1TETH

Crystal structure of an anticholera toxin peptide complex at 2.3 angstroms
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
210
structure length
209
Chain Sequence
QIQLVQSGPELKTPGETVRISCKASGYTFTTYGMSWVKQTPGKGFKWMGWINTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARRSWYFDVWGTGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an anticholera toxin peptide complex at 2.3 A.
pubmed doi rcsb
molecule tags Immunoglobulin
molecule keywords IGG1 TE33 FAB (LIGHT CHAIN)
total genus 41
structure length 209
sequence length 210
ec nomenclature
pdb deposition date 1993-06-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tetH02
2XN9E 3L3KA 1RJLB 2HH0H 2R0LH 3B9KA 4RGOL 1DQLL 2GJ6A 3KPLA 3EYSL 2GI7A 3WFBH 3GHEH 1RZIB 1R3JB 4O58H 3RVTC 5DD3L 2BOBB 4ODXB 2IH1A 4U1LA 3F12B 2ZUWA 3OAZK 3RVTD 1BFVH 4CAGA 4DKDC 4EEEA 3R06B 1VGEL 5EU6E 5HYJA 2W0KA 3LMJH 1F6AB 3Q48A 3VWKD 1YEFL 4E5XB 1HSBA 1KB9K 4FZ8L 1CN4A 2WP3O 2I9LA 3D85A 4XMKH 3LHPH 5FCUL 4I4WB 3LQAL 3LS5H 2PR4L 3QEQE 5GS2H 2E7LA 3ARXA 4YC2C 3FB5A 1C5BH 3HZMA 5GJSL 4TYUA 43CAB 4AL8L 4LP4A 2VDPL 4RFOH 2QSTA 3IYLW 1NC4A 5E2UH 3ULUD 2XRAL 1UXSB 4NKQB 2UYLA 4OUOA 3W5MA 3PWUA 5EBLB 3VJ6B 4IRZL 2ADGA 2YXFA 3VXRD 3MV9D 4Y2DB 1MFDH 4I77H 5IJKA 1T04B 4FQXB 1GXEA 3MSPA 3LV3A 4U6HA 2VWEC 4GKNB 1KEGL 5L9DL 4ZPVB 2N1KA 4Z7VF 4XP9L 4OZ4A 1OTUC 3ARFD 4E41B 4QXTA 5L7XH 3GB7A 1FL5B 4RIRB 1S8DB 3ROLA 4KROD 3KWWA 4L8SA 5EOTB 2J6EH 1JGVL 5BV7C 1X44A 2Y4SA 4J3WA 3TT1H 1N5AB 2XFXB 4XC3H 4GKOA 1LWRA 1RPQA 3TBVB 4KRPD 4HV8A 5HPMB 4KU1A 3REVA 4XP6L 3C6SA 1UCTA 2FGWL 1MUJB 1R3LA 2ORBH 3Q1SL 1F8TL 1FC2D 4GRLB 4WDIA 3U2SA 3FZUC 3MUHL 4MNQB 1CFBA 1EXUA 2N7AA 2PXYC 3MV8A 4OLXL 5A16B 3OB0K 3RL2B 3DVFA 3CAFA 2D7PA 1CE6B 5DYOA 1TJIL 3QXWA 2QADB 3S96A 4HGKC 3OKNB 4QXWA 4MB5A 3CXHJ 5GGTH 1EGJL 2NW3A 2KL6A 4XXCC 1CIUA 5DRXA 4KI5C 1YDPA 4DZBA 2AV1B 1KIUA 3JV5A 3W0WB 3FT2B 4JQVC 4OKDA 1Q38A 1N6UA 5IVZB 1OM3L 3V6ZB 5EB9A 5ADPH 4NRYB 5D7LA 1I3UA 3HMXH 5BVJB 3MRGA 3QIUA 1ODAA 2EYTB 5KVEH 1JWMB 1BAFH 1ND0B 2QJDA 1KNOB 4P2OA 3RIFK 4N8PA 1WAAA 4G43B 2ZCLL 1PZ5A 3M17A 4G7YH 1UXWB 1H3TA 5K93A 1CLZH 1KB9J 3F7PC 1DQDL 4YPJA 3FJTA 5GZOC 2VAAA 5GGUB 3FFCE 4G8IA 3P0VL 1MQ8A 1GOFA 2ADIB 4GAJL 2CD0A 3V0VB 4LRNH 5IEHA 2IPUG 4JKPH 5E95B 2D2OA 4YR6B 4GAGH 2DM7A 3TH3T 3X3FH 3RX5A 2NY4D 4NFCA 5I73C 5LCVL 4N9GB 1M7XA 5C07B 1I1AA 3AREC 1OP3K 4ODHL 1RUAL 3BGFC 1SQ2N 3BOVA 3OF6A 1YJDL 2SEBA 2BVEA 4BM7A 4IRSA 4PJAE 1MLBB 4CKVX 5C1MB 1HINL 4PLJC 3B3IB 2AJVL 2Z0BA 5E1HB 3OKMB 5DEFA 2ERJC 4X6BB 3KJ6L 3MO1B 1D6VL 1D5MA 2C4FT 1HHIA 2AGJL 4Q58C 1N0LA 4J2XA 4QTIL 5C6TL 2UVFA 1DCLA 3KYKL 4F7EA 2FH6A 2NR6C 1BFOA 4MAUL 3O2DL 2WBJC 2HWZL 1QNZL 3FAXA 3IJHA 1NMAH 5D2LB 3QEGH 4N0UE 4YH6A 5BV7L 5E2WL 3OAZH 4LSTH 1F97A 4BUGA 5F93C 2EIZA 5KJRH 4C56B 4G3YL 1A7RL 1U91A 4ZG1A 1I1RA 2YBRB 3KPPB 1FVDA 4IIQC 3PWJA 4FQXA 1GZQB 4KK9D 1KENH 2XI9A 3O6LH 2ARWA 4RFOL 5E6IB 1S7TA 1K85A 1R3KA 2CGRH 4JPKL 1FG9C 5EC2B 1N5YL 5EORL 4ZO8A 3DO3A 3LN5A 4HF5H 1KLFA 4K94H 4TVPE 4I8DA 5J12C 3WUZA 4Z9KB 3ES6A 3QDMB 4NM8L 1ZAGA 3DIFA 2W38A 5H37H 4BJLA 4H20H 3VXOA 4WFGD 2Y6SD 3HTLX 3JV6A 2JCCE 3ARGD 4M8VA 4I5BB 3HS0A 4FABL 2ZG2A 4M1GH 3QIWD 5HPMA 3TO2A 1AI1L 5KSAA 1C12B 2AJUH 3SGJA 4PJBE 4NRXB 2P4AB 4TN9A 4ALAL 4YO0A 2A6IB 4ODUA 3FL7A 3DPBA 2X7LB 5DGQA 2B8OT 2NX5E 3QIBB 4Z8FL 1VKXB 4TTDC 4NQED 4Y16C 3MFFB 2D9QB 5IVNA 3QIBD 2Z31C 3CMOH 2H1PL 5GRJL 3E6HA 2QL1A 3HZYB 3BZDA 3TYGH 1V8HA 5BRZD 5GISL 2A74A 4F58L 3BZEA 2XOTA 4QRSA 3QIUB 4DOHE 2OL3B 5D72L 5DRZA 3FT4A 3IJYB 3TF7C 1KLUB 3OXRA 1G0XA 2AQ1A 3Q3GB 1ZLWH 4CDGC 1Q0XL 1JPFB 5TFSL 4X7TA 1QKZH 3VFGH 3WKMH 2OP4L 2AJUL 2LU3A 3MLPA 3LN9A 2IBZX 4G8IB 1N59B 4KVCL 1AGCA 5HSFA 4XVUD 5DA4A 4P5TA 4PYGA 5JLZB 3P3YA 2X44D 4D0CB 2HVJB 2VDPH 3K4ZA 1Y18A 4LHQB 5BS0E 2AJSH 2ADFH 2FGZA 3OL2A 3MA7B 2AXGA 5B8CC 3MNVB 4M6NL 1Q0YH 1FFOB 3BP7B 3IDNB 4UTAH 3IJSA 3V0WL 4B7IA 3OKMA 3T4YB 3D6GA 1TTUA 4X6BA 3SJVE 3B6SB 1GGCL 3NAAL 4OQTH 1UH2A 4GRMB 3GMOB 3QB7C 4PJ7E 4OZFG 1S9VA 3SDDB 3QEQA 3SN6N 4HC1H 1EO5A 4DN4H 1G7MB 2WWMD 4WUKL 3TT3L 3T8XA 3TJEL 3I75A 4XCEB 2P49B 3SBWA 4UT7H 4E41D 2XG5A 1YNLL 3GBLA 3RUGB 2FX8L 2DQDL 1FLRL 5DQ9B 4P5MA 1IQWL 5FKPB 3GMRA 1EHNA 3WO3B 2YD4A 1UB5A 2FB4L 3EDJA 2OLDA 4OCWL 3NFPA 5KVMC 4R90L 1P7QB 4PGCA 5D1QC 3LS4L 1NBYA 5J1SC 3WUWG 3NZHH 2VAJA 2AV7A 4CMMA 2VXSH 3T2NH 3OPZH 1MCDA 2WBJD 3QWOB 4OM1H 2CLZA 5E8OB 5GRZA 2VDKL 4XGZA 4ZFGL 4RRPA 3AAZA 3IDGA 3IDMB 4P3CL 3NIGF 3SKNA 3EJZD 4Q9CA 1I85C 2YC1B 1U8NB 1UEYA 3OXSA 3QT2A 2RFXB 4M7LT 5DF0A 4FQIL 2HT4C 1D5IL 2IQAB 1XAUA 1A7BA 1FZKB 3HCVB 5CHNB 2MTPA 3HS0B 2R4RH 2WQ8A 1A6TA 5L2KD 4QRPB 5JOEA 4JQVA 4OFVA 1ZHNA 4JFXB 1QLRA 1PG7H 1HHGA 1N4XL 3MBED 2W60A 5JIHA 5T3ZH 5JQ6H 1T1WB 1H8SA 4PRAB 4K23H 1G7JB 1HN1A 4QXUH 5C0NC 1I9RL 1XCTA 3QDGB 2ZSVA 3E8UH 3BH9B 3MPCA 3PHOB 3AU1A 2C9AA 1JTTA 1WV7T 4HWNA 4Z7NE 3CLFH 3WDJA 3DOSA 5BJTB 4ZUWA 2P5WB 1YDPB 2YWYA 4H5SA 4DZBB 4IJ3B 4EOWL 3CPLB 3ECBB 5IESL 1CGXA 4Y88A 5JW3L 5DHXB 1J9CT 4KTDL 5T3XH 3LVEA 3IGAB 3WS6A 2QQLL 3X12A 3UDWC 4F9LC 4JO4L 4WU5B 5FO9B 4WFFD 2YRLA 3CVHB 5LWYL 1E4XI 3SO3C 4M9OA 1RV6X 4Y1AD 5D7LE 3NOIA 4XMPL 3RWHB 3MJ7B 4KHTH 1KFAL 1DQJA 3N9GH 4KAQH 1T5WA 4PRPE 4XBPB 1KCVL 2R4RL 4GS7B 4UT6H 5HI4C 4X7TB 5JXED 5CEZD 3BMWA 4XWGL 1KXQE 4HBCL 4XP5L 3MACH 3QEHB 3VD4A 5T3ZL 3UP1A 1LHZA 3L1OL 4CW1A 3BKYL 2D4FA 1F4XL 3VXSB 4FG6C 1CBVH 5JLZA 3L3IB 1KPVA 4X6CA 5LBSL 4MD0B 2BNRA 4ZSOB 3NZHL 1NC4B 5IWLC 2J6EL 1O0VA 2ZUSA 1F4YH 2E9BA 3IDNA 5K9QI 4EI5D 4F33A 3IU4L 3H7BA 3LPFA 4JZNB 2XTJB 3OHXA 2FX8H 1GGIH 1Q9OA 1JFQL 3P9MA 2LQRA 4NOFA 5FYKU 2NX5D 4TNWK 1CTNA 1JPTH 1LP9F 1RD6A 5EIQA 4P2RB 2V6HA 1LEIA 4Y4KC 4FZEL 1UZ6E 3HC0A 5B8CB 4YEEA 2MCPL 1MWAA 1YC7A 1U8IA 1UENA 4FQQB 2PO6A 3IETA 4DW2H 1G9NH 3CVIH 2BP3A 2W07A 3QUYD 3ROLB 5C0EA 2C7UA 1T89C 3QWRA 5FYLD 1A1NB 3IS1X 4HFUH 7FABL 4PBWD 4DK6A 1PY4A 1RI8A 1JNHA 5F9WC 4LCIL 3UTSD 4M8QA 1DBJL 3UPAA 4ZPTB 2FR4B 1I8IA 4AM0B 3L5IA 2VDLH 5ADPL 4MMZC 5FM5O 3KPRA 5DTFA 4CMMB 3PJSA 5GRVL 3S88H 3H9SD 3T3PF 2ZOLB 4MCYB 1EGJH 1S5IH 2ARJB 2QQLH 2ZP0T 1VACB 3VFTA 4WDIB 5F9WB 4LLWA 1FV1B 2C1PA 3BHBB 5ICXB 5C7XH 1B0RA 4X6FA 4L8BB 2N56A 3A67L 1XGTA 4WFHD 1A5FL 4ODWA 1X5FA 1VESA 4LQFH 4U1IA 1EEQA 4Q6YA 4Z7WF 4NZRL 5DK2B 4Z78A 5I19H 3D2UD 1H3UA 4YO0B 2GITA 3M1BB 4PJHE 4GQ9L 4EI6A 3MLVH 3TYFB 2HYMA 3T4AB 1FE8H 4F7PB 1U8QA 2R4SL 4APQD 3MXVL 3FOLB 1FFPA 4OD2B 4PJEA 1RZGA 4WRLA 5T1KA 5TJWK 3BJLA 1JPGA 4JRYB 1NCBH 2COQA 3HZYA 4UNVA 3VI3E 3TESA 3BKJH 4LMQI 1JHKL 4HXAL 3NABH 4ZUTB 5IFAH 3RGVD 1MCFA 2X4UB 2VWEE 1PX4A 2P24A 1RUML 4F15B 4WU5A 5FO9A 1OT2A 4PJ5A 1I3GH 4LSPH 5DD0H 5E70A 3F7VB 5D6CB 4X4YB 2UWEA 1ZK9A 2VLRE 4LK4A 4OF8A 4D0BB 2X4QB 3CXDH 4Y19B 4L5FH 1IEHA 3HPJA 3X3GL 1DQMH 5C0BD 3RQ3A 1ZXQA 5C07D 3VFVB 4R3SA 3FHQA 4YHIB 2A6KB 4N8VG 2FWOA 2HJFA 4M02A 2I5YH 4PJDF 3KDMB 5CBAA 5A43C 5F96L 1QR1A 4XPGH 3BDXA 1KJ2L 4MVBD 4M3KB 2NXYD 2X70A 2ZOKA 1ZEAL 1OP5K 1KCUL 4R96B 2VXUL 4OLUH 5DD1L 4FZ8H 1NBZB 4PJCB 4LLVB 2XKUA 2EDBA 4HBCH 3SBWC 4GXUN 4XH2B 3RU8H 3QIUC 1UWGL 3CZJA 3NA9H 4L8DB 5ILTL 2Y06H 3K8KA 2DIBA 1QQDA 4C4KO 4OBRA 2DQGH 2E9JA 4Z77A 1YMHA 3HC0B 4C56D 5BVPL 1MHHB 4C55A 1I7ZA 4FFZL 3OR6B 1LK3H 1ACYL 4OTXH 4HCRA 2JF1A 5JUEH 3LB6D 4PLKC 5C7XL 3CD4A 3VXMB 3EYUH 2B39A 3U46B 3U4EA 5I15H 4DGIL 1MIMH 3TA3B 3VXNB 4Q9QH 4UNTA 1BECA 1P4LB 4IJ3C 2Y5TA 2F58L 1S9WB 4M1CD 4XGZB 1S7XB 4KWUA 5SWSD 4AM0A 1BLNB 2KDGA 5IHUH 1XGRA 2IAMA 3HMXL 3CFCH 5E24E 5L2JA 4QRPD 2EE6A 4AQOA 1BZ9A 5M95B 4I48A 5D1XA 3CUPB 2Q8BH 1QVOB 1NGPL 5C09A 4OB5H 2PYED 3O2DH 1HCVA 3NGBC 5JORA 2YMXL 2G2RB 1HKLH 2NNAA 5GHWH 1EJ6A 4HKXB 4HJGA 3MZTA 1OP5H 4KRNA 1LO2L 1X5LA 3C6LA 2PYEB 1BBDH 3C5ZB 2O26U 3GI9L 2BVQA 4JFDD 1H8NA 1W72H 3BH9A 1JIBA 3BD5A 4NYLA 1HHHA 2CDEA 1OB1B 5ESQB 5C0JA 2I07B 2Z8WC 3PWLB 4EN3A 5DMKB 1V7NL 1D3CA 4TULH 3MRHB 3FTGB 1PFCA 2VLKD 3O2VH 5EZIH 1EAPA 4XCCL 4CBPA 5CP7B 3WD5L 1N6QH 1MAMH 3ZKXC 4JDTH 3X14A 1PEZA 5MHSD 1BPVA 3S97C 3NIDF 4XNZB 3CVHA 4S10A 4NWTH 5FUCC 5BXFA 2A77L 3KYNA 4JPWL 4XC1L 4P57B 4WCYH 2OQJB 5E5UB 1IAIM 4WI3A 1JWSA 3OAYK 5DHVH 1HQRB 4Z7QE 4HIIA 2J3SA 1H15B 4Q9RL 4OI8A 5HHOA 5E1AB 3RY5A 1P9MA 1QP1A 4X9FA 4ZS7L 1UM6L 3UXFA 3EAKA 3IFOA 1CFQB 3ZHLA 2ZNWA 1B6DA 1UEMA 3IKCA 5HYSG 3M8OH 2DQTL 3K4AA 2C5DC 2DQFB 4HMEA 1I8KA 3RP1A 1QR1B 2IPKB 1ZT7A 2QEJA 2YWZA 4ZAKB 4GRWE 3MA9L 3BN9C 1DUZB 4FXLA 5JHDA 1U92A 4RDQG 4H1LB 2FJFA 4QXGH 3L5XL 3QEUB 3EFDH 4NWUH 1E4XH 5EUOE 2HT2C 4XCEA 5D4QA 1YEDA 2A77H 2Y7QA 4JDVB 4MWFB 4JFEA 2AAVA 4XPBH 3ARDC 1MHEB 1SYVA 3D39E 1ZVSA 4FQLL 4LHUD 5KANI 3GSQA 4NDMB 4PG2C 4JQXA 1YNTA 3E3QC 4F57L 1KJ3L 1TQCC 1HEZA 4HBQA 5CZVL 2FZ3A 1UB6A 5CEZE 2P43B 4HS8L 3QDJA 3EDDA 3MGOA 3MLRL 4BELD 4ISVA 4GBXC 1MRFH 4DQOH 4XPHH 1JGEA 4ONGL 4KK8C 4JKLA 4NZUL 1KTDB 5F1NA 3QUKA 1VFBA 2XKNB 5IB2A 1R3HB 2C1OA 3E8UL 5F71A 3V8CA 5F9OH 5TH2B 1J86A 4K94C 1B9ZA 1PQZB 2DLGA 3MQIA 2YK1H 3KNBA 2Q7NA 3ZDXE 2GJJA 4GRLD 3SDCB 4ZTOL 3WSQH 4KROB 2B4CL 2DLIA 3PWVA 4MS8D 4S1SL 4JPIA 5JW4M 2MHAA 3AVEA 4WY7H 3MBEB 1EUTA 3FMGL 2P5WA 1J8HD 3VXUD 3IRZA 1LO5B 5IFJA 3L95B 5IF0A 3MXWH 1WWAX 4JRYD 3C6LB 2EDEA 1JZ7A 5IROC 1WCQA 5C0IA 4KVNH 3RNKB 4TTGA 3QH3B 3PABA 4JFFA 5EBWA 4I3RL 4EDXB 3VGDA 1FPTH 3RY6A 4PTTA 3T77A 4APQC 4IEFB 1MCEA 4JJHA 1FVEA 5EIIB 1MPAL 3AMLA 3BD3A 3EYVA 3MBXH 5K9OB 1DVFA 3E6FA 4F8QA 3MJ6A 4DKFH 3C8HA 3OBAA 1ZSDB 2GJZB 3EFFB 4FQ2H 8CGTA 3O2WH 3VFPA 4BQ8A 5I1EH 4S2SA 3EHBD 5D96C 2YZ8A 4KK5C 4LCWA 1MFCL 5LG1A 4LLDB 5C8JB 5I0DA 1F3JB 1WAAF 3MYZA 2D03L 1BZ7A 5IB1A 4YAQA 3I6KA 1M7IB 3SDAD 2VR5A 2HTKC 1GHFL 2M26A 3EOTH 3PGFL 2DBLH 1MREL 3QHTC 4X4XA 1OGAA 1I9EA 4AL8H 1AFVH 3V5DA 4WUKH 2AJ3A 1ADQA 4P2OD 5GISH 1I4FA 3SGDI 4Y4FD 4QXGL 3VXSD 2A6DA 1JF1B 2EDNA 5JDJA 3P77A 2VLRA 1ZV5A 4GRWF 3QDAA 3KJ4B 5EZOH 4MJID 1PDKA 1EMTL 2GK2A 1C08A 3OJ2C 3QQ9D 4FFVD 1RJCA 25C8H 2YEZB 4D8PA 2NY4B 4MJ2A 3MNWB 4P9HH 4YE4L 5ADOH 3BGFB 3X3GH 3GSNB 5DFVD 1FG2B 5AUMB 5D7SH 1U92B 1UM6H 2R0WH 2XT1B 3O9WB 3HG1D 3EDKA 1ZVHA 4DJMA 3AB0B 2VO5A 4KK6C 2ADJB 2P5EA 4MLIA 3T2PA 5JXAL 3DXAA 3MCLL 4KJWD 3BIBX 5F7EL 2Z8SA 3FRPG 3WO4C 4U1JA 3O3BB 1QYGL 1E6OL 1CL7H 3BWAB 5D1ZB 2J2ZA 5GZND 4FNLL 4JKKA 3EO1B 4QXTB 3RWGA 3ZE2F 1JMZA 3ZLQC 4LVOC 5LAXA 4ESKA 3LSOB 1JJUA 4P23B 3HUJF 4MQXC 4PJGB 5HGBB 4JO3L 4QHKI 5CEYA 3MGTA 5EPMA 5CD5C 4C4KT 3LKRB 3TP4A 4AENB 4YZFE 2ZPKH 3QXVA 2X4TA 3H9SB 5ITFA 4M4RA 4LF3A 2QQKL 3V4VL 2BRQA 4O2EB 2OR8A 4QGTA 4WHYG 3OB8A 1IILE 4ZDHA 5DRWB 1A6WH 4C58B 5CZVH 5FA3A 4WO4B 1DBAL 4KV5E 3M1BA 2R0WL 4QXUL 3CZFB 4HWBL 4M00A 3UTSB 3IVKB 3RFZC 4GH7B 1X5GA 1HDMA 3C5ZD 3ALWA 2OTUB 4JFDB 2R1WB 1B2WL 3RUGF 2VIRA 3MNZA 3TWCH 1Z9LA 4OD2A 4PJEB 5IM7B 1PSKH 1LNUB 2NW3B 4AIZB 1G7IA 3HNTH 5K9KA 1LO5A 3CFCL 3CVHL 4BFIA 1HE7A 3HE7A 3ARRA 1RIHH 3BKMH 2WMPA 3SGEI 2XYCA 1EJOL 1JRHI 5DT1H 2MKLC 4Z7UE 4G6KL 4NKIH 1U0QA 1GOGA 4HIHA 3UO1H 4IIQA 2EH7L 5F9AC 4LNRB 3EYFA 4KV5F 4U1SB 5HI5C 3VRIB 3P4MA 5EA0H 1YMMD 4HFWB 4YIQA 4MNQD 4TRPH 3BQUB 5EN2B 1DVFB 4XPFH 1EA9C 4WW2A 4M61A 4ZS7H 4KXZI 5KSVB 4QWWD 1OTTD 4QLRA 5FHBL 4IMKA 4XPAH 4ODVH 5INDA 1KYOJ 3QCVH 4LCWB 4NP4H 2OQJA 3QEGL 4QWWC 4PR5A 5FUOL 4XVSL 5HI4D 1YEKH 1V7ML 2HWZH 2UZXB 2HJFB 1WJ3A 4OGXH 3KPOA 4XT1C 4L29B 2HLFC 3EOAB 4HKZA 1J5OL 5D1QA 4G6AC 3KPSD 5EOQL 2VC2L 3MJ9H 4HIEB 5KSAC 1HSBB 1J05A 1X6LA 4HUNB 4GG8A 1DSFL 5HHQB 3ARED 1XH3A 1OAQH 1JVKA 1NGZB 4LLVA 5I8CB 1D9KD 4I4WA 3O6FC 4ZAKD 3QAZC 1KEML 2DTSA 2IGFL 5TGBB 2H8PB 1F4XH 1CU4L 2BRRH 3O41B 3R1GH 1FZOB 4OFYA 1Q1JH 4Y19D 1CT8A 4UUJA 2YUZA 5E0QA 4BKLB 1C5DA 4GUPB 4LEOB 4OZGB 5JO5B 5KOVC 2HTKD 1JGUL 4PREB 4HUXB 3DROB 4I1NB 4HH9B 4LHUB 4I18C 4UINH 1U6AH 2AABH 3MUGB 2QSCH 4XNZC 4GW1A 4XNQA 2CR6A 2VSCA 5CGYD 3C60D 1U36A 3DI2B 2NXYB 3WIHA 2ZPKL 1OWWA 5CGMA 4KPHH 4YQXL 2AK4E 1K4DB 3BP5B 3WHXB 2Q7YA 2NY1C 5GRWA 2BOCA 4U1JB 3DARA 1S7TB 4NO0D 3C09C 5T3XE 1NJ9B 1ZHLA 1NFIB 3RTQA 4KKNA 5C0FA 2E9IA 3OAUL 4I18A 4X5WA 3N06B 2VLJE 3TGXA 3QXDB 1GSMA 1A3LH 3LKNA 1T22A 1QPXA 1KEGH 1DLHB 1A7QL 2NY1B 4X80H 4ZNEE 4XTRC 4M3JA 5J11B 4PP1C 4BZ2H 3RI5K 3OKOA 3OKKA 2VQ1B 3RA7H 1CFNB 3MLZH 2NY3C 5KS9F 3K2UH 4X7SL 1UQSB 4PRIE 4U6TA 2GYSA 4PJGF 4YUEH 2Y25A 1C5CL 2X9XA 5JMRA 3VDBA 4R7DB 3PUCA 3BAEL 4IRJA 4W6XB 4P0DA 2CDEB 3FN3A 4A6YL 2NQCA 2RR3A 2NY0C 4G8FB 3W9DB 3OKNA 5FYLH 1X9QA 4WIQA 4H8WC 3HI6L 3P0YL 2V7NA 3STZB 2AJSL 5HHNA 1S5IL 3GSXB 3O45B 3BYYA 1B4RA 3BDYH 3ARGB 5F1IA 2R39A 4G8GA 1ZGLP 4MQ7A 1GVIA 1MCKA 4UTAL 1S78D 3CU7A 4GO6B 5C0AA 4FOMA 5F96H 5ICZB 4Q9QL 3E6FB 1RU9H 3EYFB 4YHZH 5J3HD 1MJ7L 4K3EH 3RIAK 4HUUB 3S35X 4Y89A 4OI7A 2HT4D 3MR9B 1EHAA 1SMAA 2E9WA 1CXEA 2VL4A 4K8RD 1WBZA 2OXHA 4ELME 3WN5C 1KJ2B 2HRPH 1MQKH 2P42B 1A7NL 2M2DA 4LCYB 4X6DE 1WTGT 4NQVA 3MRJA 1X5IA 1F4HA 4D0CA 3ARZA 2I25N 4X4XB 3ISWA 2G9HB 3TFKD 4MDJB 1U9KA 1IM9A 1OAZH 1KPRB 1N7MH 2M1KA 1HZHH 1UCBH 1ZHKB 1CLOL 5HDBF 4KZDL 3BP7A 3FOMA 5B38A 4PTUA 2PW1B 3TPKA 5F21B 1KIPA 1T66C 5DEZA 3S36H 5AAWA 2BNQE 4GLRH 1L7IL 5E6YA 1RJYA 1IE5A 2IQ9H 1II4E 3MCKA 3O9WD 1SBSH 4PPTA 1DE4B 3W5NA 2X9WA 4CDHA 4LGRB 4R4FL 1G9EA 1N0XH 1T1ZB 5CMAB 2F15A 1KCLA 3MYJB 5TE4L 4WFEE 4JRWA 4ERSL 2FZ3B 5DMIH 2ESVA 2OBGA 1UM5L 4AEEA 1R5WA 3QG6A 1AKJB 2XNAB 1I1CA 2Q8AH 4DZ8A 4PGJA 4ZXBC 2MMXA 5KTEL 2JJWA 5IMOA 1T7XA 4PRDB 1MVFA 2FEDD 2KKQA 4OV5A 5CCKL 3ARWA 4QF1B 4UDTB 4OD3L 3WJLA 1F6LL 1IGIH 3UMTA 4LKCB 2IAMC 5IQ7L 4RMUA 5EPMB 3ZKXB 2BVPA 5EU6A 4QRQB 3TBSB 2EECA 3FB6B 4Y2DC 3ULUH 5EUOB 1PKQB 3VCLA 4ZFOB 5I16A 4NNYB 1SY6L 4Y2DD 3EOYG 4TUKH 3JV6B 1F2XK 1MHCA 4Y0GA 5FHAL 4KKLC 1L9MA 5DO2D 2R0KH 4NRZB 4PGEA 2I9TA 4JFXA 3L9RA 3H3PH 3IFPB 4IDJH 4F7MA 1QZ1A 2CLRA 3ESUF 5IQ9A 3W2DH 4G6JH 5HDQL 4XZUA 5J6HA 4OCMC 2PYEE 4NCC2 4P9ML 2IBGA 3KPRD 4F37F 3BEVB 4JKPL 4C59B 5E7FA 1IAIL 2BSRA 4OLYH 3PNWA 4ZODA 2VDLL 4GKZB 4EKXA 3ARBA 5DXWA 4BFIB 4QRPE 5IB3B 3EZ8A 1QFPA 4U4BA 5EULV 1EFXD 1QBLH 3D3VE 5FUOH 4U6YB 2HRPL 2VISA 1F11B 1HILA 3EYOB 4ZQKB 5I1CH 3HLAB 3IXAB 4GBXA 4HK3N 5E94B 5T3ZE 1FYTB 3L5WA 1OAYH 3MLTB 1PW3A 1WBYA 1QPPA 2XN9D 4P59H 3KYOA 3GJEA 4PYHA 1K5NA 2DLFL 5EZLA 2RBLA 3O4LA 1NAKH 2GUOA 1I7TA 4URTB 1IGCH 3QDGD 5IB5B 3ULVD 2G75B 4D9QD 3CFJA 3EKCA 3MROA 3V4PH 4P46A 1KOAA 3QUZA 4Y8DC 5F89A 2NY0D 3MRQA 1ZWIB 1J87A 3QFJA 3RVUC 1CU4H 2EDQA 4NQDB 1WSST 2AXJA 4FZEH 5GGRB 2VUOA 3VXQB 2CQVA 2X1XR 1IEBA 4HGWA 1IAIH 4FQHA 4OLYL 4Y4FB 3P4OB 1ZLUK 4H25B 2YA0A 5F72S 4A2LA 1BEYL 5HHQA 1FNGA 2IMNA 3T2OA 1E27A 1FFOA 3N1PC 1FDLH 4N5EC 1ONQA 4V2CB 3RWCB 1XGUB 4P4KB 4JREC 4RWYH 5DEGA 4XP5H 4HDIB 4PJDA 3Q2CA 5F97E 1NANH 1UYWH 3LN4B 2FBJH 2PETA 2XXCB 3DV6B 2H6PB 2YKLH 1G7HA 4JQIH 5FO8A 1X5XA 4P3DA 2C3VA 1AO7E 1MJUL 4HH9A 4WEMB 5DFWH 1LP9E 5ISZB 2YN5A 3O8XC 1IMHC 3H7LA 3NZ8A 1QHPA 1E6JL 1S9XA 2CRMA 3MYJA 4JGUA 3DURB 3HB3D 1RZ7L 2DIAA 1R3IH 1KC5H 2V9QA 5MEQA 4YK4B 3VXPA 1A1NA 2EE9A 4ONFL 5DJXB 2EDYA 3WXVL 3KPNA 3BZFA 3FQTB 4OUUA 2VC2H 3OWEA 3THML 1XGYL 2EZ0D 1IKNA 4LAQH 4MAYC 2QSVA 3QJFA 3DYOA 4I0PD 5E9DA 1GJIA 5CLWA 3KR3H 5C6PB 4HS3B 4PJHA 4KH2A 1MIEL 3VG0H 3B5TA 3I6GB 3TBTA 4L9LC 5CWSB 4P2RD 5MEOB 1KV3A 3CVHH 1E4WH 1GYAA 2DQHH 4PBVC 1OTSD 3QXTA 5DUBB 4MA1C 1MHPH 5GGSB 4CGTA 1OAYL 1CFNA 1G1YA 5C0CA 3WYRA 2P7TB 1UZ8A 5FGRA 3JWNC 1BREA 1BGXL 1J11A 5IEKB 5H35A 2JTDA 4XNUH 4Z7WE 4ZTPL 3KXFE 4L9LB 4ZNEA 1BQHG 1A1OB 5C92A 5IHZB 2XZQL 3HC3H 1NCTA 5TDPA 2WINB 1VFOA 4OAWA 5BS0B 2CLRB 5IQ9B 4K3JL 4DFIA 3BMVA 4W4OC 2F53D 1OTUD 3ARFC 4MLSA 4BYHA 1JPGB 2UZYB 2APWA 4P2QA 5HHNB 1NSNL 4IOFC 4NGHL 3VA2C 3N85H 3LB6C 4GW5B 4DK3A 1J0JA 3FRUB 3BQUA 2NXZB 3NFSH 5DMGC 4WW2B 3U48A 1NCWL 2P24B 5ICZA 3SCMB 5AD0B 2F19L 1MFDL 3IF1B 3IDJA 5E8PB 1JZ4A 3O3EB 1Q94A 4O5LL 2FJHA 1INQA 4NT6A 3KYOB 1YMME 3HN3A 3GGWA 4OM0L 5E4EB 1IGMH 1AXTH 1UJTA 4GS7C 1UM4L 2Z8VC 3MV9E 4QT5B 4OZGF 2ICWB 4QRTA 4JFPA 5ANMA 3BKJL 3MUJA 2VERN 5EU4B 5DD1H 2XPGA 5BV7H 4R3SB 2VLKA 5I8CA 4OGZA 1BBJB 5I75C 4DVRL 3WDIA 4WU7B 3R06A 2CUIA 1DQLH 3EZJB 4P9HL 1KCSH 3IFNH 2BSED 4N0UB 5HYJE 3GNMH 2N4IA 4H25A 3R0NA 5CAYB 1OPGH 3QRGH 4J3UA 3BIKA 5B4MD 5K59E 1C5DB 4GUPA 4LEOA 5ENWA 2DQGL 1IKFH 2QKIB 5EO9A 4MB3A 1GH7A 3MCKB 1CGSH 4M9PA 3TCLA 5DD5L 5KVDL 4X4ME 5HHOD 3STBA 1RZKC 3P4NA 2O61A 1LQSR 4QGYA 4I2XE 3LKPB 4JCMA 2ATPB 4KK6D 1KJVA 4U49A 5CJOH 5B3JE 4HWEL 1JWUB 4F80A 2ZCKL 1R3JA 1A8JH 4QRRD 4WNQB 1YNKL 3FO0L 4OBSA 4KKCC 1UFUA 3GJFK 2OJZH 3WFEH 2D4DA 3BISA 5I1DA 4C54A 2VLJB 2ENSA 5D71L 3NCBB 3DTXB 3PV6A 3REWA 5MENB 3G5YA 1YEGL 3T1WA 5H2BA 5CZKA 5ID1B 1AGFB 2BMKB 3UTTD 3BI9X 4FP8H 4QNPF 3KYMB 5IOPA 4ERSH 4S1RL 5FM5M 1PG7X 4RISL 1JK8A 2R0ZL 4WWID 3TYGL 3T0ED 1IT9L 4PJIA 4K3JH 1JMXA 2Q8AL 1RU9L 5D1XB 1L0XA 5FGBC 5TE6H 4R4FH 3L3JB 5IMLB 5JPNA 5I2IA 5I30L 5DJDA 3MRFA 1BM3H 3QFDB 4S1DC 2VDRL 4DW2L 3TO4B 1OWRM 2P7TA 1KUMA 3OGCA 4JO1H 5CJQL 3JUYA 3UJIH 3PWUB 4OFIA 3SJVA 3O8XA 2DTML 3EO0A 3G5ZA 4MJIE 1HYSC 4AK1A 2OX5A 1NCWH 5IHZA 1D5ZA 5J12B 3A67H 1YECH 1CE6A 4XAWL 5DYOB 3VDCA 2AJYH 3EGSB 2X4SB 4QTIH 5C6TH 5J57B 3C8DA 1TVDA 3L1OH 2NTFB 3VG9C 4F8TA 2DI9A 3ARYA 4U1GB 4RIRA 1NGXA 2LU4A 1MEXL 3KWWB 4L8SB 1QLEL 1A9BB 4IMKC 4MNGA 3WSQL 3L7FA 4ZUVA 3MR9A 3DRQB 1XZ0B 4RFEB 1JZ3A 4HD9A 1QRNA 3IDYB 4HIJA 4M48H 4PJBF 2DJ4A 4X80L 5DS8B 4MZ2A 4OLZH 4PV9B 1MJJA 1CD8A 2DQIH 1IGJA 2CXKA 2ZJSL 4JFOB 4UOJA 5E8EA 5IFAL 3TBWB 4N0CD 3GM8A 4UQ2B 3BDBA 5KVEL 1FIGH 1EJOH 1A1MB 2VTFA 3NCCB 5SV4A 4X7FC 4JHAL 4OKVA 1A6VH 5ANMB 3BUYA 4H1LG 9CGTA 4KRMB 2RAMA 3PHQB 5T5NF 4N9GA 1NC2A 4KPHL 4YQXH 5D2NE 4W4OA 1ZT4A 3ARUA 4WU7A 5AG8A 1A2YB 4FTVE 1WC7A 5FECB 4HIXL 4XNMB 4K71C 3GMLA 1XFPA 3MV7E 3VWJD 1OOAA 1EX0A 3GMNB 4YDIH 3P0YH 5I8KH 1NBZA 3ZE0F 4RNRB 3H42L 4PJFE 5JHDB 1JHTB 1CXKA 2UY6A 4L4VD 1BQUA 1KLGB 3UBXI 1JWMA 2AJXH 3MJ8A 35C8L 5DSCA 5MEPB 1A9EB 4ETYA 1KNOA 1C1EH 15C8H 1TMCB 4P2OB 3UYRL 4KMTL 1OGAD 1YJDH 2YK1L 1IL1A 1IAMA 5EUOF 5A2FA 5IG7B 1QBML 1Q1JL 1GL4B 2AEQL 4RA0C 1IAII 3DX8A 4RWHA 1EHLH 4PJDE 2BX5A 3GMMA 4BK4A 3PGCB 5FYKL 4JY4A 4X6DF 2RIKA 2ORBL 3H9SE 3RWEA 4LGSB 1WWWX 1VHPA 2WBWB 1U91B 3PDDA 4UQ3A 3CFDB 1AH1A 1LP9A 1T0MB 5J13B 3HR5A 5JHLH 2CJUL 1BP3B 1ES0B 1IQWH 4I3SH 3DTXA 3PV6B 3HAEH 4M1DH 4NQSA 1K2DA 5C9JA 5FB8A 1KSRA 3MOBL 5IESH 3ZMRA 4YFLI 1U8MA 4P2YA 1NCUA 4JHZA 3DVIA 3UZQA 3DIFB 12E8L 4PGEB 4R97C 4XWOD 3CX2A 3QUYB 4AZ8A 1WIOA 4GW4B 1N2RA 4RCAA 2WW8A 5DDHA 3C08H 5DHVB 1ITBB 3L3JA 4MQXD 3RL2A 4NN7C 1FL6A 2XV6B 4FQJH 1GC1L 2LTQB 1N0XL 1GAFH 1VEMA 3QA3A 4EIGB 4NN6B 3MRKB 2JIXB 2DDQH 1BJ1H 1BVKB 2HLAA 2BSSA 4YNYB 3GJFA 2JB6A 3FQRB 2JIXD 3ROOB 1MNUH 1QR4A 1OAUH 1W0YT 2B1AL 1PJ9A 5IB4B 4JCLA 5ESQA 5C0JB 2DRUA 5FOJA 5DLML 1MCWW 1XGPB 4GBXB 3ULVL 1V3JA 5L2KA 3QO0B 5BRZA 2DQIL 1G9MH 1CD0A 1H0DA 3ILPB 3SDCD 2ZWLT 2HG5A 3DX9A 2DBLL 4NCDA 2GY7B 4ODXA 2WIIB 5GGUA 4PRPB 3F12A 5I17B 3WJJA 1AQDA 2EE3A 2HA1A 4LASH 5JIIA 3LZFH 1FLRH 4JANB 5D7LD 3HE7D 3Q3GA 3VXQA 5IKCA 3PQYE 3FO1B 2IADB 4OD1H 1GGBL 2BDNH 3MLYL 4JFPB 4M62L 2BJMH 5EU4A 4MXQD 2VXSL 5DJ2A 4C56E 4KZEH 5K59F 1QLFA 1URLA 5DRNB 5IFHH 3LS5L 1YMMA 1CFQA 4M6MH 2CSPA 4LPWA 2NY5H 3ESVF 4HW6A 4V1DB 4LPYA 2AEPH 4OJFH 1DR9A 5DEFB 1FYTE 4PJBB 4NN5B 4KJPD 4XHJC 5DJ6A 4LL9A 5DMYA 1DBBH 1SM3H 4JFYB 5D8JL 2CK0H 4PRID 1RMFL 2XACC 2YA1A 3W11D 4NQDD 4G8EB 4KTEH 3BSZH 1AFVL 3TCLB 1Y6KR 1J8HE 3DLQR 5D1QD 4JJ5B 3NN8A 5ESAA 1VPOL 3VXTA 1U8JB 1A9EA 4J4PC 1NUGA 4ORZC 3GMOA 1W2KT 2IANB 3QNXB 2LE9A 1SJVA 3C60B 5E5MB 3DX7A 3GHBL 3RIAF 1KJVB 4QRUB 3Q5OA 1E4WL 2JE8A 4E41A 4ZD3L 2IFFH 4LOUC 1IGIL 1GZQA 2O5XL 1JNLL 2XQYG 3RPIB 2ITDA 4M1GL 4WV1A 4YX2H 3SGJC 1Z9OA 3OX8A 1CXFA 5D2NC 5FA4A 5B39A 2VXQL 3RDTB 3PP4L 3EHBC 5KW9H 1YN6A 2KH2B 3F58L 5HVHB 1MF2L 5BO1L 3CFDA 1DFBL 4KKCD 5T3XD 5IR1A 5ITFB 4WHTB 2PTTB 1N26A 1QSEE 2L4OA 1SMOA 3NBNA 4MA3A 4I5BA 4EI5C 4YLQT 4NWUL 3CMOL 1UH4A 4HK0B 4JZOA 4OIBA 5D5MA 1KCRH 1LDSA 1UM5H 3DWTA 5GRUH 3CZFA 3UTSA 3IVKA 3U30C 2I24N 4I9WE 1WFNA 4FQXC 3W39B 2Z92A 4YXKH 1S7RA 5DHVA 1XF4B 3SJVB 2HFTA 4R26L 1FL6B 2UY7A 2VABA 2R2CA 3STLA 1ZHNB 2O5XH 4BSWA 4RAUB 5GS0L 1J1OH 2VDQL 4LVOB 5CP3A 3N1GC 3QH3A 4RBPH 1IAOA 1UB5B 4WFHE 3LEVL 5IMKA 2V2TA 2FLBT 3IXTA 2P44B 4ZUWB 1HWHB 2BHUA 1YPZB 4WO4D 5EBMA 1HHJB 2AXFB 3NGBB 4RQQB 1UG9A 2CPCA 5IW6A 2PW2B 3ARDB 3AAZB 5T5NG 3U9PL 1ZHBB 3UTPD 5JW5B 1L7TL 1OAXH 1HIML 4HIJB 2P48B 4YR6A 4QKXB 3OMZA 1AE6H 1N8ZB 1KB5A 4QOKB 1CI5A 4KJYA 3QYCA 4OCSH 4OZHA 1T1YB 5DHYB 1CDJA 2QSCL 5JOFB 5DUPH 4HJ0D 2YXMA 1CG9B 2E8ZA 3ZO0A 3P2TA 4HJ0C 4HAFA 5CUSL 4Z7OF 1RK1B 2W9DL 5MERB 4ZYKA 3RGVA 1RZJC 1REIA 3TV3H 2C4XA 1F90L 3OJDB 1S7UA 1QBLL 5F7KC 5MP6H 1FCGA 1RY7B 5DJ0A 3CFIC 2P47B 2X5PA 2F53E 4FQCL 3LZFL 3WXWL 5BJTA 4XNMA 1TETH 3BT2H 4J23A 3GMLB 2E3VA 4WI2A 1TITA 2F74B 1LO0L 2YEZA 1M7DB 2O61B 5FIEA 4LARL 4YFDB 1WFTA 2BNUB 4G9FB 3WL9B 3NTCH 4AEFA 3L3HB 3BQUC 3QEQB 2P1YA 2Q1EA 2K7QA 4G8EA 1XF1A 2OXGA 2Y5EA 5TQ0L 4W6YB 1FGVH 1OLLA 4H20L 4W4NA 3BESR 4J7RA 2GHWB 1D5BA 2FL5B 4FTVD 3GMRB 1EO8H 1NBVH 1BVLA 5DJZA 1CLZL 1P1ZA 1NJ9A 3KPTA 1HXMA 4ELKA 2UUDH 4UV4L 2W0PA 2FO4A 3GSRB 4JFZH 5JR1L 2FECI 5CJ5A 3VXRE 2VZ3A 3SCMC 3PDGA 3BW9A 5F6IC 1IQDB 1G7QB 1OLZA 4M8QB 2WBKA 1KPVB 2CO7B 1DLHA 4GG6E 5I1GL 3H9SA 2FHFA 4CU6A 3VGHA 2KUTA 5IMLA 1F02I 1P6FA 1A4JA 4OCWH 1NCDH 3HNTL 4RGNB 6FABL 4IRSC 1DQDH 4QY8B 4MA3B 4HFUL 1FNHA 4XTRD 2DMBA 2VR4A 2XTLA 4LFHD 4YK4C 1JRHH 3VGEA 3GSUB 1CDUA 3MRMA 3WIFA 5ICXA 4K7FA 1CE1H 3S35H 5MEND 1FORL 3ARSA 4NKDB 3TNNA 2X4RA 4K9EC 1IAKB 4XWOC 5C0AE 5KVGL 2XTJE 3RVVD 3QA3B 4TRPL 5EU6D 3TH2T 5DK2A 4NO3A 1WLHA 1EEYB 3MRNB 1BWMA 2IAMD 3VA6A 5K9KB 4WV1C 3NIDE 4RAUA 3S5LG 1P5VA 1U41A 2X1QA 3D39A 4NC1C 3VXSE 4MNGB 3ZTJH 1FFPB 4XP4L 3WDHA 4XCNB 1S7VB 1WEJL 5C0AB 5FHAH 4LNRA 4U1SA 2FX7L 4M1CC 1FZMB 4ZXBA 4YWGL 1QBAA 3MJ9L 4IHOA 5EO1B 1LO0H 2AJZA 3TEUA 2GJ6D 2WUBL 3KPRB 5DTFB 1A6UL 3VH8B 1YUHA 5CP3H 5GHWL 3LRSA 4HUUA 4QCIA 4LMQE 4GQPH 3GIVB 5J3HC 1MCWM 4XNYH 3TZVC 4JAMB 1ULVA 4UILH 1WIPA 3UO1L 4NCC1 1BOGB 4PLOB 3TBVA 4NUJA 3G04B 3ULUC 1NC2B 3CSBA 3V6FB 1CL7I 1D5XA 4XPFL 4IOIB 3D3VD 2HJKB 5KSUA 4MNQA 4JKWA 5MERA 1CL7L 5DVMA 4JRYE 2VYRE 3TFKC 1GPOH 3UDWA 3RI5F 5J6GB 4OD3H 4MD4B 1JYVA 3DVNB 3SDXA 4U1NB 3CH8A 1JHLH 2IANE 3ARTA 1TJHL 3OKLA 1S3KH 4XI5C 4W68A 2DICA 4EVNB 2Z93B 3EOBB 4MJ5B 5ALBH 3A6CL 3C8KB 2O5YH 5GRVK 3UTZA 3NFNB 1VA9A 3GMPB 4Y16D 1LO2H 1Z5LB 1IZJA 2GW5A 3V9FA 2PN5A 2LAGB 5E8DL 2DJSA 5ISZD 3G9VA 4YFEA 3MZGB 4LSSH 1AD9B 1OW0A 3SGDH 1KJ2H 5C70A 1BQHA 3W9EB 4YHYC 4J4PD 3WFDL 1MI5A 4D0BA 2X4QA 4Y19A 2HFGH 1ADQL 3OX8B 4L4VB 1VSCA 1B0GA 3E2HC 1BF2A 3S98A 3LEYL 5KS9B 1DANT 3IDMA 3M45A 1JHKH 4U1KA 4KRPC 5EOTA 5MI0C 4RMWA 1I1AB 4E41E 1X3DA 5DZOA 3WEXB 3IDXH 2ARJA 1GGTA 3PHSA 2Y5TB 2X41A 1Q0XH 5ERWA 4C83B 43CAA 1WF5A 4FFZH 4FQLH 4QRPA 1RFDH 1TPXB 1SHMA 2F5BH 2LABA 3HB3C 4ZFZA 4QY8A 2X4NB 1UADC 3BE1H 1OCWH 4FXGA 1FRGL 5IBUG 2Z92B 2E8YA 2ZSVB 5BCAA 3WO4B 2K9UA 4LLYB 2IFFL 5GGVH 1YEEL 2BHZA 1TZIB 3L5HA 1JPSH 1TZHB 2BCKA 2P5EE 1UWXK 1KTLB 4XP1H 5DRXB 4O9HH 5IMMA 1JRHL 3V0WH 3V6ZA 1NLDH 2AJVH 3GIZH 4KUCF 3OQ3B 2BSTA 2CR3A 5I1IH 4YGAB 1PKQE 5KVGH 2XFXA 1GC1C 1MAJA 1JGLL 2W65B 4KKBD 5IW6B 3GK8L 1RUAH 1HXYA 4PJ5B 1JZ5A 4HH8A 1A47A 5D6CA 3CFEB 4Z0BH 1QNZH 2XQBH 5C08B 4Y5XB 4AEHL 2F5BL 3X14B 4P46C 3HHRB 1R3LB 2IH1B 4Z0XB 5JOFA 4PB9L 1QFUL 2J4WH 2NY2B 3GI8L 4I3RH 4PLKD 5KS9E 3WFDH 1AQKH 5L8JB 3P4OA 4MJ6B 3OJDA 1YA5A 4ZSOA 1NFDE 2SEBB 4KTDH 2VDNH 5GRXG 1ED3A 1F4YL 5L8KB 4CJ1A 5B3JF 5E8DH 1PG7L 5DJ8A 5J1AA 1KIPB 2E7CA 4JN1L 1IARB 4ZFOL 2CRYA 2E27H 1KG0B 3GSWB 1HHIB 4XBGB 3DETC 2V7HB 1AP2B 2YUVA 1G7HB 2HFEB 3EOBA 4MJ5A 4K3HA 3SE8L 1T1ZA 5AWNL 4FABH 2JJSC 5E9DE 4RX4D 3EUUA 5JHDE 3LCYA 3QNYA 5D2LA 2JCCA 1PYWA 3BPCA 3QISA 4F9LA 1MHHA 1AGBA 1TDQA 2OK0H 2KBGA 2ESVB 2Z91A 1KT2A 1L6XA 5LGHH 4ZO6A 3SQBA 1VADA 4PRNB 1SYSA 4UAOC 2FR4A 5M94B 1GGBH 3MLYH 3NH7L 3O6KH 4RAVA 5K9JL 5MP6L 1RAMA 4S0SD 1T0NB 3BH8A 1I1YB 4GAFB 2DWEB 1MCNA 1Z0NA 5GS1B 5IFHL 2IF7A 4YGVB 1AHWC 1G7QA 1IQDA 1E4KC 2R23B 3LKQB 2JJVA 2X09A 2YD8A 3RUGE 5C0RL 4X0KB 1KTDA 1KGCD 4LSQH 4Z7VB 4LCUA 5H8DA 5HI3D 4U1IB 3JV4A 1MUJA 4Z78B 5C9KA 4UU9A 3C87A 3ZE1E 2FJFB 4MB4A 4JDZB 4JZJA 3LQZB 5INCB 1DBKH 3KNBB 1E0OB 1A1OA 3MOAL 1MCCA 5MI0B 2NLJB 3SE4C 2CDGA 5ABDE 2RCSL 3HUJB 1QFWH 5IK3B 1OW0C 2ERJB 4PD4K 4JDVA 4MWFA 4PP2A 1FNSH 1WZMA 2EKJA 3S7GA 5AYUL 5HJ3A 5E99L 1CD1B 4P2QB 3VGAB 4O51B 4X7CC 5IVZA 1DVFC 4U1MB 2R1YB 4PJAB 3T0EE 3V95A 4JFFD 4Q9RH 3BVNA 43C9A 2QV2A 4P5MB 2GJ6B 5FKPA 5J06A 5IMMB 4Y4KD 5FXCH 4ODVL 4U6YA 5I66A 4I77L 4U0RC 4NNXB 3UYOD 4NN7B 2VKXA 5CGYC 3ZDXF 3N0PB 4HQQL 2AJZB 4AG4H 3QNZB 1GC1H 1TXKA 2EXYC 4OCLC 2W65A 4EN3D 3EFFA 3CJJA 1IC4L 1RK1A 3TO2B 1T83A 4Y4HB 5EZIL 3HE7C 3VFGL 3F65A 4JR9L 2D31A 1UGNA 4FN0A 3D0VB 5E1AA 4R6UA 3F7YA 3FB7B 1CDYA 5FYJE 5I1LB 1XIWB 1AGCB 1MFBH 2VZSA 2X7LA 4OQTL 3GHBH 3QULB 4FA8A 4Q2ZB 2ZOKB 4YDKL 4BH7B 1KCUH 4EI5B 2VE6B 4PRAA 3ZE1F 1UXSA 2FHBA 4M6NH 3NCJH 4UDUB 1ONQB 5I8EA 1D5MB 4N8VB 4P46D 2A74B 4JN2B 2DQCH 1UWGH 4LVHC 3T4YA 4QHLA 1R5VA 4LSDA 3CPLA 4X5XB 5HYEA 1T7WA 2F9BT 3QEQD 5KSBB 4UIMB 5FO8B 1WISA 3RZCA 1B6UA 2FL5A 3CXDL 4MCZB 3K74B 5HHPA 5T33L 1KACB 5I30H 2WZPD 5C0DA 1I7ZB 4BFGA 4P3CH 1SEQL 2JCCB 3BPCB 1T7ZA 2PF6A 3FQUB 4FTVB 4NO5B 4RISH 4BQCA 5JHDD 2YSSB 4LIQH 3BGMB 1KBGH 4WWKB 4FQIH 4N0CC 3W82A 4HLJA 4G6JL 3VXNA 3CH1A 4L4VA 3F5WA 3WV0A 3VW3L 2I60H 4PRNA 1I9JH 3V5DB 5I18L 3IKKA 3HI5H 1CGYA 4JRXE 3ULSB 1KCRL 3MGAA 5CINL 5EZJB 2CUHA 2DKMA 2CIKB 3P30L 5CEZL 4E42A 4PJGE 1I8MB 4P2OC 5F1SA 1L0QA 3QJHA 1BX2A 3TIDA 4NO0A 1AIFA 5HVGB 1X5YA 5I1CL 1T2XA 4AG4L 4RA3A 5KSBF 4NGHH 5CIPA 2IQAA 3HE6D 3HRZB 3O3DB 4N0YH 2H3NB 5EO0B 1Y6MR 3BP6A 4M5YL 4LSTL 3SEPA 4JLRB 3U9PH 2FX7H 2MHAB 4Z7UF 3T8XB 1HHGB 4JFDE 4LLYA 3RHWK 3DVGB 4JB9H 4QHNB 4P2RA 3MREA 5IK3A 2JLLA 3D69A 1LEIB 3T08A 2X4SA 4WGWB 1HH6B 2F8OA 1J1PL 5D1ZA 4R2GD 3E6HB 5E08L 1LO3L 3QQ9C 4FFVC 1FZMA 1FH5L 1G0YR 3RBSA 2CDFA 3T0EB 3TLRA 12E8H 4KJWC 5K9OA 2B7DT 2VSDA 3QWQB 3WS6C 3NIGE 3QUMA 5JDSB 2X6MA 4QCIB 4B0MM 3SKNB 3DRQA 2ADIA 4K3DL 3BEWA 3HPLB 1TLKA 5A2LH 3SCMA 1YYLL 1QEWA 1A7NH 4NJAL 4YDLC 3DYPA 5DI8B 2Q86B 5CBEB 3C5SA 4NO2B 2MKWA 4ZS6D 1JPFA 5CSBA 4YXLH 4UIKH 4KGLA 1GZPA 1QHOA 4X99A 5EN2A 6FABH 5EC1A 3FFDB 3QCUL 2R8SL 1S3KL 5E8EB 5F7NC 5HDLA 1RJZB 2DLTA 4QT5A 5EFIB 3G6AA 5T1LD 3AXLA 4FG6D 4ONHA 3INUH 3S34L 2VZOA 5T1LB 5F8QC 5I75B 1H5BA 3VFRB 1KENL 1NAMB 4N90E 4NUGH 3PHOA 4TULL 4U3CA 2DI7A 3AREA 3MRLB 4QHUB 3Q6GH 2FX9L 1MELA 5T1DH 1ED3B 2CK2A 4HF5L 3GMNA 3VRLF 3GO1L 4EI5A 3KLHC 1YY8B 5L0QB 2CH8A 3VXUE 3U0PB 1Z5LA 1L9NA 2AERT 2DLHA 3IGAA 2DI8A 3GSWA 1NFDA 4LU5L 3QDHA 3PWNB 1A7PL 3G6JB 1HYRC 2BZDA 3QUXC 4PJFB 2APVA 4BKLA 3RJDA 3W9EA 5BOPA 1FVCA 2MQ3A 4UB0L 5GS2D 1RJLA 1WIUA 2ATPA 4LQFL 5HGDA 3ETBF 3LDBB 3MRCB 4HX1B 1U8IB 4P2CG 3GKZA 2BVOB 2DDQL 5GGVY 4KI5E 2J8HA 3HI1B 5IV2A 2DKUA 2EXWD 1QTYT 1JYNA 1HSAA 1P84J 3BH8B 4Y16B 4F7TB 3O81A 5F7LB 4UMGA 4UT9H 3DXAD 1AGFA 2BMKA 2G5RA 2A73B 4V2BA 1GAFL 1OM3H 2J12B 4PUBH 3OXSB 1G6RA 2E6PA 1FL3A 3QIWA 1AGDB 5GGRY 2V5TA 3GDBA 3QCVL 5KAQF 1IM3A 1F3DH 5IVXA 3VW3H 3TPUB 1A3QA 1NCDL 4K71B 4HC1L 3LQZA 2R1WA 3V6OA 5CIPB 4PJHF 5F1KC 2VIRB 4QYOB 1YYML 2NPLX 5CKAA 4X98B 1TJGH 5D5MF 4PJ5E 1TZHA 2BCKB 2EIEA 2YS4A 3DMMD 2PO6B 3IETB 4X83A 3MLXH 4DGYL 3RRQA 4Y2DA 4ENEC 5ETUB 2H32B 5GIRA 1TNNA 1K4DA 1PX3A 3OXRB 2B4CC 5BRZB 1RZKH 4PG2A 3BVNB 5A2JH 3UCRA 4UT6L 1CDCA 2HAZA 1RK0A 4RMVA 2E7BA 4Y1AB 3MOAH 4X5WB 1IGFH 1YEHH 2GTWA 3L7FB 4ZUVB 3S35L 4G6MH 1XZ0A 5C8JA 4NQEB 2V5MA 4Y4HD 2R69L 5INDB 2ILLA 5EU3B 1QUNA 4HKJA 1KEMH 2IGFH 2MSPA 3ZTNH 2NXYC 1AY1H 1DBMH 2J6EA 4HEPG 2R56L 3IAQA 4G9DB 2VL5A 4JFOA 3SDAA 4MJ4A 4MX7B 4GRWH 1ZVYA 4DOHB 2A6DB 3HPJB 2ZNXA 3I6LE 1EBPA 4OT1H 5EUKA 3VFSA 3L3OB 4GG8B 1QVOA 4JO4H 5HD8C 4P23C 3W81A 3L3IA 5BZWB 3BXNB 2NY4C 1BHGA 2E7HA 3U7WL 4PJ8C 5D1ZC 5JW3H 3MNWA 3VGAC 4ZOAA 3RZCC 2VE6A 2HVKB 2X70B 2ZUXA 2NX5B 2ZUUA 2PW1A 4TVSa 5FOBB 5ISZE 2CXGA 3UTOA 3GO1H 4Z6AT 5DWUH 5EH1A 3QI9D 5JW4R 1FGNH 2J1KA 3QIWC 1R5VB 1WGOA 2EE2A 3MRGB 4XRCB 3WLWD 2EKSB 5GS3A 3O11B 5DQ9A 2KPNA 2IC2A 1HZHL 1UCBL 1OF2A 3MV7B 3DX8B 4QRUA 1SYSB 1NDGB 5CGTA 4D0DB 1EIBA 4MAYB 2ESVD 3H3KA 4XMKL 3VFNA 1KPUB 3K2MC 5MHSE 2EDRA 5BXFB 1T20A 3RWEB 2CLZB 1PBYA 3U9UB 1UT9A 1MCSA 5FUCE 3UJTH 5EZOL 1V3KA 1LEGB 2XWTB 2RGSA 4IRJC 4X9BA 2G60L 2G9HA 5HHOB 5SWSA 4NQSB 2X4OB 4Z7VA 2VLKE 3GRWH 4ELMB 5C9JB 5AZEL 3DUSA 5DURB 5A3ID 2H1PH 3EOTL 3PGFH 2VDOH 1FFQA 4LGPB 5FA3B 1BLNA 5I74C 1EV2E 1U2CA 1V05A 1XF5B 1RURL 2NY7H 1ZLWK 4LLMB 4L4VE 3WFCH 4E42B 2H2PD 5E00A 1MAML 3B2VH 4EBQH 4YHYB 3C2SA 4JM4L 5JXAH 2DQEL 2A2QT 1U8KB 3TJHD 2H3NA 1NCBL 4L8CA 4OIAA 4I0PA 3U0WL 3V8OA 1AI1H 1CICC 5A2KH 4OGAD 1AXIB 4Z77B 2HLAB 4BSWB 1A7OL 5JTWA 4LRIC 4MVBC 1QRKA 4R8WH 5HI5D 2CMRL 3GI9H 2P46B 5GGQH 2YPKB 4NJAH 4OZHE 1UC6A 1HOCB 5ITBH 3LMJL 5EWIL 2ZUQC 4NDMA 2EC9T 4U7MA 5ESVA 1L4IA 5L2KB 3K46A 4OB5L 4TTDD 5E6IA 3C5JB 1DUYB 4WI9A 3FTGA 2HRLA 3NCJL 4LKCA 5AZEH 1PLGH 4M61B 1A6WL 1BGXH 4K7PY 4B7LA 5HYSA 2MQCA 4ISVB 3CMGA 1QSFD 4YDKH 5DWUL 1F11A 4YFLF 1AHWA 4X9HA 2WLZA 2F53A 3QPQD 2DLEA 3DX6B 4NBYB 1XT5A 1KJ2A 4X99B 4CW1B 4DGVH 4DTGL 4JG0L 4LCYA 5J13C 4MSWA 3QULA 1MFEH 1J05B 2G2RA 1CK0H 1NMBH 5IGXH 4HUWA 3SDCA 1NGZA 4RGOH 3RVVC 1KPRA 3WHE1 4GAYB 2ZCKH 5E2VH 4UDUA 2X40A 3BFOA 4IOSD 2MOVA 3VRJB 2MNUA 3GKWH 3FONA 3W0WE 4JZNA 4D2NA 3K81A 4RFNC 3VE0A 4UUJB 3Q5TA 2BDNL 4M62H 3KYAA 1RJYB 1WQVT 5IFJB 2IALA 4J1UA 1AC0A 1I8KB 4R9HA 1YY8A 1C7TA 2XTJD 4XNYL 4KY1L 4OM0H 1G7LB 3ZDZF 1YY9D 4XH2A 3VGBA 5IIEB 1U6AL 2AABL 2EXYD 2VKWA 2K7PA 4OFPA 5EIIA 1RUKL 2DQUH 5C0GA 4X8XA 5DD5H 2ICES 4JM2F 2FRGP 2FGWH 3B2UC 2J5LB 1YMHB 4JFEB 5EOQH 4KZEL 3CC5A 3MRCA 3U0WH 3SQOL 1TTFA 2W9EL 4TUOA 3NPSC 1NFIA 1NSNH 3KPMA 4NSKA 5E4EC 1CE1L 4LLDA 3VFNB 3MJGX 4LHUG 4F57H 3KJ6H 1G9MC 4PJXF 1YN7B 1A6ZB 5DJXA 1HSAB 4JHBA 4Y16A 4PV8B 2FATL 1LEGA 3LOWA 4HT1H 1UVQB 1E4JA 4PB0H 4DUXA 1AIFB 2DQFA 3RVUD 3VXRB 4TQEL 2NCMA 4L4TA 2YD9A 1J0IA 3QIWB 1FL3B 3JTSB 4XP4H 3CDGA 1Z9MA 3X3FL 1RZJL 4XI5D 1MI5D 1PQZA 1C08B 3MRPB 4IRJB 3OKYA 1IAKA 3SKUD 7CGTA 1ERNA 3M8OL 3WMSA 4JM2B 5I0ZA 4POZC 4LOUD 1C16A 4R4BA 1G0DA 3JWOL 5AYQA 4HZAA 4XCCH 4YJZL 2L7UA 2VZTA 3RGVC 4Q6IB 1YQVL 4OZFH 2AS5M 2OR7A 2WINA 5JQ6L 4UOW0 1C5CH 4JY5L 5GJTL 3HPLA 3BEWB 3FN9A 2ICEB 4YHOH 1NL0L 1MAKA 1F45A 1FVEB 2XKNA 4L3EB 3PXJA 3CU1A 4KDWA 3MLWL 5CEYB 4OCRL 5HGBA 1T21B 5GRUL 3MFGB 2PNDA 3MACL 4L3ED 3BIAX 5HGAB 1T2QH 1A0QL 3KYNB 4JAMA 5D7JD 1CICD 4XVJL 1JWSB 1ZWIA 5C0BA 1U95B 4IS6B 3ULUE 1NDMA 3LS4H 4KQ4L 2WQRA 3BKCL 4GBXD 1NGQH 2AVGA 2D7OA 5SWZA 3IFOB 1ZOXA 1S9KC 5TDPB 5F3BA 1ZLVH 1RZ8B 1AO7D 1DLFL 4FRWA 1E6JH 4LRIA 1D7FA 4PP1D 5BS0A 1DTUA 5D93B 3F7RA 3U1SL 1JGLH 1LK2B 4E0RB 3QDGA 4HQQH 1IC7L 1OT1A 3UYRH 2RHEA 1QO3B 2AK4D 2WV3A 4UT9L 2WP3T 3BX7C 4XP9H 5J7CC 4HPOL 5TE7H 3UPRB 2VN7A 3UTZB 1GGYA 4RMQA 4DKEH 2XWJA 1T03L 1HIMH 3GMPA 2J8UE 3I50L 1VB9A 2OS7A 3MLWH 4NFDA 2QKIA 5EO9B 5HGDB 1ZSDA 5L2KE 5AUMA 4M43H 4CN4A 3QG7L 5CJXA 1BWWA 2FEDC 3QXAA 3ZHKA 1AQKL 5GQBA 4LIQE 4D94A 3KPPA 2QQNL 1BIIA 3AFLA 3AC0A 3KLSA 3VWJA 1YYMH 3I6KB 2K3TA 4XP6H 3MJ7A 3V4VH 4OV5B 4I2XA 3TWCL 4UDTA 1T5WB 1TVBB 1CLOH 3U79A 1OAKL 3B4NA 3EO1A 3RWGB 2DMCA 2X89D 2XTJC 2A73A 5EU5B 5F1OB 4KXZH 2H41A 1WWBX 1NKOA 3LKSB 3QUYC 3VD3A 3LKRA 1A4KA 3DUSB 1CFTA 3VWJC 3DV4A 2Q3AA 1E6OH 4LLUA 1UVQA 5T3ZD 1N6QL 4P5KB 5C0CB 3C5ZC 2BFVH 5SWQB 3SGEH 4TUJB 1T0PB 3L6FB 5H35B 4X7EC 3VXMD 3O41A 2PKDA 3MRMB 3WIFB 4FFYL 5FGSA 3HC4L 4CVZA 2PCPB 2VXVL 4YHLH 3N1FC 4HUXA 4X9GA 4M5YH 1LDPH 3B5GA 1LO4H 3IFNL 5C0IB 3PIQB 5FYJU 3U6RB 1NMCC 1HOCA 1KYOK 1NCCL 4M03A 4YDVB 1EAJA 3BZEB 5I1JH 4XXDA 1QSVA 2YN3A 2J8UB 3DECA 3PQYD 2AEIT 3IJYA 4WHYH 4AENA 2BHYA 1GHFH 1LO3H 3VMNA 3O4LB 4WVRA 2VLLB 3P73A 5BQ7A 3WFCL 3O4LD 4G9DA 1Q9WA 3LKNB 1RMFH 3GIVA 1FIEA 4MA8L 4DAGL 3DHMA 5F88B 3D39D 5JMOC 3MRFB 4P5TB 1SY6H 2DN7A 1IGYA 1XCQB 5C2BL 2OZ4A 1MCPL 3V5HA 4I3SL 1U95A 3MBXL 4MA7L 1BFTA 1T3FA 5IM7A 5KSUB 2XQYK 4K2UL 3SPVB 2H32H 1LNUA 1NUDA 1CLCA 1WZLA 5D7IE 2AI0H 4PJXE 1DUZA 2KZWA 1ZGLB 1U8QB 1KC5L 2FLRT 3H9HB 1MOEA 4XRCA 1FNLA 3JWDC 4X6EA 3VWKB 2GTZB 2DD8L 3PGDA 3TBYB 4DUVA 3FMGH 4X6CF 3STZA 3BP4A 3L3GA 1OF2B 3MV7A 1A9BA 3SDYH 1NGYB 1GPOL 3RL1B 4ZUTA 3JWOC 4JHWL 4ZTOH 1RIVL 2EYRA 3D9AL 4HGMA 4NM8H 4KVNL 4UV7H 3T0AA 2ADJA 2P5EB 1P53A 3MUGA 1TJHH 3U1SH 1HH9A 3IS0X 3N1QC 5IG7A 3U9UA 5DS8A 3RUGA 4HIXH 4MAYD 3MGOB 1IJ9A 3PF2A 2DM4A 4PRIA 5B3NA 1MREH 4NKOA 2V5YA 3MV01 4XX1E 5SX5K 3SKOB 3TA3C 1T03H 4UQ2A 2AV7B 2A6JB 1YN7A 2ZKHL 1AGEA 1JZ6A 4HWBA 3K2UL 2HKHH 3VFVA 3I6GA 3TBTB 4WFED 1XF2B 3JSSA 2A6KA 3JWDL 2AK1L 1EK3A 1H8OA 3QXDA 3SDDD 3ARFB 1A4KB 4G7YL 4EIZC 1LD9A 4LLQA 3U0TB 1O7SA 3MOQA 4M48L 4EUPB 5FB8B 1CVSC 3O2VL 4L8CB 5DRWA 2E5EA 5C2UB 4XMPH 4K3EL 3FFCA 4JVUA 4F58H 3VFOB 4PY7B 5CJBA 3LIZL 1T1WA 5L6YH 5JPMA 3BD4A 4GW1B 3EJZC 2Y36L 4X4ZA 5J9PB 2EDKA 5IP4A 4UILL 2JELL 4APQB 4JFEE 1A64A 4LDOB 4PTTB 2GK0A 4MZ3A 3T77B 1YPZE 3G6DL 5TDOA 2YMXH 4WTZA 2V2WB 1MJUH 2YPLB 4PJAA 5D70L 3RPKA 3UC0H 3G5XB 3GSNL 1K8IB 1FFRA 4MXWH 4GKSA 3QG6B 3BSZL 4KK9C 1DVFD 2ZSWA 3QQ4A 4JPWH 2XZZA 3O8XD 3QCTH 4OGXL 3U36B 2QQKH 3U4EB 3G5VA 1KELL 3O3EA 4KMTH 2JJUA 3EO9H 3FZUD 1V3LA 4G80A 4Y4FC 5HGAA 1HWGB 3TV3L 2IAMB 4M7JH 1PAMA 2AI0L 1T4KA 1K8DB 4M7LL 2VZ1A 2DM3A 1M05B 1WBZB 1UQSA 4FMKA 1BBJA 3D25A 2DF3A 4ZOBA 1JV5A 1MHCB 1I1AC 1KF9B 1QYGH 2VN4A 2CGRL 4OCSL 1IGYB 5DFVC 4HIEA 3MMEB 2NMSA 2FO1A 3BIKB 4MDJA 4DUWA 1RZ8A 1JI1A 5FECA 2EZ0C 3U7YH 1TPXC 1JN6B 3V79C 4NWTL 4TOYL 3WN5B 1A6AB 2P8LA 4V1DA 4F33B 2X1WL 1JUFA 2HTLC 1IC5L 5FKAA 1AE6L 1OB1A 5SWZE 1EPFA 3P4NB 4EN3B 2HTLD 3LEXA 3UPRA 1NGWA 4U0RB 2M8XA 1IBGL 4F7CB 2DKSA 4ORGB 1G7PA 3FT3B 1A14L 2JJTA 1H0DB 3RZCB 3CGTA 1JWUA 4JGMA 3TZVB 1RIHL 2XZCH 2YPVL 3BKML 1JGDA 1F90H 1KJMA 1K4CB 4I0CC 4NBZB 4K7PH 3H42H 2I5YL 1F8TH 5I17A 3UTTE 5I73B 5C07E 4JY4B 4PJGA 5D1XC 3Q6GL 3MUZ1 3R1GL 3GJEB 1ORSB 3OGOE 4WI6A 5I9QC 2A9NH 5FYKD 2BOCB 1JBJA 1OSZA 5DVOA 5F7DA 2X4PA 1C8PA 1ZHLB 3C08L 2G75A 5ID1A 5DJ2B 1S78C 1XMWA 5EU5A 4LF3B 2ENYA 5IWLA 2D0GA 4O2EA 2CLVA 4LPCA 4JHWH 4U1HB 4Z5RA 4PTUB 1U8HB 3GHEL 1WBXA 4A6YA 1FNFA 3ULUL 1SJXA 3O6ML 1K3ZA 3ME0A 1NLDL 3ZKND 1FNEB 4HS6A 4OV6F 2PYFB 4IM8A 1QSEA 5CCKH 3SDXE 1XGUA 4P4KA 1LE5A 5HBBA 3OKEB 5ACMA 4EI6B 1CTOA 5ITBL 3B5HA 3LHPL 1AJ7H 3NH7H 3O6KL 5I71B 3IT8D 4JPVL 4LDEB 1NQBA 3STLB 1CFVL 3QFJE 3RPIA 1PLGL 4O51A 3VRIA 3P4MB 2R1YA 2CDFB 5LQBH 2YPLE 2HP4A 4P4KC 4LEXL 4PJ9C 5BZDA 5F1IB 4NM4L 5IB3A 3KXFD 4G8GB 1MI5E 2F8VA 2VITA 1K8IA 2DQEH 1U3JA 4G9FE 1D5IH 2MPAH 2BVTA 3D5OF 3VCLB 1F4WH 2IMMA 5EBMB 3OSKA 4PJ7A 1U8OB 5F70A 3RA7L 3GBNL 3IRPX 3MLTA 4N8CH 5GS0H 1N7ML 4WFGE 1NMBL 3B8YA 1Q72L 1TZGH 3MLSL 2ED8A 4HMDA 1J0YA 5FK9B 3S36L 1A3LL 3B83A 4NQUA 5GGSA 4LNVA 1QLFB 4B50A 1SJHB 3CSGA 4YHLL 4LSSL 4E0RA 5CBAB 3P4LA 1A7RH 1I3RB 1YNLH 4QHUA 3BPNB 3PNWB 3EDEA 4LSRL 3ABZA 1IZKA 4BH7A 4NC0B 3T04D 1W0WA 4G42B 3ARVA 3GJFH 5EU7E 4AMKL 4ZD3H 3WS3A 5I1EL 1FNGB 4PJCA 1MCBA 3QCUH 4F3FB 1YEJH 2CUMA 1DN0B 5TQ2H 3RNKA 1V5JA 3MCLH 3PV7A 1F42A 4HDIA 4PJDB 1WWCA 3MRIA 3BO8A 1NL0H 1D6VH 1MCHA 3LN4A 1JNNL 4F7CA 1MJ8H 1NGYA 4I0PC 5HYQB 1AKJD 1T1XB 1I9IH 3I85A 2GUOB 5DQJB 5TDNA 2BVYA 3BRDA 1TVHA 3BKYH 1CFSA 3BAEH 2AKRB 4J6RL 4U0QB 2YSSA 2F5AH 4NQDA 1VPOH 2J7LA 3NACH 1D5BB 3ORJA 1TJGL 5FYLL 4K9EL 4RZCA 1OAZL 4WTZG 3A6CH 4E5XA 3PWPB 2WUBH 5IBUB 4WEBH 3HZKB 5T1MB 5LQBL 5E2TL 2VQ1A 3RTQC 4P5KA 5CS7A 3CFBB 1DLFH 2R1XA 1W72A 2VLRB 1F4AA 1JFQH 3FO2B 1ORQA 4NNYA 4J4PA 1T5XA 4GAGL 4LFHG 4F9PC 5JHLL 2I60L 5C0CD 3N9GL 3T1FA 4WUUE 1S5HB 2J8UF 2MCPH 4GMTH 5FM8A 3SDDC 4CN1A 2YUXA 2HFGL 3TNMB 1WFOA 1YPZF 4NRZA 2UZIL 1UZ8B 5FYKH 4HKXA 3E2HB 4CN6A 3OKEA 2V7NB 3QG7H 4Y5VB 4NZUH 2P5WE 4KHXL 3TNNB 1HI6A 5CJXC 4JO2H 3O6MH 3QUXB 1WZ1L 1R5IB 3LKPA 3Q0HA 4JQIL 5IMKB 4LPVA 4ELMF 3QP3A 2Q8BL 3QO1A 3KAAA 1S7SB 1PSKL 1U3HC 1IVLA 1FYTD 2DB8A 1CBVL 5L0QC 4K8RC 5B38G 2X05A 3DO7A 4OF5A 3OAYH 2AXFA 1FORH 3H3PL 3GUTB 3VFUB 2VLJA 2BVUA 3VXUB 2MJWA 4ZUUB 4S1SH 1XF3A 4QHKJ 4MXQC 4YHOL 3FQWB 4NO2A 3DMMB 1CDGA 1Q9KB 3MRBA 5B4MC 5IOPB 5D70H 3C6SB 4TVPL 1ZE3C 5DJCB 1T3FB 5LGJA 2R9HD 3C6LC 4WO4A 5L7XL 4WI4A 1S7UB 4GXUM 1FFNA 4MQSB 4UV4H 1AD0A 4MD5B 5F6HI 2VLKB 2XXMB 4OF0A 3RKDD 5IT2L 2EO9A 4U33A 3BXNA 1TENA 4PJFF 2JJTC 3MRLA 4GJTB 1BF8A 4EQ3A 4R4ND 2R8SH 5HDOA 3O3AB 1IC1A 4N1EA 2EC9U 2HKHL 3CDFA 3KPRE 5L9DH 4H0IA 1T2QL 4PJ9A 4NRYA 2HKFH 3T65A 4MD4A 3OG4B 2EYRB 4UOW1 4OCXL 3GSVA 4HZLB 3OG6B 2BRRL 5CILH 2IANA 3QNXA 4G43A 3U83A 4FFWD 3DYMA 1L0YA 3PL6C 2E27L 1NGXB 1R5WB 3PL6B 4K9EH 3GMQA 1MHEA 3VH8A 1SYVB 32C2A 3FO9A 3T0XA 2FJHB 1S9XB 4NT6B 4D0DA 4WV1B 1JTOA 1MWAL 1WCBA 5B39B 3W2DL 3S4SA 4GG6F 3VXPB 4M43L 3S37L 5TDNB 1A7PH 2QLVB 1AR1D 4NUJB 2IEPA 1FJ1A 2A1WL 5FYJH 5ID0A 3TBSA 5IV2B 2HT2D 1R24A 4L29A 5TE7L 1JNNH 4Y19E 2VZVA 3UTTA 5HXMA 4R90H 1YY9C 4M4PA 3U7YL 4HJJH 2APFA 2ZG3A 1XH3B 3NPSB 4LU5H 3SDCC 3D18B 1FAIL 2W91A 5DK3A 1J7VR 1BVZA 1W0VB 4HXAH 1H3VA 4AIOA 4NZJA 2YD7A 4XZUB 5J6HB 1P7KA 4NC2B 4P23D 1U8KA 1F58L 4M6AA 1BAFL 3SQOH 1IM3B 3ZKNC 3CSYB 4BK5A 3KPQA 5DR5L 3TNMA 3V6BR 5MEPA 5DSCB 5IF0B 4PGZA 3RJQB 2V2XB 4FXGB 1GRWA 2VXQH 3B2UD 4G6FB 1KXVC 3FQNA 1X4ZA 3QPXL 1D5ZB 4GSDH 4TSCH 4Y5VC 4OQ1A 1HILB 4ZQKA 1N3NA 3GBNH 5DFTA 3EGSA 3EIFA 1OARH 5KSBE 3HAEB 5MENA 3C5JA 1WBYB 4Z7UA 1BD2D 1OTTC 2FBOJ 1YEFH 3WKNA 1EO7A 4X7SH 1X5ZA 3A6BL 4H8WL 4XCFH 2Z31D 4LCCA 4DVBA 1T4KB 1AHWB 3QUZB 5F89B 3VD5A 5IJKC 4OZIF 4HKJB 1SBSL 4XCYA 1INQB 3JXAA 3QUZD 1F58H 2IH3A 3LD8C 3QFJD 4PV9A 2F54D 1JNLH 5EIVA 4FQHB 4NFBA 3FN0L 4WW2F 3PP3K 4XPTL 4L1HA 4ZXBD 4PRHE 3GSOB 3EO0B 3G5ZB 3AS3A 5DMIL 2MPAL 1DBJH 3BUYB 4ZNCD 4DGIH 5CEXA 3RWCA 1MRCL 3RGHA 3AB0C 1IRAY 4KGJA 1FO0H 5A40E 4H88H 3M07A 4ONOA 4N5UA 3IDXL 3LEXB 3W0WD 5ICYA 3WL9A 2CRZA 5CJOL 3TIEB 4EVNA 3FQRA 4P2RE 1FG2A 3TZVA 3LEYH 3D3VA 3OB0H 1XR9A 5FO7A 3BO8B 2OL3H 1HHKB 2Z4QB 4OLEA 1T66D 4WWKC 4QRRB 2AJYL 1AO7B 4NQXA 3KHQA 4PJCE 5I9QB 5KN5B 1MRDH 5C09E 2DWDB 3KLDA 3S5LB 2DOCA 2NZ9C 4R4NC 3IB4A 2Y07H 5T5FL 1FL5A 3ZE0E 4UTBL 2B20A 3TBWA 1NEZA 4WO4C 1AJ7L 2AK4A 4H26A 2A83A 3B2VL 3SHSA 4EBQL 4QEGA 3LSOA 1OY3B 1MCOL 1NKRA 2Q20A 1SEQH 2B1HH 2VR9A 3QZWA 5M7QA 1AXSB 2Z35A 4HWUA 3T3MF 3RZCD 3U30B 1MJ8L 3HR5B 3I02A 5H2BB 4H88L 3PWPA 5LWYH 1ZA6A 2NY3D 5T1MA 2AXGB 1V3MA 5KG9A 3T2QA 1G9ML 3F6LA 3I9GL 1QSEB 4NQDE 3HI5L 2FJGB 4AEIL 5TQ2L 4FFWC 2ZZUT 3TO4D 3UJTL 4PJIB 1Z9SA 2FYYB 4XC1H 2FIKA 1U8MB 3R8QA 1UJ3B 4ZFZB 3WKML 1W0VA 1S5HA 3JBG7 3FRPA 3I2CL 3ZKSD 4GSDL 4TSCL 5D71H 3IDYC 5I8OH 5ALCH 4I0PB 4R4BB 1RSFA 1EEYA 3MRNA 1G7MA 3UYPA 5HHOE 3ALXA 1PYWB 1TZIA 1F6FB 3FN0H 3BPOB 2JIXA 3DETD 4HCRL 4KDTA 1R5IA 1DJSA 5F9DC 3CNKA 5C0BE 1NEUA 5IB4A 4HIHB 4HLZG 2XG4A 4R0LB 1CD1A 2EDFA 1N3NB 3TN0C 1A3RH 4I3GA 2CIIA 4FQJL 3SKJL 4G8GE 4Y4KA 1X6NA 1P84K 3QWOA 5E8OA 1ZT1B 4O4YL 5CSZB 5GGSY 5HGHB 3HMXA 1UWEL 2VLME 2ICWA 4QRTB 1MNUL 1VEOA 1E4KA 5EUOA 2YD2A 5FK9A 2F53B 1WZ1H 1NLBH 4JRXD 1AQDB 1MVUA 3G6DH 3JV4B 2A0LC 4NUGL 3TN0A 2OJEA 5DJCA 4NNPL 3DI3B 3LKOA 4U6VH 3RVWC 4LPTA 3L7EA 2JJSA 4X6DA 1QG3A 4OKVB 3I3BA 2OSLB 4WUUB 3TC9A 3L9RB 5J6GA 4OCRH 2JK5B 1T6WA 2NTSP 2FHCA 3GSOA 4U7KA 3AM8C 1QSFA 4N1HB 4POYA 1D6EB 3UBXA 4OLXH 1YMMB 4HUVA 5TGBA 2OK0L 3SE3C 5LXGH 4UBDD 2DQDH 1B90A 4GKZA 1YEKL 2IALB 4XWGH 2F5AL 4TNWF 2G60H 5CJ8A 4LSQL 5FEBA 2BC4B 4OI9A 5SX5H 4JFYA 1GIGH 3I6LD 4YHNB 4LBEA 1FDLL 2OMNA 5IIEA 2ICWI 3QUZC 1OAUL 3SGKC 3EYOA 4X8JB 3NN8B 4P48A 5ESAB 3RWFA 4ENED 25C8L 2RCSH 4QRRA 2VQTA 2GT9B 2GSGA 2GQHA 4WJ5A 3UJIL 3UTSE 4RZCB 3T0DA 3FO1A 1D9KB 4CADB 1YJDC 3ZKMD 1I7UB 2BNQB 1CGVA 3D0VA 1FC1A 4JFHE 2WM0A 3U4AA 1N8ZA 3F7YB 4DKEL 3OZ9H 1LEKA 1NEZB 1I1YA 1NBQA 5DHYA 3SO5A 1ORQB 1LK3L 3VXOB 4W81A 1IEBB 4TSBH 4UZGA 3ARBC 4NN6C 4ZMAT 3RWJB 4X0KA 4HEME 5JPNB 1A3RL 3VMOA 5DJYB 2GAZA 1LMKA 2HKFL 4PJXB 5KSAB 3RWDA 3HG1E 4AMKH 4PG9A 3WUWB 3CDGB 4KAQL 1TQCB 3OPZL 4LKXA 4ZFFB 5T3XL 3FB8B 3ZL4H 1P7QD 3WFBL 4Q9BA 2G5BA 3QJHB 4Y5VA 3P0GB 2NZ9D 1J8KA 3QBTB 2R2BB 1I3VA 4G6FD 1IGTA 2VH5L 1OGTB 1ACZA 4QHMB 3OJMB 4NNPH 1XF4A 3EJJX 2ADGB 4O4YH 2E6QA 1T83C 4J3OC 4OGYL 1QD0A 2XWBB 2KQMA 2EIBA 3CK0L 1BD2B 5JNYA 1YEHL 15C8L 2D0HA 4QRSB 5I1IL 1XGPA 3RU8L 3CLEH 3HAEA 1EZVX 3B9VA 1J8HB 4YE4H 4PLJD 5DJZB 1FAKT 2HN7B 2P8PA 4MMXC 4PRPD 2R29L 5TE4H 4HUMB 3V6OC 1MCJA 1KGCE 3DMMA 3SKJH 3HUJE 5CD5D 1HHJA 1PZUB 2ATKA 2HH0L 4Q74A 2LAAA 2DM2A 4MS8C 2AJXL 4EDWH 2Y36H 3H8NA 1I8MA 5FCUH 1MRCH 2QHRH 1QEWB 5KTEH 3T0WA 5JQHC 2GSIA 4AYFA 4ODWB 3WIIL 2AQ3A 4JFQA 2LVEA 2BY2A 5IQ7H 2VB5A 1RJZA 2DD8H 1I9IL 2QADD 3MLRH 1WC7B 4Z0BL 5F44A 5IEKA 2VABB 2YOCA 2OTWA 3PQYB 1B0WA 4M7KL 1YYLH 4D3CL 1WZKA 1I85A 1I3GL 3DVGA 3HA0A 4QHNA 3IU3A 4O58L 5DJ0B 3MREB 4TUKL 1M1SA 5FAAA 3K7UA 2H9GA 4HUVB 4X6EB 2XY2A 4XBGA 1CGWA 1QO3A 4PRHA 2D0FA 4HJJL 1YEGH 1UZ6F 3WFHB 1CCZA 2F74A 2A0LD 3UEZA 3RVXD 2HJLA 2DQJH 4UIMA 3D39B 3B9KB 1TIUA 4KI5D 5FF6B 4S1DD 4MNGE 4NPYA 1WCBB 1U8JA 1ZHBA 4RX4A 4BZYA 5HVHC 3VD7A 5JW5A 1AO7A 4NQXB 2PR4H 4M7ZC 2HT3D 2Q86A 4B53A 3IU4H 5BO1H 1DANU 3NACL 5D72H 1ZA3B 2NY2C 2DWDA 2R15A 1F3RB 2HMID 1FVCB 3RDTD 4OLUL 4MJIB 1KN4H 1R24B 1NBYB 2EDOA 2VAAB 3GGWB 3QI9A 2A83B 3F5WB 2DWEA 3ZDZE 1JYXA 1I1AD 5DD6A 1IC7H