1TFOA

Ribonuclease from escherichia coli complexed with its inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
LDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin D
publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tfoA00
1TFOA 1V74A 1TFKA
chains in the Genus database with same CATH superfamily
3S67A 5KP1A 3LH4A 3V99A 3JUPA 4AKZA 2OOVC 3AMOA 2XR8B 1EG9B 4MMYB 4MEIA 1YJ93 3BNDA 4WYKB 3GZYB 2CFDA 2ML5A 1BVIA 3T8NA 1SJWA 1N5HA 1GMRA 1VQQA 5JPPA 4NHFA 3JVCA 1K41A 1E3VA 2F98A 4HBRA 3OX9A 2R41A 1A2VA 1LQMB 1GOVA 1JRQA 5A0OB 1ISKA 1BNEA 2AADA 1VQ63 3SX1A 2CX0A 1QVG2 3GSPA 3K63A 1B20A 3UL5A 1KWIA 1R4CA 2HOHA 4R80A 5JBSA 1BUJA 1RCLA 3NBBA 3SOAA 2FXTA 3D9RA 1BSAA 2ZA4A 1ROAA 4XBXA 2WGQA 3RGAA 4IT7A 1N8QA 4NPBA 2XH9A 3UL6A 1VQ73 1YI23 4KVHA 1HKXA 2SARA 1V74A 4N3VA 8RNTA 1IT7A 3CNXA 2BMOB 4HJLB 3X3YA 4WFOA 1GD4A 1OPYA 2GXFA 3BNCA 2W0QA 5JPUA 4FCMA 1O7MB 2IY2A 1OHOA 1LRAA 1JB2A 1UGIA 3KE7A 4KFFA 5TGNA 1DMMA 5EQLA 3NHXA 2F5MA 1G02A 4L8OA 1DMNA 3H3HA 3LTBA 2LQVA 1RGCA 4O3VA 3RDEA 2H0IA 3BIRA 2CFLA 1YHQ3 2YFIB 1K734 7STDA 2WOFA 9RNTA 5CF2A 4K61A 2K3DA 3F14A 5AI1A 1L5GB 4RZMA 5FW5A 1M904 5BVBA 3BNBA 1VQM3 1LOVA 1ZGXA 2CX1A 3VF1A 2R4IA 1W5ZA 2RNTA 3D5IA 3D4AA 3K5TA 3G713 3G6E3 1RNBA 1RN1A 1YVSA 5CK6A 1BSEA 2XFSA 3A5EA 4TX4A 5KP4A 1FUWA 2BO9B 2KF5A 1HYFA 1D6ZA 1GY5A 4IIAA 3AHWA 2CK3H 1WMOA 3WOEB 1M1K4 4HM8B 4OK0A 1CH0A 1BRKA 1YGEA 3AMOB 4LZIA 1ZS7A 4RBNA 2GEYA 3DGMA 3V92A 1VQP3 1BRJA 2P0MA 1TU5A 1N9JA 4HM5B 1BNJA 1SARA 1GD3A 1RRHA 4JRFA 2GBWB 1BANA 1EEJA 1VQK3 2OOVA 4EV5A 5D81A 6STDA 1JNQA 5BU4A 1AV4A 2XF3A 2SBLA 2CH9A 2JDIH 3D3LA 3PXMA 1MWSA 1GOUA 1JV2B 2GSPA 1YGWA 4HM0B 1B2SA 3WHOA 2W9PA 1WQLB 3HIGA 3CCM3 1UCIA 3M8CA 3IMAB 2ZHXB 1VQ83 6GSPA 1YJN3 1KD14 3U1WA 3MYTA 1GS3A 5G1KA 2CFKA 4OUQA 3KCHA 5I97A 1X1XA 2F86B 5AEUB 4NREA 1W02A 2XGLA 1FUTA 1W2ZA 4XDVA 5HGRA 2OCTA 3WR2A 1IQYA 1J2BA 4HZBB 1O7GB 3F7SA 3RNTA 4HYZA 1AQZA 1OUNA 2CFGA 3CC43 5IERA 4BL2A 1Q42A 1NB3I 3GAXA 2IUKA 4EC6A 4BL3A 1GMQA 1MWUA 1IVXA 3RGRA 4HM1B 2GU1A 1K8A4 3MSOA 1BRGA 3AHSA 1VQ53 1UW1A 1X1WA 1EUIC 3UNLA 2C10A 1W6CA 1NWWA 3OV4A 1GOYA 1EA2A 3FF0A 3PCRA 4RNTA 1EQKA 2PNCA 2B24B 2CWVA 1FGQA 3OWUA 4XM4A 4STDA 1NNVA 1WNHA 2W03A 4KFEA 1V57A 1M1XB 2O3OA 3WODG 4GL6A 3ER7A 3F8HA 2L4VA 4HAAA 2W04A 1WMPA 3ALAA 3B4PA 5D82A 4HOHA 3WOFB 2E2TA 1BGSA 1PYLA 1ZO2A 3FLJA 3NQZA 4H3UA 3FH1A 5IG3A 2IUJA 5AYSC 3KSED 1AVKA 2CG0A 3A76A 5LC6A 1N9EA 2BT3A 3LYGA 1TP6A 1BNGA 1YJW3 3O8YA 3URPA 2BIRA 5IG5A 3DZLA 2YX9A 5IF6A 3ROBA 1I70A 1TTOA 1K28A 3NBJA 2K0MA 3MG2A 2Y73A 5BXQA 2D1WA 1O7WB 3N8BA 4CDLA 1PY3A 2KF4A 3LXUX 3NXJA 1U8CB 3CCS3 1CQSA 1I3FA 1JB5A 1BNSA 3DMCA 4RNYA 4XDWA 5D83A 1JKGB 3K0ZA 2XFTA 3ZFZA 3CCE3 1VQL3 1VQ93 1BNRA 1UCLA 2QEX3 4N6LA 3NBRA 3CPOA 3MHEA 1DVDA 1IQXA 4XBTA 3FZWA 1DMQA 2HMNB 3K9MC 4JF8A 1I0VA 4R9KA 1I2EA 3LZAA 3PYJA 2RGQA 1UI7A 1BSCA 1NDOB 3DM8A 1IT8A 5KP3A 3G16A 2OTL3 4J5KA 4CCVA 1MNLA 2BMRB 1Q40A 3BLZA 1TRQA 2MC8A 3D79A 4HKVB 1NO3A 3EF8A 2CG1A 3ZG0A 4BTXA 1TFKA 3WA3A 1DVCA 2STDA 1X1UA 2Y74A 2W6JH 1E97A 5CXOA 2CW9A 1RRLA 1WMNA 1G0TA 1VZZA 3B7CA 4IPBA 1R4YA 1N5PA 3FKAA 2IA7A 1B2ZA 1ULJB 3L0RA 1FGRA 3MPHA 5ELUA 1CEWI 2HMJB 3EN1B 1OF5A 2CKFB 4MJDA 1QAKA 3J7Yd 3QRDA 3X3ZA 3GWRA 1SPUA 4U13A 3NV0A 3LTDA 3SLUA 1RGKA 3KFQC 4RNZA 2ZL8A 1Q814 1DETA 4EYCA 3GZXB 2OQEC 2P0XA 4N6UA 4FMBA 1WTHA 1UUWB 1B3SA 2W56A 1LNHA 3JUMA 3NQYA 4L8PA 3CCL3 1Y4KA 4WHAA 3V98A 2ML6A 3BU4A 4EXRA 1I3IA 2BU4A 4LYLB 4O2HA 1MGRA 1BRIA 3K7CA 1VQO3 2JQ5A 2YFJB 5CLKA 1UCJA 3I563 1D6UA 3G0KA 1TFOA 3Q2PA 1B2XA 1Z1SA 1B2UA 1DYUA 3GRDA 1BUQA 1BNIA 5FGOA 3VSYA 1I2GA 1T5YA 3KIIA 2KRTA 3LMLA 1FW7A 4O02B 1NB5I 1QALA 1TIJA 3CCU3 1I0XA 1QMAA 2C11A 3IJEB 4KZ1A 1BU4A 2CHCA 2W2CA 2Z6BA 1YVBI 4WYKA 1AVLA 1T3BA 2RFRA 4K90B 3LOYA 3FG1A 4HM4B 1RKYA 3HZPA 1SIHA 2BHMA 3CCV3 4Q53A 4BIRA 2J8XB 3MG1A 1AY7A 2GU3A 4N6OB 3PGBA 2RSXA 1NU3A 2W9QA 3DY5A 3MG3A 3CCQ3 4PEJA 2HMKB 3DGLA 1NJI4 5G2GA 3PCSA 1E3RA 4ZM8A 1QVF2 1JBRA 1LXEA 1RGEA 1IU7A 3STDA 5BIRA 1IK3A 1STDA 4FR9A 3I0YA 4EV2A 2C4BA 4J8TA 2B1XB 4LMIA 3S28A 3F8XA 1MGWA 1BIRA 1RN4A 3B4OA 4DKIA 1RCKA 3CD63 3HIIA 1W01A 1RHLA 3CNMA 3EBTA 2FGTA 1ULIB 3EBYA 3S29A 3EX9A 1BNFA 1JB4A 4X2OA 1Q824 3WA2X 2HMMB 2V1LA 2Q07A 3CXC2 2F99A 2IMJA 1IQ8A 1Q9EA 2LYXA 4N6MA 1IVUA 5ELJA 1N8R4 2A15A 1OHPA 2UUGC 1LVNA 4HM2B 2OTJ3 1RSNA 1W4NA 2GBXB 4GB5A 3DH2A 1BRHA 2M7OA 3HX8A 4KT3B 1Q7HA 2CC3A 2F5WA 4AEQA 2F56A 4LSOA 3F40A 1FZUA 3FG3A 1C7HA 3LTCA 2WOHA 1JJ22 4MMXB 3JUQA 3PS8A 1PU4A 1BOXA 2XEPA 3HI7A 4O8SA 5HOHA 3CC23 3Q3FA 1AR0A 3SOYA 3EE1A 1HZ1A 1QAFA 2RBIA 1A2PA 1OCVA 2QIYA 3OWSA 2ZDJA 2H0GA 4FMDA 1I8VA 1RGAA 4FMAA 3VGNA 5RNTA 1RLSA 1RN7A 1ROVA 4WWUC 3EN8A 1TJDA 1RJOA 1IVWA 4R1KA 1RMSA 1RGGA 4HM6B 5M19A 5STDA 3CCJ3 2OQEA 3KSPA 1G96A 1SQWA 3OXAA 3NM2A 1B2MA 3N9HA 2KCDA 4G1MB 4XB5A 4AKYA 8CHOA 1UUGB 1JZOA 2HMOB 3BB9A 3AGNA 3HK4A 4EW5A 2XRXB 3NM7A 4J9AA 1V58A 4LEHA 4KFDA 1IV7A 2F4YA 3B8LA 1K9M4 1YIT3 1CYVA 1FYSA 1W6YA 4LGQA 5DREA 4N6NB 3T0UA 1Q7Y4 3SXXA 2P09A 1S5AA 1SIIA 1US1A 1BSBA 1RGFA 2CWTA 3AGOA 3IPTA 2FNQA 4QWTA 4L7KA 3OW22 3MWZA 1JN5A 1O7HB 2HMLB 5M1AA 1EKMA 4WP5A 1T2HA 3NUVA 3G4S3 4BTWA 1MOLA 3EJVA 3LTAA 3FSDA 4H61A 1UDII 1ASKA 4FCZA 1LOYA 3FGYA 4GSPA 4J5GA 1TRPA 3CPW2 3SVAA 3SYUA 1GYBA 2UGIA 5AIGA 1GY7A 2I9WA 4R4KA 1FUSA 2QA43 1RNTA 7RNTA 1IYYA 3EHCA 1B21A 1FGTA 1YIJ3 1LOWA 3OWYA 3SEDA 4HVNA 1IDPA 1RGHA 3CCR3 2Z7AA 3S27A 5DRVA 3X40A 5IW9A 1W6GA 4HM3B 1OACA 1RDSA 4MMZB 1O7NB 2E2UA 1Q864 2XGNA 3LT9A 1T2IA 1BAOA 1VQN3 3Q90A 4X2HA 4FCJA 1ZX2A 4CJNA 2BNGA 3CMA3 5GSPA 2KXGA 2P38A 5EEOA 3QK9A 1FA3A 4HM7B 3FCSB 1I2FA 3NX0A 1S723 1MWRA 4FMCA 5AYRB 2WO0A 4GHOA 3CU3A 3LT8A 4K1UA 4OVMA 3D5GA 2BMQB 3S5CA 3DGOA 2CWUA 1VQ43 1RTUA 3I553 1FGOA 1JBSA 2YFLB 3H51A 1GMPA 1UI8A 1GSPA 5AEWB 2CFWA 2XSHB 1STFI 3EC9A 1UGHI 1TUHA 5CF1A 2E2VA 4N6TA 5AIFA 4I5QA 3X41A 1OHSA 1BSDA 3TDGA 1W2B2 3CC73 3WDGB 3KN4A 4I4KA 3F9SA 2KF6A 2Z77A 1OGXA 1JN5B 3DGNA 2D42A 2O9UX 3JUOA 2UX0A 3JUNA 4N6V0 3EB8A 5LC7A 4BTYA 3BNEA 1B27A 5G1LA 5EVHA 1CYUA 3N54B 3PZWA 1RGLA 2CIUA 4EBGA 1KC84 1F8NA 1IVVA 2KAAA 1W7CA 2KF3A 1BRNL 1PFPA 1Q40B 3Q1CA 2PZVA 3G8ZA 1U5OA 3UB1A 1JKGA 2H0HA 3DXOA 3EQQB 1YNVX 3KZTA 1LNIA 1UCKA 1MWTA 2IYJA 1DE3A 2K54A 5IEPA 3GZRA 3MKIA 3FF2A 3FG4A 4BU4A 1O7PB 1A2KA 1JZDA 1QJGA 1X1YA 5IEOA 1D6YA 1OF5B 1JBTA 3UJMA 2AAEA 1M9GA 2INXA 1OGZA 2OWPA 1IV9A 3F7XA 1KSIA 2MF7A 4R9LA 5AIIA 1KQS2 1LQGC 1BRSA 3NV0B 3ECFA 1W00A 3GZBA 3DGYA 2P05A 4K1VA 5IENA 1LOXA 1GY6A 2Z76A 4ILFA 3X42A 5IG4A 1C54A 3DUKA 1OH0A 4CPKA 3HOHA 4HZ9B 3E99A 3T8UA 3X3XA 2RCDA 2W56B 1UUVB 2GEXA 2XSOB 5IG0A 4ORLA 5M18A 2QGUA 3U97A 2L1SA 3KKGA 5AIHA 2WGOA 3ZG5A 1A67A 1A90A 6RNTA 3WMDA 4XBYA 1HU9A 1FGMA 3CME3 7GSPA
chains in the Genus database with same CATH topology
3S67A 5KP1A 3LH4A 3V99A 3JUPA 4AKZA 2OOVC 3AMOA 2XR8B 1EG9B 4MMYB 4MEIA 1YJ93 3BNDA 4WYKB 3GZYB 2CFDA 2ML5A 3T8NA 1SJWA 1N5HA 5JPPA 4NHFA 3JVCA 1K41A 1E3VA 2F98A 4HBRA 3OX9A 1A2VA 1JRQA 5A0OB 1ISKA 1VQ63 3SX1A 1QVG2 3K63A 3UL5A 1KWIA 1R4CA 4R80A 5JBSA 3SOAA 3NBBA 2FXTA 3D9RA 4XBXA 1ROAA 2WGQA 3RGAA 4IT7A 1N8QA 2XH9A 3UL6A 1VQ73 1YI23 4KVHA 1HKXA 1V74A 4N3VA 1IT7A 3CNXA 2BMOB 4HJLB 3X3YA 4WFOA 1GD4A 1OPYA 2GXFA 3BNCA 2W0QA 5JPUA 4FCMA 1O7MB 1OHOA 1JB2A 3KE7A 4KFFA 5TGNA 1DMMA 5EQLA 3NHXA 4L8OA 1DMNA 3H3HA 3LTBA 2LQVA 4O3VA 3RDEA 1YHQ3 2CFLA 1K734 2YFIB 7STDA 2WOFA 5CF2A 4K61A 3F14A 5AI1A 1L5GB 4RZMA 5FW5A 1M904 5BVBA 3BNBA 1VQM3 3VF1A 2R4IA 1W5ZA 3K5TA 3G713 3G6E3 5CK6A 2XFSA 4TX4A 5KP4A 1FUWA 2BO9B 1D6ZA 1GY5A 4IIAA 2CK3H 1WMOA 3WOEB 1M1K4 4HM8B 4OK0A 1YGEA 3AMOB 4LZIA 4RBNA 2GEYA 3DGMA 3V92A 1VQP3 2P0MA 1TU5A 1N9JA 4HM5B 1GD3A 1RRHA 4JRFA 2GBWB 1VQK3 2OOVA 4EV5A 5D81A 6STDA 1JNQA 1AV4A 2XF3A 2SBLA 2CH9A 2JDIH 3D3LA 3PXMA 1JV2B 4HM0B 2W9PA 1WQLB 3HIGA 3CCM3 3M8CA 3IMAB 1VQ83 1YJN3 1KD14 3U1WA 3MYTA 1GS3A 2CFKA 4OUQA 5I97A 2F86B 5AEUB 4NREA 1W02A 2XGLA 1W2ZA 5HGRA 4XDVA 2OCTA 1J2BA 1IQYA 4HZBB 1O7GB 3F7SA 4HYZA 1OUNA 2CFGA 3CC43 5IERA 1Q42A 1NB3I 3GAXA 2IUKA 4EC6A 1IVXA 3RGRA 4HM1B 2GU1A 1K8A4 3MSOA 1VQ53 1UW1A 3UNLA 2C10A 1W6CA 1NWWA 3OV4A 1EA2A 3FF0A 3PCRA 1EQKA 2PNCA 2B24B 2CWVA 1FGQA 3OWUA 4XM4A 4STDA 1WNHA 2W03A 4KFEA 2O3OA 1M1XB 3WODG 4GL6A 3ER7A 3F8HA 2L4VA 2W04A 1WMPA 3ALAA 3B4PA 5D82A 3WOFB 2E2TA 1ZO2A 3FLJA 3NQZA 4H3UA 3FH1A 5IG3A 2IUJA 5AYSC 3KSED 1AVKA 2CG0A 3A76A 5LC6A 1N9EA 2BT3A 3LYGA 1TP6A 1YJW3 3O8YA 5IG5A 3DZLA 2YX9A 5IF6A 3ROBA 1K28A 3NBJA 2K0MA 3MG2A 2Y73A 5BXQA 2D1WA 1O7WB 3N8BA 4CDLA 3LXUX 3NXJA 1U8CB 3CCS3 1CQSA 1JB5A 3DMCA 5D83A 4RNYA 4XDWA 1JKGB 3K0ZA 2XFTA 3CCE3 1VQ93 1VQL3 2QEX3 4N6LA 3NBRA 3CPOA 3MHEA 1DVDA 1IQXA 4XBTA 3FZWA 1DMQA 2HMNB 3K9MC 4JF8A 4R9KA 3LZAA 3PYJA 2RGQA 1UI7A 1NDOB 3DM8A 1IT8A 5KP3A 3G16A 4CCVA 1MNLA 2BMRB 1Q40A 3BLZA 2MC8A 2OTL3 4HKVB 1NO3A 3EF8A 2CG1A 4BTXA 3WA3A 1TFKA 1DVCA 2STDA 2Y74A 2W6JH 1E97A 5CXOA 2CW9A 1RRLA 1WMNA 1VZZA 3B7CA 4IPBA 1N5PA 3FKAA 2IA7A 1ULJB 3L0RA 1FGRA 3MPHA 5ELUA 1CEWI 2HMJB 3EN1B 1OF5A 2CKFB 4MJDA 1QAKA 3J7Yd 3QRDA 3X3ZA 3GWRA 1SPUA 4U13A 3NV0A 3LTDA 3SLUA 3KFQC 4RNZA 2ZL8A 1Q814 4EYCA 3GZXB 2OQEC 2P0XA 4N6UA 4FMBA 1WTHA 1UUWB 2W56A 1LNHA 3JUMA 3NQYA 4L8PA 3CCL3 1Y4KA 4WHAA 3V98A 2ML6A 4EXRA 4O2HA 1VQO3 3K7CA 2JQ5A 2YFJB 5CLKA 3I563 1D6UA 3G0KA 1TFOA 3Q2PA 1Z1SA 1DYUA 3GRDA 1BUQA 5FGOA 3VSYA 3KIIA 1T5YA 2KRTA 3LMLA 4O02B 1NB5I 1QALA 1TIJA 3CCU3 1QMAA 2C11A 3IJEB 4KZ1A 2CHCA 2W2CA 2Z6BA 4WYKA 1YVBI 1AVLA 2RFRA 4K90B 3LOYA 3FG1A 4HM4B 1RKYA 3HZPA 1SIHA 2BHMA 3CCV3 4Q53A 3MG1A 2GU3A 4N6OB 3PGBA 2RSXA 1NU3A 2W9QA 3DY5A 3MG3A 3CCQ3 4PEJA 2HMKB 3DGLA 1NJI4 5G2GA 3PCSA 1E3RA 4ZM8A 1QVF2 1LXEA 1IU7A 3STDA 1IK3A 1STDA 4FR9A 3I0YA 4EV2A 4LMIA 4J8TA 2B1XB 3S28A 3F8XA 3B4OA 3CD63 3HIIA 1W01A 3CNMA 3EBTA 2FGTA 1ULIB 3EBYA 3S29A 3EX9A 1JB4A 4X2OA 1Q824 3WA2X 2HMMB 2V1LA 2Q07A 3CXC2 2F99A 2IMJA 1IQ8A 2LYXA 4N6MA 5ELJA 1IVUA 1N8R4 2A15A 1OHPA 1LVNA 4HM2B 2OTJ3 1W4NA 2GBXB 4GB5A 2M7OA 3HX8A 2CC3A 4AEQA 4LSOA 3F40A 3FG3A 1C7HA 3LTCA 2WOHA 1JJ22 4MMXB 3JUQA 3PS8A 1PU4A 2XEPA 3HI7A 4O8SA 3CC23 1AR0A 3SOYA 3EE1A 1QAFA 3OWSA 4FMDA 1OCVA 2QIYA 5IEPA 2ZDJA 3CMA3 4FMAA 3VGNA 1RN7A 1ROVA 4WWUC 3EN8A 1RJOA 1IVWA 4R1KA 4HM6B 5STDA 3CCJ3 2OQEA 3KSPA 1G96A 1SQWA 3OXAA 3NM2A 3N9HA 2KCDA 4G1MB 4XB5A 4AKYA 8CHOA 3HK4A 3BB9A 2HMOB 2XRXB 3NM7A 4J9AA 4LEHA 4KFDA 1IV7A 3B8LA 1K9M4 1YIT3 1CYVA 1W6YA 4LGQA 5DREA 4N6NB 3T0UA 1Q7Y4 3SXXA 2P09A 1S5AA 1SIIA 1US1A 2CWTA 3IPTA 2FNQA 4QWTA 4L7KA 3OW22 3MWZA 1JN5A 1O7HB 2HMLB 1EKMA 4WP5A 3NUVA 3G4S3 4BTWA 1MOLA 3EJVA 3LTAA 3FSDA 4H61A 1ASKA 4FCZA 3FGYA 3CPW2 3SVAA 1GYBA 5AIGA 1GY7A 2I9WA 4R4KA 2QA43 3EHCA 1YIJ3 1FGTA 3SEDA 3OWYA 4HVNA 1IDPA 3CCR3 2Z7AA 3S27A 5DRVA 3X40A 5IW9A 1W6GA 4HM3B 1OACA 4MMZB 1O7NB 2E2UA 1Q864 2XGNA 3LT9A 1VQN3 3Q90A 4X2HA 4FCJA 1ZX2A 2BNGA 2KXGA 2P38A 5EEOA 3QK9A 1FA3A 4HM7B 3FCSB 3NX0A 1S723 4FMCA 5AYRB 2WO0A 3CU3A 3LT8A 4K1UA 4OVMA 2BMQB 3S5CA 3DGOA 2CWUA 1VQ43 3I553 1FGOA 2YFLB 3H51A 1UI8A 5AEWB 2CFWA 2XSHB 1STFI 3EC9A 1TUHA 5CF1A 2E2VA 4N6TA 5AIFA 3X41A 1OHSA 3TDGA 1W2B2 3CC73 3WDGB 3KN4A 4I4KA 3F9SA 2Z77A 1OGXA 1JN5B 3DGNA 2D42A 2O9UX 3JUOA 2UX0A 3JUNA 4N6V0 3EB8A 5LC7A 4BTYA 3BNEA 5EVHA 1CYUA 3N54B 3PZWA 2CIUA 4EBGA 1KC84 1F8NA 1IVVA 1W7CA 1PFPA 1Q40B 3Q1CA 2PZVA 3G8ZA 1U5OA 3UB1A 1JKGA 3DXOA 3EQQB 3KZTA 2K54A 3GZRA 3MKIA 3FF2A 3FG4A 1O7PB 1A2KA 1QJGA 5IEOA 1D6YA 1OF5B 3UJMA 1M9GA 2INXA 1OGZA 2OWPA 1IV9A 3F7XA 1KSIA 2MF7A 4R9LA 5AIIA 1KQS2 3NV0B 3ECFA 1W00A 3GZBA 2P05A 4K1VA 5IENA 1LOXA 1GY6A 2Z76A 5IG4A 3X42A 3DUKA 1OH0A 4HZ9B 3E99A 3T8UA 3X3XA 2RCDA 2W56B 1UUVB 2GEXA 2XSOB 5IG0A 4ORLA 2QGUA 3U97A 3KKGA 5AIHA 2WGOA 1A67A 1A90A 3WMDA 4XBYA 1HU9A 1FGMA 3CME3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFO A;  1V74 A;  1TFK A; 
#chains in the Genus database with same CATH topology
 3S67 A;  5KP1 A;  3LH4 A;  3V99 A;  3JUP A;  4AKZ A;  2OOV C;  3AMO A;  2XR8 B;  1EG9 B;  4MMY B;  4MEI A;  1YJ9 3;  3BND A;  4WYK B;  3GZY B;  2CFD A;  2ML5 A;  1BVI A;  3T8N A;  1SJW A;  1N5H A;  1GMR A;  1VQQ A;  5JPP A;  4NHF A;  3JVC A;  1K41 A;  1E3V A;  2F98 A;  4HBR A;  3OX9 A;  2R41 A;  1A2V A;  1LQM B;  1GOV A;  1JRQ A;  5A0O B;  1ISK A;  1BNE A;  2AAD A;  1VQ6 3;  3SX1 A;  2CX0 A;  1QVG 2;  3GSP A;  3K63 A;  1B20 A;  3UL5 A;  1KWI A;  1R4C A;  2HOH A;  4R80 A;  5JBS A;  1BUJ A;  1RCL A;  3NBB A;  3SOA A;  2FXT A;  3D9R A;  1BSA A;  2ZA4 A;  1ROA A;  4XBX A;  2WGQ A;  3RGA A;  4IT7 A;  1N8Q A;  4NPB A;  2XH9 A;  3UL6 A;  1VQ7 3;  1YI2 3;  4KVH A;  1HKX A;  2SAR A;  1V74 A;  4N3V A;  8RNT A;  1IT7 A;  3CNX A;  2BMO B;  4HJL B;  3X3Y A;  4WFO A;  1GD4 A;  1OPY A;  2GXF A;  3BNC A;  2W0Q A;  5JPU A;  4FCM A;  1O7M B;  2IY2 A;  1OHO A;  1LRA A;  1JB2 A;  1UGI A;  3KE7 A;  4KFF A;  5TGN A;  1DMM A;  5EQL A;  3NHX A;  2F5M A;  1G02 A;  4L8O A;  1DMN A;  3H3H A;  3LTB A;  2LQV A;  1RGC A;  4O3V A;  3RDE A;  2H0I A;  3BIR A;  2CFL A;  1YHQ 3;  2YFI B;  1K73 4;  7STD A;  2WOF A;  9RNT A;  5CF2 A;  4K61 A;  2K3D A;  3F14 A;  5AI1 A;  1L5G B;  4RZM A;  5FW5 A;  1M90 4;  5BVB A;  3BNB A;  1VQM 3;  1LOV A;  1ZGX A;  2CX1 A;  3VF1 A;  2R4I A;  1W5Z A;  2RNT A;  3D5I A;  3D4A A;  3K5T A;  3G71 3;  3G6E 3;  1RNB A;  1RN1 A;  1YVS A;  5CK6 A;  1BSE A;  2XFS A;  3A5E A;  4TX4 A;  5KP4 A;  1FUW A;  2BO9 B;  2KF5 A;  1HYF A;  1D6Z A;  1GY5 A;  4IIA A;  3AHW A;  2CK3 H;  1WMO A;  3WOE B;  1M1K 4;  4HM8 B;  4OK0 A;  1CH0 A;  1BRK A;  1YGE A;  3AMO B;  4LZI A;  1ZS7 A;  4RBN A;  2GEY A;  3DGM A;  3V92 A;  1VQP 3;  1BRJ A;  2P0M A;  1TU5 A;  1N9J A;  4HM5 B;  1BNJ A;  1SAR A;  1GD3 A;  1RRH A;  4JRF A;  2GBW B;  1BAN A;  1EEJ A;  1VQK 3;  2OOV A;  4EV5 A;  5D81 A;  6STD A;  1JNQ A;  5BU4 A;  1AV4 A;  2XF3 A;  2SBL A;  2CH9 A;  2JDI H;  3D3L A;  3PXM A;  1MWS A;  1GOU A;  1JV2 B;  2GSP A;  1YGW A;  4HM0 B;  1B2S A;  3WHO A;  2W9P A;  1WQL B;  3HIG A;  3CCM 3;  1UCI A;  3M8C A;  3IMA B;  2ZHX B;  1VQ8 3;  6GSP A;  1YJN 3;  1KD1 4;  3U1W A;  3MYT A;  1GS3 A;  5G1K A;  2CFK A;  4OUQ A;  3KCH A;  5I97 A;  1X1X A;  2F86 B;  5AEU B;  4NRE A;  1W02 A;  2XGL A;  1FUT A;  1W2Z A;  4XDV A;  5HGR A;  2OCT A;  3WR2 A;  1IQY A;  1J2B A;  4HZB B;  1O7G B;  3F7S A;  3RNT A;  4HYZ A;  1AQZ A;  1OUN A;  2CFG A;  3CC4 3;  5IER A;  4BL2 A;  1Q42 A;  1NB3 I;  3GAX A;  2IUK A;  4EC6 A;  4BL3 A;  1GMQ A;  1MWU A;  1IVX A;  3RGR A;  4HM1 B;  2GU1 A;  1K8A 4;  3MSO A;  1BRG A;  3AHS A;  1VQ5 3;  1UW1 A;  1X1W A;  1EUI C;  3UNL A;  2C10 A;  1W6C A;  1NWW A;  3OV4 A;  1GOY A;  1EA2 A;  3FF0 A;  3PCR A;  4RNT A;  1EQK A;  2PNC A;  2B24 B;  2CWV A;  1FGQ A;  3OWU A;  4XM4 A;  4STD A;  1NNV A;  1WNH A;  2W03 A;  4KFE A;  1V57 A;  1M1X B;  2O3O A;  3WOD G;  4GL6 A;  3ER7 A;  3F8H A;  2L4V A;  4HAA A;  2W04 A;  1WMP A;  3ALA A;  3B4P A;  5D82 A;  4HOH A;  3WOF B;  2E2T A;  1BGS A;  1PYL A;  1ZO2 A;  3FLJ A;  3NQZ A;  4H3U A;  3FH1 A;  5IG3 A;  2IUJ A;  5AYS C;  3KSE D;  1AVK A;  2CG0 A;  3A76 A;  5LC6 A;  1N9E A;  2BT3 A;  3LYG A;  1TP6 A;  1BNG A;  1YJW 3;  3O8Y A;  3URP A;  2BIR A;  5IG5 A;  3DZL A;  2YX9 A;  5IF6 A;  3ROB A;  1I70 A;  1TTO A;  1K28 A;  3NBJ A;  2K0M A;  3MG2 A;  2Y73 A;  5BXQ A;  2D1W A;  1O7W B;  3N8B A;  4CDL A;  1PY3 A;  2KF4 A;  3LXU X;  3NXJ A;  1U8C B;  3CCS 3;  1CQS A;  1I3F A;  1JB5 A;  1BNS A;  3DMC A;  4RNY A;  4XDW A;  5D83 A;  1JKG B;  3K0Z A;  2XFT A;  3ZFZ A;  3CCE 3;  1VQL 3;  1VQ9 3;  1BNR A;  1UCL A;  2QEX 3;  4N6L A;  3NBR A;  3CPO A;  3MHE A;  1DVD A;  1IQX A;  4XBT A;  3FZW A;  1DMQ A;  2HMN B;  3K9M C;  4JF8 A;  1I0V A;  4R9K A;  1I2E A;  3LZA A;  3PYJ A;  2RGQ A;  1UI7 A;  1BSC A;  1NDO B;  3DM8 A;  1IT8 A;  5KP3 A;  3G16 A;  2OTL 3;  4J5K A;  4CCV A;  1MNL A;  2BMR B;  1Q40 A;  3BLZ A;  1TRQ A;  2MC8 A;  3D79 A;  4HKV B;  1NO3 A;  3EF8 A;  2CG1 A;  3ZG0 A;  4BTX A;  1TFK A;  3WA3 A;  1DVC A;  2STD A;  1X1U A;  2Y74 A;  2W6J H;  1E97 A;  5CXO A;  2CW9 A;  1RRL A;  1WMN A;  1G0T A;  1VZZ A;  3B7C A;  4IPB A;  1R4Y A;  1N5P A;  3FKA A;  2IA7 A;  1B2Z A;  1ULJ B;  3L0R A;  1FGR A;  3MPH A;  5ELU A;  1CEW I;  2HMJ B;  3EN1 B;  1OF5 A;  2CKF B;  4MJD A;  1QAK A;  3J7Y d;  3QRD A;  3X3Z A;  3GWR A;  1SPU A;  4U13 A;  3NV0 A;  3LTD A;  3SLU A;  1RGK A;  3KFQ C;  4RNZ A;  2ZL8 A;  1Q81 4;  1DET A;  4EYC A;  3GZX B;  2OQE C;  2P0X A;  4N6U A;  4FMB A;  1WTH A;  1UUW B;  1B3S A;  2W56 A;  1LNH A;  3JUM A;  3NQY A;  4L8P A;  3CCL 3;  1Y4K A;  4WHA A;  3V98 A;  2ML6 A;  3BU4 A;  4EXR A;  1I3I A;  2BU4 A;  4LYL B;  4O2H A;  1MGR A;  1BRI A;  3K7C A;  1VQO 3;  2JQ5 A;  2YFJ B;  5CLK A;  1UCJ A;  3I56 3;  1D6U A;  3G0K A;  1TFO A;  3Q2P A;  1B2X A;  1Z1S A;  1B2U A;  1DYU A;  3GRD A;  1BUQ A;  1BNI A;  5FGO A;  3VSY A;  1I2G A;  1T5Y A;  3KII A;  2KRT A;  3LML A;  1FW7 A;  4O02 B;  1NB5 I;  1QAL A;  1TIJ A;  3CCU 3;  1I0X A;  1QMA A;  2C11 A;  3IJE B;  4KZ1 A;  1BU4 A;  2CHC A;  2W2C A;  2Z6B A;  1YVB I;  4WYK A;  1AVL A;  1T3B A;  2RFR A;  4K90 B;  3LOY A;  3FG1 A;  4HM4 B;  1RKY A;  3HZP A;  1SIH A;  2BHM A;  3CCV 3;  4Q53 A;  4BIR A;  2J8X B;  3MG1 A;  1AY7 A;  2GU3 A;  4N6O B;  3PGB A;  2RSX A;  1NU3 A;  2W9Q A;  3DY5 A;  3MG3 A;  3CCQ 3;  4PEJ A;  2HMK B;  3DGL A;  1NJI 4;  5G2G A;  3PCS A;  1E3R A;  4ZM8 A;  1QVF 2;  1JBR A;  1LXE A;  1RGE A;  1IU7 A;  3STD A;  5BIR A;  1IK3 A;  1STD A;  4FR9 A;  3I0Y A;  4EV2 A;  2C4B A;  4J8T A;  2B1X B;  4LMI A;  3S28 A;  3F8X A;  1MGW A;  1BIR A;  1RN4 A;  3B4O A;  4DKI A;  1RCK A;  3CD6 3;  3HII A;  1W01 A;  1RHL A;  3CNM A;  3EBT A;  2FGT A;  1ULI B;  3EBY A;  3S29 A;  3EX9 A;  1BNF A;  1JB4 A;  4X2O A;  1Q82 4;  3WA2 X;  2HMM B;  2V1L A;  2Q07 A;  3CXC 2;  2F99 A;  2IMJ A;  1IQ8 A;  1Q9E A;  2LYX A;  4N6M A;  1IVU A;  5ELJ A;  1N8R 4;  2A15 A;  1OHP A;  2UUG C;  1LVN A;  4HM2 B;  2OTJ 3;  1RSN A;  1W4N A;  2GBX B;  4GB5 A;  3DH2 A;  1BRH A;  2M7O A;  3HX8 A;  4KT3 B;  1Q7H A;  2CC3 A;  2F5W A;  4AEQ A;  2F56 A;  4LSO A;  3F40 A;  1FZU A;  3FG3 A;  1C7H A;  3LTC A;  2WOH A;  1JJ2 2;  4MMX B;  3JUQ A;  3PS8 A;  1PU4 A;  1BOX A;  2XEP A;  3HI7 A;  4O8S A;  5HOH A;  3CC2 3;  3Q3F A;  1AR0 A;  3SOY A;  3EE1 A;  1HZ1 A;  1QAF A;  2RBI A;  1A2P A;  1OCV A;  2QIY A;  3OWS A;  2ZDJ A;  2H0G A;  4FMD A;  1I8V A;  1RGA A;  4FMA A;  3VGN A;  5RNT A;  1RLS A;  1RN7 A;  1ROV A;  4WWU C;  3EN8 A;  1TJD A;  1RJO A;  1IVW A;  4R1K A;  1RMS A;  1RGG A;  4HM6 B;  5M19 A;  5STD A;  3CCJ 3;  2OQE A;  3KSP A;  1G96 A;  1SQW A;  3OXA A;  3NM2 A;  1B2M A;  3N9H A;  2KCD A;  4G1M B;  4XB5 A;  4AKY A;  8CHO A;  1UUG B;  1JZO A;  2HMO B;  3BB9 A;  3AGN A;  3HK4 A;  4EW5 A;  2XRX B;  3NM7 A;  4J9A A;  1V58 A;  4LEH A;  4KFD A;  1IV7 A;  2F4Y A;  3B8L A;  1K9M 4;  1YIT 3;  1CYV A;  1FYS A;  1W6Y A;  4LGQ A;  5DRE A;  4N6N B;  3T0U A;  1Q7Y 4;  3SXX A;  2P09 A;  1S5A A;  1SII A;  1US1 A;  1BSB A;  1RGF A;  2CWT A;  3AGO A;  3IPT A;  2FNQ A;  4QWT A;  4L7K A;  3OW2 2;  3MWZ A;  1JN5 A;  1O7H B;  2HML B;  5M1A A;  1EKM A;  4WP5 A;  1T2H A;  3NUV A;  3G4S 3;  4BTW A;  1MOL A;  3EJV A;  3LTA A;  3FSD A;  4H61 A;  1UDI I;  1ASK A;  4FCZ A;  1LOY A;  3FGY A;  4GSP A;  4J5G A;  1TRP A;  3CPW 2;  3SVA A;  3SYU A;  1GYB A;  2UGI A;  5AIG A;  1GY7 A;  2I9W A;  4R4K A;  1FUS A;  2QA4 3;  1RNT A;  7RNT A;  1IYY A;  3EHC A;  1B21 A;  1FGT A;  1YIJ 3;  1LOW A;  3OWY A;  3SED A;  4HVN A;  1IDP A;  1RGH A;  3CCR 3;  2Z7A A;  3S27 A;  5DRV A;  3X40 A;  5IW9 A;  1W6G A;  4HM3 B;  1OAC A;  1RDS A;  4MMZ B;  1O7N B;  2E2U A;  1Q86 4;  2XGN A;  3LT9 A;  1T2I A;  1BAO A;  1VQN 3;  3Q90 A;  4X2H A;  4FCJ A;  1ZX2 A;  4CJN A;  2BNG A;  3CMA 3;  5GSP A;  2KXG A;  2P38 A;  5EEO A;  3QK9 A;  1FA3 A;  4HM7 B;  3FCS B;  1I2F A;  3NX0 A;  1S72 3;  1MWR A;  4FMC A;  5AYR B;  2WO0 A;  4GHO A;  3CU3 A;  3LT8 A;  4K1U A;  4OVM A;  3D5G A;  2BMQ B;  3S5C A;  3DGO A;  2CWU A;  1VQ4 3;  1RTU A;  3I55 3;  1FGO A;  1JBS A;  2YFL B;  3H51 A;  1GMP A;  1UI8 A;  1GSP A;  5AEW B;  2CFW A;  2XSH B;  1STF I;  3EC9 A;  1UGH I;  1TUH A;  5CF1 A;  2E2V A;  4N6T A;  5AIF A;  4I5Q A;  3X41 A;  1OHS A;  1BSD A;  3TDG A;  1W2B 2;  3CC7 3;  3WDG B;  3KN4 A;  4I4K A;  3F9S A;  2KF6 A;  2Z77 A;  1OGX A;  1JN5 B;  3DGN A;  2D42 A;  2O9U X;  3JUO A;  2UX0 A;  3JUN A;  4N6V 0;  3EB8 A;  5LC7 A;  4BTY A;  3BNE A;  1B27 A;  5G1L A;  5EVH A;  1CYU A;  3N54 B;  3PZW A;  1RGL A;  2CIU A;  4EBG A;  1KC8 4;  1F8N A;  1IVV A;  2KAA A;  1W7C A;  2KF3 A;  1BRN L;  1PFP A;  1Q40 B;  3Q1C A;  2PZV A;  3G8Z A;  1U5O A;  3UB1 A;  1JKG A;  2H0H A;  3DXO A;  3EQQ B;  1YNV X;  3KZT A;  1LNI A;  1UCK A;  1MWT A;  2IYJ A;  1DE3 A;  2K54 A;  5IEP A;  3GZR A;  3MKI A;  3FF2 A;  3FG4 A;  4BU4 A;  1O7P B;  1A2K A;  1JZD A;  1QJG A;  1X1Y A;  5IEO A;  1D6Y A;  1OF5 B;  1JBT A;  3UJM A;  2AAE A;  1M9G A;  2INX A;  1OGZ A;  2OWP A;  1IV9 A;  3F7X A;  1KSI A;  2MF7 A;  4R9L A;  5AII A;  1KQS 2;  1LQG C;  1BRS A;  3NV0 B;  3ECF A;  1W00 A;  3GZB A;  3DGY A;  2P05 A;  4K1V A;  5IEN A;  1LOX A;  1GY6 A;  2Z76 A;  4ILF A;  3X42 A;  5IG4 A;  1C54 A;  3DUK A;  1OH0 A;  4CPK A;  3HOH A;  4HZ9 B;  3E99 A;  3T8U A;  3X3X A;  2RCD A;  2W56 B;  1UUV B;  2GEX A;  2XSO B;  5IG0 A;  4ORL A;  5M18 A;  2QGU A;  3U97 A;  2L1S A;  3KKG A;  5AIH A;  2WGO A;  3ZG5 A;  1A67 A;  1A90 A;  6RNT A;  3WMD A;  4XBY A;  1HU9 A;  1FGM A;  3CME 3;  7GSP A; 
#chains in the Genus database with same CATH homology
 3S67 A;  5KP1 A;  3LH4 A;  3V99 A;  3JUP A;  4AKZ A;  2OOV C;  3AMO A;  2XR8 B;  1EG9 B;  4MMY B;  4MEI A;  1YJ9 3;  3BND A;  4WYK B;  3GZY B;  2CFD A;  2ML5 A;  3T8N A;  1SJW A;  1N5H A;  5JPP A;  4NHF A;  3JVC A;  1K41 A;  1E3V A;  2F98 A;  4HBR A;  3OX9 A;  1A2V A;  1JRQ A;  5A0O B;  1ISK A;  1VQ6 3;  3SX1 A;  1QVG 2;  3K63 A;  3UL5 A;  1KWI A;  1R4C A;  4R80 A;  5JBS A;  3SOA A;  3NBB A;  2FXT A;  3D9R A;  4XBX A;  1ROA A;  2WGQ A;  3RGA A;  4IT7 A;  1N8Q A;  2XH9 A;  3UL6 A;  1VQ7 3;  1YI2 3;  4KVH A;  1HKX A;  1V74 A;  4N3V A;  1IT7 A;  3CNX A;  2BMO B;  4HJL B;  3X3Y A;  4WFO A;  1GD4 A;  1OPY A;  2GXF A;  3BNC A;  2W0Q A;  5JPU A;  4FCM A;  1O7M B;  1OHO A;  1JB2 A;  3KE7 A;  4KFF A;  5TGN A;  1DMM A;  5EQL A;  3NHX A;  4L8O A;  1DMN A;  3H3H A;  3LTB A;  2LQV A;  4O3V A;  3RDE A;  1YHQ 3;  2CFL A;  1K73 4;  2YFI B;  7STD A;  2WOF A;  5CF2 A;  4K61 A;  3F14 A;  5AI1 A;  1L5G B;  4RZM A;  5FW5 A;  1M90 4;  5BVB A;  3BNB A;  1VQM 3;  3VF1 A;  2R4I A;  1W5Z A;  3K5T A;  3G71 3;  3G6E 3;  5CK6 A;  2XFS A;  4TX4 A;  5KP4 A;  1FUW A;  2BO9 B;  1D6Z A;  1GY5 A;  4IIA A;  2CK3 H;  1WMO A;  3WOE B;  1M1K 4;  4HM8 B;  4OK0 A;  1YGE A;  3AMO B;  4LZI A;  4RBN A;  2GEY A;  3DGM A;  3V92 A;  1VQP 3;  2P0M A;  1TU5 A;  1N9J A;  4HM5 B;  1GD3 A;  1RRH A;  4JRF A;  2GBW B;  1VQK 3;  2OOV A;  4EV5 A;  5D81 A;  6STD A;  1JNQ A;  1AV4 A;  2XF3 A;  2SBL A;  2CH9 A;  2JDI H;  3D3L A;  3PXM A;  1JV2 B;  4HM0 B;  2W9P A;  1WQL B;  3HIG A;  3CCM 3;  3M8C A;  3IMA B;  1VQ8 3;  1YJN 3;  1KD1 4;  3U1W A;  3MYT A;  1GS3 A;  2CFK A;  4OUQ A;  5I97 A;  2F86 B;  5AEU B;  4NRE A;  1W02 A;  2XGL A;  1W2Z A;  5HGR A;  4XDV A;  2OCT A;  1J2B A;  1IQY A;  4HZB B;  1O7G B;  3F7S A;  4HYZ A;  1OUN A;  2CFG A;  3CC4 3;  5IER A;  1Q42 A;  1NB3 I;  3GAX A;  2IUK A;  4EC6 A;  1IVX A;  3RGR A;  4HM1 B;  2GU1 A;  1K8A 4;  3MSO A;  1VQ5 3;  1UW1 A;  3UNL A;  2C10 A;  1W6C A;  1NWW A;  3OV4 A;  1EA2 A;  3FF0 A;  3PCR A;  1EQK A;  2PNC A;  2B24 B;  2CWV A;  1FGQ A;  3OWU A;  4XM4 A;  4STD A;  1WNH A;  2W03 A;  4KFE A;  2O3O A;  1M1X B;  3WOD G;  4GL6 A;  3ER7 A;  3F8H A;  2L4V A;  2W04 A;  1WMP A;  3ALA A;  3B4P A;  5D82 A;  3WOF B;  2E2T A;  1ZO2 A;  3FLJ A;  3NQZ A;  4H3U A;  3FH1 A;  5IG3 A;  2IUJ A;  5AYS C;  3KSE D;  1AVK A;  2CG0 A;  3A76 A;  5LC6 A;  1N9E A;  2BT3 A;  3LYG A;  1TP6 A;  1YJW 3;  3O8Y A;  5IG5 A;  3DZL A;  2YX9 A;  5IF6 A;  3ROB A;  1K28 A;  3NBJ A;  2K0M A;  3MG2 A;  2Y73 A;  5BXQ A;  2D1W A;  1O7W B;  3N8B A;  4CDL A;  3LXU X;  3NXJ A;  1U8C B;  3CCS 3;  1CQS A;  1JB5 A;  3DMC A;  5D83 A;  4RNY A;  4XDW A;  1JKG B;  3K0Z A;  2XFT A;  3CCE 3;  1VQ9 3;  1VQL 3;  2QEX 3;  4N6L A;  3NBR A;  3CPO A;  3MHE A;  1DVD A;  1IQX A;  4XBT A;  3FZW A;  1DMQ A;  2HMN B;  3K9M C;  4JF8 A;  4R9K A;  3LZA A;  3PYJ A;  2RGQ A;  1UI7 A;  1NDO B;  3DM8 A;  1IT8 A;  5KP3 A;  3G16 A;  4CCV A;  1MNL A;  2BMR B;  1Q40 A;  3BLZ A;  2MC8 A;  2OTL 3;  4HKV B;  1NO3 A;  3EF8 A;  2CG1 A;  4BTX A;  3WA3 A;  1TFK A;  1DVC A;  2STD A;  2Y74 A;  2W6J H;  1E97 A;  5CXO A;  2CW9 A;  1RRL A;  1WMN A;  1VZZ A;  3B7C A;  4IPB A;  1N5P A;  3FKA A;  2IA7 A;  1ULJ B;  3L0R A;  1FGR A;  3MPH A;  5ELU A;  1CEW I;  2HMJ B;  3EN1 B;  1OF5 A;  2CKF B;  4MJD A;  1QAK A;  3J7Y d;  3QRD A;  3X3Z A;  3GWR A;  1SPU A;  4U13 A;  3NV0 A;  3LTD A;  3SLU A;  3KFQ C;  4RNZ A;  2ZL8 A;  1Q81 4;  4EYC A;  3GZX B;  2OQE C;  2P0X A;  4N6U A;  4FMB A;  1WTH A;  1UUW B;  2W56 A;  1LNH A;  3JUM A;  3NQY A;  4L8P A;  3CCL 3;  1Y4K A;  4WHA A;  3V98 A;  2ML6 A;  4EXR A;  4O2H A;  1VQO 3;  3K7C A;  2JQ5 A;  2YFJ B;  5CLK A;  3I56 3;  1D6U A;  3G0K A;  1TFO A;  3Q2P A;  1Z1S A;  1DYU A;  3GRD A;  1BUQ A;  5FGO A;  3VSY A;  3KII A;  1T5Y A;  2KRT A;  3LML A;  4O02 B;  1NB5 I;  1QAL A;  1TIJ A;  3CCU 3;  1QMA A;  2C11 A;  3IJE B;  4KZ1 A;  2CHC A;  2W2C A;  2Z6B A;  4WYK A;  1YVB I;  1AVL A;  2RFR A;  4K90 B;  3LOY A;  3FG1 A;  4HM4 B;  1RKY A;  3HZP A;  1SIH A;  2BHM A;  3CCV 3;  4Q53 A;  3MG1 A;  2GU3 A;  4N6O B;  3PGB A;  2RSX A;  1NU3 A;  2W9Q A;  3DY5 A;  3MG3 A;  3CCQ 3;  4PEJ A;  2HMK B;  3DGL A;  1NJI 4;  5G2G A;  3PCS A;  1E3R A;  4ZM8 A;  1QVF 2;  1LXE A;  1IU7 A;  3STD A;  1IK3 A;  1STD A;  4FR9 A;  3I0Y A;  4EV2 A;  4LMI A;  4J8T A;  2B1X B;  3S28 A;  3F8X A;  3B4O A;  3CD6 3;  3HII A;  1W01 A;  3CNM A;  3EBT A;  2FGT A;  1ULI B;  3EBY A;  3S29 A;  3EX9 A;  1JB4 A;  4X2O A;  1Q82 4;  3WA2 X;  2HMM B;  2V1L A;  2Q07 A;  3CXC 2;  2F99 A;  2IMJ A;  1IQ8 A;  2LYX A;  4N6M A;  5ELJ A;  1IVU A;  1N8R 4;  2A15 A;  1OHP A;  1LVN A;  4HM2 B;  2OTJ 3;  1W4N A;  2GBX B;  4GB5 A;  2M7O A;  3HX8 A;  2CC3 A;  4AEQ A;  4LSO A;  3F40 A;  3FG3 A;  1C7H A;  3LTC A;  2WOH A;  1JJ2 2;  4MMX B;  3JUQ A;  3PS8 A;  1PU4 A;  2XEP A;  3HI7 A;  4O8S A;  3CC2 3;  1AR0 A;  3SOY A;  3EE1 A;  1QAF A;  3OWS A;  4FMD A;  1OCV A;  2QIY A;  5IEP A;  2ZDJ A;  3CMA 3;  4FMA A;  3VGN A;  1RN7 A;  1ROV A;  4WWU C;  3EN8 A;  1RJO A;  1IVW A;  4R1K A;  4HM6 B;  5STD A;  3CCJ 3;  2OQE A;  3KSP A;  1G96 A;  1SQW A;  3OXA A;  3NM2 A;  3N9H A;  2KCD A;  4G1M B;  4XB5 A;  4AKY A;  8CHO A;  3HK4 A;  3BB9 A;  2HMO B;  2XRX B;  3NM7 A;  4J9A A;  4LEH A;  4KFD A;  1IV7 A;  3B8L A;  1K9M 4;  1YIT 3;  1CYV A;  1W6Y A;  4LGQ A;  5DRE A;  4N6N B;  3T0U A;  1Q7Y 4;  3SXX A;  2P09 A;  1S5A A;  1SII A;  1US1 A;  2CWT A;  3IPT A;  2FNQ A;  4QWT A;  4L7K A;  3OW2 2;  3MWZ A;  1JN5 A;  1O7H B;  2HML B;  1EKM A;  4WP5 A;  3NUV A;  3G4S 3;  4BTW A;  1MOL A;  3EJV A;  3LTA A;  3FSD A;  4H61 A;  1ASK A;  4FCZ A;  3FGY A;  3CPW 2;  3SVA A;  1GYB A;  5AIG A;  1GY7 A;  2I9W A;  4R4K A;  2QA4 3;  3EHC A;  1YIJ 3;  1FGT A;  3SED A;  3OWY A;  4HVN A;  1IDP A;  3CCR 3;  2Z7A A;  3S27 A;  5DRV A;  3X40 A;  5IW9 A;  1W6G A;  4HM3 B;  1OAC A;  4MMZ B;  1O7N B;  2E2U A;  1Q86 4;  2XGN A;  3LT9 A;  1VQN 3;  3Q90 A;  4X2H A;  4FCJ A;  1ZX2 A;  2BNG A;  2KXG A;  2P38 A;  5EEO A;  3QK9 A;  1FA3 A;  4HM7 B;  3FCS B;  3NX0 A;  1S72 3;  4FMC A;  5AYR B;  2WO0 A;  3CU3 A;  3LT8 A;  4K1U A;  4OVM A;  2BMQ B;  3S5C A;  3DGO A;  2CWU A;  1VQ4 3;  3I55 3;  1FGO A;  2YFL B;  3H51 A;  1UI8 A;  5AEW B;  2CFW A;  2XSH B;  1STF I;  3EC9 A;  1TUH A;  5CF1 A;  2E2V A;  4N6T A;  5AIF A;  3X41 A;  1OHS A;  3TDG A;  1W2B 2;  3CC7 3;  3WDG B;  3KN4 A;  4I4K A;  3F9S A;  2Z77 A;  1OGX A;  1JN5 B;  3DGN A;  2D42 A;  2O9U X;  3JUO A;  2UX0 A;  3JUN A;  4N6V 0;  3EB8 A;  5LC7 A;  4BTY A;  3BNE A;  5EVH A;  1CYU A;  3N54 B;  3PZW A;  2CIU A;  4EBG A;  1KC8 4;  1F8N A;  1IVV A;  1W7C A;  1PFP A;  1Q40 B;  3Q1C A;  2PZV A;  3G8Z A;  1U5O A;  3UB1 A;  1JKG A;  3DXO A;  3EQQ B;  3KZT A;  2K54 A;  3GZR A;  3MKI A;  3FF2 A;  3FG4 A;  1O7P B;  1A2K A;  1QJG A;  5IEO A;  1D6Y A;  1OF5 B;  3UJM A;  1M9G A;  2INX A;  1OGZ A;  2OWP A;  1IV9 A;  3F7X A;  1KSI A;  2MF7 A;  4R9L A;  5AII A;  1KQS 2;  3NV0 B;  3ECF A;  1W00 A;  3GZB A;  2P05 A;  4K1V A;  5IEN A;  1LOX A;  1GY6 A;  2Z76 A;  5IG4 A;  3X42 A;  3DUK A;  1OH0 A;  4HZ9 B;  3E99 A;  3T8U A;  3X3X A;  2RCD A;  2W56 B;  1UUV B;  2GEX A;  2XSO B;  5IG0 A;  4ORL A;  2QGU A;  3U97 A;  3KKG A;  5AIH A;  2WGO A;  1A67 A;  1A90 A;  3WMD A;  4XBY A;  1HU9 A;  1FGM A;  3CME 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...