1TFKA

Ribonuclease from escherichia coli complexed with its inhibtor protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
QLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin D
publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
total genus 25
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tfkA00
1TFKA 1TFOA 1V74A
chains in the Genus database with same CATH superfamily
1QVG2 3NV0B 1M1K4 4LSOA 4GL6A 4KFFA 2CIUA 1TRPA 4HM2B 3DM8A 4ORLA 4HM8B 1JBTA 3RGRA 1VZZA 1BUJA 1NB3I 2R41A 3N54B 1OGXA 2WOFA 4HBRA 1WQLB 3AHWA 1VQN3 3D3LA 2GXFA 3D79A 3SYUA 1B20A 3AGOA 2E2TA 3Q2PA 3WOEB 2XSHB 1OH0A 3K9MC 1OHOA 3KKGA 2CFGA 1DMQA 4H61A 1AY7A 3X40A 3NM2A 1WMNA 2CWTA 2D42A 2F4YA 5TGNA 3URPA 1U8CB 3IPTA 4LGQA 3K63A 5EEOA 4N6LA 3WA2X 2RSXA 2OTJ3 5A0OB 1ULJB 3RDEA 3AMOA 1WTHA 1FGRA 1GMRA 3DGYA 3G0KA 1T5YA 4HZBB 3NQZA 3N9HA 4KZ1A 2QA43 3EF8A 3UL6A 6RNTA 2Z6BA 1JRQA 2W6JH 1L5GB 4K61A 1OF5A 3UJMA 1VQ63 1IT8A 4EXRA 1NU3A 1STDA 3OW22 1JKGA 4HM4B 1RSNA 4FCZA 4BL2A 2O3OA 2PNCA 1LVNA 3A5EA 2IY2A 1AQZA 1B2UA 3EB8A 2KF5A 7RNTA 5JPPA 3OX9A 3HI7A 4OK0A 1YVBI 1M9GA 5DRVA 1VQP3 3Q90A 3CC23 1UI7A 2E2VA 2STDA 3JUNA 2OOVA 3D5GA 3U1WA 1AV4A 1I0XA 2MF7A 2QGUA 1BNFA 1ROVA 3F7SA 1HZ1A 1DE3A 1ZO2A 1QMAA 1G96A 3EBYA 1IT7A 1OF5B 4RBNA 2SBLA 5EVHA 1MGRA 3VSYA 1LOWA 1TTOA 1GY7A 2ZHXB 3MPHA 1GS3A 2SARA 1KD14 1VQQA 4R4KA 3STDA 2W9QA 1SJWA 1FZUA 1Q40B 3GZYB 4FMDA 5BU4A 1RNTA 3Q1CA 3CC43 3TDGA 4O3VA 5IERA 4CCVA 4O8SA 2Z76A 1RMSA 2F5WA 4N6TA 3FCSB 1YGEA 2YX9A 2OTL3 1V58A 4OVMA 2Z77A 1UW1A 2CK3H 1Y4KA 1B2XA 4WYKB 8CHOA 4IIAA 1K9M4 1EQKA 3IMAB 1SQWA 1NDOB 4FMAA 4QWTA 4XBTA 1RDSA 2GSPA 4PEJA 1FUSA 3ROBA 3RGAA 4LEHA 3I563 4GB5A 4HOHA 2B24B 1PYLA 6STDA 2UUGC 1SIHA 2MC8A 1RGHA 3CC73 4L7KA 1V74A 2ML6A 2RNTA 2W56B 4CDLA 4JRFA 2IYJA 4BTXA 1G0TA 3EN1B 1BRSA 1CYUA 1CYVA 5FW5A 1BSCA 2F56A 1BNJA 2AADA 2C4BA 1ASKA 2K0MA 1IVXA 1A90A 3EJVA 3X3XA 1JN5A 1LXEA 3HZPA 6GSPA 2XH9A 4RZMA 1BNGA 3NXJA 1S5AA 1FGMA 3FLJA 3MG1A 1RGAA 2RGQA 3O8YA 4HM3B 4R9KA 2P09A 4BU4A 5I97A 4BTYA 3T8UA 1ULIB 2J8XB 4KVHA 1A2KA 2M7OA 3LTBA 2OQEA 3BNEA 1MWUA 3OXAA 1RNBA 2AAEA 1LNIA 2CX0A 3HIIA 5D81A 1WMOA 1TIJA 1D6YA 2LYXA 3JUQA 3T0UA 5IENA 4N6OB 2F5MA 2Z7AA 3NBRA 1LNHA 3LTDA 3V92A 4EC6A 3EX9A 1KC84 4STDA 1JB4A 4O02B 1BAOA 2GU3A 1OHPA 1PY3A 1UCJA 2W04A 3DUKA 3RNTA 1LOXA 1BSAA 3LT9A 4MMXB 1B2MA 1TRQA 3CMA3 1IYYA 4JF8A 2RFRA 1MGWA 3KFQC 1RRHA 3SOAA 2HMKB 5IG5A 4XB5A 2HMLB 1J2BA 1Q7HA 3GZBA 1NO3A 3CPW2 1OCVA 3B4OA 5AIHA 4HVNA 2XGNA 4N6UA 1YHQ3 3ECFA 2IA7A 5JBSA 3ZG5A 1W7CA 3V98A 2OOVC 1R4CA 2BU4A 3MKIA 2XRXB 1Q7Y4 2BMOB 3J7Yd 1BNEA 1BU4A 1EG9B 2HMOB 3KCHA 1OUNA 1GOVA 1MOLA 3CCJ3 1Z1SA 1GMQA 5LC7A 3EN8A 1GOYA 1JB2A 2CHCA 1B21A 2W2CA 3WR2A 4HAAA 4KFEA 4MMYB 2FXTA 1MWSA 3AHSA 1N8R4 1RGLA 1UUVB 1ROAA 1EA2A 1WNHA 3OWUA 1BNIA 4NREA 1GY5A 1A2VA 2F86B 4NPBA 3NBJA 1VQO3 3Q3FA 2F98A 5RNTA 1I2FA 2BMQB 4L8PA 3PYJA 1YJN3 4N6MA 5AIFA 1K41A 1GYBA 4ILFA 4X2OA 1UGHI 3B8LA 3QRDA 2GBXB 1Q9EA 1HYFA 1QVF2 4NHFA 1IVUA 4K1VA 4I4KA 1UCLA 1FGTA 1YVSA 2HMJB 1HKXA 1A67A 4WHAA 3S27A 1DVDA 3MG2A 1IV7A 2H0HA 3IJEB 3K7CA 2ZL8A 1PU4A 4XDWA 5AI1A 1M904 2RCDA 4EV5A 2HMNB 1STFI 2YFJB 3AMOB 1TJDA 3DH2A 5IEOA 1JNQA 1IU7A 2O9UX 1BRNL 1ISKA 1BOXA 2PZVA 2RBIA 1B2SA 3LXUX 4AEQA 3MHEA 2OCTA 4L8OA 2BO9B 8RNTA 3G6E3 5CF1A 1BANA 1O7MB 2XFTA 3MSOA 1RRLA 1JKGB 3BNCA 3GSPA 1JV2B 4BIRA 5KP4A 1K734 1VQ43 1N8QA 1QAKA 5G2GA 2CW9A 1BRJA 1PFPA 2OWPA 2GEXA 1TU5A 5IEPA 1W00A 3F7XA 3LT8A 1O7WB 3AGNA 3V99A 3CCS3 4O2HA 3KSED 1RGCA 3G8ZA 5KP3A 1B2ZA 4HM0B 5ELUA 5G1LA 2BNGA 2KF3A 3GZRA 4RNZA 1W2ZA 1DYUA 1LQGC 2C10A 2FNQA 2L4VA 3WODG 5BXQA 1CQSA 1I2EA 1R4YA 1DETA 2B1XB 2KXGA 3F9SA 3NX0A 5AYRB 3PCSA 1Q42A 4WP5A 1QAFA 3X3YA 3PXMA 2CG0A 1C7HA 2ZDJA 5BVBA 1US1A 4HM1B 1UCIA 4N3VA 3CCV3 2BHMA 1F8NA 3DGMA 1IV9A 5DREA 5LC6A 1YIT3 4U13A 2CFDA 3F40A 3CCR3 4MEIA 1CEWI 1B3SA 3EC9A 4HKVB 2QEX3 1RN1A 4WFOA 3FH1A 3DXOA 3HK4A 1CH0A 3QK9A 2K3DA 1NJI4 1RGKA 4Q53A 1B27A 1IVVA 2GBWB 3FG4A 4CJNA 4FR9A 1SIIA 3SX1A 3K5TA 5M19A 4EW5A 2K54A 1RLSA 1AVLA 3DZLA 1W6CA 1GMPA 2UX0A 3FF2A 4AKZA 3CCU3 1VQL3 1W6GA 3LOYA 1X1XA 2R4IA 2P0MA 7GSPA 1K8A4 1JZOA 3OV4A 4HM6B 1A2PA 3DMCA 2Y73A 4HYZA 2E2UA 1FA3A 1K28A 2F99A 3WHOA 1E3VA 1JN5B 4J5GA 1UUWB 4HM7B 4R9LA 1JBSA 1NB5I 1U5OA 3SEDA 1E97A 1RGGA 1W5ZA 2BT3A 3G4S3 3WMDA 1EEJA 1GOUA 1WMPA 3LYGA 1RN4A 1W6YA 4IT7A 1O7PB 3S28A 4R80A 1ZS7A 1I2GA 1RCKA 2D1WA 3NV0A 1RHLA 5HOHA 1JJ22 5IG0A 2XFSA 1O7NB 5EQLA 3CCE3 4N6NB 1GY6A 1UDII 1KWIA 1I70A 2QIYA 3LH4A 5CK6A 5AIGA 1FYSA 2KRTA 1SPUA 1W4NA 4FMCA 3B7CA 1D6UA 3F8HA 2CG1A 1SARA 3LTAA 2Y74A 1Q814 1UCKA 1O7GB 2CFWA 2GEYA 2P0XA 5GSPA 5CF2A 2IMJA 1RTUA 3EBTA 3EE1A 5AIIA 3FG1A 5FGOA 3S5CA 1BNRA 3ER7A 1LQMB 1YJW3 5ELJA 3DGOA 3NM7A 3SVAA 4N6V0 4GSPA 1O7HB 2P38A 5M18A 1FUWA 1M1XB 1RGFA 3G16A 3HOHA 4CPKA 4HJLB 2H0IA 3S67A 1AR0A 1QALA 4EBGA 4AKYA 3CCM3 1YIJ3 2IUKA 3EQQB 4XM4A 1MNLA 1TFOA 3JUMA 2CH9A 3G713 3CME3 3JVCA 1S723 3PGBA 4J9AA 1UUGB 2WO0A 1BIRA 1I0VA 1BSEA 2XEPA 3T8NA 2JDIH 1GD4A 3FF0A 4TX4A 1RN7A 5D83A 3N8BA 1BGSA 3VGNA 3WOFB 3MG3A 1BRHA 2WGQA 1FGOA 2CKFB 3UL5A 2FGTA 4R1KA 1ZGXA 3HIGA 3I0YA 3D4AA 1X1WA 4G1MB 3I553 1IDPA 4KFDA 5M1AA 1VQM3 3SOYA 3X3ZA 3FKAA 1W2B2 4J8TA 3KE7A 4XDVA 3CXC2 1IQXA 4LZIA 5G1KA 3BU4A 1OPYA 4BL3A 1RKYA 3WA3A 1TFKA 2YFIB 3PCRA 4KT3B 2W03A 2CWUA 2KF4A 1OGZA 2HOHA 2W0QA 2OQEC 1RGEA 1T2IA 4HZ9B 1NNVA 2INXA 1BSDA 3UB1A 2CWVA 3BIRA 3CNXA 1YI23 1LRAA 3DY5A 1I8VA 1Q40A 1IQ8A 3EHCA 1AVKA 1X1UA 1N5PA 3PS8A 1NWWA 9RNTA 1N5HA 3B4PA 3MYTA 3CD63 2A15A 3HX8A 1FUTA 4I5QA 4K1UA 2XGLA 1UGIA 1KQS2 3UNLA 3BNBA 4WYKA 3D5IA 2KF6A 3DGNA 2CFKA 3ZFZA 1VQ83 5CXOA 2HMMB 1D6ZA 1HU9A 2YFLB 2ZA4A 3BB9A 3H51A 3MWZA 4FCMA 4DKIA 2GU1A 3NQYA 2IUJA 1VQ53 1DMMA 2W56A 3E99A 1YNVX 1T3BA 3KZTA 4IPBA 5CLKA 2V1LA 4LYLB 1IVWA 4XBYA 1RJOA 3CU3A 3FSDA 1LOVA 5BIRA 5IG3A 1VQ93 1BNSA 1T2HA 2C11A 3FZWA 1E3RA 3JUPA 3ALAA 3K0ZA 1QJGA 3VF1A 2XF3A 2H0GA 1LOYA 3NUVA 3S29A 3FGYA 4X2HA 3CPOA 3LZAA 5IF6A 1JB5A 3JUOA 1Q824 1DVCA 2KAAA 3FG3A 1VQK3 3CNMA 4RNTA 1JBRA 3M8CA 3DGLA 4H3UA 4ZM8A 1C54A 4K90B 3GZXB 2ML5A 5IW9A 2UGIA 4MMZB 1I3IA 4MJDA 1W02A 3U97A 5AEWB 4FMBA 5STDA 1OHSA 1VQ73 1GSPA 2WGOA 3CCL3 1W01A 2P05A 1YJ93 3F14A 1BUQA 1BRKA 3PZWA 3WDGB 3BLZA 3X42A 5AYSC 3H3HA 2LQVA 1V57A 1YGWA 1MWTA 3ZG0A 3A76A 3KIIA 2CX1A 1MWRA 1TP6A 2L1SA 5HGRA 1GD3A 1TUHA 2XR8B 1EKMA 4RNYA 5JPUA 3OWYA 1BRGA 2BIRA 2KCDA 3GWRA 5AEUB 2JQ5A 3BNDA 2XSOB 1EUIC 3GAXA 1FGQA 4WWUC 2Q07A 2WOHA 3KSPA 1X1YA 1DMNA 3D9RA 4EYCA 4OUQA 2CC3A 1RCLA 1N9EA 3LTCA 3SLUA 5KP1A 4EV2A 1OACA 3LMLA 4LMIA 3KN4A 3OWSA 4HM5B 1KSIA 1G02A 1N9JA 1IQYA 2W9PA 4GHOA 2CFLA 5IG4A 1ZX2A 1JZDA 3GRDA 3CCQ3 3X41A 1UI8A 1BSBA 2I9WA 3NHXA 1BVIA 2BMRB 4J5KA 3NBBA 3SXXA 1IK3A 5D82A 4XBXA 1Q864 1I3FA 1FW7A 3L0RA 4FCJA 3F8XA 1BRIA 7STDA 4BTWA
chains in the Genus database with same CATH topology
3NV0B 1M1K4 4LSOA 4GL6A 4KFFA 2CIUA 4HM2B 3DM8A 4ORLA 4HM8B 3RGRA 1VZZA 1NB3I 3N54B 1OGXA 2WOFA 4HBRA 1WQLB 1VQN3 3D3LA 2GXFA 2E2TA 3Q2PA 3WOEB 2XSHB 1OH0A 3K9MC 1OHOA 3KKGA 2CFGA 1DMQA 4H61A 3X40A 3NM2A 1WMNA 2CWTA 2D42A 5TGNA 1U8CB 3IPTA 4LGQA 3K63A 5EEOA 4N6LA 3WA2X 2RSXA 2OTJ3 5A0OB 1ULJB 3RDEA 3AMOA 1WTHA 1FGRA 4HZBB 3G0KA 1T5YA 3NQZA 3N9HA 4KZ1A 2QA43 3EF8A 3UL6A 2Z6BA 1JRQA 2W6JH 1L5GB 4K61A 1OF5A 3UJMA 1VQ63 1IT8A 4EXRA 1NU3A 1STDA 3OW22 1JKGA 4HM4B 4FCZA 2O3OA 2PNCA 1LVNA 3EB8A 5JPPA 3OX9A 3HI7A 4OK0A 1YVBI 1M9GA 5DRVA 1VQP3 3Q90A 3CC23 1UI7A 2E2VA 2STDA 3JUNA 2OOVA 3U1WA 1AV4A 2MF7A 2QGUA 1ROVA 3F7SA 1ZO2A 1QMAA 1G96A 3EBYA 1IT7A 1OF5B 4RBNA 2SBLA 5EVHA 3VSYA 5CF1A 1GY7A 3MPHA 1GS3A 1KD14 4R4KA 3STDA 2W9QA 1SJWA 1Q40B 3GZYB 4FMDA 3CC43 3Q1CA 3TDGA 4O3VA 5IERA 4CCVA 4O8SA 2Z76A 4N6TA 3FCSB 1YGEA 2YX9A 2OTL3 4OVMA 2Z77A 1UW1A 2CK3H 1Y4KA 4WYKB 8CHOA 4IIAA 1K9M4 1EQKA 3IMAB 1SQWA 1NDOB 4FMAA 4QWTA 4XBTA 3ROBA 4PEJA 3RGAA 4LEHA 3I563 4GB5A 2B24B 6STDA 1SIHA 2MC8A 3CC73 4L7KA 1V74A 2ML6A 2W56B 4CDLA 4JRFA 4BTXA 3EN1B 1CYUA 1CYVA 5FW5A 1ASKA 2K0MA 1IVXA 1A90A 3EJVA 3X3XA 1JN5A 1LXEA 3HZPA 2XH9A 4RZMA 3NXJA 1S5AA 1FGMA 3FLJA 3MG1A 2RGQA 3O8YA 4HM3B 4R9KA 2P09A 5I97A 1QVG2 4BTYA 3T8UA 1ULIB 2OQEA 4KVHA 1A2KA 2M7OA 3LTBA 3BNEA 3OXAA 3HIIA 5D81A 1WMOA 1TIJA 1D6YA 2LYXA 3JUQA 3T0UA 5IENA 4N6OB 2Z7AA 3NBRA 1LNHA 3LTDA 3V92A 4EC6A 3EX9A 1KC84 4STDA 1JB4A 4O02B 2GU3A 1OHPA 2W04A 3DUKA 1LOXA 3LT9A 4MMXB 3CMA3 4JF8A 2RFRA 3KFQC 1RRHA 3SOAA 2HMKB 5IG5A 4XB5A 2HMLB 1J2BA 3GZBA 1NO3A 3CPW2 1OCVA 3B4OA 5AIHA 4HVNA 2XGNA 4N6UA 1YHQ3 3ECFA 2IA7A 5JBSA 1W7CA 3V98A 2OOVC 1R4CA 3MKIA 1Q7Y4 2XRXB 2BMOB 3J7Yd 2HMOB 1EG9B 1OUNA 1MOLA 3CCJ3 1Z1SA 5LC7A 3EN8A 1JB2A 2CHCA 2W2CA 4KFEA 4MMYB 2FXTA 1N8R4 1UUVB 1ROAA 1EA2A 1WNHA 3OWUA 4NREA 1GY5A 1A2VA 2F86B 1VQO3 3NBJA 2F98A 2BMQB 4L8PA 3PYJA 1YJN3 4N6MA 5AIFA 1K41A 1GYBA 4X2OA 3B8LA 3QRDA 2GBXB 1QVF2 4NHFA 1IVUA 4K1VA 4I4KA 1FGTA 2HMJB 1HKXA 1A67A 4WHAA 3S27A 1DVDA 3MG2A 1IV7A 3IJEB 3K7CA 2ZL8A 1PU4A 4XDWA 5AI1A 1M904 2RCDA 4EV5A 3AMOB 2YFJB 1STFI 2HMNB 1ISKA 5IEOA 1JNQA 1IU7A 2O9UX 2PZVA 4AEQA 3LXUX 3MHEA 2OCTA 4L8OA 2BO9B 3G6E3 1O7MB 2XFTA 3MSOA 1RRLA 1JKGB 3BNCA 1JV2B 5KP4A 1K734 1VQ43 1N8QA 1QAKA 5G2GA 2CW9A 2OWPA 1PFPA 2GEXA 1TU5A 5IEPA 1W00A 3F7XA 3LT8A 1O7WB 3V99A 3CCS3 4O2HA 3KSED 3G8ZA 5KP3A 4HM0B 5ELUA 2BNGA 3GZRA 4RNZA 1W2ZA 1DYUA 2FNQA 2C10A 3WODG 2L4VA 5BXQA 1CQSA 2B1XB 2KXGA 3NX0A 3F9SA 3X3YA 5AYRB 3PCSA 1Q42A 4WP5A 1QAFA 3PXMA 2CG0A 1C7HA 2ZDJA 5BVBA 1US1A 4HM1B 4N3VA 3CCV3 2BHMA 1F8NA 3DGMA 1IV9A 5DREA 5LC6A 1YIT3 4U13A 2CFDA 3F40A 3CCR3 4MEIA 1CEWI 3EC9A 4HKVB 2QEX3 4WFOA 3FH1A 3DXOA 3HK4A 3QK9A 1NJI4 4Q53A 1IVVA 2GBWB 3FG4A 4FR9A 1SIIA 3SX1A 3K5TA 2K54A 1AVLA 3DZLA 1W6CA 2UX0A 3FF2A 4AKZA 3CCU3 1VQL3 1W6GA 3LOYA 2R4IA 2P0MA 1K8A4 3OV4A 4HM6B 3DMCA 2Y73A 4HYZA 2E2UA 1FA3A 1K28A 2F99A 1E3VA 1JN5B 1UUWB 4HM7B 4R9LA 1NB5I 1U5OA 3SEDA 1E97A 2BT3A 1W5ZA 3G4S3 3WMDA 1WMPA 3LYGA 1W6YA 4IT7A 1O7PB 3S28A 4R80A 2D1WA 3NV0A 1JJ22 5IG0A 2XFSA 1O7NB 5EQLA 3CCE3 4N6NB 1GY6A 1KWIA 2QIYA 3LH4A 5CK6A 5AIGA 2KRTA 1SPUA 1W4NA 4FMCA 3B7CA 1D6UA 3F8HA 2CG1A 3LTAA 2Y74A 1Q814 2CFWA 1O7GB 2GEYA 2P0XA 5CF2A 2IMJA 5FGOA 3EBTA 3EE1A 5AIIA 3FG1A 3S5CA 3ER7A 1YJW3 5ELJA 3DGOA 3NM7A 3SVAA 4N6V0 1O7HB 2P38A 1FUWA 1M1XB 3G16A 4HJLB 3S67A 1AR0A 1QALA 4EBGA 4AKYA 3CCM3 1YIJ3 2IUKA 3EQQB 4XM4A 1MNLA 1TFOA 3JUMA 2CH9A 3G713 3CME3 3JVCA 1S723 3PGBA 4J9AA 2WO0A 2XEPA 3T8NA 2JDIH 1GD4A 3FF0A 4TX4A 1RN7A 5D83A 3N8BA 3VGNA 3WOFB 3MG3A 2WGQA 1FGOA 2CKFB 3UL5A 2FGTA 4R1KA 3HIGA 3I0YA 4G1MB 3I553 1IDPA 4KFDA 1VQM3 3SOYA 3X3ZA 3FKAA 1W2B2 4J8TA 3KE7A 4XDVA 3CXC2 1IQXA 4LZIA 1RKYA 1OPYA 3WA3A 1TFKA 2YFIB 3PCRA 2W03A 2CWUA 4HZ9B 1OGZA 2W0QA 2OQEC 2INXA 3UB1A 2CWVA 3CNXA 1YI23 3DY5A 1Q40A 1IQ8A 3EHCA 1AVKA 1N5PA 3PS8A 1NWWA 1N5HA 3B4PA 3MYTA 3CD63 2A15A 3HX8A 4K1UA 2XGLA 1KQS2 3UNLA 3BNBA 4WYKA 3DGNA 2CFKA 1VQ83 5CXOA 2HMMB 1D6ZA 1HU9A 2YFLB 3BB9A 3H51A 3MWZA 4FCMA 2GU1A 3NQYA 2IUJA 1VQ53 1DMMA 2W56A 3E99A 3KZTA 4IPBA 5CLKA 2V1LA 4XBYA 1IVWA 1RJOA 3CU3A 3FSDA 5IG3A 1VQ93 2C11A 3FZWA 1E3RA 3JUPA 3ALAA 3K0ZA 1QJGA 3VF1A 2XF3A 3NUVA 3S29A 3FGYA 4X2HA 3CPOA 3LZAA 5IF6A 1JB5A 3JUOA 1Q824 1DVCA 3FG3A 1VQK3 3CNMA 3M8CA 3DGLA 4H3UA 4ZM8A 4K90B 3GZXB 2ML5A 5IW9A 4MMZB 4MJDA 1W02A 3U97A 5AEWB 4FMBA 5STDA 1OHSA 1VQ73 2WGOA 3CCL3 1W01A 2P05A 1YJ93 3F14A 1BUQA 3PZWA 3WDGB 3BLZA 3X42A 5AYSC 3H3HA 2LQVA 3A76A 3KIIA 1TP6A 5HGRA 1GD3A 1TUHA 2XR8B 1EKMA 4RNYA 5JPUA 3OWYA 5AEUB 2KCDA 3GWRA 2JQ5A 3BNDA 2XSOB 3GAXA 1FGQA 4WWUC 2Q07A 2WOHA 3KSPA 3D9RA 1DMNA 4EYCA 4OUQA 2CC3A 1N9EA 3LTCA 3SLUA 5KP1A 4EV2A 1OACA 3LMLA 4LMIA 3KN4A 3OWSA 4HM5B 1KSIA 1N9JA 2W9PA 1IQYA 5IG4A 2CFLA 1ZX2A 3GRDA 3CCQ3 3X41A 1UI8A 3NHXA 2I9WA 2BMRB 3NBBA 3SXXA 1IK3A 5D82A 4XBXA 1Q864 3L0RA 4FCJA 3F8XA 7STDA 4BTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFK A;  1TFO A;  1V74 A; 
#chains in the Genus database with same CATH topology
 1QVG 2;  3NV0 B;  1M1K 4;  4LSO A;  4GL6 A;  4KFF A;  2CIU A;  1TRP A;  4HM2 B;  3DM8 A;  4ORL A;  4HM8 B;  1JBT A;  3RGR A;  1VZZ A;  1BUJ A;  1NB3 I;  2R41 A;  3N54 B;  1OGX A;  2WOF A;  4HBR A;  1WQL B;  3AHW A;  1VQN 3;  3D3L A;  2GXF A;  3D79 A;  3SYU A;  1B20 A;  3AGO A;  2E2T A;  3Q2P A;  3WOE B;  2XSH B;  1OH0 A;  3K9M C;  1OHO A;  3KKG A;  2CFG A;  1DMQ A;  4H61 A;  1AY7 A;  3X40 A;  3NM2 A;  1WMN A;  2CWT A;  2D42 A;  2F4Y A;  5TGN A;  3URP A;  1U8C B;  3IPT A;  4LGQ A;  3K63 A;  5EEO A;  4N6L A;  3WA2 X;  2RSX A;  2OTJ 3;  5A0O B;  1ULJ B;  3RDE A;  3AMO A;  1WTH A;  1FGR A;  1GMR A;  3DGY A;  3G0K A;  1T5Y A;  4HZB B;  3NQZ A;  3N9H A;  4KZ1 A;  2QA4 3;  3EF8 A;  3UL6 A;  6RNT A;  2Z6B A;  1JRQ A;  2W6J H;  1L5G B;  4K61 A;  1OF5 A;  3UJM A;  1VQ6 3;  1IT8 A;  4EXR A;  1NU3 A;  1STD A;  3OW2 2;  1JKG A;  4HM4 B;  1RSN A;  4FCZ A;  4BL2 A;  2O3O A;  2PNC A;  1LVN A;  3A5E A;  2IY2 A;  1AQZ A;  1B2U A;  3EB8 A;  2KF5 A;  7RNT A;  5JPP A;  3OX9 A;  3HI7 A;  4OK0 A;  1YVB I;  1M9G A;  5DRV A;  1VQP 3;  3Q90 A;  3CC2 3;  1UI7 A;  2E2V A;  2STD A;  3JUN A;  2OOV A;  3D5G A;  3U1W A;  1AV4 A;  1I0X A;  2MF7 A;  2QGU A;  1BNF A;  1ROV A;  3F7S A;  1HZ1 A;  1DE3 A;  1ZO2 A;  1QMA A;  1G96 A;  3EBY A;  1IT7 A;  1OF5 B;  4RBN A;  2SBL A;  5EVH A;  1MGR A;  3VSY A;  1LOW A;  1TTO A;  1GY7 A;  2ZHX B;  3MPH A;  1GS3 A;  2SAR A;  1KD1 4;  1VQQ A;  4R4K A;  3STD A;  2W9Q A;  1SJW A;  1FZU A;  1Q40 B;  3GZY B;  4FMD A;  5BU4 A;  1RNT A;  3Q1C A;  3CC4 3;  3TDG A;  4O3V A;  5IER A;  4CCV A;  4O8S A;  2Z76 A;  1RMS A;  2F5W A;  4N6T A;  3FCS B;  1YGE A;  2YX9 A;  2OTL 3;  1V58 A;  4OVM A;  2Z77 A;  1UW1 A;  2CK3 H;  1Y4K A;  1B2X A;  4WYK B;  8CHO A;  4IIA A;  1K9M 4;  1EQK A;  3IMA B;  1SQW A;  1NDO B;  4FMA A;  4QWT A;  4XBT A;  1RDS A;  2GSP A;  4PEJ A;  1FUS A;  3ROB A;  3RGA A;  4LEH A;  3I56 3;  4GB5 A;  4HOH A;  2B24 B;  1PYL A;  6STD A;  2UUG C;  1SIH A;  2MC8 A;  1RGH A;  3CC7 3;  4L7K A;  1V74 A;  2ML6 A;  2RNT A;  2W56 B;  4CDL A;  4JRF A;  2IYJ A;  4BTX A;  1G0T A;  3EN1 B;  1BRS A;  1CYU A;  1CYV A;  5FW5 A;  1BSC A;  2F56 A;  1BNJ A;  2AAD A;  2C4B A;  1ASK A;  2K0M A;  1IVX A;  1A90 A;  3EJV A;  3X3X A;  1JN5 A;  1LXE A;  3HZP A;  6GSP A;  2XH9 A;  4RZM A;  1BNG A;  3NXJ A;  1S5A A;  1FGM A;  3FLJ A;  3MG1 A;  1RGA A;  2RGQ A;  3O8Y A;  4HM3 B;  4R9K A;  2P09 A;  4BU4 A;  5I97 A;  4BTY A;  3T8U A;  1ULI B;  2J8X B;  4KVH A;  1A2K A;  2M7O A;  3LTB A;  2OQE A;  3BNE A;  1MWU A;  3OXA A;  1RNB A;  2AAE A;  1LNI A;  2CX0 A;  3HII A;  5D81 A;  1WMO A;  1TIJ A;  1D6Y A;  2LYX A;  3JUQ A;  3T0U A;  5IEN A;  4N6O B;  2F5M A;  2Z7A A;  3NBR A;  1LNH A;  3LTD A;  3V92 A;  4EC6 A;  3EX9 A;  1KC8 4;  4STD A;  1JB4 A;  4O02 B;  1BAO A;  2GU3 A;  1OHP A;  1PY3 A;  1UCJ A;  2W04 A;  3DUK A;  3RNT A;  1LOX A;  1BSA A;  3LT9 A;  4MMX B;  1B2M A;  1TRQ A;  3CMA 3;  1IYY A;  4JF8 A;  2RFR A;  1MGW A;  3KFQ C;  1RRH A;  3SOA A;  2HMK B;  5IG5 A;  4XB5 A;  2HML B;  1J2B A;  1Q7H A;  3GZB A;  1NO3 A;  3CPW 2;  1OCV A;  3B4O A;  5AIH A;  4HVN A;  2XGN A;  4N6U A;  1YHQ 3;  3ECF A;  2IA7 A;  5JBS A;  3ZG5 A;  1W7C A;  3V98 A;  2OOV C;  1R4C A;  2BU4 A;  3MKI A;  2XRX B;  1Q7Y 4;  2BMO B;  3J7Y d;  1BNE A;  1BU4 A;  1EG9 B;  2HMO B;  3KCH A;  1OUN A;  1GOV A;  1MOL A;  3CCJ 3;  1Z1S A;  1GMQ A;  5LC7 A;  3EN8 A;  1GOY A;  1JB2 A;  2CHC A;  1B21 A;  2W2C A;  3WR2 A;  4HAA A;  4KFE A;  4MMY B;  2FXT A;  1MWS A;  3AHS A;  1N8R 4;  1RGL A;  1UUV B;  1ROA A;  1EA2 A;  1WNH A;  3OWU A;  1BNI A;  4NRE A;  1GY5 A;  1A2V A;  2F86 B;  4NPB A;  3NBJ A;  1VQO 3;  3Q3F A;  2F98 A;  5RNT A;  1I2F A;  2BMQ B;  4L8P A;  3PYJ A;  1YJN 3;  4N6M A;  5AIF A;  1K41 A;  1GYB A;  4ILF A;  4X2O A;  1UGH I;  3B8L A;  3QRD A;  2GBX B;  1Q9E A;  1HYF A;  1QVF 2;  4NHF A;  1IVU A;  4K1V A;  4I4K A;  1UCL A;  1FGT A;  1YVS A;  2HMJ B;  1HKX A;  1A67 A;  4WHA A;  3S27 A;  1DVD A;  3MG2 A;  1IV7 A;  2H0H A;  3IJE B;  3K7C A;  2ZL8 A;  1PU4 A;  4XDW A;  5AI1 A;  1M90 4;  2RCD A;  4EV5 A;  2HMN B;  1STF I;  2YFJ B;  3AMO B;  1TJD A;  3DH2 A;  5IEO A;  1JNQ A;  1IU7 A;  2O9U X;  1BRN L;  1ISK A;  1BOX A;  2PZV A;  2RBI A;  1B2S A;  3LXU X;  4AEQ A;  3MHE A;  2OCT A;  4L8O A;  2BO9 B;  8RNT A;  3G6E 3;  5CF1 A;  1BAN A;  1O7M B;  2XFT A;  3MSO A;  1RRL A;  1JKG B;  3BNC A;  3GSP A;  1JV2 B;  4BIR A;  5KP4 A;  1K73 4;  1VQ4 3;  1N8Q A;  1QAK A;  5G2G A;  2CW9 A;  1BRJ A;  1PFP A;  2OWP A;  2GEX A;  1TU5 A;  5IEP A;  1W00 A;  3F7X A;  3LT8 A;  1O7W B;  3AGN A;  3V99 A;  3CCS 3;  4O2H A;  3KSE D;  1RGC A;  3G8Z A;  5KP3 A;  1B2Z A;  4HM0 B;  5ELU A;  5G1L A;  2BNG A;  2KF3 A;  3GZR A;  4RNZ A;  1W2Z A;  1DYU A;  1LQG C;  2C10 A;  2FNQ A;  2L4V A;  3WOD G;  5BXQ A;  1CQS A;  1I2E A;  1R4Y A;  1DET A;  2B1X B;  2KXG A;  3F9S A;  3NX0 A;  5AYR B;  3PCS A;  1Q42 A;  4WP5 A;  1QAF A;  3X3Y A;  3PXM A;  2CG0 A;  1C7H A;  2ZDJ A;  5BVB A;  1US1 A;  4HM1 B;  1UCI A;  4N3V A;  3CCV 3;  2BHM A;  1F8N A;  3DGM A;  1IV9 A;  5DRE A;  5LC6 A;  1YIT 3;  4U13 A;  2CFD A;  3F40 A;  3CCR 3;  4MEI A;  1CEW I;  1B3S A;  3EC9 A;  4HKV B;  2QEX 3;  1RN1 A;  4WFO A;  3FH1 A;  3DXO A;  3HK4 A;  1CH0 A;  3QK9 A;  2K3D A;  1NJI 4;  1RGK A;  4Q53 A;  1B27 A;  1IVV A;  2GBW B;  3FG4 A;  4CJN A;  4FR9 A;  1SII A;  3SX1 A;  3K5T A;  5M19 A;  4EW5 A;  2K54 A;  1RLS A;  1AVL A;  3DZL A;  1W6C A;  1GMP A;  2UX0 A;  3FF2 A;  4AKZ A;  3CCU 3;  1VQL 3;  1W6G A;  3LOY A;  1X1X A;  2R4I A;  2P0M A;  7GSP A;  1K8A 4;  1JZO A;  3OV4 A;  4HM6 B;  1A2P A;  3DMC A;  2Y73 A;  4HYZ A;  2E2U A;  1FA3 A;  1K28 A;  2F99 A;  3WHO A;  1E3V A;  1JN5 B;  4J5G A;  1UUW B;  4HM7 B;  4R9L A;  1JBS A;  1NB5 I;  1U5O A;  3SED A;  1E97 A;  1RGG A;  1W5Z A;  2BT3 A;  3G4S 3;  3WMD A;  1EEJ A;  1GOU A;  1WMP A;  3LYG A;  1RN4 A;  1W6Y A;  4IT7 A;  1O7P B;  3S28 A;  4R80 A;  1ZS7 A;  1I2G A;  1RCK A;  2D1W A;  3NV0 A;  1RHL A;  5HOH A;  1JJ2 2;  5IG0 A;  2XFS A;  1O7N B;  5EQL A;  3CCE 3;  4N6N B;  1GY6 A;  1UDI I;  1KWI A;  1I70 A;  2QIY A;  3LH4 A;  5CK6 A;  5AIG A;  1FYS A;  2KRT A;  1SPU A;  1W4N A;  4FMC A;  3B7C A;  1D6U A;  3F8H A;  2CG1 A;  1SAR A;  3LTA A;  2Y74 A;  1Q81 4;  1UCK A;  1O7G B;  2CFW A;  2GEY A;  2P0X A;  5GSP A;  5CF2 A;  2IMJ A;  1RTU A;  3EBT A;  3EE1 A;  5AII A;  3FG1 A;  5FGO A;  3S5C A;  1BNR A;  3ER7 A;  1LQM B;  1YJW 3;  5ELJ A;  3DGO A;  3NM7 A;  3SVA A;  4N6V 0;  4GSP A;  1O7H B;  2P38 A;  5M18 A;  1FUW A;  1M1X B;  1RGF A;  3G16 A;  3HOH A;  4CPK A;  4HJL B;  2H0I A;  3S67 A;  1AR0 A;  1QAL A;  4EBG A;  4AKY A;  3CCM 3;  1YIJ 3;  2IUK A;  3EQQ B;  4XM4 A;  1MNL A;  1TFO A;  3JUM A;  2CH9 A;  3G71 3;  3CME 3;  3JVC A;  1S72 3;  3PGB A;  4J9A A;  1UUG B;  2WO0 A;  1BIR A;  1I0V A;  1BSE A;  2XEP A;  3T8N A;  2JDI H;  1GD4 A;  3FF0 A;  4TX4 A;  1RN7 A;  5D83 A;  3N8B A;  1BGS A;  3VGN A;  3WOF B;  3MG3 A;  1BRH A;  2WGQ A;  1FGO A;  2CKF B;  3UL5 A;  2FGT A;  4R1K A;  1ZGX A;  3HIG A;  3I0Y A;  3D4A A;  1X1W A;  4G1M B;  3I55 3;  1IDP A;  4KFD A;  5M1A A;  1VQM 3;  3SOY A;  3X3Z A;  3FKA A;  1W2B 2;  4J8T A;  3KE7 A;  4XDV A;  3CXC 2;  1IQX A;  4LZI A;  5G1K A;  3BU4 A;  1OPY A;  4BL3 A;  1RKY A;  3WA3 A;  1TFK A;  2YFI B;  3PCR A;  4KT3 B;  2W03 A;  2CWU A;  2KF4 A;  1OGZ A;  2HOH A;  2W0Q A;  2OQE C;  1RGE A;  1T2I A;  4HZ9 B;  1NNV A;  2INX A;  1BSD A;  3UB1 A;  2CWV A;  3BIR A;  3CNX A;  1YI2 3;  1LRA A;  3DY5 A;  1I8V A;  1Q40 A;  1IQ8 A;  3EHC A;  1AVK A;  1X1U A;  1N5P A;  3PS8 A;  1NWW A;  9RNT A;  1N5H A;  3B4P A;  3MYT A;  3CD6 3;  2A15 A;  3HX8 A;  1FUT A;  4I5Q A;  4K1U A;  2XGL A;  1UGI A;  1KQS 2;  3UNL A;  3BNB A;  4WYK A;  3D5I A;  2KF6 A;  3DGN A;  2CFK A;  3ZFZ A;  1VQ8 3;  5CXO A;  2HMM B;  1D6Z A;  1HU9 A;  2YFL B;  2ZA4 A;  3BB9 A;  3H51 A;  3MWZ A;  4FCM A;  4DKI A;  2GU1 A;  3NQY A;  2IUJ A;  1VQ5 3;  1DMM A;  2W56 A;  3E99 A;  1YNV X;  1T3B A;  3KZT A;  4IPB A;  5CLK A;  2V1L A;  4LYL B;  1IVW A;  4XBY A;  1RJO A;  3CU3 A;  3FSD A;  1LOV A;  5BIR A;  5IG3 A;  1VQ9 3;  1BNS A;  1T2H A;  2C11 A;  3FZW A;  1E3R A;  3JUP A;  3ALA A;  3K0Z A;  1QJG A;  3VF1 A;  2XF3 A;  2H0G A;  1LOY A;  3NUV A;  3S29 A;  3FGY A;  4X2H A;  3CPO A;  3LZA A;  5IF6 A;  1JB5 A;  3JUO A;  1Q82 4;  1DVC A;  2KAA A;  3FG3 A;  1VQK 3;  3CNM A;  4RNT A;  1JBR A;  3M8C A;  3DGL A;  4H3U A;  4ZM8 A;  1C54 A;  4K90 B;  3GZX B;  2ML5 A;  5IW9 A;  2UGI A;  4MMZ B;  1I3I A;  4MJD A;  1W02 A;  3U97 A;  5AEW B;  4FMB A;  5STD A;  1OHS A;  1VQ7 3;  1GSP A;  2WGO A;  3CCL 3;  1W01 A;  2P05 A;  1YJ9 3;  3F14 A;  1BUQ A;  1BRK A;  3PZW A;  3WDG B;  3BLZ A;  3X42 A;  5AYS C;  3H3H A;  2LQV A;  1V57 A;  1YGW A;  1MWT A;  3ZG0 A;  3A76 A;  3KII A;  2CX1 A;  1MWR A;  1TP6 A;  2L1S A;  5HGR A;  1GD3 A;  1TUH A;  2XR8 B;  1EKM A;  4RNY A;  5JPU A;  3OWY A;  1BRG A;  2BIR A;  2KCD A;  3GWR A;  5AEU B;  2JQ5 A;  3BND A;  2XSO B;  1EUI C;  3GAX A;  1FGQ A;  4WWU C;  2Q07 A;  2WOH A;  3KSP A;  1X1Y A;  1DMN A;  3D9R A;  4EYC A;  4OUQ A;  2CC3 A;  1RCL A;  1N9E A;  3LTC A;  3SLU A;  5KP1 A;  4EV2 A;  1OAC A;  3LML A;  4LMI A;  3KN4 A;  3OWS A;  4HM5 B;  1KSI A;  1G02 A;  1N9J A;  1IQY A;  2W9P A;  4GHO A;  2CFL A;  5IG4 A;  1ZX2 A;  1JZD A;  3GRD A;  3CCQ 3;  3X41 A;  1UI8 A;  1BSB A;  2I9W A;  3NHX A;  1BVI A;  2BMR B;  4J5K A;  3NBB A;  3SXX A;  1IK3 A;  5D82 A;  4XBX A;  1Q86 4;  1I3F A;  1FW7 A;  3L0R A;  4FCJ A;  3F8X A;  1BRI A;  7STD A;  4BTW A; 
#chains in the Genus database with same CATH homology
 3NV0 B;  1M1K 4;  4LSO A;  4GL6 A;  4KFF A;  2CIU A;  4HM2 B;  3DM8 A;  4ORL A;  4HM8 B;  3RGR A;  1VZZ A;  1NB3 I;  3N54 B;  1OGX A;  2WOF A;  4HBR A;  1WQL B;  1VQN 3;  3D3L A;  2GXF A;  2E2T A;  3Q2P A;  3WOE B;  2XSH B;  1OH0 A;  3K9M C;  1OHO A;  3KKG A;  2CFG A;  1DMQ A;  4H61 A;  3X40 A;  3NM2 A;  1WMN A;  2CWT A;  2D42 A;  5TGN A;  1U8C B;  3IPT A;  4LGQ A;  3K63 A;  5EEO A;  4N6L A;  3WA2 X;  2RSX A;  2OTJ 3;  5A0O B;  1ULJ B;  3RDE A;  3AMO A;  1WTH A;  1FGR A;  4HZB B;  3G0K A;  1T5Y A;  3NQZ A;  3N9H A;  4KZ1 A;  2QA4 3;  3EF8 A;  3UL6 A;  2Z6B A;  1JRQ A;  2W6J H;  1L5G B;  4K61 A;  1OF5 A;  3UJM A;  1VQ6 3;  1IT8 A;  4EXR A;  1NU3 A;  1STD A;  3OW2 2;  1JKG A;  4HM4 B;  4FCZ A;  2O3O A;  2PNC A;  1LVN A;  3EB8 A;  5JPP A;  3OX9 A;  3HI7 A;  4OK0 A;  1YVB I;  1M9G A;  5DRV A;  1VQP 3;  3Q90 A;  3CC2 3;  1UI7 A;  2E2V A;  2STD A;  3JUN A;  2OOV A;  3U1W A;  1AV4 A;  2MF7 A;  2QGU A;  1ROV A;  3F7S A;  1ZO2 A;  1QMA A;  1G96 A;  3EBY A;  1IT7 A;  1OF5 B;  4RBN A;  2SBL A;  5EVH A;  3VSY A;  5CF1 A;  1GY7 A;  3MPH A;  1GS3 A;  1KD1 4;  4R4K A;  3STD A;  2W9Q A;  1SJW A;  1Q40 B;  3GZY B;  4FMD A;  3CC4 3;  3Q1C A;  3TDG A;  4O3V A;  5IER A;  4CCV A;  4O8S A;  2Z76 A;  4N6T A;  3FCS B;  1YGE A;  2YX9 A;  2OTL 3;  4OVM A;  2Z77 A;  1UW1 A;  2CK3 H;  1Y4K A;  4WYK B;  8CHO A;  4IIA A;  1K9M 4;  1EQK A;  3IMA B;  1SQW A;  1NDO B;  4FMA A;  4QWT A;  4XBT A;  3ROB A;  4PEJ A;  3RGA A;  4LEH A;  3I56 3;  4GB5 A;  2B24 B;  6STD A;  1SIH A;  2MC8 A;  3CC7 3;  4L7K A;  1V74 A;  2ML6 A;  2W56 B;  4CDL A;  4JRF A;  4BTX A;  3EN1 B;  1CYU A;  1CYV A;  5FW5 A;  1ASK A;  2K0M A;  1IVX A;  1A90 A;  3EJV A;  3X3X A;  1JN5 A;  1LXE A;  3HZP A;  2XH9 A;  4RZM A;  3NXJ A;  1S5A A;  1FGM A;  3FLJ A;  3MG1 A;  2RGQ A;  3O8Y A;  4HM3 B;  4R9K A;  2P09 A;  5I97 A;  1QVG 2;  4BTY A;  3T8U A;  1ULI B;  2OQE A;  4KVH A;  1A2K A;  2M7O A;  3LTB A;  3BNE A;  3OXA A;  3HII A;  5D81 A;  1WMO A;  1TIJ A;  1D6Y A;  2LYX A;  3JUQ A;  3T0U A;  5IEN A;  4N6O B;  2Z7A A;  3NBR A;  1LNH A;  3LTD A;  3V92 A;  4EC6 A;  3EX9 A;  1KC8 4;  4STD A;  1JB4 A;  4O02 B;  2GU3 A;  1OHP A;  2W04 A;  3DUK A;  1LOX A;  3LT9 A;  4MMX B;  3CMA 3;  4JF8 A;  2RFR A;  3KFQ C;  1RRH A;  3SOA A;  2HMK B;  5IG5 A;  4XB5 A;  2HML B;  1J2B A;  3GZB A;  1NO3 A;  3CPW 2;  1OCV A;  3B4O A;  5AIH A;  4HVN A;  2XGN A;  4N6U A;  1YHQ 3;  3ECF A;  2IA7 A;  5JBS A;  1W7C A;  3V98 A;  2OOV C;  1R4C A;  3MKI A;  1Q7Y 4;  2XRX B;  2BMO B;  3J7Y d;  2HMO B;  1EG9 B;  1OUN A;  1MOL A;  3CCJ 3;  1Z1S A;  5LC7 A;  3EN8 A;  1JB2 A;  2CHC A;  2W2C A;  4KFE A;  4MMY B;  2FXT A;  1N8R 4;  1UUV B;  1ROA A;  1EA2 A;  1WNH A;  3OWU A;  4NRE A;  1GY5 A;  1A2V A;  2F86 B;  1VQO 3;  3NBJ A;  2F98 A;  2BMQ B;  4L8P A;  3PYJ A;  1YJN 3;  4N6M A;  5AIF A;  1K41 A;  1GYB A;  4X2O A;  3B8L A;  3QRD A;  2GBX B;  1QVF 2;  4NHF A;  1IVU A;  4K1V A;  4I4K A;  1FGT A;  2HMJ B;  1HKX A;  1A67 A;  4WHA A;  3S27 A;  1DVD A;  3MG2 A;  1IV7 A;  3IJE B;  3K7C A;  2ZL8 A;  1PU4 A;  4XDW A;  5AI1 A;  1M90 4;  2RCD A;  4EV5 A;  3AMO B;  2YFJ B;  1STF I;  2HMN B;  1ISK A;  5IEO A;  1JNQ A;  1IU7 A;  2O9U X;  2PZV A;  4AEQ A;  3LXU X;  3MHE A;  2OCT A;  4L8O A;  2BO9 B;  3G6E 3;  1O7M B;  2XFT A;  3MSO A;  1RRL A;  1JKG B;  3BNC A;  1JV2 B;  5KP4 A;  1K73 4;  1VQ4 3;  1N8Q A;  1QAK A;  5G2G A;  2CW9 A;  2OWP A;  1PFP A;  2GEX A;  1TU5 A;  5IEP A;  1W00 A;  3F7X A;  3LT8 A;  1O7W B;  3V99 A;  3CCS 3;  4O2H A;  3KSE D;  3G8Z A;  5KP3 A;  4HM0 B;  5ELU A;  2BNG A;  3GZR A;  4RNZ A;  1W2Z A;  1DYU A;  2FNQ A;  2C10 A;  3WOD G;  2L4V A;  5BXQ A;  1CQS A;  2B1X B;  2KXG A;  3NX0 A;  3F9S A;  3X3Y A;  5AYR B;  3PCS A;  1Q42 A;  4WP5 A;  1QAF A;  3PXM A;  2CG0 A;  1C7H A;  2ZDJ A;  5BVB A;  1US1 A;  4HM1 B;  4N3V A;  3CCV 3;  2BHM A;  1F8N A;  3DGM A;  1IV9 A;  5DRE A;  5LC6 A;  1YIT 3;  4U13 A;  2CFD A;  3F40 A;  3CCR 3;  4MEI A;  1CEW I;  3EC9 A;  4HKV B;  2QEX 3;  4WFO A;  3FH1 A;  3DXO A;  3HK4 A;  3QK9 A;  1NJI 4;  4Q53 A;  1IVV A;  2GBW B;  3FG4 A;  4FR9 A;  1SII A;  3SX1 A;  3K5T A;  2K54 A;  1AVL A;  3DZL A;  1W6C A;  2UX0 A;  3FF2 A;  4AKZ A;  3CCU 3;  1VQL 3;  1W6G A;  3LOY A;  2R4I A;  2P0M A;  1K8A 4;  3OV4 A;  4HM6 B;  3DMC A;  2Y73 A;  4HYZ A;  2E2U A;  1FA3 A;  1K28 A;  2F99 A;  1E3V A;  1JN5 B;  1UUW B;  4HM7 B;  4R9L A;  1NB5 I;  1U5O A;  3SED A;  1E97 A;  2BT3 A;  1W5Z A;  3G4S 3;  3WMD A;  1WMP A;  3LYG A;  1W6Y A;  4IT7 A;  1O7P B;  3S28 A;  4R80 A;  2D1W A;  3NV0 A;  1JJ2 2;  5IG0 A;  2XFS A;  1O7N B;  5EQL A;  3CCE 3;  4N6N B;  1GY6 A;  1KWI A;  2QIY A;  3LH4 A;  5CK6 A;  5AIG A;  2KRT A;  1SPU A;  1W4N A;  4FMC A;  3B7C A;  1D6U A;  3F8H A;  2CG1 A;  3LTA A;  2Y74 A;  1Q81 4;  2CFW A;  1O7G B;  2GEY A;  2P0X A;  5CF2 A;  2IMJ A;  5FGO A;  3EBT A;  3EE1 A;  5AII A;  3FG1 A;  3S5C A;  3ER7 A;  1YJW 3;  5ELJ A;  3DGO A;  3NM7 A;  3SVA A;  4N6V 0;  1O7H B;  2P38 A;  1FUW A;  1M1X B;  3G16 A;  4HJL B;  3S67 A;  1AR0 A;  1QAL A;  4EBG A;  4AKY A;  3CCM 3;  1YIJ 3;  2IUK A;  3EQQ B;  4XM4 A;  1MNL A;  1TFO A;  3JUM A;  2CH9 A;  3G71 3;  3CME 3;  3JVC A;  1S72 3;  3PGB A;  4J9A A;  2WO0 A;  2XEP A;  3T8N A;  2JDI H;  1GD4 A;  3FF0 A;  4TX4 A;  1RN7 A;  5D83 A;  3N8B A;  3VGN A;  3WOF B;  3MG3 A;  2WGQ A;  1FGO A;  2CKF B;  3UL5 A;  2FGT A;  4R1K A;  3HIG A;  3I0Y A;  4G1M B;  3I55 3;  1IDP A;  4KFD A;  1VQM 3;  3SOY A;  3X3Z A;  3FKA A;  1W2B 2;  4J8T A;  3KE7 A;  4XDV A;  3CXC 2;  1IQX A;  4LZI A;  1RKY A;  1OPY A;  3WA3 A;  1TFK A;  2YFI B;  3PCR A;  2W03 A;  2CWU A;  4HZ9 B;  1OGZ A;  2W0Q A;  2OQE C;  2INX A;  3UB1 A;  2CWV A;  3CNX A;  1YI2 3;  3DY5 A;  1Q40 A;  1IQ8 A;  3EHC A;  1AVK A;  1N5P A;  3PS8 A;  1NWW A;  1N5H A;  3B4P A;  3MYT A;  3CD6 3;  2A15 A;  3HX8 A;  4K1U A;  2XGL A;  1KQS 2;  3UNL A;  3BNB A;  4WYK A;  3DGN A;  2CFK A;  1VQ8 3;  5CXO A;  2HMM B;  1D6Z A;  1HU9 A;  2YFL B;  3BB9 A;  3H51 A;  3MWZ A;  4FCM A;  2GU1 A;  3NQY A;  2IUJ A;  1VQ5 3;  1DMM A;  2W56 A;  3E99 A;  3KZT A;  4IPB A;  5CLK A;  2V1L A;  4XBY A;  1IVW A;  1RJO A;  3CU3 A;  3FSD A;  5IG3 A;  1VQ9 3;  2C11 A;  3FZW A;  1E3R A;  3JUP A;  3ALA A;  3K0Z A;  1QJG A;  3VF1 A;  2XF3 A;  3NUV A;  3S29 A;  3FGY A;  4X2H A;  3CPO A;  3LZA A;  5IF6 A;  1JB5 A;  3JUO A;  1Q82 4;  1DVC A;  3FG3 A;  1VQK 3;  3CNM A;  3M8C A;  3DGL A;  4H3U A;  4ZM8 A;  4K90 B;  3GZX B;  2ML5 A;  5IW9 A;  4MMZ B;  4MJD A;  1W02 A;  3U97 A;  5AEW B;  4FMB A;  5STD A;  1OHS A;  1VQ7 3;  2WGO A;  3CCL 3;  1W01 A;  2P05 A;  1YJ9 3;  3F14 A;  1BUQ A;  3PZW A;  3WDG B;  3BLZ A;  3X42 A;  5AYS C;  3H3H A;  2LQV A;  3A76 A;  3KII A;  1TP6 A;  5HGR A;  1GD3 A;  1TUH A;  2XR8 B;  1EKM A;  4RNY A;  5JPU A;  3OWY A;  5AEU B;  2KCD A;  3GWR A;  2JQ5 A;  3BND A;  2XSO B;  3GAX A;  1FGQ A;  4WWU C;  2Q07 A;  2WOH A;  3KSP A;  3D9R A;  1DMN A;  4EYC A;  4OUQ A;  2CC3 A;  1N9E A;  3LTC A;  3SLU A;  5KP1 A;  4EV2 A;  1OAC A;  3LML A;  4LMI A;  3KN4 A;  3OWS A;  4HM5 B;  1KSI A;  1N9J A;  2W9P A;  1IQY A;  5IG4 A;  2CFL A;  1ZX2 A;  3GRD A;  3CCQ 3;  3X41 A;  1UI8 A;  3NHX A;  2I9W A;  2BMR B;  3NBB A;  3SXX A;  1IK3 A;  5D82 A;  4XBX A;  1Q86 4;  3L0R A;  4FCJ A;  3F8X A;  7STD A;  4BTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...