1TETH

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
210
structure length
209
Chain Sequence
QIQLVQSGPELKTPGETVRISCKASGYTFTTYGMSWVKQTPGKGFKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARRSWYFDVWGTGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 41
structure length 209
sequence length 210
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetH02
2XA8L 4Z7WB 1R3HB 5JW4M 3UPRA 1GYAA 4GG8A 1HSAB 2ARWA 2QBWA 3B9AA 1YEFL 1MUJB 1HSBB 1J1PH 3OHXB 4HGMA 5GRVL 5IV2B 1KB9K 3QIBB 1TZGL 2P8LB 3ARTA 2R29L 2UV3A 4NM4L 3RU8H 1F3JB 4KKLC 2E9IA 1F11B 3DRQA 5SWSB 4ZXBC 4QXTB 1FV1A 2BNQD 5FYKH 4JRYA 1DVFC 1YMHB 3IDXL 4U3HA 1NMBH 2BSRB 1OAUH 1KC5H 2F53A 2J5LC 4HWZA 4IDLA 3PIQA 1AJ7L 1JPST 1OT2A 3ULUD 1IGJB 1G9EA 5M7QA 1HINH 1JGUH 3G5YB 4WDIA 3SHSA 3HE7B 4LCWE 4NOBA 1BX2B 3QI9C 1EVTC 5ALCL 1T1XB 4LOUC 2PNDA 2YA2A 2IANE 4ODUA 1BJ1H 1WT5A 3HC4L 2RHEA 4ZXBB 3TF7C 2OJZL 5F7EL 1XAUA 1DVFB 2OK0L 4P4RB 4R26H 3F5WA 5FEBA 3U7YH 1KLUB 3KPTA 2GJ6A 3OMZA 3X3FH 1QKZL 2VZVA 5F9DC 1C16B 4Z76B 4MJIB 2ZKHL 4PJIA 4MAUH 3NH7L 5ESVB 3RWDB 4UUJB 2NY2C 2YC1A 4NC2B 2DQIL 3O6FA 4S1RL 1BREA 5BQ7A 4JN2B 1U42A 4Z7WE 4JB9H 1Z9MA 3E1F1 1V7ML 3OZ9L 4PGEA 5KVGH 4HDIB 3LDBB 1JZ3A 5CSGA 3UJJL 3TV3L 4GAGL 3MLYH 3QJFA 4ISVA 2ENYA 1JPSH 2GQHA 2W0KA 2Y7QB 4LCCB 1XEDA 4LDOB 1BD2A 3QO0B 4EEEA 1RK0B 3NCJH 4PJGB 5EO0A 3V4VL 3MZTA 5I6XB 1D5BB 3WFEH 5SWSE 1A6WL 2AABL 4UILL 1E27B 1GH7A 3IRZA 1YNTB 4XP1H 4TSCH 2V2WB 2F5AH 1CVSC 2FD6H 3DIFA 3SE9H 5EIIB 3OX8A 3K2UH 1T20A 1I8IA 4Y4KA 3QCTL 3VXQB 3TO4B 3U9PH 5KS9A 2YOCA 3VXMD 4UU9B 1HHHA 4J3SA 3V0WL 4LEXL 1JN6A 3QUYD 2VJXA 1Z3GL 3QEUB 2IG2L 15C8H 5GJTH 2ZP0T 2F54D 3FO2B 2O5XL 2O93L 1FYTB 4K9EL 3UC0H 3RVTD 3QIWB 1DUZA 2FR4B 1CTNA 1KCRL 4X9GA 3V5KB 4TUKL 3MRIB 1U8JB 3EOAB 1TTFA 1ZLSH 4PJFF 1WITA 2DYPB 4JZJA 4MJIE 4AM0A 4K3DH 4Y16B 1J0IA 4KK6C 4NYLA 2D7TH 3HI1A 5CBEA 5C0FA 1T0MB 4G9FD 4JO4L 3U0PA 4NFCA 1PLGL 2VE6A 1DLFL 2XY2A 1DQLL 1EA9C 5L88H 5FCSH 1DN0B 1FZOB 1QYGL 5DMKB 2XWBB 4G42B 4L8SC 4FFYL 1P1ZB 3REVB 4YHLL 4WU7B 1G7JA 4PJGE 1U8QA 2OZ4H 2HWZH 3U36B 1D6VL 2VLJD 1PQZA 2EH7H 1LEGA 4EI5A 3RDTA 2DB8A 2NTFA 1SEBB 2YD9A 3MNVB 4KI5F 3BO8B 1N6QL 3G04B 1XGRA 3GKWL 2I9TA 4GKNA 4QXGL 1N5AB 3ZE2E 2R0LL 4JFPA 1AQDB 2MTPA 1FYTE 2BOCB 5JHDA 2Q76A 5JOFB 2FX8L 4N0FA 5TPWH 4QEGA 3RWCA 2PYEA 3O4LB 3ZLQC 1XIWA 4N0UB 4BYHA 3R06B 4L29B 3BIAX 5HY9B 3D39A 5L2KD 4K8RH 4N9GB 1AI1L 3U46A 3W9DA 3MJ9H 3B9KC 4WJ5A 3TJHD 1WWWX 2UZIH 4PJXB 2A0LD 5E08H 1T22B 1K8IA 3TYFB 3RX7A 1CFTB 2HYMA 3H42L 3V52H 5I9QC 3BGAA 5J11C 5DD0L 4FABL 1ZTXL 3FOLA 3WLBA 5EU5B 4R0LA 1LQSR 4LAQH 3BDXA 5EUKA 4CVZA 4X4YA 4XB7A 1WBZB 1GCFA 5KW9L 1XF1A 1Q38A 5I1EH 5B39G 3WE6B 4MNQD 4KTDH 5DD3L 1BQLH 1GAFH 3B9KB 3CX2A 3RIFK 4U6YB 1ERNA 1AR1C 2R8SL 1UB5B 4EN3A 1U3HB 5I9QB 5CD5D 1T83C 3FQRB 4Z7QE 5J9PA 3MRRB 1UVQB 2DKSA 5IVZB 4LVHC 2ATPB 4CDGC 4AYFA 1A7BA 1MJJB 5JXEA 4F7CB 4GFTB 1CLYL 1MWAH 3RTQA 3ARBA 1HE7A 4LGSB 1I8MB 1MFDH 1T5XA 5E6ID 2G2RB 2FO1A 3VWJD 2RB8A 2R56H 2VDKH 3QHFH 5E8DL 4NCDA 5T1KB 2SEBB 3I50H 1EV2E 1AE6H 3BP4A 3O4LE 1H3GA 1I7RB 4YGVA 1BJ1J 1ETZB 4N0UE 2CMRL 3GMPA 4OLEA 4RFNC 4LVHB 2F58H 3PWUB 2CR3A 2IF7A 3ULUH 5FCUH 3QA3A 4HC1L 2CK2A 4OZFG 3HB3C 4KTYA 5DMGC 3BXNB 4PJXE 1T6WA 2K3TA 5CUSH 5J56B 4PP1D 4P2RA 2PF6A 2L4OA 3UBXA 5F70A 4HT1L 1SYVB 4X6CB 3QUKB 4LGRB 3AXLB 2AXHA 4H8WH 5DFWH 1JPGB 1OGAB 4HH9B 4DJMA 3PL6A 5HD8C 2K1MA 5SX5H 4X6BB 1MAKA 5HPOA 3ZTNL 5HGHA 4MSWA 5LQBL 4RFNB 5KSUB 4QOKB 2DQGL 4KMTL 3CVIH 1HHJA 5C6TH 3L5XH 1UXSA 5EC1B 3EJZD 5BV7H 4R3SB 5I74C 4PYGA 3VWKA 1FORH 3DVNA 4IIQA 3T3PF 2WBKA 4OZIB 3L7EB 3ORJA 1MCNA 3MV7B 3HNVL 4GG6F 4TPRL 2ZUQB 4ENED 5AD0B 4OZFH 4MAYD 3ZMRA 3BPLC 4C83B 2VISA 3D5OF 3GMMB 5GISL 3FFCA 3QIUD 3GGWA 3EDJA 3UTTD 3NPZB 3TC9A 4JRWA 4KAQH 3HFMH 3QAZC 3MYJB 5BMFH 3W39A 3RWJB 1E4XH 1NGWB 1SJHB 5BXFA 4KH2A 5DJCA 4I18A 4U7SA 3VRLF 2DM7A 4OM1H 1AD9B 2R0WH 1B0GB 3TYGH 3EHBD 4HIJA 5I71B 2YZ8A 1ZT4B 3IXAA 1WIPA 1OTSC 3HS0B 3DX8B 4FQXB 4NJAL 2R15A 1NAKH 5FUOL 1EH9A 1MVUB 3VXNB 3L95B 3LMJL 4YXLH 1IAII 1F97A 1H3UA 4HGKC 3V6OE 3I9GL 1A0QH 3MV01 3AVEA 4U1MA 4X6CE 3S4SA 3IDNA 5HDOA 3GMOA 1OGAE 3GIVA 4OF0A 3MBED 3RI5K 2VKWA 3B9DA 4QHNA 1QBMH 3BEWA 5EU4B 3WIFA 1HILA 4N68A 5JOEA 3K1KC 2PETA 25C8H 4QOKE 3AS2A 4NNPL 1D5MB 1NDGB 2W9DL 9CGTA 5IB3B 2UWEF 5DA0B 1QR1A 4JM2A 5E8PA 5L8LB 1K6QL 5HPMA 3QDAA 1IM9A 5J3HD 3UDWA 1K3IA 4ZPVA 3IAQA 1RZ8B 2W07A 4OZIE 5FA4B 5DR5L 3MV7E 4KDTC 3GUTA 3L3GA 1QBAA 4D0DA 3FO9A 1DFBL 4X7SL 5D70H 3H3BC 4DGVL 1G6RA 1GGUA 1KB5H 43CAB 1NFIB 3T2QA 3FQWB 1KJVA 4I0CC 4H1LB 4MA8L 4PD4J 1CICA 1A7OH 1MRFH 4RMVA 2B39A 1EHAA 32C2B 1INEH 3HZYA 1UCBH 5I8KL 4P3DB 1U8IA 4FA8A 1KEML 4JRXB 3VI4F 3MLUH 3QDGA 1DSFH 1MF2L 4JAMB 4DN4H 4Z5RB 1WEJH 2F5BL 2LFGA 3IU4L 2L7JA 3OAZK 4HUVB 4GRWF 1HKFA 3OG6B 5IROC 4JHZA 1OGTA 4Z7VA 4U7KA 4XNMA 2GFBA 4P2QA 3BW9B 2H3NB 3FQNA 1SMOA 4JO2H 1MNUH 3CUPA 4HXBL 1P4BH 2VR4A 4C56A 3QUMH 3PWPD 2XN9D 2AI0H 2OL3L 4M7LL 2XV6B 5HHOA 4YNYB 5JW5A 2GAZA 1RZFL 5EBLB 3ABZA 1HWGB 4LCIH 2PTVA 1E6OL 1GZQA 5C0DB 2FWOA 3UO1H 1I9RH 4ALAL 2EH8L 4KK8C 3U9UA 4PBVC 3SGEI 1TETH 3LPFA 4TVSa 3MLVL 4KXZH 2VH5L 2OL3B 1HCVA 5FYLD 1RZKH 2AEPH 1A14H 4I3RH 1N2RB 3LB6C 3V2AR 3WD5L 1HEZB 2VC2L 3C5ZB 3LRHA 4YQXL 1X5FA 5C07D 1OSZA 1T2JA 1X7QB 1JFQL 4RBPH 1TJGL 1UM4H 5IQ7H 2BNQA 5AEAA 3T0EB 3D2UA 1K85A 2J6EA 4LVEA 4WV1A 4YGAB 4Z7UA 4S0TD 1S7QA 5CAYB 4YPGA 4JRXE 3AB0C 4NZTH 5D1QA 3PWJA 1WK0A 5CEZL 1KCKA 1KELH 3RNQA 2HG5A 2OP4H 4LSSH 5F1KC 3MC0A 4XPTH 3WUZA 4PJEB 2R1YA 1NL0H 4QF1A 2PYFB 2YEZA 1S7UA 3HMXL 3MJGX 4PRID 4NZUL 4X6EA 3MUHL 1FFPB 2EYSB 3K8KA 2YR3A 3QDMA 2ENSA 4TRPL 4LVNB 4NFDA 2X4OA 2IH3A 2NLJA 4HIHB 3GJEB 1NGQL 2I26N 4X4XA 5C0AA 1OSPH 1T1YA 1ZHNA 5J12C 5KANI 3AB0B 4PG9B 4U0RB 5I75C 1QRKA 2COQA 4RISH 2E6PA 5HYIA 3GSRA 2H32A 4X4ZA 3W9EB 5MHSD 3GSVA 1M6OA 3OKDA 3AY4C 3H9SB 3V5HA 3TT1H 5JXAH 1XGUB 5DVOA 1HNGA 2R9HD 3OV6A 1ZWIB 1J11A 4PLJC 4JO1H 1FNSH 3EYOB 1WIUA 2E6JA 1RULL 1FNLA 2DWDB 4JY6B 4OUUB 4OI7A 4D2NA 3GI9H 1LE5A 1X6LA 2XG5A 2OR7A 5E00A 2EYTB 3L3JB 1Q0XL 2VL4A 4HPOH 5HGGS 3OKLA 1MRDL 1N5YL 3ZHKA 5LXGH 6FABL 4M1DL 2NY5L 2ZCHL 3T0EE 4HFUH 5EO1B 4AMKL 5J8OA 1MHHA 1WC7B 1ZHLB 1KPRA 4XXCC 4V1DB 5GRVK 5D5MA 3IU3B 1IM3B 3LY6A 5IVXF 3VXMA 2I07B 4YDVB 1VESA 4WWKD 5GHWL 3QUYA 4PJEE 3GMNB 1TQBC 2ADFH 5E2UL 1N0XH 5HYQA 3FB6B 1NFDA 5GIRA 3K81A 3CXDL 1FIEA 1SJVA 1FRGL 3BH9B 3WIHL 1G9NL 1CTOA 1AD0A 5GRUL 3WFHB 3DUHA 2BMKA 2NY6C 3T8XB 3LZFL 2UZYB 2JTDA 3DETC 2EIZA 4OI9A 5E7BA 1BMGA 4APQD 5CEZE 4MDIA 3DI3B 2JJWA 2YMXH 2D7MA 2KUTA 2YK1L 5F21B 2CK0L 5HHMB 1A64A 4JQXC 4PGCB 4PJBB 1QRNA 1YPZB 2FB4L 3STZA 4CN1A 5LGJB 4KK9C 1XZ0A 3EYQC 3QDHA 5BOPA 1TQBB 2AK1H 4UT9H 1ND0B 3O6MH 4XAWH 4M6NH 3RHWK 1TJHH 2A6IB 4Q0XH 1G7PB 4G9FA 3H9SE 5TGBB 4JVUA 4Z78B 4NT6B 4D8PB 1PKOA 2Z31D 1UWEL 4MXQD 2NY6B 4KHXL 4NPYB 1YNKH 4XZUB 1EERB 5FIEA 1EDQA 3L7FB 1L7IL 4YXKH 5ADOL 1A6TB 2X4PB 2OR9H 1OB1A 1LHZA 3OJ2C 4XWOD 4K3JH 1CD0A 4OD2A 3NFNB 1ORQA 1JGDA 4NDMA 4O02H 4IM8A 3PGCB 2D31A 5CKGA 4G6KL 4V1DE 1A4JA 2BNRD 1U8KA 2VLKD 3JSSA 2UY6A 4KZDH 1IMHC 3R8QA 3JUYA 4KRPB 1KV3A 2GUOA 5EUOB 1JE6A 4CMMA 2ESVA 4UBDC 3MLSL 4HJJH 4P5KB 3L3KA 3BUTA 2UUDK 3D0VB 2NZ9D 3OF6A 2HKHH 4OCYL 4HUNB 4KY1L 1AGFA 2VZ3A 4JO3L 3JV5A 5AYUH 4JM4H 5FUZL 4M6OL 3NCFB 3WXWH 2XQBL 2Z35A 4ODVH 4PJIF 3TWCH 4XNXL 2C3GA 5INCA 4I9WD 4KTEL 4KKAD 5LBSH 3UJIH 3K7UA 5HHME 4PJBE 1YPZE 3IJSB 5FK9A 3ARDC 1HQRA 4LASL 1CGSL 3U4EA 1P4IH 5DQJB 5K9QG 5CGMA 3V8CA 4NWUL 3A6BL 1L9MA 1F13A 5ANMA 3EJYD 4PV8A 1NBZB 3DUSB 3DRTB 2NY4C 8FABB 4LPYA 2Y25A 1QLRA 4JANB 4F9PC 1URLA 3PJSA 3SOBH 2RIKA 2FHCA 3ARDB 2OTUA 4NN5C 3NFSH 3FFDA 5GGQL 5KSAD 2Y4SA 3C8DA 1VEOA 1QO3A 2A74A 4TSBH 5D2NB 1T03L 4TQEL 4NWTH 3O3EB 1IGTB 3BFOA 5KS9F 2QADC 3BPOC 2P5WB 1X5IA 4XC1L 3GNML 3QFDA 5J1SC 1MFEL 3KPPB 5I15L 4BSWB 4Y1AA 5EUOE 3MLXL 1P7KB 1ZK9A 4TYUA 2BJMH 2ZZUT 1NCAH 4A2MA 2BX5A 3JV4B 3MR9B 5DSCA 3LD8C 4LLYB 4NN5B 5D6DA 4ELMB 5IMOA 1WBXA 4J3XA 1EBAA 3KVQA 1I1AB 1J1PL 3WFBL 4DQOH 1S7VA 3MV9A 2GTZA 4GUPA 2VIRA 4FMKA 3VFVA 4NKOB 4FQPA 5HVHC 3D87B 1CK0H 4IRZH 2QADB 5GS1C 3RU8L 5E03A 2JK5B 3HA0A 1R5WA 1CFNA 4WI8A 3D9AH 4YO0A 3RP1A 5AG8A 4ZUVA 4L8DA 3MA7B 1CFQA 1UZ8B 4NN6C 3UAJD 4PFEA 1RUKH 4I4WA 4OZHB 1NMBL 1WGOA 5F9JB 4X5LA 1OAUL 1KC5L 4MJ5B 3OKKB 3LQMA 1QP1A 3WIIH 2XA3A 1GVIA 5J1TC 3ARWA 4CADA 2OTWB 2VQ1A 1A6ZB 1JGUL 1HINL 1MREH 2NR6C 3PDDA 3BGMB 4OZGB 4U33A 5LG1A 1HWHB 5HVHB 4XP4H 4YR6B 5DRXB 4U2YA 5GS1B 5FHBH 1UM5H 4L8BB 3BP5B 3S5LA 1NANI 1YC8A 2Z8RA 4NN6B 4R26L 3GB7B 5IR1B 3U7YL 4BZYA 4U1NB 4FNLH 5D2NE 2C9AA 3AUVA 3HZMA 4BUHA 4E9LA 4YBQC 3MRPA 2XYCA 4MAUL 4MD5B 3IGAA 3H7LA 4F37K 2P5WE 3GRWH 1T7VA 5D2LA 3UTTA 1V8HA 5CILH 4KDVA 1U41A 2O5ZL 2QQKH 5C92A 4ELME 2RFXB 5KVGL 1M7XA 2DICA 2AJZA 4ZFZA 5BS0B 1ZGLB 5KG9A 2VABA 2H2PD 2W9EL 3ILPA 3MLYL 3HNSH 4X6FA 3B9VA 1JPSL 4GS7B 4HUXB 3F7YB 5E0QA 5F72S 1F45A 4D9QE 3NCJL 3OB8A 4WFHD 4JDZA 4YDKH 1M7DB 3WFEL 5ACZB 2P5EA 3BRFA 4IJ3C 2P1YA 4XP1L 1ZEAH 1VACB 4TSCL 4ZSOA 2F5AL 2C1OA 2FD6L 2P7TB 1YMMD 2ZWLT 2BP3A 4OZHE 2VWEE 1AHWA 5EN2A 3SE9L 3MRQA 3QSKB 3K2UL 5I17B 4XX1G 3MBEA 3U9PL 1BGXH 3CH1B 1HQ4B 1JZ4A 5E4EC 4NKIH 4OZGE 2P4AB 3DVIA 5GS3A 5J6HA 3LSOA 2J1KA 4WO4B 15C8L 5GJTL 3T3MF 3GMLA 1OQXA 1M7IA 2VTFA 4WI5A 1JJUA 1KJMA 5FYKE 3UC0L 3R8BB 2C4FU 4JKKA 3O9WD 4IJ3B 3C8KB 4PJ9B 3CFKB 2M1KA 1I4FA 3NTCH 3PWLB 4WRLA 4P23A 3MQIA 3JUZA 4X5WA 1B88A 5CJ8A 4RIRB 3DSNA 5DEGA 3LKPB 1ZLSL 2BVPB 1EO8H 4X9BA 4M48H 3CDCA 4K3DL 1WWAX 1KIQA 3IDIA 2ICWA 2XKNB 3FB7B 2D7TL 2O26U 1QLEH 4IHOB 3KPSD 3OAUH 4Y19D 1LMKA 3EOBB 1HI6B 4LBEB 4ZO8A 2EDNA 5L88L 5BS0E 3C60A 3MFFB 1KTLA 3RWIA 2Y5TB 1H3VA 2XTLA 2V7NB 4PTUB 1EFXA 5IK3A 2EDKA 2HRPH 1DP0A 3LEXA 2YD5A 4HV8B 1IFHH 3GM0A 2OZ4L 3G5ZA 3D3VB 2HWZL 3WN5B 1ZSDB 2ZUWA 4F15C 4OF3A 3QEHA 2EH7L 5FGCB 2PCPA 4J6RH 4XGZB 3WKMH 3WJLC 2B4CH 4PJ8A 3QUXD 3PWPA 3K46A 3P9MB 1YQ2A 4S1QH 1CQYA 3T0DA 3BZFB 5IJVB 4HKXA 4LHUA 4PR5A 2RR3A 2FCBA 1BOGB 1GOHA 3VXSA 4GW1B 4TNVF 4P46A 2FJFA 4OD3H 5JIIA 1LP9B 4GOSA 1I85A 3CFEB 4JFZH 5SV3A 5MENA 1MHCA 4MQ7B 3V6ZB 3QCVH 1P7QD 1CL7H 1Q9KA 3LKSB 4UAOB 5TPWL 3TBSB 2YSSA 2BCKB 2X4TA 3HC0B 3RUGA 1AY1H 2DL2A 4FQJH 1BJMA 3H2WA 2EIEA 2X6MA 4K23H 3TNMB 1E6JH 3RWFA 3H9HA 5AYQA 1NKRA 2JELL 3V4UH 5C0EB 1YEKH 4PRHD 4K8RL 2JB5H 1CF8H 3MJ9L 3MODH 2UZIL 5C07A 5E08L 1VHPA 2C3XA 4NO0A 3V52L 3I75A 2H8PB 1IBGH 1XF2B 5D96C 2H6PA 5HBBA 4HQQH 2ADJB 4LAQL 5JLZB 1VA9A 2HJKA 1JZ5A 4Q2ZB 1EAPA 5I1EL 4MXVF 4KTDL 4OCLC 1BQLL 1GAFL 3CX5K 3TA3D 4U6XA 3STBA 4OGXL 4E5XB 3D3VE 4KJYB 3D48R 5IB1B 4K3EH 2NYYD 2FLRT 3MSPA 5FGCE 3P4NB 5IT2H 4JQVA 4KGLA 4LPXA 4R7DB 5D96B 4UINH 5FGBA 4IRSB 3SQOH 3VRIA 4ZAKB 3I02B 2J2ZA 5TDNB 1F4HA 3DUUA 2BSTA 4JFDB 1UB6B 4PIRF 1GZPA 1ZMYA 1J7VR 2ATKA 4Y4FD 3L5WB 3O3AB 3IAGC 4D94A 2WLZA 1MWAL 3UBXG 1LP9E 4XXDB 1OP3H 2I24N 3AMLA 1Y0LA 3MRGB 4YWGH 3QFJD 1MFDL 1UYWH 1CXEA 3MRJB 2ADIB 3FQTA 4BUGA 2Z93A 1G7IA 2HT3D 4JM2F 5C0JA 2R56L 3QHFL 4OQTH 3X12A 1G1YA 3I50L 2G5BA 1AE6L 3IT8D 2DLEA 4IRJC 1W8NA 2P8PB 2VO5A 4L4TB 1A1OB 2DI8A 5C1MB 4NHUB 2F58L 3S88H 3KLDA 3ULUL 5FCUL 1MWAB 3P73B 4J3WA 3KHQA 2VLRD 2J4WH 1P84K 5I1AA 3RWGA 1JGEA 5CUSL 2X89D 4XAKD 3VH8A 1KJ3H 2XKUA 2WV3A 3ARGA 1M71A 4Y89A 3SO3C 4H8WL 2ZUVA 1UWGH 4HUWB 4XVUD 5IW1B 4IRJB 1JL8A 1R3KB 3QO1A 3VG9C 3WL9B 4KVCH 3QWOA 1U3ZA 4WWKA 4JHWH 3CVIL 1I3GH 4KI5C 4M93C 3S35H 5C6TL 3L5XL 2I60H 1JK8B 3MRKB 4YFLF 4Z7VF 4I8DA 3ISWA 4IS6B 5BV7L 1ZHBA 3DMMC 4H20H 3BGFC 4YAQA 4Q6YA 4U7MA 4F7EB 4HJ0D 1VKXA 3OJDB 4RNRB 1FORL 1FSKB 2EKSA 3HAEH 3VXOA 4QWWD 3NZ8A 3QH3B 2BFVH 3VE0A 1XF3A 1CDJA 5CCKH 2HVJB 3RY6A 4G8EB 4JFDE 1F4YH 3IJHB 4KROB 3VG9B 3MLPA 4KAQL 3HFML 1IL1A 2Z8VC 4M93B 3A67H 5BMFL 5BV7B 4HKBB 3S6CA 1T4KB 1XR9B 1QNZL 1E4XL 2MFNA 3S4SG 3BJ91 4NQSA 3DMMB 1SYSA 2WW8A 3RJQB 1A9EA 2YPVH 4OM1L 3L3OA 5ID1B 2R0WL 5DJXB 3TYGL 3TIDA 3CJJA 4L4TE 5MEOA 4OZFB 1HXMB 1NAKL 2VXUH 4KJQC 5HHPA 4YXLL 4LRIA 3KPOA 4PP2A 3OGOE 5JO5A 4JREC 3IKCA 1EIBA 1A0QL 4FQ1H 4P4KA 1AQKH 4HX1B 2Y36H 4Z7UF 1JPFB 3P0YH 1ZLVH 3MV11 4PRDB 2VDNH 3N1QC 1H3TA 2OR8A 1C12B 1QBML 1M05B 3ULUE 3LKOB 2Z91A 5L9DH 3SDYH 1P2CA 1SEQH 25C8L 4L3AA 4PJHB 3C5SA 5ADPH 1LD9A 4Y5VA 5T1LD 3SY0A 5ITFB 3T1FB 4JREB 3RVVD 2X1QA 1FZKB 5ENWA 4L4VB 4Z0BH 4DKFH 3CC5B 3FQXA 4BA8A 1FDLH 1PZUB 5JQHC 2IJ0C 3RZCC 4F7MA 5DJ8A 1E4XI 5D70L 4M1CC 2Q1EA 1RZJC 1J05A 1KPVA 1KB5L 3ZDYE 2IH1B 3LIZH 1F5WA 1T2QH 2BHYA 3QRFM 2DJUA 3MRLB 3TVMA 5DJYA 3UMTA 3X11A 1DANT 1A7OL 1U3JA 3G08A 4OCMC 4GAJH 4L1DA 1INEL 1UCBL 4Y4HA 4OFPA 2GSGA 3OAYK 4AT6A 4LK4A 3VFRB 1D9KD 3MLUL 1E4KC 1DSFL 2EZ0D 4XNUH 4DN4L 2XTJD 1EO5A 3C6SB 1U8HB 1WEJL 4JZNB 1KB5B 1FJ1B 5IB4A 1I1YB 3RZCB 1PKQB 3DVGA 5JPNB 3ILQC 3MRBA 1BFOB 4JFFD 3UYOD 1R3IH 1S8DB 1VFMA 1H15B 5ID0B 5B8CC 1U92B 4TN9A 1FG2B 2OQJA 5E8EA 4JO2L 1MNUL 3JWDL 1P4BL 4ZNEA 2VLJB 5KSAA 4Q6IA 3QUML 3GSXA 3F6LA 3QQ4B 2AI0L 1FFNA 4KQ4H 4F3FB 3GM8A 4Y7MA 3C09C 1I8LC 5D5MF 2VQTA 3TZVD 3V79C 1G7MA 1RD6A 1P5UA 5I16B 2FX9H 4HWNA 2VDRH 1QA9A 5CJQH 2VAAA 3HPJA 3V6FB 1NC2D 2E5EA 4PJHE 4WW2B 3U0WH 1AP2A 1EEYB 2EKJA 4LCIL 3QUZD 1NFDF 1Q8MA 1CFSA 1M4KA 3UPCA 1I9RL 3UO1L 3E6FA 4K2UH 4I48A 3QNXA 1TETL 3QUMB 4L4VE 1DUYA 2BHUA 2HJFB 4QHLB 3SEPA 4H0IA 1JRHH 3OWEA 3RL2B 4XHJD 1RZKL 2AEPL 1A14L 2JJUA 2Y07H 4I3RL 1Z5LA 5FAAA 2WMPA 1AKJD 1TIUA 1QUNA 1REIA 1X5GA 4BFIB 2AJUL 1UM4L 5IQ7L 5JQ6H 4GG6B 5SWZA 4LMQI 3C6LC 3SDDD 5K59E 5GGVH 4WFFD 3SGKA 4O2FA 4Z95H 4QTIH 1ITCA 1TZIB 5H2BA 4NZTL 2PO6A 2WLYA 2YZ1A 4CVUA 1KELL 4MZ3A 2OP4L 4LSSL 5EU3A 4XPTL 1PKQE 1UJ3A 2CLRB 1NL0L 3NA4A 4Y5YA 2G60L 1U58A 2J6EH 4JY4B 5GSVB 2HVKA 5F88A 5CSBA 1OF2B 4J2XA 4QRTB 4Z0XA 3VXRA 4NBXB 5K93A 3MRCA 3VDAA 3P4OB 2VLJE 4QRQA 4JFHD 1WTLA 3L3HB 3C6LB 3BP6A 2YN3A 3OGCA 4LMQE 5D7JD 1EGJA 1OSPL 5FFLA 4F33A 4P57B 4DZBA 4ESKA 3Q5TA 4RISL 3Q3GB 1T0NB 3D0LB 5DFTA 3RBGA 1NEZB 1HOCB 3RY5A 4KXZI 5F7MC 3EFFA 4X7TA 3ZT7A 4NQXB 3E0GA 1R3LA 3DGGA 2H26A 1MPAH 3BD4A 3ZKXC 2E9JA 3TT1L 3MOAH 5DEZA 4OSUH 1I7ZB 1WVZA 5JXAL 5M94B 2HLAA 1KBGL 3WNOA 4BSJA 1FL6B 4JO1L 1FNSL 4O00A 5HYJA 1MHEB 3WXVH 1H3WM 4MQXD 3W11C 2UWEB 5EB9A 5IEKB 2JE8A 4FQCL 4GBXA 4UNTA 3C9NB 4U1KA 3WFCH 4HPOL 1I1FB 3O81A 3T3PE 1DQQB 1RMFH 1ES0A 4HUKB 4HUUA 1FFQA 4U1JA 5LXGL 4GG6E 3O6LH 2GYSA 4OD1H 3TN0C 4HFUL 3E6HB 2E7HA 1YEDB 1KIRA 3ZKXB 2P8MB 4OKVA 4MMZC 3NFPB 1GOFA 3BI9X 5B38A 1IEAA 3FRUA 4CU6A 2AK4D 1J87A 5C0NC 5CGYD 2ADFL 3VCLB 1N0XL 4H88H 2GK0A 4HWEH 3GSQA 3OPZH 4HZLB 3VI3E 5DK3A 4B0MM 2FO4B 4OV5B 1PG7W 3MRHA 3O9WA 1CZ8H 4PGDA 4ZUWB 4ZUTB 1WUNT 1YNLH 5GGSB 3BKJH 5K9OB 1QPXA 4OF6A 4NQCD 2APBA 1YYLH 2NY0C 1EHNA 3F65A 1IT9H 1SJXA 1ZOXA 2YMXL 1HH9A 4NSKA 1GGYA 3K8MA 4AEEA 4MAYB 5KTEL 2ZPKH 3MUGB 4PRAA 4UT9L 5MEQB 3O6ML 4XAWL 4M6NL 1TJHL 4P49A 1TCRA 5IHBA 2E27H 1PYWB 1U93A 4Q0XL 7CGTA 4HK3N 1G7HB 3F7RA 1K2DA 4JGMA 2W0PA 4Y5XC 1TVHA 1YNKL 1S5IH 1YN7A 4YXKL 2UWEE 2NY0B 3BUYB 2YPLD 4BJLA 2D7NA 2OR9L 3DX7A 1PY9A 2O61B 3T65A 1J0ZA 5I8CA 3EYFB 1GC1L 4I0PD 3UXFA 1ORSB 5HDLA 3D69B 5IUSA 3NA9H 1WBYB 5A40E 4O02L 1A3LH 1UQSB 1CGYA 5DD5H 4Z8FH 2BVTA 4UOW1 4Y5XB 2XXMB 4DUWA 4CDHA 4KZDL 1G7LA 3HCVB 4EQ3A 2YD3A 3SCMC 2V7HB 4AQ1B 1JZ6A 4L3ED 1KT2A 2A6DB 1UENA 3MOQA 5F7NC 4HJJL 5HI5C 3B5HA 3SJVB 1YECH 4EDXB 1OP9A 4FFWC 2XI9A 3RIAF 3BQUD 4YHYC 4KHTH 4TUJB 2HKHL 4GRLA 4YPJA 1DTUA 3V95A 4XTRC 1Z0NA 5AYUL 5AAWA 3LEVH 4JM4L 5I66B 3WXWL 1LWRA 2CKBH 3P0VH 4Y2DD 3MLZH 4ODVL 5A3ID 3TWCL 1CGVA 3BYYA 2CRZA 2CRMA 5LBSL 3UJIL 3KPRA 2R39A 5D2LF 3PQYA 4MA1C 2BZDA 1INQB 3QXDA 3AREC 1X44A 1P4IL 4PRBB 4ZODA 3A6OA 3IS0X 4PJAA 1JF5A 1CS6A 2J8HA 2KQNA 3GKZA 4YHYB 1T3FA 4XH2B 1AH1A 3QJHB 4LCUA 3IFNH 2J3SA 5F7WC 5IWLA 3ARFD 2M8XA 1J8KA 4J3VA 1Q9OB 4XCCH 2VDQH 3TA3A 3SOBL 4OI8A 3ULVD 2DJSA 3VW3L 4QNPE 4MA1B 1B0RA 3JV0A 3NFSL 3AREB 5EA0H 4LRNH 5D6CA 1TPXC 3WHXB 5EIVA 4HIIA 4B50A 1T1WB 5I1HH 4TSBL 4R4BA 1KXTB 3SGDH 1AGDB 2XN9B 4NWTL 5D1ZA 1MQ8A 5IOPA 3RL1B 4XPFH 3HRZB 3QIBD 3DYOA 1JI2A 5JMOC 4ORZC 4PRPA 3K4ZA 2BJML 3CSYA 5JPMA 1NCAL 4YC2B 2AV7B 1JWMB 5IVXB 4LL9A 4KMLB 3SJVE 3G9VA 5C0BB 1QSED 5T1MA 1YQVH 4DQOL 3RGVD 4KUZH 5JIPA 2MMXA 1AC6A 1EEZB 4PD4K 1JNHA 1NGZA 1CK0L 4IRZL 2EYRA 1OCWH 2W0LA 5IQ9A 1OWWA 4J1UB 1UKQA 2J8UB 3S5LG 3D9AL 2DLGA 2E9BA 3VFOB 4K07A 1X4XA 2X89A 2VXVH 1KPUB 1RUKL 4KKLD 4R4NC 2OSLA 1W0WB 3MJ8B 5IFJB 3JWOL 4ZXBD 3WIIL 2QSTA 1IJ9A 1DVFD 2E3VA 3VXPB 2FL5A 3MTRA 1MREL 3NIGF 1A6AB 2CLVA 3MRFB 4KKNA 4DTGH 3MRDA 4XP4L 4ZO9A 4MJID 5GS0H 4GG8B 2QR0B 5FHBL 1UM5L 4LNRA 4MDJB 4MGXA 4PRIB 3F6IA 3CFDA 3QI9D 5BZWA 3I6GB 4LOUD 3KNBA 2HFGH 3E3QC 5E4IA 1U8MB 4FNLL 3IRPX 1FVCB 4X80L 3DRQB 2XN9E 1WT5C 5K9QI 3BRGC 1NKOA 5IMKA 3ZKNC 4JRYB 3G6AA 2FIRT 3GRWL 3TCLA 1A1MA 3M17A 5L0QC 3KS0H 4G6MH 4ODXA 5EU6D 5IW6A 4N8CH 2VDOH 5FA3A 1KJ2A 3HR5B 3ELAT 2F53B 3FAWA 4HWZB 3PIQB 5CILL 2NY2D 1W72A 1NMCC 4RX4D 2A73B 5IVXE 2WWKO 4XI5C 5C0BE 1WAAA 1WV7T 2QQKL 4HULB 3RUGF 3BAEH 4N8VB 5J0BA 3HNSL 3K4DA 2GJZB 2OBGA 3TO4D 3DURB 5CSZB 3OXSB 5L0QB 3F5WB 1MLCB 4YDKL 2J8UE 1MOEA 1ZEAL 3UTPD 4PJIB 1FYTD 4JHBA 1NMCB 5DS8A 3MUZ1 3CU1A 1RZGA 3VJ6A 2Y72A 1FGNH 3BWAA 3L5JA 3VXUA 5A16A 5IJKA 4LCYB 3FOMA 4NKIL 4DKEH 1J86A 1A4KA 3Q6FB 4HLZH 1CFVH 4QCIB 2DYPD 4WFGD 1IEBA 2LABA 4UIMB 4Y4KC 4UT7H 2YD6A 2EIDA 2BC4A 1QQDB 4PRIE 3RPKA 4ISVB 4WU5A 4P99A 3DTXB 3NTCL 2HFFA 1E4JA 1WSST 3VFGH 4YDIH 1B0WA 2CH8A 3OL2A 4JVPA 1QSZA 3L6FA 5SX5K 1EO8L 1S5HA 4M48L 4U6TA 4JRYE 2EICA 5EOQH 2CKNA 3GJFH 1QLEL 1PX3A 2F53E 1MCRA 1T20B 5H94A 3OAUL 1I8IB 4Y4KB 1FNGA 2JF1A 4JZJC 2H2SC 1IZKA 4UQ2B 5MHSE 5BOZG 2AXGA 5KBNC 4KK6D 3HLAB 1S78C 2VL5B 3P2TA 4WHTA 1CBVH 1D6EB 4LHUG 2Z31B 4YZFF 1U95A 2PXYC 5IBUB 2HRPL 5HGDB 1CD1B 4DCQA 3G9AB 1IFHL 1JIBA 2PW1A 3TO2A 5A2KH 1QFOA 1CDBA 1BEYH 2NNAA 3WKML 4J6RL 4CVXB 4PJIE 5DJZB 4OFYA 2B4CL 1CLZH 1GPOH 4J8RB 3HI1B 4S1QL 5I1IH 3O4LD 4H5SA 4HKJA 4UT6H 2Q86A 1BLNB 3QXWA 1KCUL 4EI5C 4RMWA 3RDTC 3U0PB 3RNKA 5DMJB 2NX5A 2PXYB 4OD3L 2HJLB 1F00I 2VE6B 1NC2A 4BSVB 2C26A 3QUZA 5C0GA 1AIFA 4JFZL 3QCVL 4U1LA 3QBTB 1CL7L 3P9WB 4UNUA 1TVBB 3GFUA 3UTSA 4EXPX 2CDFB 4PV9B 5DF0A 5GZNC 4LPCA 4FQJL 4LIQH 1LO4H 1RIHH 1VCAA 2YKLH 3BZ4B 3EDDA 4K23L 5CMAA 1CCZA 5CZVH 1E6JL 1ED3A 1U8QB 3TBTA 4BQBA 4MCZB 3BKML 3UTQA 2EEAA 3V4UL 1YEKL 1PQZB 3QULA 1PY4A 1LEGB 2JB5L 4EI5B 1CF8L 3KAAA 1XIWC 3MODL 3RDTB 1LO0H 5JTWA 2P48B 2NY3C 4FFZH 3B9KD 1IBGL 3ULVH 1L9NA 1N8ZA 2OXGA 2I9TB 4HQQL 3HPLA 5DRZB 4GKNB 2M26A 2ZG2A 3RVXC 1JUFB 2AJ3A 2DIAA 1MEXH 2Q76B 4XNQB 2D3VA 3I6KA 1BPVA 3NN8B 4R0LC 1T5WA 3RWCB 2PYEB 4HK0B 1HDMB 1XIWB 3P0GB 1NDMB 3DXAA 4WI9A 4W4OC 4NNYA 2X4QA 4K3EL 3TCXA 4LP4A 2W0FB 5IT2L 4M02A 2YXFA 1ONQA 4UINL 4WJ5B 4MWFA 1AR1D 3SQOL 3X13A 1CWVA 1CL7I 1ZXQA 4YHNB 3FOLB 5C08D 3VH8G 2R2CA 1DBMH 4K94C 4R0LB 3TESA 2EC9T 1H8SA 4YWGL 2F8VA 4MQSB 1UYWL 4CVZB 1OAZH 3HN3A 2MQ0A 4OQTL 2EXWC 5FO8A 1AGEB 5EOTA 3RTQC 4OJFH 3ARBC 1WQVT 1JWUB 3SKNB 3HG1A 3BP7A 2YBRA 5K9KB 1QSFA 4HIEB 1J8HA 1OAQH 2HKFH 4R96B 5E2JA 2FHFA 3S88L 3EYUH 2CGRH 3VMNA 4HEPG 2J4WL 1DBAH 2LQRA 1O0VA 1ZVSA 4QOKD 3IVKA 4ZUSB 1KJ3L 4LEOB 1LDSA 1BBJA 2WWMC 1R5VB 3BIKA 5HHQB 3HB3D 2W65A 3DSFH 5DMGD 3TIEB 4C57C 3AS1A 1UWGL 3KS0J 1F4XH 4M9PA 1AO7A 2V6HA 4ETQB 3G5XB 3MV7D 3GSUA 5HYSA 4JHWL 1T66C 3S35L 2I60L 5HD8D 3WJJA 2X7LB 5E2VH 2PYEE 3BP4B 3PL6C 2FECL 5LKNA 4EUPH 5CBAA 4YGVB 4H20L 3S97C 3MGTA 4PY8J 3B43A 3GMPB 2ICEA 1BM3H 4V2CB 5EBGA 1U36A 3LS4H 1HHIA 1QLFA 4G7VH 1G6VK 5H37H 5HI3C 1I8KA 2KL6A 3LV3A 3O41B 1U8PA 2BY2A 4NQCA 5CHNA 2BFVL 5DVLA 4CNIB 5DDHA 3RX8A 5CCKL 3UBXB 2QSVA 4IIQC 3VWKC 4WHDA 2WUCH 2VYRE 1L0XA 3A67L 3PL6B 3FB5B 1MCPH 2BDNH 2A77H 5HVGB 2YPVL 4DZ8A 3HAEB 3QG6A 2RAMA 4JE4B 3T3ME 1A3QA 3CFCH 1JHTA 4ZOCA 4I18C 3V5DA 5DUPH 2VXUL 3QNYB 1BP3B 3VWKB 3DVNB 3EIFA 3CDFA 2BVOA 5SWQB 1OTSD 3VFPA 4HHAB 1ZA6B 4FQ1L 1AQKL 4I0PA 2Y36L 4JZOA 5ICZA 5IHLB 4L3CA 3UBXI 3P0YL 3GGWB 1ZHKA 2VDNL 3W39B 2FECI 3TNNA 5L9DL 3SDYL 3OJVC 1SEQL 5DJCB 4I18B 4RA3A 1XF4A 5ADPL 4LFHD 3QQ9C 1XCTA 1FGVH 1MY7A 4HIJB 2ICWJ 3U79A 1S7RA 3QWQB 4Z0BL 4P9HC 5A2FA 5ALBH 4DKFL 2NXZC 5JNYB 2ARJA 1FDLL 3KPQB 5DI8A 1AXSA 1X5KA 3O45B 1HCFX 4JM2C 5GXBB 2GTWB 4JRXD 3UDWC 4U1MB 5FF6A 3LIZL 1T2QL 2X4SB 4LCWA 3GMOB 3GIVB 3VFUA 3KPSB 1EUTA 1VSCA 3KPLA 5DRNB 4QHNB 3WIFB 3BEWB 2IANA 2P44B 3C2AH 3PWNB 2FIKA 4UV7H 4GAJL 3NABH 1MCLA 5I1LA 5MP6H 4HJGA 1R5IB 4B5EA 1RZIB 1IAOA 5EC2A 2NXZB 2CO7B 3ZE1E 1IQWH 4XNUL 4NKMA 1CICC 4I1NB 3GSOA 5IIEA 4L8CB 1GHFL 1QR1B 4JM2B 5HPMB 5C2UB 2PTTA 5INDA 4E0RA 1R3IL 4R2GC 2X05A 2KZ1B 4ZPTA 2BNUA 1Q9WA 4TULH 4WFHE 3QNZA 1K9TA 1UEMA 3GUTB 5DEFB 4D0DB 3FO9B 2R2EA 4KVNH 3PGDB 3PHOA 5B21A 5L2JB 3FQUA 4ONHA 3QWRA 2XWTA 5MEPB 4KQ4L 2ICES 3H6JA 3QUXB 4A6YA 1NAMA 3CMGA 3VGAC 2NXYC 4YJZL 1MUJA 1HSBA 2DLTA 1CICB 3OHXA 2FX9L 3BKCH 2VDRL 2XG4A 5CJQL 5IV2A 1H8OA 3HZYB 3VFWB 4Y88A 3U0WL 1MHPH 1WFUA 2R69H 3AGVA 2PTUA 3QDGB 1F3JA 1VGEH 4K2UL 5F9WC 3BT2H 1S7SB 1IKFH 1P7QB 5SWSA 2VAJA 1U2CA 1BQHB 5C9KA 5I2IA 4QXTA 3I85A 1JRHL 5F7FA 3H9YA 1WZ1H 4MXVE 1YMHA 1FO0A 4KK8D 1CXHA 1TMCB 2Y07L 2BSRA 4XNMB 4P2QB 4QRUA 2NXYB 1IGJA 4PRHB 3HE7A 3DI2B 4Q9RH 5JQ6L 3PWVA 5ESAA 3LB6D 1I7TA 1NLDH 3KPSE 1A6PA 4IMLA 5F9WB 5HHOB 5JW5B 5GGVL 1BFTA 4ZXBA 1CLOH 4QTIL 1KCSL 3EGSB 4P48A 3PDOB 4WV1C 1KLUA 3U9UB 3DARA 2YPKA 5CEZD 3ZDZF 3NACH 4G6FB 3FN9A 1C16A 1MLBB 2J6EL 4Z76A 4MJIA 2ZUUA 1X5LA 5IFAL 5ESVA 5D1QC 4UUJA 3DYMA 3BE1H 5FHAH 3U4BH 1RVFH 4BELD 2IPUG 1JWSB 4HIXH 2X70B 4EXKA 3KPMA 4G6AC 5B39A 1FCGA 1O7SA 1A7NH 5FYJD 1NBQA 1PEZA 1JGLH 1JRHI 4Y4FB 1OARH 4LCCA 2HLFC 4U6VH 3JVGA 1JNJA 3QO0A 3QDGE 5DMYA 5D1QB 2DTMH 2G9HA 4O51B 4PJGA 3QFJB 1MPAL 3PWJB 3MPCA 1D5BA 1EGJH 2KQMA 3MOAL 1Y18B 4OSUL 1E27A 4CUCA 1YNTA 4QF1B 5B38G 2V2WA 1XH3B 3CDGB 4X6EB 3WXVL 3UX9B 5EIIA 3QDMB 4BQ6A 5F7LB 1A8JH 1WWCA 4NRYB 1IAIH 4P2QE 4V1DD 4M03A 4PLJD 3TO4A 3WFCL 4JFYB 2BVUA 3CLEH 1RMFL 4PRHE 5DVMA 2VLRB 5E2WH 4OAWB 1RJZA 3J8F7 1T1YB 4OD1L 3VGDA 4PJAF 1IGMH 5HHOE 1BVKB 3QIWA 3GSRB 2FR4A 2OCFD 5E8OA 5BZDA 3MRIA 1U8JA 5FM5M 2BY0A 3LKQA 4DVRH 4H88L 4HWEL 3V6BR 4U49A 1HYRC 3OPZL 4Y16A 5GS2D 1CZ8L 4HMDA 2ZSVB 1C1EH 1YNLL 5EULV 1YEGH 1WFNA 3SE3C 2X1XR 3BKJL 1BF2A 1B6UA 3L1OH 1YYLL 3RVTC 3MV8A 1KUMA 2NY6D 1AR2A 1FZOA 3DETD 2ZPKL 5DMKA 1KPRB 2XWBA 5DHXB 1VEPA 4ONFH 3C2SA 3S3PA 3REVA 2VKXA 4YK4B 4WU7A 3NPSC 2E27L 5DWUH 2ED9A 3QFJE 3QDJD 4KK9D 4AZ8A 3IB4A 3EYQD 2IMMA 1QFWH 5TH2A 3U36A 3GK8H 1LK2B 1EXUB 4W6YB 1NFDB 2VUYA 5GIRB 2R1WB 2R2BB 3EAKA 3QDME 3MNVA 3BO8A 1OLLA 1ZT1B 3PHQA 4X8JB 5AWNH 1S9WB 5C7XL 2OMNA 3G04A 2BMKB 1JGVH 4Q74A 3BVNB 3EW3B 1KCVH 2VLRE 4LHQB 1MY5A 2EIZB 3CZFB 4LLAA 1N5AA 3W81A 3NPSB 4Q9CA 1AQDA 2BOCA 2YD8A 3NA9L 4HCRH 1A3LL 3STZB 4QHKJ 4XCNA 3BZEA 5JOFA 3LRSB 3FRPA 1GSMA 5E5MB 5J4MA 5DD5L 4Z8FL 1RUMH 3V0AC 3AROA 4YHPB 1B4JH 2WK2A 3QT2A 4LQ1A 5GGUB 4L29A 3O11A 3SGEH 1MCJA 2W9LA 2IQ9H 4FXGB 4RMQA 2A38A 1YECL 1T22A 1Z2KA 4KHTL 3BPCB 1CFTA 1NSNL 4HG4J 3GSNH 4LPTA 4UBDD 5IP4A 3LEVL 5IB5B 2EDHA 2CKBL 3P0VL 4NC0B 3MLZL 4WI3A 4U1HA 1CIDA 1QFWM 3WEXA 1JPTH 1ORQB 2FH6A 3LQZB 1FAKT 3UJTH 1WBZA 3N1GC 1P4LB 5EDXA 4ZTPH 5DQ9A 3PHSA 1U8KB 4E41A 4U6YA 3ARDD 3MX0A 1WAAF 2B5IC 1UB5A 1U3HA 1F42A 4CMMB 2CKBB 4PG2A 1NFDE 3IFNL 1KF9B 4IOIA 1UVQA 5DJ0B 1T7ZA 5IVZA 2ATPA 1JBJA 3B6SB 2NY4D 1UH2A 4XCCL 5CZXC 2P5WD 2VDQL 1MJJA 4JFFB 1AGFB 4F7CA 3CCHB 3O8XC 3I3DA 1UADC 3B5TA 3O3BA 5EA0L 3GEWB 4LRNL 5INCB 5FUCE 4ETYA 1I8MA 2G2RA 1NEUA 5I1HL 1A22B 3IFOB 1WISA 1J1XH 5FK9B 1PBYA 2B5IB 5T1KA 1F2QA 2SEBA 1MCWW 1J0JA 3U4EB 5KZCD 1I7RA 4F57H 2RQ8A 4XPFL 5GRXG 1AGBB 5D1XB 1II4E 1ETZA 2EE6A 3O3DB 3PWUA 2QADD 3BKYH 3O4OC 4PV8B 4WTZA 4D9QD 3DO7A 3O8XB 2B20A 3E8UL 3V6OA 1YQVL 1SYVA 4X6CA 4M6MH 1CGTA 3QHTC 3QUKA 4KUZL 1J10A 1JPGA 3P40A 3ZE0E 1OGAA 4F9LA 4Q9QL 2YA1A 4HH9A 5D6DC 2MWCA 1ZS8B 1AKJB 4NC1C 3FFDB 1OCWL 3SPVB 3CFJB 3SDAA 3VGEA 1QG3A 1NUDA 1QO3B 4HC1A 5KSUA 3M1BB 4QOKA 4KKCC 3O4OB 4M43H 4FP8H 2VXVL 5EC1A 3UTOA 2DQEL 5FYKD 3RIFF 5GJSH 3BMVA 4OBRA 1DQMH 3SDDB 1Q1JH 1G9MC 2C3WA 4Y1AB 3MRMB 4OZIA 3L7EA 5GS0C 1NBVH 5DSCB 2IC2A 5TE4H 1JVKA 2UVFA 5FYJH 4DTGL 5ESQB 5GS0L 3VRJB 5IMOB 3GBNH 1WBXB 2N4IA 2NR6D 2BRRH 4C83A 2AW2A 4JFFE 3MV9B 3GMMA 4PJCB 5JW4Q 4GUPB 2VIRB 3VFVB 3MYJA 2V9TA 2HFGL 4XNZC 1JYVA 2VSCA 1KOAA 1Q9LB 1D3CA 1N64H 1NGYB 1SJHA 3DYPA 4MNGB 3W0WA 4IMKA 4NQED 1R5WB 1AD9A 3ARYA 3PF2A 1B0GA 2X1PA 4FHBD 2W60A 3C08H 4MLIA 5D7JB 4ZUVB 3MBXH 1UKTA 4AY0A 4G6ML 1ZT4A 2P42B 3L3DA 4IEFB 2VDOL 4N8CL 4MZ2A 3HS0A 3DX8A 3E2HB 4FQXA 1OVZA 4YBQD 3QZWB 4FQQB 5DT1H 3EYSH 4LPVA 4UI2A 3RAJH 5B3JE 1MVUA 3O0RH 3VXNA 4CADB 2GSIA 2IALA 2EC8A 3BAEL 4G8IB 4XNZB 1SBBA 3MNWB 1KN2H 2AERT 4LF3B 3S5LB 1X5JA 5FGSA 1OP3K 3MA9H 5C09B 3MRPB 1D5MA 3IGAB 2N7BA 1J5OH 4PJ9D 1FGNL 3K4AA 4RGOH 4Y1AE 1DR9A 2X4RB 1RZ8A 4DKEL 1AHWC 4GMSH 1CFVL 4NC1E 4UT7L 3MBEC 1LO2H 2M2DA 4ZFZB 5KG9B 3MV9E 43CAA 3ILPB 4OTXH 4BM7A 4X6FB 2ZNXA 3B5GA 4H1LA 4GKSA 4MNGE 3VFGL 32C2A 2QL1A 4YDIL 4P3DA 1NCNA 4JRXA 1QFUH 4P23C 1I9IH 4JAMA 4KUCD 5EOQL 5IVNA 1TQCB 3CLFH 4KDTA 3MRQB 4ERSH 2X4UB 4LSPH 5CINH 1PX4A 3LN5B 4PY8I 3D3VD 3L3IB 4LNVA 1CBVL 1ZANH 3BW9A 3ZT5A 2EEDA 1M7IB 3RI5F 2HA1A 5KVFH 1KYOJ 4LLUB 3GJFB 2XFXA 1I4FB 2DDQH 3U0TA 4P23B 3C60C 5JW3H 4X5WB 1JV5B 4GXUM 5F7DA 3N1FC 4YNYA 5C09E 1B3JA 4P2CG 3KDMA 2AQ1A 5DFVC 1BEYL 3FO1A 1Z6JT 4P2OA 2ZCKH 1CLZL 4MMXC 4DK6A 1GPOL 3CZJA 1HH6B 2ICWB 1ZV5A 3WHE0 4OB5H 5I1IL 1M1SA 4UT6L 1RU9H 3EO1B 1PW3A 4C4KT 4PJ8C 4M1GH 5IFHH 4NQVB 2D0HA 1YEHH 1N2RA 2YUVA 5H35A 1HEZA 2GITB 3C5ZA 5GPRA 1AXIB 4L3EB 3C60B 4MA7H 2DD8H 3KG5A 3UTZA 1SVCP 3NAAH 3D85A 1X7QA 4P46C 1FFOB 3N50A 1I85C 4BH8B 3BQUB 3T0EA 4LIQL 3LEXB 1LO4L 1RIHL 2YKLL 2KZWA 1LGVA 2AAVA 3BEVB 4D9RE 4RMTA 1HHKB 3QEHB 4Y2DB 2E6QA 2PCPB 5FB8B 3P3YA 4ZFFB 2WP3T 1BQSA 1UFUA 2ZCLH 1C5BH 4PJ8B 4FFZL 4PJEA 2ICWI 3FONA 4O9HL 1S9KC 2F8XC 3ZHLA 3ULVL 4PR5B 2EYSA 3VXSB 2IAMA 4P46B 5EZIH 1RIUH 1S7TA 3CK0H 3D18B 2GCYB 5ACMA 2H41A 1MEXL 5E1AB 1A1NB 4HIHA 3GJEA 3FHQA 4B7LA 2IPKA 1QZ1A 4XPHH 3CIQA 3ZKMC 2JLLA 2VNCA 1NANH 5CWSB 3CSBA 5TQ0H 3RWFB 3H9HB 4NHCH 1IGIH 3C8HA 1WZMA 2EDRA 4L9DA 3W9EA 4WUUD 4BH7B 1FNAA 4QTHA 1MI5D 4I13B 3H9SA 5LGHH 1MH5B 1XGUA 4N0YH 4L4TD 2AV1B 5E56A 4W6WB 1T89A 4JQVC 4OUUA 5FGBC 4M61B 2H6PB 1DBML 4M7ZC 1ZVYA 2P47B 1H0DB 2HJKB 2EYTA 2IMNA 2VZ1A 4HBCH 1OAZL 4L3EE 3H0TB 3NGBB 5DJ6A 1HYSC 4I3SH 3NIGE 3IETB 1MCDA 4OJFL 1QSEB 5EO1A 2Q8BH 5HYSG 1BHGA 1ZHLA 4XCYB 2JIXB 3RGVB 3THML 3GMQB 1OAQL 2HKFL 5LVEA 3EYUL 5BW7A 2CGRL 4IRJD 5IBLC 1DEEA 1DBAL 1IM3A 2CLZB 2I07A 4YDVA 3NIDF 4M7ZB 3C87A 2HTKC 3SE4A 5F7YC 3B8YA 3DSFL 3FB6A 4OT1H 1TXKA 3DUUB 3WV0A 4LIQE 1FBIH 1DE4A 3VXSE 5I0DA 1F4XL 4RGNC 2AXFB 1X5HA 1VGKB 3BH9A 4ZOBA 3ARGC 5F9OH 2D4FA 1RUQH 2Z93B 1FVEB 2ZUYA 4FFVC 2J5LB 4Z6AT 5E2VL 5J6GB 3QHZH 4JY5H 2HP4A 4K7PY 4KROD 4P5TA 4PGCA 4PJBA 1YPZA 5LGJA 1BM3L 4KI5D 3ULVE 3LS4L 2IPTH 3QI9B 4CBPA 3B3IB 1ND0A 2CXKA 4G7VL 1XGQB 1P7HL 3DMMD 1G7PA 2WBWB 1ZLWH 3H3PH 1PEWA 5T3ZH 5TGBA 4XWGH 3RFZC 4RGNB 3HI5L 4D8PA 3AC0A 3G5VB 4WFED 4NZJA 4XRCB 3VH8B 2FJHA 4J4PD 4AEFA 4XBGA 1M71B 4NPYA 2WUCL 3L7FA 5EU6B 4EUPB 1A6TA 3EDKA 2CIIA 5FM8A 4YIQA 1MCPL 2BDNL 2A77L 3RY6C 1KFAH 2NY2B 3QO1B 3U82B 3MGOA 1BVLB 1HKLH 2V9QA 4HF5H 3AM8A 2VZOA 1QSEE 3CFCL 3NFNA 3ZKQD 1ZHBB 3PGCA 5DUPL 4GSDH 1LE9B 1VKXB 1U8LA 4LLQA 4X99A 4O4YH 5F93C 4FOMA 3FZUD 3VXOB 3OKNA 3D25A 3NZ8B 4G80B 4QRPD 4KJQD 5EZJA 1XGTA 4LRIC 5D93C 4L4VD 3F8UB 4P5KA 4PUBH 1IL1B 1NCWH 3QCUH 1HIMH 2NY7H 3D0VA 3PUCA 4N0RA 4P4KC 4NRXA 5DK0A 2ID5A 1E4WH 3LPWA 5ISZB 1F58H 1FGVL 3B8SA 5H8DA 4NZRH 4YZFE 5IGXH 5MEOB 3LVEA 2OX5A 3V8OA 5ALBL 3RHWF 4M4RA 2DKMA 1WCQA 3N0PB 5DC4B 1ITBB 4WI2A 4Y5VC 5DQJA 3TPUB 4PP2B 5JO5B 2VRAA 3B83A 4X6DA 4RGNE 4O5LH 1E0OB 3DOSA 1NBZA 3DGCR 3DUSA 4P4KB 2V9RA 8FABA 3R0MA 3SO5A 3RZCD 5EU6E 3Q6GH 4M1CD 4PRNB 4Z7OE 3C2AL 1MFAH 4PJGF 2ZOLB 1LO3H 2K7QA 4UV7L 2Z91B 4LSVH 3NABL 1P2CB 5MP6L 3TVMC 4ZDHB 3HUJB 1BOYA 3C5SB 4YLQT 5HDBE 1IQWL 3KGRA 4WEMB 5JDSB 4X4ME 5D2NA 3VXTA 2NQCA 1KTDB 4Y4HC 1N26A 3FQXB 4F8QA 2P5WA 5CD3A 4TULL 3DV6B 4NQUA 3M07A 3ILQD 3KPPA 4KVNL 4F7MB 4JKLA 4AIXA 4BSWA 4L8SB 5DJ8B 5BCAA 4F9PA 4EVNB 2VN7A 1J05B 1KPVB 4LPUA 3UTPE 5KSBA 5JMRA 3SDCC 3ROOB 3JV4A 5AZ2H 3KYNB 5DJYB 5CIPH 4ELMA 2YRZA 2ITDB 2MPAH 1I1AA 3FJTA 3UROR 3BKCL 4Q6IC 3PP3H 4U1SB 2FJGB 1VERA 4TVPH 4NKOA 2LV4A 1MHPL 2X41A 2R69L 4Y4HB 5ISZE 2GSGB 4AT6B 1T7WA 4WFGE 4UQ3A 1CYGA 1VGEL 1INDH 4O2CB 3BT2L 1NAMH 2QTEA 1YEIH 1IKFL 5TQ2H 5IB4B 2UZXB 1V3MA 1XCQB 3MRBB 3MA7A 1WZ1L 4QHKI 1UZ8A 5C0CA 4W4NA 2NY1C 3SDCB 4B7IA 4OZHA 2OXHA 5F9JA 3BPNC 5E8EB 5C71A 3PNWB 1PG7H 2BOBA 2OTWA 4Q6IB 4EJ1C 1A6ZA 3BGMA 3RKDC 4XPGH 4Q9RL 1A5FH 4OIIH 1FO0H 4KPHH 4UDTB 5HHVH 5IMMA 4L8BA 3LAFA 3P9LB 2PW2A 3HPJB 5EOCH 1CLOL 3HUJE 1RUPH 3P11H 1ACZA 1OQOA 4Z7QF 5IR1A 3GB7A 5J11B 3C6LD 2NY1B 5C2BH 3E6FB 4U1NA 3VFSA 4I48B 3QNXB 4K7PX 2GY7B 1NGXA 3NACL 5DD6A 3GO1H 3BPNB 2C1PA 5CZKA 4UTAH 4MD5A 2PO6C 3WDHA 2ZOKB 3BE1L 5FHAL 3U4BL 1RVFL 3MLRH 1IVLA 5F96H 1UJ3C 4HIXL 4Y5YC 1A7RH 3FT3B 4K7FA 4WNQA 1A7NL 2WIMA 1FAIH 4JFED 3IDGA 3L5HA 3TBWB 4FTVD 5BS0A 1ZGLA 4GW4B 4NO5A 3H8NA 5CGTA 4LSTH 3WLWC 1JGLL 4UV4H 5C08B 4Y8AA 1OWRM 2D9QB 1OARL 4HUXA 4U6VL 2GJJA 5H2BB 2DTML 4Z7NE 3FT4B 4PPTA 1EGJL 1M7DA 1TVDA 1X9QA 5EU3B 2YD4A 2NW3B 5F9AC 4Y5YB 4M7KH 2HVKB 2P7TA 2DS4A 1UACH 3MACH 4Z0XB 5I17A 1IAIL 1CVRA 1O5DT 1IILE 4ZNEE 3CLEL 3CH1A 4QRQB 3BP6B 5E2WL 3W11D 3QXUA 4LKXA 2W91A 3IDMB 4G8GD 3U30C 3IAPA 5C6WH 2UYLB 4WO4A 1V7MH 4GBXC 1XR8A 4YFDB 1IGML 4D9LH 1V05A 3MO1A 4GAGH 1CE1H 1VFBB 4L1HA 1NC4B 2LTQC 4PJ9A 3CFKA 3EFFB 4I2XA 3TN0D 3PWLA 3JV6A 4KJPC 3NCYS 4W70A 1NMAH 3ARZA 2E7BA 1R0AH 3LKPA 4AIZB 3FTGB 2HLAB 2BVPA 5DC0A 4DVRL 5HHNA 1VFAA 3VFNA 1A02N 5HYJB 2E7CA 3O2WH 2XKNA 3FB7A 5DZLA 1FYHB 3U30B 5C0ND 4IHOA 1OPGH 1C1EL 1WTGT 4GBXB 1YEGL 4OCRH 1I3VA 2FGWH 4OV6F 3EOBA 4HUUB 2LTQB 3L1OL 4U1JB 3O9WC 4LBEA 1RK1A 2HFEA 5I74B 3S37X 5IMLB 5C0RH 3ALPA 2ZJSH 3MFFA 2DLIA 1KIRB 3A0OA 2NY0D 2Y5TA 5C08E 3QQ3B 2V7NA 4ONFL 1VFOA 2NW2B 5IG7B 4HV8A 5DWUL 5E8NA 3BPLB 1IEAB 2P43B 3LQAC 4NKQB 1CU4H 3FRPG 3QAZB 3GK8L 3WN5A 5BRZA 4XMKH 2E7MA 4XGZA 4X6CF 1CGWA 1FLTX 1IGFH 2DQJH 4N0CD 1EJOH 4H26B 5BO1H 3MRHB 1S7XB 3P9MA 5AWNL 4PGDB 2DQTH 5IEHB 3BZFA 5IJVA 5CP3H 1JGVL 1KCVL 1OM3H 1HXYB 1LP9A 2OZ4A 3CFEA 4BQ8A 1HH9B 3V6ZA 1C5DA 2R0ZH 5HTSA 4NQDA 4HCRL 3UZQA 3SJVD 4KFZC 5DYOB 4CN6A 4HFWA 3LKSA 3TBSA 3N85H 4LLDA 2BCKA 3HC0A 1RUML 4PGJA 4OZIF 3H7BA 1TCRB 1B4JL 2QKIA 2OJEA 1IC7H 1KXVC 4PJ7A 5ELIA 1P6AB 2YD1A 5KVMC 4KV5E 2IQ9L 1TVHB 5HYJE 3CVHH 1YN7B 3SCMD 3VU2A 1BZQK 2HAZA 4WCYH 1RZJH 4P5MA 3DX7B 4BZ1H 3GSNL 5BVPH 2H8PA 3DO3A 3ES6B 5D9SA 5HI5D 1QR4A 4FFWD 4PJ5A 3FB8A 4NZDA 2ADJA 5JLZA 2RGSA 5F8RC 4CJ1A 4GRLC 1JPTL 5E9DB 5C9JB 1QFWI 3UJTL 3ME0A 2FX8H 3OSKA 4ZTPL 3UEZA 2X42A 2DIBA 3I6LE 2B1HH 3GSNB 4E5XA 4KJYA 3ARED 5IB1A 1FL5B 1RJLA 3P4NA 4HEME 4FXKA 1KT2B 3MCLH 3MJ7B 4HPYH 4JG0H 4R7DA 5C70A 4IRSA 5GZOC 3KPNA 1YN6B 4WTZG 4ZAKA 5F97E 1JHKH 3U2SB 3GJFK 3I02A 1RHHB 5C8JA 4N1HB 4QY8B 4JFDA 1UB6A 3STLA 1XGYH 4YUEH 2X9XA 3L5WA 3CPLA 5IWLC 3O3AA 4OGAC 1H9VA 3MRGA 1RI8A 3TFKC 3EJJX 5ILTH 3KPRB 5C0BD 1V5JA 1J1XL 3PQYB 3JXAA 4XC3H 3GDBA 3QXDB 5T1DH 3OXRB 2R23A 4F57L 2P8PA 4PJAB 5FO9B 4H0GA 4U3XA 2VB5A 5D1ZC 2VLLB 3BKYL 3B4NA 5EOCJ 3MREA 5F1OB 4XBEH 3P73A 4RZCB 1OP5H 3RRQA 4LCUB 1FVDA 1MFCH 4OLXH 1W0YT 1GL4B 2MKLC 3BSZH 3ZDZE 2AQ2A 1I3RB 3VG0H 1CT8B 5ICXB 5E99H 2VMFA 1LK3H 4HUWA 5EU7C 3C5JB 5IW1A 1U3YA 5E9DE 2XKSA 4R4BB 1F3DH 5D1ZB 2BVEA 1B6DA 1YA5A 5IOPB 4FP8L 4G5ZH 3ESUF 5GJSL 4IS6A 5L8JB 1DQML 2QLVB 1Q1JL 4JFOB 4PRPB 3OJDA 4R4ND 4RNRA 1NBVL 2VZTA 1G7QB 4U1GC 3Q5OA 5TE4L 5FYJL 1SBSH 3NCCB 5E7FA 3NVQA 2FX7H 3GBNL 1CDYA 3DX9B 4JRYD 4MD4B 5T1MB 2WINB 2BRRL 1S7WA 4G8EA 5M95B 1GGIH 2KPNA 3MCG1 4E42B 2F53D 3MNZB 4HKBA 1T4KA 1XR9A 3K2MC 2EYRB 5CJXA 1N64L 3DMMA 1ZA3A 3KPRE 1CG9A 3ARUA 2EXYC 3PQYE 5ID1A 4PGBB 5J1AB 1VB9A 2G5RA 3ULSA 3C08L 5DJXA 4CW1A 3MBXL 2X4NA 4J4PA 4PJAE 2DQUL 4U1GB 3BYTA 3T1WA 4JHAH 1HXMA 2JCCB 3REWA 1BZ7A 4GW5B 3ZKND 2F74A 5DT1L 3EYSL 3RAJL 5J12B 4TUOB 3O0RL 1LVEA 5I75B 2GJ6D 4Z77A 4F80A 5EBMA 2FBJH 4FG6C 4M6AA 3NCMA 2Z92B 3MOBH 4HX1A 2DM3A 2CDEB 4LNRB 3WDIA 4FRWA 2I9LA 2E7LA 1JPFA 4CN4A 4XI5D 1KN2L 5BZWB 4GRWH 4PRDA 2YHGA 2QHRH 3KNBB 4GRMB 1M05A 1ROWA 3LKOA 3DBXB 5TF1H 3MA9L 4PJEF 4PJHA 1SY6A 4H1LG 5DRWB 4BFGA 2F54A 5ITFA 3TCLB 1A1MB 1NBYA 3M17B 1U8OB 4MB4A 4ODXB 5IW6B 1J5OL 4NO2B 4L4VA 4PRPE 3LKRA 4RGOL 5KAQF 3CC5A 4EBQH 1BD2D 3GBLA 1NGPH 4UMGA 3KYOB 4GMSL 2HRLA 3QG7H 1IEHA 5EO9B 1LO2L 5IJKC 2OM5A 3GIZH 4DFIA 2C4FT 3KLSA 4OTXL 4HMCA 4YHMH 1F02I 3NOIA 4YDLC 4Y4KD 5F1SA 2HMIC 3MZGB 2XNAA 4GXUN 3O6KH 4H25A 4WY7H 1D5ZB 3SKJH 2V5RA 3AMKA 4ODWA 5E94B 5FYJE 1V3JA 3MLTB 1QFUL 1I9IL 4YBLC 3QRGH 4ZOAA 4ORGA 2R4RH 4CU7A 1RV6X 3C6SA 3CLFL 4JZNA 4ERSL 1KB5A 1FJ1A 3RZCA 1PKQA 1RZGB 2JCCE 4LSPL 3VJ6B 5JPNA 1K6QH 3BWAB 5CINL 3VXUB 1MJUH 1S8DA 4M7LT 3FOMB 1H15A 1ZKAA 2FBOJ 4RAUB 4WW1B 3QDJB 3RQ3A 1A4KB 1ZANL 4WEUD 1FG2A 4YDLB 1IEBB 2VXTH 2VLJA 2VITB 1PJ9A 1S78D 2BC4B 2DWEA 3WNMA 2HTLC 4K55A 5KVFL 3I84A 4WENB 4F3FA 4WU5B 1S3KH 2DDQL 2YUZA 4YBLB 2HFFB 4MA8H 4OF5A 5JW3L 2HFTA 5I16A 1R24B 2PXYD 1BZ9B 1RJYB 5KANG 2AQ3A 3O2VH 2IEPA 3V6FA 4MVBC 4WW2A 1EEYA 1EFQA 1JMZA 3L6FB 1S5HB 1OAYH 1V3KA 4RDQF 1CDGA 2WBJC 2ZCKL 5IB2A 1K4CB 3ZTJG 4ZUUA 3QUMA 4OB5L 2HJFA 3X14B 1RU9L 3RL2A 4M3JA 1F4WH 4M1GL 5HI4C 2OI9C 5IFHL 1YYMH 1YEHL 1TCMA 4WHTB 4YFEA 4ZFOL 1CLCA 1N3NB 4EI5D 1Y6MR 4MA7L 2DD8L 4PJBF 3RDTD 3ARQA 1YPZF 4FQHB 5L2KA 3NAAL 4GXVH 3V0VA 3O2DH 1A6VH 4XP5H 5KAQG 4NUJB 2JJTA 2WBJB 3QUZC 4DCQB 3IFPA 3RA7L 3TO2B 3S36X 1X6NA 2DQHH 2A2QT 5GZND 3PV7A 4ZFOB 1JNLH 5JHDD 4ELKA 2XWJB 2ZCLL 1C5BL 5DJAA 1UA6H 4GO6B 3MXWH 3VDBA 4S11A 3TJEH 4X7EC 3QPQC 1R3JB 4G8FB 2CLRA 2PYED 3VXUE 3LH2H 5F3HB 5GSVA 4JY4A 1XIWD 1OF2A 4MNQA 4QRTA 1WZLA 4Y8DC 2Q86B 1ZE3C 2NY3D 3EKCA 3RNKB 3QDJE 2DLFH 5EZIL 2MHAB 3MROB 1RIUL 5CEYA 3D39D 3CK0L 3DPBA 3P4OA 1AIFB 3L3HA 3C6LA 4GJTB 4N5UA 4NQTA 1JFQH 3RY4A 3W82A 4XPHL 3RVXD 2P46B 2GW5A 2NY4B 4XCFH 5TQ0L 3AU1A 4JFQB 1ED3B 1NEZA 4NHCL 1HOCA 1T04A 1IGIL 3AAZB 5EUOF 1V7NH 1MAMH 5ICYB 3RPIA 5E6IA 3VWJA 5LGHL 1F3DJ 4N0YL 1FL6A 1QEWA 2EDQA 5KZCB 1MHEA 1W8OA 4HG4K 3BZDA 3F7PC 2Z4QA 4HGWB 1J18A 4RDQG 3C9NA 1LNUB 3A6CH 5DC9B 4HBCL 4U6HA 3WO3B 5MERA 3BPOB 1DQQA 4DKAA 4KJWC 3MUJA 3FAXA 3I6KB 4I3SL 2EDOA 5FYKL 1T5WB 2Q8BL 3UZVB 1SQ2N 3WO4C 2VOTA 2IBBA 1YEDA 3CFIC 5I73C 2APXA 2EXWD 4X6DF 3LD8B 2P8MA 4ONOA 4NBYB 4NNYB 3RTQD 3NFPA 3ARBD 5LCVH 4PREA 1FC1A 1FZMA 4JJ5A 4JG1H 1YEJH 4DAGH 2B1AH 1WFOA 3VCLA 4WEBH 3X13B 4LSDA 1U8NB 4OT1L 5DGQA 4EI6A 3NZHH 4HZLA 1V3LA 1FBIL 2FO4A 2V5TA 2WWMD 4ZUTA 4ZUWA 4WHCA 4U2ZA 4R4FH 3WO4B 5F9OL 5GGSA 1WFTA 1BBDH 5K9OA 5I73B 1RUQL 1HHGA 2EO9A 3KR3H 5DZNA 3X3FL 5FO8B 4P2RD 2LVCA 4OCXH 3QHZL 4JY5L 3MMEB 3DECA 3EO0B 4LHJB 4MAYA 1ZT7B 1FNEB 1IGCH 3HG1B 1T66D 3BP7B 3MUGA 3QIUA 1QSFB 2IPTL 1J8HB 1J9CT 3BX7C 3PL6D 1A7QH 1HNFA 3WJJC 2WQRA 5KSBF 2IADB 4D3CH 1PYWA 2AJVH 3H3PL 1ZVSB 3T77B 5T3ZL 4XWGL 3IVKB 4JB9L 4NOFA 4NQEB 4ELMF 4QT5B 1QHOA 2XZCH 5HI3D 4MA3B 4W68A 2AP2A 1S9XB 2LU3A 3AS0A 4LVOC 3BUYA 5JORA 5D71H 3VWKD 2O61A 4M3KB 4D0CB 2EDEA 1KFAL 4URTB 3HE6C 3GSUB 4HK3J 5HYSB 1HKLL 1MCEA 4HF5L 4XVSH 1FNHA 3EYFA 3D69A 2GHWB 3QXAB 3WS3A 4HXAH 3FFCD 4OZHF 1P5VA 5CBAB 1WBYA 7FABH 1UQSA 2DAVA 4GAYB 4FQ2H 3GMRB 3Q2CA 1GRWA 4GSDL 4P3WA 4Q58C 3OKMB 2BK8A 3BDYH 4OZGF 3T08A 4O4YL 1I8KB 4PTTB 3LV3B 2V7HA 1FZJA 2W59A 5DDHB 4NGHH 2A6DA 3IF1B 4NNXB 3HE6B 3TH4T 4PUBL 5KSVB 1NCWL 3QCUL 1HIML 2NY7L 2DOCA 5JOPD 4I0PC 1CGXA 3TBVB 1E4WL 5I66A 3V7MA 1T6VN 3GHEH 1F58L 1UGNA 5DTFB 1VADA 4NZRL 4TOYH 4NM8H 5DA4A 5FECA 5IGXL 5E4EB 2IPUK 2BXYA 1GGCH 3HG1E 5DJDB 1QSFE 1J8HE 3QQ9D 4QLRA 3V5DB 1R6VA 1PVHA 1KCLA 1INQA 2O5YH 4AEIH 5D7IB 4X7DC 4PRBA 4EOWH 2BVOB 4O5LL 3IS1X 2NXZD 4NQEE 5F89A 3VFPB 3ZYJA 4JZOB 4XH2A 1AC0A 3EO9H 2YUWA 2N56A 4JM2D 3RBSA 5JR1H 2Q6WB 5FOBB 3Q6GL 2Q8AH 1IM9D 1ZHKB 1Q9OA 3TNNB 1X5XA 1MFAL 1YDPB 1LO3L 3RX5A 1SM3H 4LSVL 2APWA 2XACC 4J3OC 3KWWA 5T3ZE 2D2OA 2XICA 4XVJH 3IYLW 1T1WA 1S7RB 1MCBA 1AGDA 2XN9A 2XZZA 1L7TH 4WHYG 1WLHA 4LASH 3WNPA 1CGSH 3V4PH 4B53A 4HWBA 1CICD 3RL1A 2ARJB 4PLKC 2OLDA 3HRZA 2HN7B 4TTGA 2NMSA 5FKPB 4R2GD 1QPPA 3QDGD 2QEJA 1JWMA 2AV7A 5AZ2L 4EQ2A 3MCKB 1DDHA 2MSPA 1PD6A 3BJLA 3VFUB 4F15B 2MPAL 3KPLB 2XIDA 1IKNA 3H3KA 2OYPA 4TVPL 4P2QD 1GJIA 5GRWA 2NXYD 4QRSA 3ZYZA 4C56D 3FL7A 12E8H 4Y0GA 1INDL 2JJVA 4J1UA 1BIIA 1YEIL 5TQ2L 2J8UA 4QRRB 5TFSH 2LU4A 1DBJH 1L0QA 2VZUA 5INDB 5D7IE 5CIPB 5HHOD 3GHBH 2BVQB 4L9LC 4ZPTB 5J7CC 1W0WA 2BNUB 5IFJA 1OD7A 5I76A 5I15H 2R2EB 5E6YA 3PHOB 1PG7L 4N90E 3VXPA 2W38A 3MLXH 5DVNA 1A6AA 3MRFA 4FN0A 4G6FD 4A6YB 1NAMB 1A5FL 4OIIL 3SN6N 1FO0L 1KYOK 2D7QA 4KPHL 2QR0A 5HHVL 4MDJA 3WFBH 5B4MC 4PRIA 3WS6A 3HE7C 5EOCL 3PABB 4CMHC 1RUPL 1YJDH 3P11L 3PGFH 3I6GA 5F7UA 2WIIA 5C2BL 1U8MA 4L9LB 4ZQKB 1FVCA 3W5MA 3GO1L 5EIQA 3WNLA 5I2IB 4HS6A 4UTAL 3D2UD 1W0VA 1FO0B 5DMIH 4P3CH 3MLRL 3HR5A 3BHBB 1LP9F 5F96L 2P49B 4QRUB 1A7RL 2A6JA 5D1QD 4WUUB 3U1SH 1I7UB 2D7OA 4OGYH 2A73A 1MI5B 1Q72H 2X1WL 4K94H 2VDKL 4CMHB 3PWVB 1A3RH 1FAIL 1I7TB 1T21B 2J8OA 3NIDE 3K80A 4PY7B 5ESAB 4XCEB 4I5BB 4G6AD 3T0XA 4N8VA 3HKFA 4IMLB 5EFIB 4LSTL 2A6KA 2GEEA 3QDMD 4PJ7F 4UV4L 3OKEA 1T1ZA 3GRWA 2GJZA 2W1NA 5GRJH 4YHIB 3DURA 1IQDA 3QR2A 5CSZA 2Q3ZA 2HT4C 3LDBC 3OXSA 5A2LH 1MLCA 4QRRE 2YPKB 5C0AD 2HLFD 4LCCC 4M7KL 2YRLA 3JVGC 4PJFB 1UACL 4S2SB 3MACL 5I6XC 5DURD 3KXFB 4TVPE 4LCYA 1LEIA 3KPMB 5B39B 4PJDA 4YDJB 4CRPA 4F7PB 4TNWK 2G75A 2O5ZH 2QSCH 3Q6FA 4KKBC 4P9MH 2R0KH 4QCIA 5T3XD 5IHZA 4UIMA 4D9LL 3TO4C 1A2YA 4NO3B 1QACA 1QQDA 2W9EH 1CE1L 3SGJA 3PG2A 5FV1L 1UXWB 2PN5A 1D5XA 2JJSA 3DTXA 5EPMA 1NMAL 3SO3B 2G9HB 4BKLA 1F3RB 1MCOH 1R0AL 3QIWC 4APQA 5CS7A 1KIPA 2V2XB 1UC6A 3O2WL 4MX7B 1Q94B 4LPWA 4F58H 5I8EB 1KNOB 1K5NB 1OPGL 4HS8H 4OZ4A 1KLGA 2EECA 4UQ2A 4OCRL 4WUUE 4RMRA 2FGWL 3HLAA 4Y16C 5DHVA 1MI5E 3BGFB 4GLRH 2VL5A 4K9EC 2C3VA 1D6EA 1RJZB 4HS3B 2Z31A 4MNHB 5C0RL 1ZGLM 2ZJSL 1DL7H 1F8TH 2H1PH 4NFBA 2EDJA 1F6AB 2Y6SC 5HGDA 4KK5C 2XY1A 5E8OB 1CD1A 5TDOA 3TT3H 4M7JH 1CU4L 5BZDB 3L9RA 2DQFB 5TJWK 2B0SH 3LKQB 4XMKL 4CVXA 1T7XA 5DJZA 4PJFE 3DNKA 1IGFL 3U6RA 2DQJL 1QRND 5HGAB 3W2DH 4J8RA 1EJOL 3KXFE 5BO1L 1EHLH 2DQTL 3ULUF 2BNRA 1BLNA 2XT1B 3UP1A 43C9A 4PYHA 3QEQB 1OM3L 2DBJA 2PXYA 2VLKA 3T4YA 2HJLA 4BSVA 3MV8B 4J12A 4QRPB 2R0ZL 3S98A 4YE4H 3NIFF 5HVWA 2XRAH 1TVBA 4I0KA 3N85L 1S9VB 2AJSH 2CDFA 4PV9A 3JTSB 3BZ4A 4P9HH 3S3SA 4MCZA 1IC7L 1FIGH 5TH2B 1IC5H 4QGYA 2AEIT 3ZDYF 3CVHL 3UZEA 4WCYL 1RZJL 1KGCD 3PHQB 4KI5E 4ODHH 4BZ1L 3RGHA 5BVPL 5DUBA 1MRFL 2DTSA 4MD0A 1AGCA 1I9EA 2VDLH 4GQ9H 1MCWM 5DRZA 1G6RH 4WFEE 1JUFA 2ESVD 3R4DA 5FO7B 2CJUH 4XNQA 3B2VH 4PB9H 4XCNB 3BZEB 2CPCA 3CVHB 1LILA 3WFDH 3NN8A 3OF6D 1H5BA 1IAMA 4LLMA 4Q97A 4HK0A 5K9JH 1HDMA 4M62H 1G1CA 1NDMA 2B1HL 3AFLA 1MELA 4X0KB 3DHMA 1EVUA 2JELH 2ZSWB 5AAMA 2W0FA 3O11B 4O2EB 3MCLL 3OB0H 4HPYL 4JG0L 3DROB 5F3BB 2H9GB 2MQCA 1JHKL 3OBAA 2Y9RT 3ZL4H 1U3HC 5T5NF 4PG2C 4HD9A 4YHNA 5D1XD 1XGYL 4YUEL 3QEQE 5FYKU 2LAAA 5E2TH 4PJHF 4RAVA 5EZLB 4U1HB 1X3DA 5CZXD 3MV8E 4QRPE 2C5DC 3FCTA 3O8XD 3WEXB 5ILTL 1FL3A 3U4AA 4W4OA 5B8CB 5DO2C 5I1GH 1AGEA 5CP7A 4XC3L 1JYNA 1I9JH 4R6UA 3CGTA 5T1DL 5DQ9B 1XGPB 4UIKH 1JWUA 5ECJE 3SKNA 4E41B 3RZWA 4ZG1A 4X98B 5L8KB 4OGXH 5K9KA 4HIEA 5GSRA 4R96A 3ARSA 2KKQA 3C09B 3T2OA 4XBEL 4P2YA 3RWHA 1MFCL 3BDBA 4IOIB 4OLXL 3SQBA 4TSAH 2XQYK 1J0HA 3BSZL 2Q87A 3DV4B 4LEOA 4ZUSA 3B2UC 4OQTA 4JDVA 1R5VA 5HHQA 2EDBA 2HT2D 1G0XA 2NPLX 4JKMA 3VG0L 3TIEA 1EJ6A 4AK1A 5K59F 4BZ2H 1IGYB 3V6OC 5E99L 3O3BB 4Y1AD 1LK3L 2P24A 1RAMA 4C54A 3ESVF 4ETQA 3G5XA 4JJHA 1MSPA 2JKXA 4G6JH 5GGRB 4F9LC 2X7LA 4G5ZL 3MV9D 2R2HB 3OKOA 3SDAC 4KKCD 1DBKH 2QQNH 2YXMA 5KOMC 2XPGA 3DO7B 5CEXA 1TLKA 5TDPB 4PLNC 1SBSL 3O41A 3ZKSD 2Q3AA 2FX7L 3F7VA 4CNIA 5GS0D 1NH6A 4WI6A 1GGIL 4WW2F 1JTOA 2JB6B 2ZUQC 3FN0H 3FB5A 2ZNWA 5CJOH 4ODBD 3SDAB 2FZ3A 2BERA 3MRNA 3VFTB 2Q7YB 2X5PA 3HAEA 4MQTB 1TENA 4LLWB 1RFDH 4JFEB 5T5NG 5ERWA 1I75A 2DJ4A 4FTVB 4E41E 1CN4A 4LDEB 4IMKC 4JHAL 5HJ3A 2H32H 3HR6A 4LAJH 2FDBP 1DEDA 3IDYC 3GI9L 1GXEA 1BAFH 3QNYA 3QB7C 3RVUC 5I71C 1C5CH 2GKIA 5C09D 1Z9OA 5SWQA 5T3XH 4HHAA 2FBJL 1ZA6A 4MJ6A 4FQXC 3MOBL 2MCPH 3HZVB 2ADGA 1YMMA 2X9WA 2QHRL 4D0BB 2KBGA 4JLRB 1QNZH 4WI4A 2WNGA 2A83B 5KVDH 5J89A 5TF1L 3W0WB 3WUWA 1QVOA 4G8GB 3IDYB 3VRLE 3K8LA 1DQJB 5IM7A 2W60B 4QHUA 3VI3F 4UOW0 3L3DB 5JZ7C 2FYYA 3G6JA 5E6ZA 4EBQL 3QYCA 2FLBT 3TN0B 4GRWB 5JNYA 3KPQA 1WICA 1ZLUH 1NGPL 3CSGA 1JHLH 4GQPH 3SDXA 3O45A 1SY6H 2P5ED 3S34H 3QG7L 4D9RD 2GSIB 2GTWA 2IALB 5F1IA 4DN3H 4POYA 3GIZL 3BIBX 4K7PH 4JQIH 2X4SA 4YHML 3SBWA 3N9GH 2AK1L 3KPSA 5IHUH 2EDDA 5DRNA 3O6KL 1GGTA 4Y19A 4WY7L 2V5MA 3PWNA 3SKJL 3EZJB 1K3ZA