA 1O7VA 3QO0A 4QRTA 5K93A 5GPRA 1WT5C 1CWVA 2APXA 5E8DH 2D7TH 4UV4L 4FQQB 4X6DE 3TF7C 1I9JH 1HH6B 1DQJB 1K3ZA 3G5XB 1JWSA 3H9HB 1AQDA 4PLOB 4LLDA 4TQEH 2AEPL 5B8CC 2I07B 3BEWA 1GC1H 4M4RA 4R4FH 4HWNA 3LV3A 3ZE0F 2PW2B 1I9RH 1FZMA 3EHBD 1K4DB 1VPOH 4G8GB 1ZS8B 2EEBA 3CFJB 1RK1A 3T77A 1M6OA 2PO6A 1INDH 2J8UB 4L4TE 5A2LH 3FT4B 3JWNC 1J8HE 3L5WB 4IDLA 3OKMA 2E9BA 3M8OH 5KG9A 5GS1C 5EIQA 4OZHE 1G7LB 4G6AD 1FNHA 5CP3A 2DQUL 3L5HA 1UZ6E 3MSPA 2E8YA 3MROA 3U0TB 3FHAA 4J3SA 1FPTH 4JM2C 2JK5A 3TIEA 5JZ7C 3REVA 4GG6E 3MJ8B 2DS4A 3DIFB 2BNQB 5BVJA 5I8KL 3MA7A 3K0WA 1C5CL 3O45A 2C3VB 3P4OB 4UAOC 4ZXBD 3NIGE 3X12A 3VXRD 2EE2A 3HR6A 4U1IA 1JGUH 5GS0H 2JB6B 1DDHB 1QUNA 1NPUA 5ALBH 3CXHK 3HC0B 4Z7WA 3MBXH 2BK8A 3NA9H 4H1LH 2BVQB 5GGUA 2X4SB 4HH8A 4I0PB 5DC0A 3RZCA 2Q7NA 1DQQB 4JFYA 5ACMA 1PQZB 1A1NB 4RNRA 5IKCA 5GIRA 3ARDA 3WN5A 4LRNL 4FNLH 5EU6A 3INUL 1S3KH 1DQDL 2OP4H 1A6UH 1OAYH 3E0GA 4U33A 4D0BB 3IT8D 2MHAB 3OMZA 2VLRA 2OZ4H 1ZHKA 3AVEA 3BIKB 3BPCB 1GSMA 3O11B 4UTBL 3K2MC 1B0WA 1HHHA 4XVJL 1LEIA 3IAGC 1A3QA 5TF1L 2QQLL 3O6FC 1NANI 4U1SA 2OCFD 3IFNL 4PUBH 3R8BB 1WBZA 3ULVF 2R29H 4GW1A 4PGCA 4K3JL 5F7DA 4KZEH 4PJ8D 4PLJD 3BKCL 4DGVL 5HI4C 3U1SL 4RMTA 2ARJQ 1BD2E 3QI9C 4G9DA 1HKLL 4D9RD 4YZFF 1U3HB 1VGEH 1U6AL 4YHLH 1U8QB 3HZKB 4IS6B 1Z6JT 2AJUL 5C0CD 2P8PB 4O2EA 3C6LC 3GI9L 5K9JH 5JR1H 3U7YH 1AI1H 1WZLA 3WXWL 1K3IA 3HC3H 5F72S 4HEME 4JM4L 1IGYA 4OLXH 2X9WA 5IEHA 1HYSC 1SVZA 4GS7B 4BFIA 2W9DH 5C0IA 3WHXB 1JNHB 1O5DT 2LFGA 3BZFA 3ROOA 1PGRB 4JLRA 4Z78B 2AKRB 1EZVX 4F57L 3RY6A 4G8GD 4J23A 3HUJB 5ICXB 3SGJA 2X4TA 4U49A 5IBUB 1A0QH 3IFPB 3D39A 3T3MF 3V4UH 3Q0HA 1RZKL 2Y5EA 4N1CA 2Y36H 4G80A 3C2AH 3D85B 3NAAH 2NY5H 1EH9A 3MNWB 3RIAK 3LKSA 1KCRH 3L95B 4QRUA 1CGWA 3QCVL 4HJJH 5IOPA 4Y7MA 1DBBL 3OL2A 1LE9A 3MODH 3HC4H 4YGAB 4LSUL 5FEBA 3C60A 5EOTA 3ZO0A 5ID1A 1RJLA 5BZWB 2WW8A 3O2VL 4KTDH 1OTTC 1HEZB 3KYKH 3EO0B 2VDRH 4YHPA 2ZNWA 2Q8AL 1CLZH 2MWCA 1MCJA 3FQUA 2BNQD 1YQVH 1IAMA 2DD8H 1CD9B 4X83A 1R3HA 1VEPA 1KT2A 1PY4A 2EC9U 1NFDF 4Z7QE 3VRIA 2ESVA 1Q94A 4PS4H 3NPSB 1QACA 1WEJL 1U92A 1BWMA 1FBIH 3D5OF 1DJSA 2NNAA 2ICWJ 5K59F 1ORQA 1R5IB 3SE3C 4HF5H 3MRIB 1F58L 1SJXA 2X4UA 2VDPL 5L88H 1BQHG 3O9WC 3WO4C 1Q0XH 1E4WH 4O9HL 4I0PD 4YHKH 2EDKA 1CFVL 1PX4A 3GJFH 1RUQL 2X4RA 1M05B 3QQ3B 2CUMA 1ZLWK 1K8IA 1CFQB 4R90L 1DL7H 1JI1A 3EYVA 4PJIF 1X4ZA 3GSNB 3QJHA 4LCUA 5SWQB 1IEHA 1ZWIB 4EN3C 5DT1L 1LP9A 5KVFH 2AEQL 1BREA 1FYTB 2RJMA 2IBZY 2FGWL 2ED7A 4F3FA 1G7MB 4XNQB 3CFKA 1JUFB 2O61B 5GS3A 1WWCA 5I1AB 4ZYKA 2Z31B 1DE4A 1N0LA 3BKJL 1XF3B 3BWAB 1U8LA 3H8NA 3S36L 2ZOLA 1U3HD 4U31A 3SE4C 1HDMB 3V2AR 4HUWB 4ODTH 2ADIB 4LQFH 4FN0A 4UB0H 1KTLA 3C9NA 1W72H 1M7IA 5FYLH 2R2EB 1UM4L 1I1AA 3KLSA 1ACYH 2PTTB 4YDIL 5FYKU 5JA9A 3QNXB 4ISVB 5F8QC 3QG6A 3X13A 1TJGL 4YO0B 1AQKH 1V3MA 2WP3T 5ALCH 3OJ2C 3N06B 3AB0C 2OS7A 2EKSB 4UTAL 5L6YH 1OTSD 3FOMB 3RGVC 4UBDD 5J6HA 2J6EA 4ZUWA 1MY5A 3HAEH 3OHXB 3MV01 1I7RB 5CILH 3QH3B 1YPZE 1QBAA 1HSAB 2XQBL 3CDFA 5JPMA 2GAZA 1B6DA 4QF1A 1OAUL 3H7BA 1U91A 3T3PF 3HNTH 4P57A 3MLZL 2DM4A 3LN4A 1XF4B 3D85D 3OKNA 4P2RA 4Z7UF 5D7SL 5D1ZA 2VB5A 1NJ9B 1L9NA 1RFDL 2WBWB 5I1EH 4GXVL 2DM3A 3OPZL 3AS1A 3IRPX 4FZ8L 3T0BA 3LEYH 1OPGL 5D1QC 1IAKB 4R96B 1CU4H 2OXGA 4QTHA 3DXAE 1T7WA 4ODWB 1KTKE 5DJAA 4WFFE 3QXWA 3BAEL 4X7SL 1LD9B 3SDXB 1CT8A 2VNCA 2XZAL 1QSZA 3GMRA 3BN9D 3TBVA 1R5WA 1IL1B 5D7LB 4MQTB 1VFMA 4H88L 5TDPB 3U6RA 1KPRB 2AERT 4OZFB 2FEDC 1IAOB 2Z9TA 5IF0B 4MA8H 4HBQA 1X7QA 4P2QB 5DYOA 2CLZA 5TF0A 4M1CC 2I26N 2E27H 3EOAA 1LEKA 3IKKA 1FSKC 5T5NF 3C08H 3WS3B 3K8LA 2OXHA 4LKXB 2HN7A 5DZLA 4CU6A 3KWWB 1RAMA 4WJ5A 4HC1A 1UB5A 2J12B 4KHXH 5IEKB 5TGBB 1CD0A 2J2ZA 3IDNB 3IB4A 4HWUA 5EOCL 1MI5A 3V6ZA 1FYTD 4EXPX 3NZ8A 3RWGA 4A6YA 2X4PA 4LGSB 1OQOA 2GSIA 2X7LB 4AM0B 2N7BA 3OSKA 2P44B 4PJ5B 5C0DA 2Z35A 2OK0L 1J5OH 2Z31D 3S37X 5FYKH 1WT5A 5I8EA 1X6LA 3I84A 4P9HC 1KFAH 3HCVB 4XWOD 1U3ZA 4R9HA 5F89A 4ZODA 3G6DH 3CLFH 1FV1A 1JWSB 3BYTA 5FGRA 5IHZA 3VU2A 3F6LA 1AQDB 1QFWL 1FDLH 4LLDB 3VFMB 4PJAA 4OIIL 1N0XH 1H3GA 1CE1H 2J4WL 2FH6A 2WWKO 3LV3B 4IIQC 1CL7I 5EA0L 3UPAA 1FZMB 1CTOA 4AMKL 2E7MA 4JHBA 1V8HA 3MR9A 3KYAA 5FA4A 3T77B 1CXIA 2PO6B 4ODUB 5JNYA 2CLRA 2UY7A 2HWZH 5EZOH 1YECL 3O6LH 3OKMB 5KG9B 4EOWH 3WNNA 5IBLD 1HIML 4LSRL 4KKNA 3BO8A 1IGJA 4JM2A 4XPHL 1F5WA 2CUIA 1MF2H 1A2YB 2X2YA 3MROB 4U1HA 12E8H 5GJSL 3DTXA 3TIEB 3REVB 4F8TA 4QXGH 1YEFH 3P40A 1WGOA 2FGZA 3T65A 3STLA 2FJFA 2OI9C 3CCHB 3CLEH 3MX0A 3DO3A 3VG0H 3X12B 5DWUH 1P5VA 3MLVH 4U1IB 4U0RC 2NLJA 1NC4A 4Q74A 5D7LD 1ULVA 3B2UD 2EKJA 2CSPA 1R0AL 3RPIA 1XCTA 3OKDA 3BGFB 3QCTH 4P5MA 4IDJL 4JJHA 5GGUB 2Z93A 1FNEA 1NCDL 1EMTH 3RZCB 1Q0YL 4JFYB 2XWBA 3WNPA 5AAWA 4RNRB 3AXLA 5IKCB 5GIRB 5TE6L 3ARDB 3WN5B 4YAQA 5EU6B 4QNPF 1HWHB 4P2QD 3V8CA 2QKIB 4UV4H 2NY6B 3BIBX 5DUML 3D87B 1JBJA 3MXWL 4DN4L 2B1AL 3NABL 2VLRB 3BPOB 4WW1A 1ZHKB 3BD5A 1QSFE 3RVTC 5CGMA 1HHHB 1DBML 3TO4C 2AEPH 2B5IB 1M7DA 4M61A 5IGXL 1SY6A 1WBZB 4NOFA 1H15B 4LMQI 3E8UL 3QXTA 4PGCB 2EEAA 3QI9A 5F7DB 4K94C 1IQDB 4L8SC 1A3LH 1JZ3A 1KCUL 4AYFA 4G9DB 4QYOA 4JG1L 4KAQL 4L8DA 5CMAA 1N8ZA 5DD6B 2GT9A 4DVRH 1WC7A 1MCBA 4PJ5D 3S97C 5CBEA 5DQDL 1T20A 4X4YA 4NQSB 5CEZD 4HGKC 2BOCA 3BD3A 4OFIA 4BKLA 2DQUH 2A6IA 3C6SA 4HK0A 4XP9L 1I3RA 4LVHC 2K1MA 1IGYB 3S3SA 5IEHB 1MPAL 5EFIA 4FXLA 4ZSOE 3LKNA 4BFIB 2QLVB 4JGUA 3E2HB 5I8KH 5C0IB 1C5CH 3AS0A 4WI3A 4EEEA 1KN4L 1MFNA 1FYTE 3BZFB 3B8SA 5IP4A 3ROOB 4JLRB 4MHHI 5EZLB 5HGHA 1TQBC 1YEJL 3S6CA 4GKSA 1AR2A 5C08B 4JGMA 2X4TB 3DV4A 2PYEA 3D39B 4XAKD 2PO6D 5ETUA 3EYOA 5BXFB 4G80B 1F4AA 2VISA 4GXUM 3LKSB 4XBPA 4QRUB 4LRNH 3INUH 3RVXC 5IOPB 1DQDH 1IVLA 4XWGL 4JFZL 3UJJL 5JW4R 4NN6B 1BOGA 2VR9A 4LLAA 1LE9B 3T4AA 3LB6D 4YDLC 1Q9KA 3BP6A 3C60B 4AEEA 5EOTB 4UTBH 5ID1B 1RJLB 3SDDC 1I7TA 3ARFC 2UWEF 1YUHB 1CI5A 4XVJH 5EU7C 1G1YA 4YHPB 5TF1H 2QQLH 5F7FA 3WE6B 3IFNH 1R3HB 1KT2B 5JDJA 3DX8A 3LS5L 3VRIB 2ESVB 2J3SA 4K3JH 3BKCH 2YD5A 4UOJA 4DGVH 1HHJA 2YPLB 2NNAB 4LKCA 1OCWL 1HKLH 5EN2A 1ORQB 3KPPA 2M1KA 1FZOA 1QTYT 1U6AH 3IXTA 2X4UB 5HHQA 2YWZA 4JVWA 5C0BA 1B0RA 2AJUH 5D93C 3RZCD 2FL5B 4R4BA 1U95A 4RMWA 5I0ZA 2X4RB 3ARDD 3GI9H 3L3IA 5EU6D 4GW5A 1K8IB 2QR0B 3WXWH 4KXZH 2NY6D 3EYVB 5DEZA 4JM4H 3STBA 5TE7L 2VLRD 4LCUB 2HT3D 2NY4C 5E0QA 4WI7A 1LP9B 2C3HA 4Q6IC 3W11C 2E9JA 5H94A 4JVUA 5D2NC 1IFHL 4PTTA 3HMXL 4F57H 1UWXH 4FQXC 1DE4B 3VWKC 1WTGT 2WQRA 4Y2DC 1I7UB 4MX7A 4GBXC 4WCYH 1U8LB 2AJ3A 4ERSL 2HTKC 1RZKH 3ZKMD 2ZOLB 4RFOL 4HSQA 4NFBA 5DEFB 1OF2A 2Q6WB 4P2QE 3QCVH 3C9NB 1DBBH 1M7IB 2EDOA 4MD5B 3RNQA 4LSUH 3IVKA 3RQ3A 1E4JA 3MLTA 3I6LE 2QHLA 3QG6B 3RGVA 4LPTA 2Q8AH 5E6IC 3VFPB 4D9QD 5J6HB 4ZUWB 4J3UA 5D9SA 1UXSB 1WEJH 4QRSA 1KF9B 4ZNCD 5JPMB 5C08D 2GAZB 1EZVY 1T2XA 4NIKB 3H7BB 4MS8C 3D39D 1CXFA 1YEEL 2VDPH 5CEZE 3LN4B 3VMPA 4O9HH 4G7YL 5C0EA 3OKNB 4P2RB 5DTFA 5D1ZB 5ITFA 1CFVH 5HHOA 1WAAA 1RUQH 3KLAA 3L6FA 4HS8L 2AABL 1FAKT 4QTHB 4R90H 5DJAB 4O2CA 3QBTB 2VLMD 3C60D 5DT1H 1J1XL 1CT8B 2AEQH 1PFCA 2FGWH 3GMRB 3TBVB 1R5WB 2GY7B 4KKLD 1PJ9A 3T2QA 3U6RB 4UINL 3G04B 3K7UA 2ESVD 4PJEA 4XAKE 1KPUA 2CPCA 3BKJH 5IB1A 3D2UA 2YPLD 2DQTL 3S36H 4M00A 1X7QB 3WSQL 2CLZB 4TTDC 1FIGL 2XG5A 3MRPA 1MCQA 5LGKA 4YPGB 1LEKB 3EOAB 4OBRA 3UJTL 3HI6L 5J11C 2PR4L 4JQXA 4S0SD 4ELMA 3L3JA 1OTUC 3OKYA 3IXAB 3IJSB 2HN7B 4F37K 1UM4H 1YEGL 4WJ5B 4YDIH 1ZGLM 3IGAA 1UB5B 1WIOA 4J6RL 2VKWA 1TJGH 4OI9A 2JJVA 5C1MB 2D0FA 5EO9B 1TTFA 2NZ9D 4QY8A 1MI5B 4UTAH 3V6ZB 1KIQA 1J05B 3NZ8B 4A6YB 2GSIB 3LY6A 5IBUG 2CQVA 4FXKB 4KKCC 4MWFA 3ILQC 5JIPA 5C0DB 1A6WL 2Z35B 2WWMC 1J10A 1CD1A 5FKAA 1OT1A 2GIYA 4Z7WE 5I8EB 3RY5A 2ITDA 3X14A 4CVXA 4S1DD 5GRWA 3VD7A 3MLZH 3T0XA 4WUUB 3GB7A 5F89B 5MENA 4PREA 4XVSL 1RFDH 4P59L 4GXVH 3TBSA 3OPZH 4FZ8H 1OPGH 5IHZB 2I9TA 3F7QA 5KSAC 2NX5A 3KPNA 3BAEH 4PJAB 5C2UB 4X7SH 4F8QA 2GTWB 1K2DA 1ZKAA 2EXYC 2XZAH 2NXZB 3SDCA 4LSPL 2QTEA 4X6DF 2C4FU 1IGFL 1QG3A 1P4IL 3MR9B 4NBYB 1XMWA 4QLRA 3VRJB 4HUXA 5FA4B 4H88H 3WDHA 1GHFL 5DZNA 1QFHA 5JNYB 2CLRB 5GZNC 4M6AA 3OF6D 4NJ9L 4LBEA 4W81A 1A7QL 2BERA 4PLKC 4RAHA 4Y89A 3GJEB 1FYHB 4DUWA 4GT7A 2UZIL 3BO8B 4H20L 1IGJB 3T0EE 1FRGL 1WICA 3QQ4A 4P2RD 5D1ZD 5DVOA 4U1HB 1LK2A 1P53A 2OTPA 3DTXB 2R2HA 2ERJB 1HZHL 3FB7A 4UAOB 1KULA 3LRGA 2KUTA 3QXVA 4HIJB 5HI5C 3T65B 3STLB 1Y18A 4PLNC 3JWOL 4OZHF 1H0DA 5JW5A 2FJFB 1TTGA 1JHTA 4N9GA 4CVWA 1SMOA 2UVFA 1ZT1A 1XFPA 3TESA 5IMMA 3O3BA 1RMFL 5EOCH 1OAXL 1UZ6F 3MV9E 2W91A 2BVOA 2XQYK 2VL4A 1GOGA 2UZXB 3B6SA 4N8PA 1XCTB 32C2B 2EH7L 3OKDB 4IEFB 4P5MB 5CSGA 2OK0H 4NNYA 5LBSL 3U79A 1FNEB 1OAZL 3D39E 2I25N 1KYOK 2XWBB 3HS0A 3VFVA 1UQSA 3NIGF 1MHEA 1UG9A 3ESVF 4YAQB 3OGCA 5F3BA 1HINL 5IVXF 3T08A 1M71A 4G9FA 2GHWB 3QDME 4WW1B 1J0HA 3GIZL 3TO4A 2HVJA 4HXAL 4WHYH 1QFWH 1NAMA 2AEWA 2VLME 2NXYC 1PKQA 4OIIH 5IUSA 1M7DB 1AC0A 2J4WH 1G9EA 4M61B 5HYEA 1DQLL 4U6VL 5EA0H 1JPFA 4AMKH 1A64A 3GMNA 4XNMA 1J0IA 1MI5D 3DVIA 1U8NA 4QYOB 4L8DB 4PJFA 1N8ZB 1A6ZA 2GT9B 1WC7B 1YECH 2PYFA 1P7QB 1MNUL 3LPFA 3UX9B 5CBEB 1Z9LA 3QULA 5DK2B 1KB5L 4X4YB 2BOCB 4BKLB 1FC1A 3FO0L 3MV7A 1H8OA 1HIMH 4PY8J 4LSRH 4WI6A 3SEPA 3SGEH 3C6SB 1QEWA 4HK0B 4WUUD 4XPHH 4D9LL 4KHTL 2IG2L 5KVMC 1I3RB 1A7PL 5JXEA 1G7QB 3U0PA 5GJSH 3ULUF 5EFIB 3RX8A 3WNOA 3LKNB 1ADQL 2HKHL 4U3XA 3FB5A 1BFOA 1S9XA 4KWUA 5DO2C 3BSZL 5HDQL 5HGHB 2NXZD 2BXYA 4TTGA 5I1KL 3D1MC 1A7NL 5J89A 1H8NA 2D31A 3DV4B 4PPTA 5FGSA 2PYEB 1V7NL 5ETUB 3EYOB 4IDJH 1MHPL 3TN0A 1NGXA 1NCDH 5CKGA 2VISB 1Q0YH 4IOFC 3RPKA 5H35A 2ZWLT 2H8PA 1VADA 5TE6H 4IRJA 1S7VB 5IHLB 4H5SA 4HV8A 1G7IA 1I8KA 2DL2A 5CGYC 1BOGB 5DUMH 3MXWH 4DN4H 2B1AH 3NABH 3T4AB 1Q9KB 1T1WA 3BP6B 4FTVE 2HTLD 2EZ0C 4ETYA 2E9IA 5C71A 5IG7A 1DBMH 4RA3A 3ARGC 1EO8L 1JYNA 4G42A 5IGXH 8FABA 1FHGA 3DX8B 3E8UH 2N7AA 4L3EA 5HHPB 2BY3A 3O4OB 4NM8L 1HHJB 1KCUH 2XTJE 2J7LA 4LKCB 5DC9B 2EDHA 5EN2B 3WO4B 4JG1H 4KAQH 3TCLA 1FZOB 1L0QA 4KDWA 4XRCB 4P23B 5HHQB 5DQDH 5SWZA 1ZLSL 2W92A 3S96A 4URTB 4R4BB 1U95B 5FHBL 1C5BL 2YUXA 4HCRL 4LVEA 3VH8A 2FDBP 4XP9H 4JANA 2CH8A 4Q6IA 1MPAH 5D7IB 2EDDA 1U93A 5D2LF 1OW0C 5IQ9A 1LO3H 5C3TA 1KN4H 5H94B 1U8PA 3VWKA 2ZJSL 4Y2DA 3NGBC 1YEJH 4GBXA 1T1XA 3QEGL 4S0TD 5IT2L 3LQMA 4MX7B 1W0YT 3CAFA 2AJ3B 1QKZL 5EULV 1A47A 4UT9L 3EZJB 4LSSL 1P7QD 2AXHA 1OF2B 2XKNB 1RUAL 3DX6A 3CMGA 3SGDI 1S8DA 3D69A 5A2KH 5BW7C 2LU7A 4XWGH 4JFZH 3UJJH 3T0VA 4ZAKC 4JVPA 1M1SA 4QT5A 4WWKC 4B50A 3IVKB 2DQDL 3MLTB 1UACL 1U8KB 3QHFL 5J13C 5GS2H 4J3WA 4Q2ZB 3ZDXE 4OF6A 4ZDHA 1OSZA 2FYYA 3LS5H 4KGJA 5D9SB 5I1LB 2WAHA 5CEZL 2RCSL 4QRSB 5HYJE 2ENSA 3V6OE 1EO5A 1X5XA 3C5JA 3LD8B 1QFWM 3LPGA 5FYJD 4NZUL 2PYED 1GGCL 2DDQL 3FQXA 3PDOA 4MNGE 4HKJA 4KQ4L 4KVNL 5EU3A 5IMKA 1OP5K 2EE3A 5DTFB 5ITFB 1A7RL 5AWNL 5HHOB 3DETD 2CRMA 3KLAB 4Z7VA 1HSBA 1TETL 3RJDA 1T1YA 1KB9J 2H6PA 2VABA 4XP4L 3IS1X 5TE7H 3O4LA 2J88L 3RTQC 3KYNA 5JHDB 1UJ3A 1K9TA 3PF2A 1URLA 5I30L 1E0OB 5LGJB 1NMCC 3BJ91 2ENYA 2NTSP 1JMZA 5J9PA 4G6JL 4OV5B 2AJZA 4I2XA 3OB8A 1GZPA 1IFHH 1D5ZA 2XY1A 3HMXH 1WBYA 4PJEB 1KPUB 2HFTA 2BDNL 5IB1B 3D2UB 3LN5A 4ERSH 2J8OA 2YUWA 1J88A 4RFOH 1YN7A 2WUCL 4P23D 1Y6KR 2XI9A 3MRPB 5DJZA 1CYGA 4FFZL 3VMOA 2VH5L 1I4FA 1X5JA 4PJDA 3H42L 4JQVC 3EFDL 3IDYB 4AEFA 4ELMB 1LE5A 2APBA 3RVWD 4EVNA 4M6ML 4X7DC 2J8UF 4NDMA 3IGAB 4PJHA 3HKFA 3CFCL 4OI7A 1YYML 5K9QI 5HHVL 3T4YA 2LU4A 3MJ9A 4QY8B 4ZFFA 5T3ZD 1KIQB 5A2IH 1XGQB 1TENA 1B4RA 5CJ5A 3QR2A 4MWFB 2YRLA 3MOQA 1IKNC 5IWLA 4WVRA 4C57C 2V7NA 1XF2A 3DSFL 4NQEA 3EDKA 1EUTA 5E8EA 4HEPG 2ITDB 3X14B 4CVXB 1K8DB 3NIDF 3QUZC 1YEEH 3PHQB 1CFNA 5MENB 4PREB 1NUFA 4G7YH 4F7EB 4JQIL 4HS8H 2AABH 2I9TB 1A9BA 2VZTA 3CFDA 4RGOL 1NFIA 1JIBA 5GHWL 2BY2A 3KPNB 5H2BB 1K2DB 8CGTA 2WK2A 1J1XH 3SDCB 3WFHA 1PG7L 1FCCA 3MNVA 1RU9L 4HUXB 3SBWA 4X8JA 5IW3A 4UINH 4R4ND 1CK0L 2WV3A 1NCBL 3D18A 3BEVA 3V5KA 2DQTH 4PR5A 4YIQB 3OZ9L 1S7WA 3K8KA 1T0PB 5GRZA 5T5FL 3WSQH 1XR9A 5EZJA 5F1OB 1FIGH 2YXFA 5IHUL 3TBWB 3UJTH 3MUZ1 3RIFF 3EIFA 5DQ9A 2W9EL 2E6QA 3HI6H 3QQ4B 4O2FA 2PR4H 5HHOD 4WEUD 4Y5VA 2R2HB 2CIKB 3FB7B 3MGAA 1YEGH 5GRVL 1TZHB 2APVA 1Y18B 1TVBA 4J6RH 4ONOA 3K46A 4WFHE 1I3UA 5JHDD 1X5KA 1ZT1B 4K71C 5IMMB 3O3BB 2BVOB 2GK0B 1S5HB 3C8HA 5BV7C 5I8CA 4Y19A 1MHHA 1A6WH 1KCVL 4NNYB 4P3CL 2CDFA 1LILA 1F45A 3D2UD 1XGYL 3HS0B 3VFVB 3FMGL 1DBAL 5FFLA 1UQSB 4XCEA 2OMNA 1MHEB 3C8DA 2VSCA 3OGCB 1X4YA 1M71B 3BUYA 5ICZA 2FJHA 4G9FB 2FLRT 4XVSH 4P59H 2BMKA 3BJLA 4OM0L 1ZOXA 4XI5D 3HUJF 1BWWA 2HVJB 3HAEA 1K6QL 1NAMB 1B4JL 5SX5H 1PKQB 5I66A 5LJYH 4KUCD 1IC7L 1TJIL 4ENEC 2NZIA 4I18C 3UTTA 3WNMA 1CVRA 1PKOA 4JFXA 3DO7B 1JPFB 1KUMA 3GMNB 5I1IL 4LSPH 2A1WL 1I9EA 1IGFH 1P4IH 2EO1A 1JTTA 1GHFH 3FN0L 3QZWA 3FHQA 1U8NB 5I75C 2NY3B 3ZMRA 1A6ZB 4NJ9H 2BNRA 2FIRT 2PYFB 3DRTB 3L5JA 5BMFL 3PV7A 4H25A 1A7QH 4I48A 3QULB 1HXYA 1MCDA 1JI2A 3S5LA 3SDAA 1D5BA 4P3WA 5C0BE 1FFPA 4GLRH 3ETBF 1L9MA 3MV7B 1OLLA 4LVHB 2UZIH 4U3HA 4H20H 3B8YA 5DMIL 5MEND 1FRGH 4GQ9L 3U0WL 4R8WL 1N2RB 4PRHA 1AKJA 3QEHA 3U0PB 4IRSA 1HZHH 5HYSG 1J86A 3CK0L 3W9EA 3VFNA 5F9WC 3FB5B 2Z91A 3JWOH 1BFOB 1N5YL 1S9XB 1KJVA 5T3ZE 5FUCE 2C1OB 1MJUL 2EDYA 1RMFH 2MKLC 4LPVA 1OAXH 3GSWA 5DRXA 3SDCD 3E3QC 3QIBC 2GQHA 2D31B 4YWGL 3VGDA 2EH7H 3LZFL 3TN0B 5LBSH 1NGXB 1OAZH 2IPTL 1G9NL 3T2NL 4MQXC 3UPCA 3NCFB 1U58A 5H35B 1C16A 1VADB 4IRJB 4EUPH 4KRPC 5I1JL 1HINH 1NQBA 4UV7L 1I8KB 5EU4A 2E7LC 2FHFA 3GIZH 3ARGA 4OZGA 1T1WB 4YDKL 1RZ8A 3UTPE 4RA0C 3HZYB 2V9QA 4HXAH 4PJCB 4XVUC 4LDOB 4RIRA 5IG7B 1UCTA 2J6EL 1PDKA 4G42B 2DI7A 1DQLH 4J1UB 4U6VH 3SKNA 8FABB 3U7AA 3VJ6A 1LQSR 5FF6A 1UWEL 4HMCA 5C92A 3QUYC 5D93B 3TCLB 3DJ9A 1MNUH 4YFLI 3NOIA 5SWZB 3S96B 1KB5H 4RMVA 1ITBB 1UYWL 1Y0LA 1WFOA 5E4EC 3FO0H 2UUDK 4WW2C 3OGOE 2R4SL 4S1RL 2V7HA 1WAAE 4MLSA 4D9LH 5LWYL 4KHTH 2IG2H 4G9FD 2OMBA 1A7PH 1CXHA 4JANB 1OW0A 3HHRB 4JKWA 4K8RL 4HPYL 3BMVA 1UT9A 1ADQH 1U93B 2HKHH 1V3KA 5IQ9B 1T5XA 5AZEL 4C4KO 2DQEL 4WI5A 3BSZH 5HDQH 4Y2DB 4MAUL 5CZXC 4KI5D 2JJUA 4F15C 1T1XB 5I1KH 1U36A 1A7NH 4IOIA 2HMID 3MREA 4YX2L 1ZSDA 1V7NH 4PJEE 4U1LB 2IC2A 3B2VL 1MHPH 4Q7DA 2NY3D 1SYSA 2VXQL 3TFKC 5BW7A 3EDDA 3SDXF 2D7MA 1CIUA 3DX6B 4ZAKA 4HWBA 1XT5A 3D69B 3S4SA 4XMPL 4OLYL 3MV7D 4JN1L 5GGTA 4LARL 3ZKSD 2LV4A 4KUZL 4WDIA 1Z9OA 2KPNA 2CKBA 1NFKA 1NEZB 2R0ZL 3MRNA 3UZVB 4PJ7F 3FRPG 3E1F1 3GGWA 5B39A 5JXED 4NQXB 4A6YL 1YY9D 1T1ZA 1EO8H 4FMKA 3ZYIA 5DJYA 3WFBL 4H1LB 1FH5L 4MA7L 4ZDHB 3RNKA 4OFPA 2FYYB 3LEXA 4LAQL 4NM8H 1A7BA 5CEYA 3NTCL 3C5JB 4OCWL 4PRIE 4OB5L 3WNLA 2ZPKL 5C0FA 3IJHA 4WV1A 1DLHA 3FQXB 3PDOB 4HQQL 1ZLSH 3TN0D 4HKJB 2AJSL 4F9LA 5EU3B 1Q9WA 5IMKB 1KXQE 2W65A 3KJ4B 1YQ2A 3TNMA 5FHBH 1A3RL 1C5BH 2DTSA 3PWVA 5MI0B 2YRPA 4IRJD 2NR6D 5MENE 4HCRH 2ZCLL 1T1YB 2H6PB 3R06A 3WEXA 2VABB 3O4LB 3KYNB 1KIPA 1UJ3B 3DRQA 3QDJB 2NX5E 5J9PB 1J12A 3T1FA 2XXMB 5FM5O 3MGOA 4OZFH 4I2XB 3DI2B 1GZPB 2ZJSH 4DCQA 2Z8VC 4FZEL 1T7XA 4XC3L 5EPMB 4E42A 4KMQA 1D5ZB 5D70L 3QEGH 1WBYB 1MJ8L 5IT2H 2AJXL 4F9PC 4HJ0C 1QKZH 3LN5B 3EOBA 1LDSA 1WCQA 4UT9H 3N9GL 1YN7B 1JGEB 4LSSH 5J11B 1JPSL 4GAJL 4JQVA 1RUAH 3P4LA 5CJXC 5SWZD 1MRDL 4K7PL 1I4FB 3NBNA 3QO1A 4HLZG 4PJDB 4GAYA 4PJGE 1LE5B 5B3NA 4EVNB 1X5IA 4RCAA 3OV6A 4NDMB 4PJHB 4R26L 2DQDH 3G5ZB 1UACH 4NN5C 5GRUL 2Y23A 3QHFH 3T4YB 5JOPE 4BQ8A 2WLZA 4JRXA 1ZGLA 4MXVF 4ZFFB 3OB0H 4PG2C 3JTSA 2DYPA 3CIQA 5CEZH 4Y2DD 2RCSH 3KYOA 4LVNC 1XF2B 4NQEB 4Y4FA 1BBJA 5E8EB 4KK5D 1BJ8A 2EIZA 4Y1AE 5GZOD 3D6GA 4NZUH 1GGCH 2DDQH 4FS0A 1IC4L 1HNFA 2DQJL 2FSEA 3P4MA 1CFNB 1NMBL 4KQ4H 4KVNH 1A7RH 5AWNH 2ARJA 4XB8A 5MEQA 1TETH 1X5ZA 5ELIA 1A9BB 4TSAL 1SY6L 1NFIB 5C0AA 2ATKA 1JZ5A 2H2PC 4XP4H 4Y8AA 2J88H 4FA8A 4BZYA 5E4IA 5GS0D 3UJIH 4PGJA 1PKQE 2DKMA 3GMOA 1UM5L 3WFHB 4G6JH 3MNVB 3C5ZC 1J8KA 4PBVC 3V5DA 4KI5E 4Y16C 2P43B 4X8JB 3GJFB 3IU3A 5I17A 2BDNH 3D18B 4XMLL 1R3IL 5CP3H 5E5RB 2XY2A 5E08L 4PJFE 2NYYD 3V5KB 5EIVA 1GRWA 5L8LB 4PR5B 1S7WB 1XR9B 1L7TL 2WUCH 5DSCA 1EV2E 3RI5F 3RWJA 2D9QB 4FFZH 1G9ML 3VFUB 3MV7E 3TZVA 2VH5H 4O2FB 3H42H 3EFDH 1RZGA 4I3SL 4U1GB 4Y5VB 1GC1C 4M6MH 4W4NA 5EZIL 4POYA 3BWUC 5M94B 1VHPA 3CFCH 3O4LD 3OJDA 1YYMH 3ET9F 3GHEL 1OB1A 3ZKXC 4YHYC 1D9KB 5HHVH 3QDJD 4Z95L 5T3XE 3HE6C 4QHKJ 2QADB 2MCPL 3G6AA 4MJ2A 5I8CB 2A83A 3FOLA 2PCPA 5FGCE 3DROB 4Y19B 1MHHB 3CNKA 3DSFH 1RZFL 1BM3L 1LDPL 4XCEB 2R9HD 1HH9B 1YZZA 3BUYB 3VI3F 1RZJL 3MCG1 5ICZB 2FJHB 3AM8A 2BMKB 4P0DA 3HPJA 4JQIH 2NXYB 2DMCA 4KJQC 4BFBD 4I18A 4AT6B 5ANME 1HXMA 4RGOH 3HAEB 2A9NL 5GHWH 5I66B 3KPRA 2RBLA 3VGFA 3BP7A 1AXSA 3UTTB 2VLJE 1MLCA 5GISH 4JJ5A 2BSED 2CO6B 1B6UA 1PG7H 4BM7A 4JN2A 1RU9H 3V0VA 4KKCD 3M07A 1CFTA 4L3EE 4N8VA 4OGAD 1MRCH 3MRLB 4LOUD 3QZWB 2N4IA 4W6YB 1AGFA 1CK0H 5J8OA 3CH8A 3RU8L 4WWID 1NCBH 1EGJA 1UKTA 4H25B 4I48B 5KS9A 3OAYK 3TJEL 4NQED 3SO5A 3S5LB 3SDAB 2IALA 4M93B 1D5BB 1A8JH 3OZ9H 2KL6A 5E6ZA 5T5FH 3D3VA 1FFPB 1WK0A 4DWHA 4YHZL 2PN5A 4GRWB 5ESQA 5IHUH 2BJML 5LGHL 4WUKL 2W9EH 5T3ZL 3SCMA 4PRHB 3V7AG 1AKJB 1SVCP 3IDXL 4IRSB 2AXGA 3TT1L 4NCDA 3VFNB 1QO3A 4XPBL 3S98A 3RP1A 1Z9MA 3MFGB 1KJVB 2CRIA 2WMPA 1ZT7A 5D2NE 3QIBA 4LCYA 4P4KC 3QUXC 3GSWB 2A38A 3FB6B 2W60A 3HNSL 1YEDA 1LHZA 5GZND 4PP1C 4TN9A 4X5WA 2C4FT 3P9WB 1KCVH 5FGBC 4P3CH 3ARWA 4HFUL 1BFTA 1LP9F 1XGYH 3FMGH 1DBAH 1BQSA 1U58B 3JV4A 3S37L 1C16B 5L0QC 1P84K 2E7LA 3VXPB 1P1ZB 3JBG7 4KROB 3FAWA 1JZ4A 5EU4B 4N0UE 3HRZA 3ARGB 4OM0H 4OZGB 4XGZB 4X4MA 2R8SL 4GO6B 2XFXA 1RZ8B 4UDUA 2A0LD 2P47B 3KPSA 1B4JH 4GMTL 4EBQL 1IC7H 1TJIH 4M43L 2FBJL 2I5YL 3K1KC 1IQWL 3SKNB 4OM1L 1D9KD 1QVOB 3ZTJH 4IJ3C 5I1IH 4WI9A 2A1WH 5C2BL 3Q5OA 3DURA 1AHWA 3VJ6B 3GUTA 5FF6B 2QADD 2CDEA 3N0PB 3ULVC 3ZTNL 4M7JL 5GSRA 3FN0H 2ZUTA 4PD4K 4L4JA 5MEOA 3IJYB 1G7JA 2F15A 4Y19D 5DFVC 5BMFH 4CN1A 4HH9A 4WW2A 1T80A 1KGCE 4GJTB 4PGEA 1Y0LB 4K3GA 4PBXA 5FYLD 1WCBA 2AEIT 3OTTA 1JNJA 3PQYA 2GCYA 1NCUA 3EYQC 2V7HB 4MD4B 5DMIH 1VCAA 4Z7VE 5ISZA 4GQ9H 3U0WH 4R8WH 4UIKH 2AXJA 4XH2A 1FFOA 2Y6SD 1YNLL 2NXYD 3LDBC 3T0AA 3SPVA 3O4LE 4MJIE 1U3YA 5BO1L 2GJ6A 5IHBA 3EBAA 1T5XB 2HH0L 2VYRE 4HX1B 3KG5A 1N5YH 1WWWX 3RAJL 1IC1A 3UTTD 1TZGL 1MJUH 3OG6B 2DF3A 5KN5A 6FABL 1MIEL 4FMFA 4IOIB 3MREB 2Y72A 4YWGH 1KXTB 2AK4E 4LLQA 1ZSDB 3LZFH 4HT1L 1QOKA 2IPTH 1G9NH 3T2NH 1X44A 3BGMA 5F7HA 3SDAD 1CQKA 5I1JH 3S4SB 1TXKA 4UV7H 5CWSA 5F71A 7CGTA 1RJCA 3QUMA 4WDIB 4X4XB 4CN4A 2CKBB 3SJVA 4YDKH 4FFVD 1YMMA 3MRNB 4DZBA 4PRHD 3GGWB 5B39B 1AKJD 4M4PA 2ADJA 2VDNL 4IRSD 2J6EH 3ARUA 5HPOA 3ARQA 5DJYB 5C0JA 1JN6A 2LVEA 3RNKB 4P9HL 5ESVA 1JWUA 1MCCA 1LGVA 3HB3D 3LEXB 3O3EA 2A73A 1G7PA 1VACA 1UWEH 2D03L 1II4E 2QJDA 4N5EC 1UEYA 5B21A 4LEXH 3ME0A 1YJDC 4Z7NF 3JV6A 5ACZA 3IJHB 3QIUC 5JMRA 4BQBA 4WV1B 5HXMA 2Z4QA 1DLHB 1QBBA 3ZDXF 5EUOF 4UIMA 5J3HC 1Q9WB 1UYWH 1AY1L 1HI6A 2W65B 3VXNA 3L3HA 2R4SH 2QV2A 1EAPA 4U2YA 3JVGA 3R06B 3WLBA 4KROD 2AV7B 4YNYA 1AJ7L 1KIPB 4K8RH 4HPYH 1QBML 2G2RB 3ARGD 3B9DA 4KRNA 3FB8A 1CFSB 4R0LB 1IZKA 1A14L 3DVNA 4AIOA 1CGYA 1CN4A 3T1FB 5AZEH 3MGOB 3A6CL 2DQEH 5F3HA 3I3BA 1JPTL 3RY4A 1Q9OA 4PJXA 4MAUH 2OBGA 4LCCC 4E42B 3TO2A 2VJXA 4QRQA 1QNZL 4TUJA 5EB9A 4RBPK 4YX2H 5EWIL 5HJ3A 1MCWM 4FRWA 2ATPB 5CFHA 4PJAF 3B2VH 4JFDB 4LCWA 1MAKA 2VXQH 4CW1B 1MCNA 3U48A 5EBMA 3BPNC 4YK4B 3AY4A 3BH9A 3QO1B 4XMPH 4JREC 2H26A 4I3GA 4OLYH 1CDGA 4JN1H 4LARH 3IFOA 4KUZH 2ADFL 1FG2A 4YC2B 4Q0XL 3SKMB 2R0ZH 4R6UA 1P84J 1FFNA 4YBHA 3CH1A 3QHTC 5EOCJ 4A6YH 3HE7C 2GW5A 5F1SA 3BIAX 2IH3B 4JRXB 1ZGLB 3WJJA 3WFBH 1UWGL 2LVCA 5FO8B 1RIVL 1FH5H 4MA7H 4NZDA 3JUZA 3JTSB 2DYPB 1I3GL 2F53E 15C8L 4LAQH 3WKNA 3G5YA 1A4KB 3SQOL 4UDTB 3KYOB 4ZS6C 3NTCH 3QJFA 1TITA 4OCWH 4Y4FB 4OB5H 2EIZB 3K74B 1HHKA 2ZPKH 4P3DB 3Q2CA 4L9LC 3WLWC 4ZTOL 4HQQH 3P4MB 4BSVA 2AJSH 4KPHL 2BVPA 2BSTA 4DOHB 2DLHA 2ARJB 1A3RH 3BMWA 1JMXA 5C0RL 4C56E 3PGCA 3F7RA 1U8HA 2ZCLH 1ZHBA 4M62L 3DGCR 5GGQL 4K94L 4Z0XA 5C0AB 4GAFB 2ATKB 4O58L 3TPKA 5DVLA 3NMEA 4FQJL 4NNPL 1CS6A 1P6AB 1G6RL 1P4LB 3C5ZA 4L29A 3UTTE 1BJ1H 1INQA 1MQKL 3V5DB 3ZLQC 2XKUA 4XC3H 4FZEH 4YBQD 4ACPA 5ADOL 4OD2B 2DI9A 5D70H 1MJ8H 3IU3B 5I17B 4HXBL 2AJXH 5B22A 3HI1A 3WIHA 2DLTA 4NRYB 5JMOC 1T6VN 2BNRE 1PG7W 5JW4N 3HI5L 3HLAA 3N9GH 5FYJU 3REWA 5BVPL 5DSCB 1O0VA 1BLNB 4FQLL 1JPSH 4GAJH 2QQNL 1MRDH 1XCQA 2G9HA 4K7PH 3TZVB 5KZCB 1JZ2A 3ZDZE 4GRWE 3TJHD 5K9OA 1F3JA 1RZGB 2AXFA 4FQ2L 5T3XL 4RBPH 3UO1L 3QAZC 4PRHE 3MRQA 1T0NA 5GRUH 4EI5C 4XNZC 5IFJA 3N85L 3G6JE 3MRRA 3NIFE 4QHNA 4G8FA 2AV1B 5BV7B 2Q87A 1OARL 1VEMA 3G6AB 3LRHA 5DGRA 4APQC 1MCWW 4Z77A 5H37H 2A83B 3FOLB 2PCPB 4LHUG 3LQAL 4ZFOL 1SBBA 2X70A 5DMGD 1Y6NR 1IC4H 2DQJH 4JFDD 2W38A 3GM8A 1NMBH 4DFHA 4YHNB 4NBXB 4F80A 1VENA 2UYLB 1E6JL 1NEZG 4OT1L 4DK6A 4I18B 1HXMB 4TSAH 1SY6H 4U6XA 4OZGE 3KPRB 2P42B 4H1LG 3BP7B 4RGNC 1MLCB 1AO7E 2DAVA 5I15L 1T5WA 4F7TA 3FZUC 4F33B 4BQCA 1UM5H 2VZSA 4JN2B 4JRXD 4NUGL 1TDQA 1R3LB 5C9KA 3V0VB 4WNQB 2X4OA 1CFTB 4N8VB 4YEFA 2NPLX 2DYPD 1AGFB 2JJSC 3VFSB 2NY1B 3TLRA 4XMLH 1R3IH 5E08H 3GSUA 5CD5D 4OIAA 4KK8C 4D3CL 4Y4FD 2IALB 2OJEA 1CDJA 1FVCA 2YA0A 3STZA 3D3VB 1L7TH 4RX4A 3MV11 5ESQB 2GJJA 1UGNA 3M45A 1TMCB 1G9MH 3VXUA 3SCMB 3AS2A 3WHE1 4PG9A 4I3SH 2X41A 2AXGB 4QGYA 5EZIH 3SO3B 1QO3B 2IH1A 4YXHL 5C0AD 1A6VH 3HMXA 4YUEL 3QIWC 2JIXA 4P4KA 5E00B 3GHEH 3TYFA 4YXLL 1BIHA 4DUXA 1ZT7B 4U6TA 3I9GL 4QGTA 4Z95H 4LCYB 4XHJC 5HI3D 1MFBL 4DVBB 2MCPH 1DVFC 2W60B 1BQLL 3CVHA 5F7EL 3W0WA 1MHCB 5FGBA 3MUGB 1AR1C 2VZOA 3PHOA 1YEIL 4HG4K 2H3NA 4X5WB 5HHXL 3UBXA 4S2SA 1CDCA 5D7IF 1RZFH 1BM3H 1BF8A 4MVBD 1LDPH 3CMOL 3JV4B 1ZHLA