1TFOA

Ribonuclease from escherichia coli complexed with its inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
LDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Colicin D
publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tfoA00
1TFKA 1V74A 1TFOA
chains in the Genus database with same CATH superfamily
1O7NB 1YJW3 1IVXA 4J8TA 1UUWB 2Z7AA 4JF8A 3J7Yd 1QVF2 1C7HA 1BRKA 4MMZB 3S28A 1BSDA 1MOLA 4N3VA 1I70A 3D5IA 4IIAA 5IEPA 1CQSA 3PCSA 3T0UA 4EV5A 4O8SA 1UGIA 4K61A 4NPBA 3OW22 3FGYA 1O7GB 2XGLA 4HM8B 2XFTA 4LYLB 4XBXA 1I3IA 4FCMA 5BIRA 3MG2A 4FCZA 3NBRA 6RNTA 2C10A 4HVNA 4OK0A 3S27A 1IV7A 1JJ22 1O7PB 2F86B 1WMPA 4O02B 1RRLA 3EX9A 3JUMA 3IJEB 5M18A 4XBYA 1JBRA 1STFI 2C4BA 1RGCA 1DMMA 1GOUA 5IW9A 3F8HA 1BSAA 4DKIA 3HZPA 2C11A 4RBNA 1IDPA 1GMPA 1BNJA 3KIIA 1W02A 3AHWA 5BU4A 5ELUA 1Q40B 4RNTA 1CH0A 1JN5B 1IVUA 2YFLB 1FUSA 4NHFA 3Q3FA 3GZRA 5LC6A 2CX0A 1YHQ3 5HOHA 3LT8A 3LOYA 1HYFA 2E2VA 2OOVC 1U5OA 2WOHA 2YFIB 5IG3A 3FF2A 2MC8A 1BUJA 3G4S3 2KCDA 3BLZA 2CHCA 3MPHA 3F9SA 1OACA 1ZGXA 1I8VA 1OPYA 2HMJB 1TP6A 4CCVA 2INXA 2GU3A 2PNCA 1MWRA 1RDSA 2KRTA 2Q07A 3BNDA 3GZXB 4PEJA 2XGNA 1UI7A 1YGEA 5D83A 4XB5A 3KN4A 3KZTA 6GSPA 1K734 4HKVB 5STDA 1N8R4 2CH9A 2Z77A 1JB4A 3ZG5A 4I4KA 3VGNA 3DGMA 3ER7A 1MGRA 1OF5A 2OOVA 1RN1A 2KF3A 1Q40A 1YVSA 7STDA 2F4YA 1M904 1DYUA 2BO9B 3JUOA 3L0RA 1LRAA 5M19A 4X2OA 1W2ZA 1T5YA 3WA2X 1GS3A 1V58A 2W04A 4Q53A 2XSHB 1VQ73 1BVIA 2P09A 3FKAA 2JDIH 3V98A 3N9HA 4WWUC 1A67A 1MNLA 3U1WA 1DVDA 3EHCA 3PXMA 1QAKA 1SIHA 3HX8A 3OXAA 2IYJA 4R1KA 1D6YA 3G713 4KVHA 5KP3A 1TRPA 1OGXA 1UCIA 3GSPA 1A2KA 1I2FA 1LVNA 2W56B 3NV0B 4HM3B 1BSEA 4KZ1A 1FW7A 1DETA 1GY6A 3WHOA 4CJNA 1BRGA 2R4IA 2D42A 1FYSA 4N6V0 2O3OA 3E99A 4GSPA 3CCU3 2CFGA 3QK9A 3A5EA 2OTL3 1JZDA 1TRQA 1LOVA 1LQMB 2CX1A 3I0YA 3WOFB 2P0XA 1OHPA 3EN1B 3EE1A 4AEQA 1YIT3 1OHSA 1WNHA 5EEOA 3UL6A 2WOFA 4HZ9B 1NDOB 1E3VA 1T2IA 1ASKA 1I2EA 3GZYB 3K5TA 1BANA 1NWWA 2Y74A 2W2CA 3OX9A 4CDLA 7RNTA 4HM5B 4N6UA 1KC84 1V57A 2IMJA 4IPBA 3CME3 4WHAA 1RHLA 2BMOB 3NHXA 3CCL3 1TTOA 2W03A 3G16A 4HM7B 3DGLA 2W56A 2PZVA 3FG3A 3NBJA 2KF4A 3K0ZA 1IQYA 3URPA 2CG1A 1OHOA 1VQ43 2P38A 3EB8A 3LXUX 1W6CA 3FSDA 4STDA 1DMNA 3AMOA 1VQQA 1G02A 1VQ93 1JNQA 4EBGA 1R4CA 2XH9A 3HIIA 4FMCA 4N6TA 2XRXB 4NREA 1YNVX 2HOHA 1EA2A 1T2HA 2AADA 4L7KA 1BNIA 3LTAA 4H3UA 1AVKA 4RZMA 4J9AA 3S5CA 1G0TA 1UW1A 5AI1A 2SARA 3X3YA 4CPKA 3V92A 3HOHA 3EQQB 2K0MA 3D4AA 1ROAA 3UJMA 4EW5A 3B4OA 1NU3A 1YI23 4G1MB 3X40A 2W6JH 3AGOA 3T8NA 3WDGB 4AKYA 2QIYA 3SLUA 2IUKA 3G0KA 5IG4A 2HMNB 1B2UA 2IY2A 3FCSB 3UB1A 4KFEA 3U97A 2RGQA 3DH2A 1N8QA 1BIRA 3TDGA 1A2PA 2OQEC 2LYXA 4OVMA 1JBSA 1L5GB 2GU1A 1JZOA 1R4YA 3LMLA 4L8OA 4HM4B 1RN7A 3LTCA 1CYUA 1N5HA 7GSPA 3SOAA 3BU4A 4FCJA 3F14A 1ZS7A 1W5ZA 3CXC2 2CW9A 1TFOA 5ELJA 3D79A 2GBXB 3VF1A 1BRSA 2CG0A 3AGNA 1GD4A 4J5GA 3KCHA 2I9WA 1SPUA 3CCV3 3FLJA 2OQEA 1SARA 3Q90A 1KWIA 3HI7A 1RTUA 3IMAB 3SOYA 2HMOB 2UX0A 3HIGA 1UDII 1JKGB 1IU7A 1KSIA 1QALA 1K28A 1BGSA 2ZA4A 1FGQA 1N9EA 1G96A 1LNHA 1LXEA 5AEWB 1OCVA 3CCR3 3WOEB 1RGLA 4HM6B 5IG0A 1RKYA 2L1SA 2E2TA 4WYKB 2HMMB 4ORLA 1UCJA 1UI8A 3IPTA 4HZBB 2R41A 5A0OB 1TU5A 2H0GA 3EF8A 3V99A 1M1K4 1VQO3 1JRQA 1JB5A 2F98A 3S67A 3CPW2 4WFOA 2GEXA 3DGYA 3EC9A 4I5QA 3PZWA 2L4VA 5IERA 1W6GA 1M1XB 2BMRB 3SEDA 3D9RA 3NBBA 1JN5A 1W2B2 1MWUA 2FNQA 2QGUA 1WMOA 2ML6A 3GZBA 3KSED 2YFJB 3CD63 2OWPA 2GBWB 3ZG0A 1TJDA 1O7HB 3OWYA 5HGRA 1JB2A 1WTHA 1J2BA 1GMQA 1I2GA 5JPUA 2Z76A 1YGWA 4N6LA 1ROVA 1D6ZA 4BTWA 1OH0A 2BHMA 4LEHA 2CIUA 5D82A 1BRIA 1DMQA 3BNCA 2ZDJA 4WYKA 1PYLA 3LTDA 2W0QA 5CXOA 5CF2A 1C54A 1PFPA 3H3HA 1A2VA 2IUJA 5KP4A 1W00A 2BMQB 1AR0A 3FF0A 1N5PA 3OWSA 3UNLA 2CKFB 1U8CB 1AQZA 2M7OA 3X3ZA 2F5WA 3SX1A 1JBTA 4R4KA 5RNTA 3CNXA 8RNTA 4K1UA 3JUPA 3LH4A 1TUHA 4LMIA 5AYRB 1BRJA 1UGHI 2KF6A 3DUKA 3EJVA 3LTBA 3Q1CA 3Q2PA 5EQLA 3RGRA 3WMDA 3BNEA 2K3DA 2V1LA 1BUQA 1GD3A 4MEIA 1KD14 3X3XA 5CLKA 1I0VA 3ROBA 5IG5A 3G6E3 3DM8A 4LSOA 1GYBA 2W9QA 4FR9A 3CCQ3 1HZ1A 2RCDA 3CNMA 3CCS3 1LNIA 1W01A 2ZL8A 3VSYA 3NV0A 4AKZA 1Q824 1FUWA 4MJDA 5EVHA 3KKGA 4JRFA 1NB5I 1X1YA 1FGMA 3F8XA 2H0HA 4R9KA 1B2ZA 4XDWA 3GRDA 2YX9A 3B7CA 3MKIA 2CFKA 4GL6A 1UCKA 1EQKA 2HMLB 5BXQA 5IF6A 6STDA 2QEX3 1W4NA 1WMNA 3FG4A 1FZUA 1NB3I 4RNYA 5KP1A 1BNRA 2W9PA 3K7CA 1RMSA 1T3BA 3KFQC 1AVLA 1N9JA 3JUQA 3MG3A 3MWZA 2E2UA 1OGZA 3NM2A 4H61A 5AIGA 3B8LA 4WP5A 3RDEA 5D81A 1FA3A 3CCM3 1B27A 1ISKA 2MF7A 1BRHA 1O7MB 1RNBA 1VQ63 1QMAA 1I3FA 3OV4A 4K1VA 4EC6A 4BTXA 1CEWI 4K90B 1RLSA 4FMDA 1RJOA 1YIJ3 4R80A 3GAXA 1MGWA 4U13A 2P0MA 2B24B 1LQGC 3DMCA 2P05A 2F99A 3SXXA 2OCTA 2D1WA 3EBTA 3MHEA 1Y4KA 1IQ8A 1BU4A 1RRHA 2BNGA 2QA43 1X1UA 2WGQA 5IEOA 1QAFA 1W6YA 2AAEA 2XEPA 3T8UA 3ALAA 4HBRA 4OUQA 2GXFA 2STDA 3NQYA 1VQ83 1EUIC 1DVCA 1US1A 3MG1A 1ULIB 1YVBI 4XDVA 1S723 4XM4A 1Q7Y4 3PCRA 4EYCA 2A15A 1QJGA 5G1KA 1NO3A 1FUTA 4FMAA 5AIHA 1VQL3 1IQXA 1EKMA 4GB5A 1RGKA 3D5GA 1BAOA 1GMRA 1VQK3 2WGOA 4MMYB 1RNTA 3DZLA 2F5MA 3NXJA 5IENA 3CC43 5AYSC 3ECFA 4BL2A 2FGTA 3MYTA 4KT3B 4R9LA 4EXRA 1X1WA 1EG9B 3D3LA 4TX4A 2OTJ3 1RGGA 2XF3A 2XFSA 1EEJA 1IVVA 4EV2A 3CCJ3 1FGTA 5GSPA 2BU4A 1K41A 3BB9A 1BNFA 5G1LA 3CMA3 3EBYA 2RNTA 1AV4A 3FZWA 4N6MA 5AEUB 4BU4A 1RGHA 1WQLB 1MWTA 1B2SA 1M9GA 2BT3A 3STDA 1OF5B 1X1XA 5CF1A 3RNTA 3JVCA 4HYZA 1K8A4 1GY5A 1V74A 1RCKA 2SBLA 2Z6BA 1A90A 1NNVA 1RGAA 2CWUA 1IT8A 3I563 2WO0A 1YJ93 2BIRA 3PGBA 1Q864 1QVG2 1B2MA 5I97A 1O7WB 2UUGC 3X42A 1JKGA 4BL3A 5G2GA 4HJLB 2KAAA 2KXGA 2HMKB 4ZM8A 4HOHA 1GSPA 4IT7A 3BIRA 2CWVA 3NM7A 5DREA 2ZHXB 1FGRA 1GY7A 4N6OB 1B3SA 5M1AA 2CWTA 3NUVA 3A76A 1ZX2A 2CFLA 3SYUA 1SIIA 1IYYA 1SQWA 3UL5A 1CYVA 4HM1B 4O2HA 2B1XB 1RCLA 1W7CA 3GWRA 1Q9EA 3JUNA 5AIIA 3CC73 2RFRA 3WODG 3DGNA 2K54A 1OUNA 1E3RA 1RGEA 2KF5A 3FG1A 3O8YA 3ZFZA 3G8ZA 3WA3A 2GSPA 2XR8B 1GOVA 1IK3A 1TIJA 1IVWA 3PYJA 3QRDA 5CK6A 1BNGA 1JV2B 3K9MC 3FH1A 3N54B 4BIRA 1PU4A 3CPOA 3HK4A 2UGIA 4MMXB 1VQM3 1Q7HA 1NJI4 3CC23 3BNBA 4N6NB 3WR2A 1RGFA 3I553 5AIFA 3KE7A 2H0IA 5BVBA 9RNTA 4FMBA 3SVAA 2XSOB 5JBSA 3M8CA 3NX0A 4LGQA 1Q42A 4KFDA 3KSPA 1RSNA 3EN8A 1BRNL 1HKXA 1K9M4 1GOYA 1LOWA 3F7SA 4O3VA 5LC7A 1BSCA 1AY7A 3AMOB 4HM0B 1B21A 2GEYA 5JPPA 1BNSA 1STDA 3F7XA 4XBTA 3LZAA 1RN4A 2CK3H 2JQ5A 5FGOA 3LT9A 1ZO2A 1Z1SA 1IT7A 4KFFA 1UCLA 1YJN3 3AHSA 1HU9A 3MSOA 1BNEA 1VQP3 3PS8A 1BOXA 1D6UA 1UUVB 4RNZA 1KQS2 3NQZA 5FW5A 1SJWA 3N8BA 4QWTA 4L8PA 3CCE3 3H51A 1I0XA 1Q814 1LOYA 2CFWA 1ULJB 2J8XB 4HM2B 1B2XA 3F40A 1TFKA 5TGNA 1S5AA 1F8NA 2RSXA 1VZZA 2F56A 3S29A 2CFDA 1BSBA 4LZIA 1DE3A 3DGOA 3RGAA 2IA7A 4BTYA 4J5KA 1B20A 8CHOA 3OWUA 1VQ53 3DY5A 3B4PA 1MWSA 3LYGA 2Y73A 3X41A 1LOXA 2FXTA 4HAAA 2O9UX 5DRVA 4GHOA 4ILFA 3DXOA 1PY3A 2CC3A 2ML5A 1UUGB 4X2HA 1VQN3 3CU3A 2RBIA 1E97A 3K63A 2LQVA 1IV9A 1FGOA
chains in the Genus database with same CATH topology
1O7NB 1YJW3 1IVXA 4J8TA 1UUWB 2Z7AA 4JF8A 3J7Yd 1QVF2 1C7HA 4MMZB 3S28A 1MOLA 4N3VA 4IIAA 5IEPA 1CQSA 3PCSA 3T0UA 4EV5A 4O8SA 4K61A 3OW22 3FGYA 1O7GB 2XGLA 4HM8B 2XFTA 4XBXA 4FCMA 3MG2A 4FCZA 3NBRA 2C10A 4HVNA 4OK0A 3S27A 1IV7A 1JJ22 1O7PB 2F86B 1WMPA 4O02B 1RRLA 3EX9A 3JUMA 3IJEB 4XBYA 1STFI 1DMMA 5IW9A 3F8HA 3HZPA 2C11A 4RBNA 1IDPA 3KIIA 1W02A 5ELUA 1Q40B 1JN5B 1IVUA 2YFLB 4NHFA 3GZRA 5LC6A 1YHQ3 3LT8A 3LOYA 2E2VA 2OOVC 1U5OA 2WOHA 2YFIB 5IG3A 3FF2A 2MC8A 3G4S3 2KCDA 3BLZA 2CHCA 3MPHA 3F9SA 1OACA 1OPYA 2HMJB 1TP6A 4CCVA 2INXA 2GU3A 2PNCA 2KRTA 2Q07A 3BNDA 3GZXB 4PEJA 2XGNA 1UI7A 1YGEA 5D83A 4XB5A 3KN4A 3KZTA 1K734 1N8R4 4HKVB 5STDA 2CH9A 2Z77A 1JB4A 4I4KA 3VGNA 3DGMA 3ER7A 1OF5A 2OOVA 1Q40A 7STDA 1M904 1DYUA 2BO9B 3JUOA 3L0RA 4X2OA 1W2ZA 1T5YA 3WA2X 1GS3A 4Q53A 2W04A 2XSHB 1VQ73 2P09A 3FKAA 2JDIH 3V98A 3N9HA 4WWUC 1A67A 1MNLA 3U1WA 1DVDA 3EHCA 3PXMA 1QAKA 1SIHA 3HX8A 3OXAA 4R1KA 1D6YA 3G713 4KVHA 5KP3A 1OGXA 1A2KA 1LVNA 3NV0B 2W56B 4HM3B 4KZ1A 1GY6A 2R4IA 2D42A 4N6V0 2O3OA 3E99A 3CCU3 2CFGA 3QK9A 2OTL3 3WOFB 3I0YA 2P0XA 1OHPA 3EN1B 3EE1A 4AEQA 1YIT3 1OHSA 1WNHA 5EEOA 3UL6A 2WOFA 4HZ9B 1NDOB 1E3VA 1ASKA 3GZYB 3K5TA 1NWWA 2Y74A 2W2CA 3OX9A 4CDLA 4HM5B 4N6UA 1KC84 2IMJA 3CME3 4IPBA 4WHAA 2BMOB 3NHXA 3CCL3 2W03A 3G16A 4HM7B 3DGLA 2W56A 2PZVA 3FG3A 3NBJA 3K0ZA 1IQYA 2CG1A 1OHOA 1VQ43 2P38A 3EB8A 3LXUX 1W6CA 3FSDA 4STDA 1DMNA 3AMOA 1VQ93 1JNQA 4EBGA 1R4CA 2XH9A 3HIIA 4FMCA 4N6TA 2XRXB 4NREA 4L7KA 1EA2A 3LTAA 4H3UA 1AVKA 4RZMA 4J9AA 3S5CA 1UW1A 5AI1A 3X3YA 3V92A 3EQQB 2K0MA 1ROAA 3UJMA 3B4OA 1NU3A 1YI23 4G1MB 3X40A 2W6JH 3T8NA 3WDGB 4AKYA 2QIYA 3SLUA 2IUKA 3G0KA 5IG4A 2HMNB 3FCSB 3UB1A 4KFEA 3U97A 2RGQA 1N8QA 3TDGA 4OVMA 2OQEC 2LYXA 1L5GB 2GU1A 3LMLA 4L8OA 4HM4B 1RN7A 3LTCA 1CYUA 1N5HA 3SOAA 4FCJA 3F14A 1W5ZA 3CXC2 2CW9A 1TFOA 5ELJA 2GBXB 3VF1A 2CG0A 1GD4A 2I9WA 1SPUA 3CCV3 3FLJA 2OQEA 3Q90A 1KWIA 3HI7A 3IMAB 3SOYA 2HMOB 2UX0A 3HIGA 1JKGB 1IU7A 1KSIA 1QALA 1K28A 1FGQA 1N9EA 1G96A 1LNHA 1LXEA 5AEWB 1OCVA 3CCR3 3WOEB 4HM6B 5IG0A 1RKYA 2E2TA 4WYKB 2HMMB 4ORLA 1UI8A 3IPTA 4HZBB 5A0OB 1TU5A 3EF8A 3V99A 1M1K4 1VQO3 1JRQA 1JB5A 2F98A 3S67A 3CPW2 4WFOA 2GEXA 3EC9A 3PZWA 2L4VA 5IERA 1W6GA 1M1XB 2BMRB 3SEDA 3D9RA 3NBBA 1JN5A 1W2B2 2FNQA 2QGUA 3GZBA 1WMOA 2ML6A 3CD63 3KSED 2YFJB 2OWPA 2GBWB 1O7HB 3OWYA 5HGRA 1JB2A 1WTHA 1J2BA 5JPUA 2Z76A 4N6LA 1ROVA 1D6ZA 4BTWA 1OH0A 2BHMA 4LEHA 2CIUA 5D82A 1DMQA 3BNCA 2ZDJA 4WYKA 3LTDA 5CF2A 2W0QA 5CXOA 1PFPA 3H3HA 1A2VA 2IUJA 5KP4A 1W00A 2BMQB 1AR0A 3FF0A 1N5PA 3OWSA 3UNLA 2CKFB 1U8CB 2M7OA 3X3ZA 3SX1A 4R4KA 3CNXA 4K1UA 3JUPA 3LH4A 1TUHA 4LMIA 5AYRB 3WMDA 3DUKA 3EJVA 3LTBA 3Q1CA 3Q2PA 5EQLA 3RGRA 3BNEA 2V1LA 1BUQA 1GD3A 4MEIA 1KD14 3X3XA 5CLKA 5IG5A 3ROBA 3G6E3 3DM8A 4LSOA 1GYBA 2W9QA 4FR9A 3CCQ3 2RCDA 3CNMA 3CCS3 1W01A 2ZL8A 3VSYA 4AKZA 3NV0A 1Q824 1FUWA 4MJDA 5EVHA 3KKGA 4JRFA 1NB5I 1FGMA 3F8XA 4R9KA 4XDWA 3GRDA 2YX9A 3B7CA 3MKIA 2CFKA 4GL6A 1EQKA 2HMLB 5BXQA 5IF6A 6STDA 2QEX3 1W4NA 1WMNA 3FG4A 1NB3I 4RNYA 5KP1A 2W9PA 3K7CA 3KFQC 1AVLA 1N9JA 3JUQA 3MG3A 3MWZA 2E2UA 1OGZA 3NM2A 4H61A 5AIGA 3B8LA 4WP5A 3RDEA 5D81A 1FA3A 3CCM3 1ISKA 2MF7A 1O7MB 1VQ63 1QMAA 3OV4A 4K1VA 4EC6A 4BTXA 1CEWI 4K90B 4FMDA 1RJOA 1YIJ3 4R80A 3GAXA 4U13A 2P0MA 2B24B 3DMCA 2P05A 2F99A 3SXXA 2OCTA 2D1WA 3EBTA 3MHEA 1Y4KA 1IQ8A 1RRHA 2BNGA 2QA43 2WGQA 5IEOA 1QAFA 1W6YA 2XEPA 3T8UA 3ALAA 4HBRA 4OUQA 2GXFA 2STDA 3NQYA 1VQ83 1US1A 1DVCA 3MG1A 4XDVA 1ULIB 1YVBI 1S723 1Q7Y4 4XM4A 3PCRA 4EYCA 2A15A 1QJGA 1NO3A 4FMAA 5AIHA 1VQL3 1IQXA 1EKMA 4GB5A 1VQK3 2WGOA 4MMYB 3DZLA 3NXJA 5IENA 3CC43 5AYSC 3ECFA 2FGTA 3MYTA 4R9LA 4EXRA 1EG9B 3D3LA 4TX4A 2OTJ3 2XF3A 2XFSA 3CCJ3 1IVVA 4EV2A 1FGTA 1K41A 3BB9A 3CMA3 3EBYA 1AV4A 3FZWA 4N6MA 5AEUB 1WQLB 1M9GA 2BT3A 3STDA 1OF5B 5CF1A 3JVCA 4HYZA 1K8A4 1GY5A 1V74A 2SBLA 2Z6BA 1A90A 2CWUA 1Q864 1IT8A 3I563 2WO0A 1YJ93 3PGBA 1QVG2 5I97A 1O7WB 3X42A 1JKGA 5G2GA 4HJLB 2KXGA 2HMKB 4ZM8A 4IT7A 2CWVA 3NM7A 5DREA 1FGRA 1GY7A 4N6OB 2CWTA 3NUVA 3A76A 1ZX2A 2CFLA 1SIIA 1SQWA 3UL5A 1CYVA 4HM1B 4O2HA 2B1XB 1W7CA 3GWRA 3JUNA 5AIIA 3CC73 2RFRA 3WODG 3DGNA 2K54A 1OUNA 1E3RA 3FG1A 3O8YA 3WA3A 3G8ZA 2XR8B 1IK3A 1TIJA 1IVWA 3PYJA 3QRDA 5CK6A 1JV2B 3K9MC 3N54B 3FH1A 1PU4A 3CPOA 3HK4A 4MMXB 1VQM3 1NJI4 3CC23 3BNBA 4N6NB 3I553 5AIFA 3KE7A 5BVBA 5JBSA 4FMBA 3SVAA 2XSOB 3M8CA 3NX0A 4LGQA 1Q42A 4KFDA 3KSPA 3EN8A 1HKXA 1K9M4 4O3VA 3F7SA 5LC7A 3AMOB 4HM0B 2GEYA 5JPPA 1STDA 3F7XA 4XBTA 3LZAA 2CK3H 2JQ5A 5FGOA 3LT9A 1ZO2A 1Z1SA 1IT7A 4KFFA 1YJN3 1HU9A 3MSOA 1VQP3 3PS8A 1D6UA 1UUVB 4RNZA 1KQS2 3NQZA 5FW5A 1SJWA 3N8BA 4QWTA 4L8PA 3CCE3 3H51A 1Q814 2CFWA 1ULJB 4HM2B 3F40A 1TFKA 5TGNA 1S5AA 1F8NA 2RSXA 1VZZA 3S29A 2CFDA 4LZIA 3DGOA 3RGAA 2IA7A 4BTYA 8CHOA 3OWUA 1VQ53 3DY5A 3B4PA 3LYGA 2Y73A 3X41A 1LOXA 2FXTA 2O9UX 5DRVA 3DXOA 2ML5A 2CC3A 4X2HA 1VQN3 3CU3A 1E97A 3K63A 2LQVA 1IV9A 1FGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFK A;  1V74 A;  1TFO A; 
#chains in the Genus database with same CATH topology
 1O7N B;  1YJW 3;  1IVX A;  4J8T A;  1UUW B;  2Z7A A;  4JF8 A;  3J7Y d;  1QVF 2;  1C7H A;  1BRK A;  4MMZ B;  3S28 A;  1BSD A;  1MOL A;  4N3V A;  1I70 A;  3D5I A;  4IIA A;  5IEP A;  1CQS A;  3PCS A;  3T0U A;  4EV5 A;  4O8S A;  1UGI A;  4K61 A;  4NPB A;  3OW2 2;  3FGY A;  1O7G B;  2XGL A;  4HM8 B;  2XFT A;  4LYL B;  4XBX A;  1I3I A;  4FCM A;  5BIR A;  3MG2 A;  4FCZ A;  3NBR A;  6RNT A;  2C10 A;  4HVN A;  4OK0 A;  3S27 A;  1IV7 A;  1JJ2 2;  1O7P B;  2F86 B;  1WMP A;  4O02 B;  1RRL A;  3EX9 A;  3JUM A;  3IJE B;  5M18 A;  4XBY A;  1JBR A;  1STF I;  2C4B A;  1RGC A;  1DMM A;  1GOU A;  5IW9 A;  3F8H A;  1BSA A;  4DKI A;  3HZP A;  2C11 A;  4RBN A;  1IDP A;  1GMP A;  1BNJ A;  3KII A;  1W02 A;  3AHW A;  5BU4 A;  5ELU A;  1Q40 B;  4RNT A;  1CH0 A;  1JN5 B;  1IVU A;  2YFL B;  1FUS A;  4NHF A;  3Q3F A;  3GZR A;  5LC6 A;  2CX0 A;  1YHQ 3;  5HOH A;  3LT8 A;  3LOY A;  1HYF A;  2E2V A;  2OOV C;  1U5O A;  2WOH A;  2YFI B;  5IG3 A;  3FF2 A;  2MC8 A;  1BUJ A;  3G4S 3;  2KCD A;  3BLZ A;  2CHC A;  3MPH A;  3F9S A;  1OAC A;  1ZGX A;  1I8V A;  1OPY A;  2HMJ B;  1TP6 A;  4CCV A;  2INX A;  2GU3 A;  2PNC A;  1MWR A;  1RDS A;  2KRT A;  2Q07 A;  3BND A;  3GZX B;  4PEJ A;  2XGN A;  1UI7 A;  1YGE A;  5D83 A;  4XB5 A;  3KN4 A;  3KZT A;  6GSP A;  1K73 4;  4HKV B;  5STD A;  1N8R 4;  2CH9 A;  2Z77 A;  1JB4 A;  3ZG5 A;  4I4K A;  3VGN A;  3DGM A;  3ER7 A;  1MGR A;  1OF5 A;  2OOV A;  1RN1 A;  2KF3 A;  1Q40 A;  1YVS A;  7STD A;  2F4Y A;  1M90 4;  1DYU A;  2BO9 B;  3JUO A;  3L0R A;  1LRA A;  5M19 A;  4X2O A;  1W2Z A;  1T5Y A;  3WA2 X;  1GS3 A;  1V58 A;  2W04 A;  4Q53 A;  2XSH B;  1VQ7 3;  1BVI A;  2P09 A;  3FKA A;  2JDI H;  3V98 A;  3N9H A;  4WWU C;  1A67 A;  1MNL A;  3U1W A;  1DVD A;  3EHC A;  3PXM A;  1QAK A;  1SIH A;  3HX8 A;  3OXA A;  2IYJ A;  4R1K A;  1D6Y A;  3G71 3;  4KVH A;  5KP3 A;  1TRP A;  1OGX A;  1UCI A;  3GSP A;  1A2K A;  1I2F A;  1LVN A;  2W56 B;  3NV0 B;  4HM3 B;  1BSE A;  4KZ1 A;  1FW7 A;  1DET A;  1GY6 A;  3WHO A;  4CJN A;  1BRG A;  2R4I A;  2D42 A;  1FYS A;  4N6V 0;  2O3O A;  3E99 A;  4GSP A;  3CCU 3;  2CFG A;  3QK9 A;  3A5E A;  2OTL 3;  1JZD A;  1TRQ A;  1LOV A;  1LQM B;  2CX1 A;  3I0Y A;  3WOF B;  2P0X A;  1OHP A;  3EN1 B;  3EE1 A;  4AEQ A;  1YIT 3;  1OHS A;  1WNH A;  5EEO A;  3UL6 A;  2WOF A;  4HZ9 B;  1NDO B;  1E3V A;  1T2I A;  1ASK A;  1I2E A;  3GZY B;  3K5T A;  1BAN A;  1NWW A;  2Y74 A;  2W2C A;  3OX9 A;  4CDL A;  7RNT A;  4HM5 B;  4N6U A;  1KC8 4;  1V57 A;  2IMJ A;  4IPB A;  3CME 3;  4WHA A;  1RHL A;  2BMO B;  3NHX A;  3CCL 3;  1TTO A;  2W03 A;  3G16 A;  4HM7 B;  3DGL A;  2W56 A;  2PZV A;  3FG3 A;  3NBJ A;  2KF4 A;  3K0Z A;  1IQY A;  3URP A;  2CG1 A;  1OHO A;  1VQ4 3;  2P38 A;  3EB8 A;  3LXU X;  1W6C A;  3FSD A;  4STD A;  1DMN A;  3AMO A;  1VQQ A;  1G02 A;  1VQ9 3;  1JNQ A;  4EBG A;  1R4C A;  2XH9 A;  3HII A;  4FMC A;  4N6T A;  2XRX B;  4NRE A;  1YNV X;  2HOH A;  1EA2 A;  1T2H A;  2AAD A;  4L7K A;  1BNI A;  3LTA A;  4H3U A;  1AVK A;  4RZM A;  4J9A A;  3S5C A;  1G0T A;  1UW1 A;  5AI1 A;  2SAR A;  3X3Y A;  4CPK A;  3V92 A;  3HOH A;  3EQQ B;  2K0M A;  3D4A A;  1ROA A;  3UJM A;  4EW5 A;  3B4O A;  1NU3 A;  1YI2 3;  4G1M B;  3X40 A;  2W6J H;  3AGO A;  3T8N A;  3WDG B;  4AKY A;  2QIY A;  3SLU A;  2IUK A;  3G0K A;  5IG4 A;  2HMN B;  1B2U A;  2IY2 A;  3FCS B;  3UB1 A;  4KFE A;  3U97 A;  2RGQ A;  3DH2 A;  1N8Q A;  1BIR A;  3TDG A;  1A2P A;  2OQE C;  2LYX A;  4OVM A;  1JBS A;  1L5G B;  2GU1 A;  1JZO A;  1R4Y A;  3LML A;  4L8O A;  4HM4 B;  1RN7 A;  3LTC A;  1CYU A;  1N5H A;  7GSP A;  3SOA A;  3BU4 A;  4FCJ A;  3F14 A;  1ZS7 A;  1W5Z A;  3CXC 2;  2CW9 A;  1TFO A;  5ELJ A;  3D79 A;  2GBX B;  3VF1 A;  1BRS A;  2CG0 A;  3AGN A;  1GD4 A;  4J5G A;  3KCH A;  2I9W A;  1SPU A;  3CCV 3;  3FLJ A;  2OQE A;  1SAR A;  3Q90 A;  1KWI A;  3HI7 A;  1RTU A;  3IMA B;  3SOY A;  2HMO B;  2UX0 A;  3HIG A;  1UDI I;  1JKG B;  1IU7 A;  1KSI A;  1QAL A;  1K28 A;  1BGS A;  2ZA4 A;  1FGQ A;  1N9E A;  1G96 A;  1LNH A;  1LXE A;  5AEW B;  1OCV A;  3CCR 3;  3WOE B;  1RGL A;  4HM6 B;  5IG0 A;  1RKY A;  2L1S A;  2E2T A;  4WYK B;  2HMM B;  4ORL A;  1UCJ A;  1UI8 A;  3IPT A;  4HZB B;  2R41 A;  5A0O B;  1TU5 A;  2H0G A;  3EF8 A;  3V99 A;  1M1K 4;  1VQO 3;  1JRQ A;  1JB5 A;  2F98 A;  3S67 A;  3CPW 2;  4WFO A;  2GEX A;  3DGY A;  3EC9 A;  4I5Q A;  3PZW A;  2L4V A;  5IER A;  1W6G A;  1M1X B;  2BMR B;  3SED A;  3D9R A;  3NBB A;  1JN5 A;  1W2B 2;  1MWU A;  2FNQ A;  2QGU A;  1WMO A;  2ML6 A;  3GZB A;  3KSE D;  2YFJ B;  3CD6 3;  2OWP A;  2GBW B;  3ZG0 A;  1TJD A;  1O7H B;  3OWY A;  5HGR A;  1JB2 A;  1WTH A;  1J2B A;  1GMQ A;  1I2G A;  5JPU A;  2Z76 A;  1YGW A;  4N6L A;  1ROV A;  1D6Z A;  4BTW A;  1OH0 A;  2BHM A;  4LEH A;  2CIU A;  5D82 A;  1BRI A;  1DMQ A;  3BNC A;  2ZDJ A;  4WYK A;  1PYL A;  3LTD A;  2W0Q A;  5CXO A;  5CF2 A;  1C54 A;  1PFP A;  3H3H A;  1A2V A;  2IUJ A;  5KP4 A;  1W00 A;  2BMQ B;  1AR0 A;  3FF0 A;  1N5P A;  3OWS A;  3UNL A;  2CKF B;  1U8C B;  1AQZ A;  2M7O A;  3X3Z A;  2F5W A;  3SX1 A;  1JBT A;  4R4K A;  5RNT A;  3CNX A;  8RNT A;  4K1U A;  3JUP A;  3LH4 A;  1TUH A;  4LMI A;  5AYR B;  1BRJ A;  1UGH I;  2KF6 A;  3DUK A;  3EJV A;  3LTB A;  3Q1C A;  3Q2P A;  5EQL A;  3RGR A;  3WMD A;  3BNE A;  2K3D A;  2V1L A;  1BUQ A;  1GD3 A;  4MEI A;  1KD1 4;  3X3X A;  5CLK A;  1I0V A;  3ROB A;  5IG5 A;  3G6E 3;  3DM8 A;  4LSO A;  1GYB A;  2W9Q A;  4FR9 A;  3CCQ 3;  1HZ1 A;  2RCD A;  3CNM A;  3CCS 3;  1LNI A;  1W01 A;  2ZL8 A;  3VSY A;  3NV0 A;  4AKZ A;  1Q82 4;  1FUW A;  4MJD A;  5EVH A;  3KKG A;  4JRF A;  1NB5 I;  1X1Y A;  1FGM A;  3F8X A;  2H0H A;  4R9K A;  1B2Z A;  4XDW A;  3GRD A;  2YX9 A;  3B7C A;  3MKI A;  2CFK A;  4GL6 A;  1UCK A;  1EQK A;  2HML B;  5BXQ A;  5IF6 A;  6STD A;  2QEX 3;  1W4N A;  1WMN A;  3FG4 A;  1FZU A;  1NB3 I;  4RNY A;  5KP1 A;  1BNR A;  2W9P A;  3K7C A;  1RMS A;  1T3B A;  3KFQ C;  1AVL A;  1N9J A;  3JUQ A;  3MG3 A;  3MWZ A;  2E2U A;  1OGZ A;  3NM2 A;  4H61 A;  5AIG A;  3B8L A;  4WP5 A;  3RDE A;  5D81 A;  1FA3 A;  3CCM 3;  1B27 A;  1ISK A;  2MF7 A;  1BRH A;  1O7M B;  1RNB A;  1VQ6 3;  1QMA A;  1I3F A;  3OV4 A;  4K1V A;  4EC6 A;  4BTX A;  1CEW I;  4K90 B;  1RLS A;  4FMD A;  1RJO A;  1YIJ 3;  4R80 A;  3GAX A;  1MGW A;  4U13 A;  2P0M A;  2B24 B;  1LQG C;  3DMC A;  2P05 A;  2F99 A;  3SXX A;  2OCT A;  2D1W A;  3EBT A;  3MHE A;  1Y4K A;  1IQ8 A;  1BU4 A;  1RRH A;  2BNG A;  2QA4 3;  1X1U A;  2WGQ A;  5IEO A;  1QAF A;  1W6Y A;  2AAE A;  2XEP A;  3T8U A;  3ALA A;  4HBR A;  4OUQ A;  2GXF A;  2STD A;  3NQY A;  1VQ8 3;  1EUI C;  1DVC A;  1US1 A;  3MG1 A;  1ULI B;  1YVB I;  4XDV A;  1S72 3;  4XM4 A;  1Q7Y 4;  3PCR A;  4EYC A;  2A15 A;  1QJG A;  5G1K A;  1NO3 A;  1FUT A;  4FMA A;  5AIH A;  1VQL 3;  1IQX A;  1EKM A;  4GB5 A;  1RGK A;  3D5G A;  1BAO A;  1GMR A;  1VQK 3;  2WGO A;  4MMY B;  1RNT A;  3DZL A;  2F5M A;  3NXJ A;  5IEN A;  3CC4 3;  5AYS C;  3ECF A;  4BL2 A;  2FGT A;  3MYT A;  4KT3 B;  4R9L A;  4EXR A;  1X1W A;  1EG9 B;  3D3L A;  4TX4 A;  2OTJ 3;  1RGG A;  2XF3 A;  2XFS A;  1EEJ A;  1IVV A;  4EV2 A;  3CCJ 3;  1FGT A;  5GSP A;  2BU4 A;  1K41 A;  3BB9 A;  1BNF A;  5G1L A;  3CMA 3;  3EBY A;  2RNT A;  1AV4 A;  3FZW A;  4N6M A;  5AEU B;  4BU4 A;  1RGH A;  1WQL B;  1MWT A;  1B2S A;  1M9G A;  2BT3 A;  3STD A;  1OF5 B;  1X1X A;  5CF1 A;  3RNT A;  3JVC A;  4HYZ A;  1K8A 4;  1GY5 A;  1V74 A;  1RCK A;  2SBL A;  2Z6B A;  1A90 A;  1NNV A;  1RGA A;  2CWU A;  1IT8 A;  3I56 3;  2WO0 A;  1YJ9 3;  2BIR A;  3PGB A;  1Q86 4;  1QVG 2;  1B2M A;  5I97 A;  1O7W B;  2UUG C;  3X42 A;  1JKG A;  4BL3 A;  5G2G A;  4HJL B;  2KAA A;  2KXG A;  2HMK B;  4ZM8 A;  4HOH A;  1GSP A;  4IT7 A;  3BIR A;  2CWV A;  3NM7 A;  5DRE A;  2ZHX B;  1FGR A;  1GY7 A;  4N6O B;  1B3S A;  5M1A A;  2CWT A;  3NUV A;  3A76 A;  1ZX2 A;  2CFL A;  3SYU A;  1SII A;  1IYY A;  1SQW A;  3UL5 A;  1CYV A;  4HM1 B;  4O2H A;  2B1X B;  1RCL A;  1W7C A;  3GWR A;  1Q9E A;  3JUN A;  5AII A;  3CC7 3;  2RFR A;  3WOD G;  3DGN A;  2K54 A;  1OUN A;  1E3R A;  1RGE A;  2KF5 A;  3FG1 A;  3O8Y A;  3ZFZ A;  3G8Z A;  3WA3 A;  2GSP A;  2XR8 B;  1GOV A;  1IK3 A;  1TIJ A;  1IVW A;  3PYJ A;  3QRD A;  5CK6 A;  1BNG A;  1JV2 B;  3K9M C;  3FH1 A;  3N54 B;  4BIR A;  1PU4 A;  3CPO A;  3HK4 A;  2UGI A;  4MMX B;  1VQM 3;  1Q7H A;  1NJI 4;  3CC2 3;  3BNB A;  4N6N B;  3WR2 A;  1RGF A;  3I55 3;  5AIF A;  3KE7 A;  2H0I A;  5BVB A;  9RNT A;  4FMB A;  3SVA A;  2XSO B;  5JBS A;  3M8C A;  3NX0 A;  4LGQ A;  1Q42 A;  4KFD A;  3KSP A;  1RSN A;  3EN8 A;  1BRN L;  1HKX A;  1K9M 4;  1GOY A;  1LOW A;  3F7S A;  4O3V A;  5LC7 A;  1BSC A;  1AY7 A;  3AMO B;  4HM0 B;  1B21 A;  2GEY A;  5JPP A;  1BNS A;  1STD A;  3F7X A;  4XBT A;  3LZA A;  1RN4 A;  2CK3 H;  2JQ5 A;  5FGO A;  3LT9 A;  1ZO2 A;  1Z1S A;  1IT7 A;  4KFF A;  1UCL A;  1YJN 3;  3AHS A;  1HU9 A;  3MSO A;  1BNE A;  1VQP 3;  3PS8 A;  1BOX A;  1D6U A;  1UUV B;  4RNZ A;  1KQS 2;  3NQZ A;  5FW5 A;  1SJW A;  3N8B A;  4QWT A;  4L8P A;  3CCE 3;  3H51 A;  1I0X A;  1Q81 4;  1LOY A;  2CFW A;  1ULJ B;  2J8X B;  4HM2 B;  1B2X A;  3F40 A;  1TFK A;  5TGN A;  1S5A A;  1F8N A;  2RSX A;  1VZZ A;  2F56 A;  3S29 A;  2CFD A;  1BSB A;  4LZI A;  1DE3 A;  3DGO A;  3RGA A;  2IA7 A;  4BTY A;  4J5K A;  1B20 A;  8CHO A;  3OWU A;  1VQ5 3;  3DY5 A;  3B4P A;  1MWS A;  3LYG A;  2Y73 A;  3X41 A;  1LOX A;  2FXT A;  4HAA A;  2O9U X;  5DRV A;  4GHO A;  4ILF A;  3DXO A;  1PY3 A;  2CC3 A;  2ML5 A;  1UUG B;  4X2H A;  1VQN 3;  3CU3 A;  2RBI A;  1E97 A;  3K63 A;  2LQV A;  1IV9 A;  1FGO A; 
#chains in the Genus database with same CATH homology
 1O7N B;  1YJW 3;  1IVX A;  4J8T A;  1UUW B;  2Z7A A;  4JF8 A;  3J7Y d;  1QVF 2;  1C7H A;  4MMZ B;  3S28 A;  1MOL A;  4N3V A;  4IIA A;  5IEP A;  1CQS A;  3PCS A;  3T0U A;  4EV5 A;  4O8S A;  4K61 A;  3OW2 2;  3FGY A;  1O7G B;  2XGL A;  4HM8 B;  2XFT A;  4XBX A;  4FCM A;  3MG2 A;  4FCZ A;  3NBR A;  2C10 A;  4HVN A;  4OK0 A;  3S27 A;  1IV7 A;  1JJ2 2;  1O7P B;  2F86 B;  1WMP A;  4O02 B;  1RRL A;  3EX9 A;  3JUM A;  3IJE B;  4XBY A;  1STF I;  1DMM A;  5IW9 A;  3F8H A;  3HZP A;  2C11 A;  4RBN A;  1IDP A;  3KII A;  1W02 A;  5ELU A;  1Q40 B;  1JN5 B;  1IVU A;  2YFL B;  4NHF A;  3GZR A;  5LC6 A;  1YHQ 3;  3LT8 A;  3LOY A;  2E2V A;  2OOV C;  1U5O A;  2WOH A;  2YFI B;  5IG3 A;  3FF2 A;  2MC8 A;  3G4S 3;  2KCD A;  3BLZ A;  2CHC A;  3MPH A;  3F9S A;  1OAC A;  1OPY A;  2HMJ B;  1TP6 A;  4CCV A;  2INX A;  2GU3 A;  2PNC A;  2KRT A;  2Q07 A;  3BND A;  3GZX B;  4PEJ A;  2XGN A;  1UI7 A;  1YGE A;  5D83 A;  4XB5 A;  3KN4 A;  3KZT A;  1K73 4;  1N8R 4;  4HKV B;  5STD A;  2CH9 A;  2Z77 A;  1JB4 A;  4I4K A;  3VGN A;  3DGM A;  3ER7 A;  1OF5 A;  2OOV A;  1Q40 A;  7STD A;  1M90 4;  1DYU A;  2BO9 B;  3JUO A;  3L0R A;  4X2O A;  1W2Z A;  1T5Y A;  3WA2 X;  1GS3 A;  4Q53 A;  2W04 A;  2XSH B;  1VQ7 3;  2P09 A;  3FKA A;  2JDI H;  3V98 A;  3N9H A;  4WWU C;  1A67 A;  1MNL A;  3U1W A;  1DVD A;  3EHC A;  3PXM A;  1QAK A;  1SIH A;  3HX8 A;  3OXA A;  4R1K A;  1D6Y A;  3G71 3;  4KVH A;  5KP3 A;  1OGX A;  1A2K A;  1LVN A;  3NV0 B;  2W56 B;  4HM3 B;  4KZ1 A;  1GY6 A;  2R4I A;  2D42 A;  4N6V 0;  2O3O A;  3E99 A;  3CCU 3;  2CFG A;  3QK9 A;  2OTL 3;  3WOF B;  3I0Y A;  2P0X A;  1OHP A;  3EN1 B;  3EE1 A;  4AEQ A;  1YIT 3;  1OHS A;  1WNH A;  5EEO A;  3UL6 A;  2WOF A;  4HZ9 B;  1NDO B;  1E3V A;  1ASK A;  3GZY B;  3K5T A;  1NWW A;  2Y74 A;  2W2C A;  3OX9 A;  4CDL A;  4HM5 B;  4N6U A;  1KC8 4;  2IMJ A;  3CME 3;  4IPB A;  4WHA A;  2BMO B;  3NHX A;  3CCL 3;  2W03 A;  3G16 A;  4HM7 B;  3DGL A;  2W56 A;  2PZV A;  3FG3 A;  3NBJ A;  3K0Z A;  1IQY A;  2CG1 A;  1OHO A;  1VQ4 3;  2P38 A;  3EB8 A;  3LXU X;  1W6C A;  3FSD A;  4STD A;  1DMN A;  3AMO A;  1VQ9 3;  1JNQ A;  4EBG A;  1R4C A;  2XH9 A;  3HII A;  4FMC A;  4N6T A;  2XRX B;  4NRE A;  4L7K A;  1EA2 A;  3LTA A;  4H3U A;  1AVK A;  4RZM A;  4J9A A;  3S5C A;  1UW1 A;  5AI1 A;  3X3Y A;  3V92 A;  3EQQ B;  2K0M A;  1ROA A;  3UJM A;  3B4O A;  1NU3 A;  1YI2 3;  4G1M B;  3X40 A;  2W6J H;  3T8N A;  3WDG B;  4AKY A;  2QIY A;  3SLU A;  2IUK A;  3G0K A;  5IG4 A;  2HMN B;  3FCS B;  3UB1 A;  4KFE A;  3U97 A;  2RGQ A;  1N8Q A;  3TDG A;  4OVM A;  2OQE C;  2LYX A;  1L5G B;  2GU1 A;  3LML A;  4L8O A;  4HM4 B;  1RN7 A;  3LTC A;  1CYU A;  1N5H A;  3SOA A;  4FCJ A;  3F14 A;  1W5Z A;  3CXC 2;  2CW9 A;  1TFO A;  5ELJ A;  2GBX B;  3VF1 A;  2CG0 A;  1GD4 A;  2I9W A;  1SPU A;  3CCV 3;  3FLJ A;  2OQE A;  3Q90 A;  1KWI A;  3HI7 A;  3IMA B;  3SOY A;  2HMO B;  2UX0 A;  3HIG A;  1JKG B;  1IU7 A;  1KSI A;  1QAL A;  1K28 A;  1FGQ A;  1N9E A;  1G96 A;  1LNH A;  1LXE A;  5AEW B;  1OCV A;  3CCR 3;  3WOE B;  4HM6 B;  5IG0 A;  1RKY A;  2E2T A;  4WYK B;  2HMM B;  4ORL A;  1UI8 A;  3IPT A;  4HZB B;  5A0O B;  1TU5 A;  3EF8 A;  3V99 A;  1M1K 4;  1VQO 3;  1JRQ A;  1JB5 A;  2F98 A;  3S67 A;  3CPW 2;  4WFO A;  2GEX A;  3EC9 A;  3PZW A;  2L4V A;  5IER A;  1W6G A;  1M1X B;  2BMR B;  3SED A;  3D9R A;  3NBB A;  1JN5 A;  1W2B 2;  2FNQ A;  2QGU A;  3GZB A;  1WMO A;  2ML6 A;  3CD6 3;  3KSE D;  2YFJ B;  2OWP A;  2GBW B;  1O7H B;  3OWY A;  5HGR A;  1JB2 A;  1WTH A;  1J2B A;  5JPU A;  2Z76 A;  4N6L A;  1ROV A;  1D6Z A;  4BTW A;  1OH0 A;  2BHM A;  4LEH A;  2CIU A;  5D82 A;  1DMQ A;  3BNC A;  2ZDJ A;  4WYK A;  3LTD A;  5CF2 A;  2W0Q A;  5CXO A;  1PFP A;  3H3H A;  1A2V A;  2IUJ A;  5KP4 A;  1W00 A;  2BMQ B;  1AR0 A;  3FF0 A;  1N5P A;  3OWS A;  3UNL A;  2CKF B;  1U8C B;  2M7O A;  3X3Z A;  3SX1 A;  4R4K A;  3CNX A;  4K1U A;  3JUP A;  3LH4 A;  1TUH A;  4LMI A;  5AYR B;  3WMD A;  3DUK A;  3EJV A;  3LTB A;  3Q1C A;  3Q2P A;  5EQL A;  3RGR A;  3BNE A;  2V1L A;  1BUQ A;  1GD3 A;  4MEI A;  1KD1 4;  3X3X A;  5CLK A;  5IG5 A;  3ROB A;  3G6E 3;  3DM8 A;  4LSO A;  1GYB A;  2W9Q A;  4FR9 A;  3CCQ 3;  2RCD A;  3CNM A;  3CCS 3;  1W01 A;  2ZL8 A;  3VSY A;  4AKZ A;  3NV0 A;  1Q82 4;  1FUW A;  4MJD A;  5EVH A;  3KKG A;  4JRF A;  1NB5 I;  1FGM A;  3F8X A;  4R9K A;  4XDW A;  3GRD A;  2YX9 A;  3B7C A;  3MKI A;  2CFK A;  4GL6 A;  1EQK A;  2HML B;  5BXQ A;  5IF6 A;  6STD A;  2QEX 3;  1W4N A;  1WMN A;  3FG4 A;  1NB3 I;  4RNY A;  5KP1 A;  2W9P A;  3K7C A;  3KFQ C;  1AVL A;  1N9J A;  3JUQ A;  3MG3 A;  3MWZ A;  2E2U A;  1OGZ A;  3NM2 A;  4H61 A;  5AIG A;  3B8L A;  4WP5 A;  3RDE A;  5D81 A;  1FA3 A;  3CCM 3;  1ISK A;  2MF7 A;  1O7M B;  1VQ6 3;  1QMA A;  3OV4 A;  4K1V A;  4EC6 A;  4BTX A;  1CEW I;  4K90 B;  4FMD A;  1RJO A;  1YIJ 3;  4R80 A;  3GAX A;  4U13 A;  2P0M A;  2B24 B;  3DMC A;  2P05 A;  2F99 A;  3SXX A;  2OCT A;  2D1W A;  3EBT A;  3MHE A;  1Y4K A;  1IQ8 A;  1RRH A;  2BNG A;  2QA4 3;  2WGQ A;  5IEO A;  1QAF A;  1W6Y A;  2XEP A;  3T8U A;  3ALA A;  4HBR A;  4OUQ A;  2GXF A;  2STD A;  3NQY A;  1VQ8 3;  1US1 A;  1DVC A;  3MG1 A;  4XDV A;  1ULI B;  1YVB I;  1S72 3;  1Q7Y 4;  4XM4 A;  3PCR A;  4EYC A;  2A15 A;  1QJG A;  1NO3 A;  4FMA A;  5AIH A;  1VQL 3;  1IQX A;  1EKM A;  4GB5 A;  1VQK 3;  2WGO A;  4MMY B;  3DZL A;  3NXJ A;  5IEN A;  3CC4 3;  5AYS C;  3ECF A;  2FGT A;  3MYT A;  4R9L A;  4EXR A;  1EG9 B;  3D3L A;  4TX4 A;  2OTJ 3;  2XF3 A;  2XFS A;  3CCJ 3;  1IVV A;  4EV2 A;  1FGT A;  1K41 A;  3BB9 A;  3CMA 3;  3EBY A;  1AV4 A;  3FZW A;  4N6M A;  5AEU B;  1WQL B;  1M9G A;  2BT3 A;  3STD A;  1OF5 B;  5CF1 A;  3JVC A;  4HYZ A;  1K8A 4;  1GY5 A;  1V74 A;  2SBL A;  2Z6B A;  1A90 A;  2CWU A;  1Q86 4;  1IT8 A;  3I56 3;  2WO0 A;  1YJ9 3;  3PGB A;  1QVG 2;  5I97 A;  1O7W B;  3X42 A;  1JKG A;  5G2G A;  4HJL B;  2KXG A;  2HMK B;  4ZM8 A;  4IT7 A;  2CWV A;  3NM7 A;  5DRE A;  1FGR A;  1GY7 A;  4N6O B;  2CWT A;  3NUV A;  3A76 A;  1ZX2 A;  2CFL A;  1SII A;  1SQW A;  3UL5 A;  1CYV A;  4HM1 B;  4O2H A;  2B1X B;  1W7C A;  3GWR A;  3JUN A;  5AII A;  3CC7 3;  2RFR A;  3WOD G;  3DGN A;  2K54 A;  1OUN A;  1E3R A;  3FG1 A;  3O8Y A;  3WA3 A;  3G8Z A;  2XR8 B;  1IK3 A;  1TIJ A;  1IVW A;  3PYJ A;  3QRD A;  5CK6 A;  1JV2 B;  3K9M C;  3N54 B;  3FH1 A;  1PU4 A;  3CPO A;  3HK4 A;  4MMX B;  1VQM 3;  1NJI 4;  3CC2 3;  3BNB A;  4N6N B;  3I55 3;  5AIF A;  3KE7 A;  5BVB A;  5JBS A;  4FMB A;  3SVA A;  2XSO B;  3M8C A;  3NX0 A;  4LGQ A;  1Q42 A;  4KFD A;  3KSP A;  3EN8 A;  1HKX A;  1K9M 4;  4O3V A;  3F7S A;  5LC7 A;  3AMO B;  4HM0 B;  2GEY A;  5JPP A;  1STD A;  3F7X A;  4XBT A;  3LZA A;  2CK3 H;  2JQ5 A;  5FGO A;  3LT9 A;  1ZO2 A;  1Z1S A;  1IT7 A;  4KFF A;  1YJN 3;  1HU9 A;  3MSO A;  1VQP 3;  3PS8 A;  1D6U A;  1UUV B;  4RNZ A;  1KQS 2;  3NQZ A;  5FW5 A;  1SJW A;  3N8B A;  4QWT A;  4L8P A;  3CCE 3;  3H51 A;  1Q81 4;  2CFW A;  1ULJ B;  4HM2 B;  3F40 A;  1TFK A;  5TGN A;  1S5A A;  1F8N A;  2RSX A;  1VZZ A;  3S29 A;  2CFD A;  4LZI A;  3DGO A;  3RGA A;  2IA7 A;  4BTY A;  8CHO A;  3OWU A;  1VQ5 3;  3DY5 A;  3B4P A;  3LYG A;  2Y73 A;  3X41 A;  1LOX A;  2FXT A;  2O9U X;  5DRV A;  3DXO A;  2ML5 A;  2CC3 A;  4X2H A;  1VQN 3;  3CU3 A;  1E97 A;  3K63 A;  2LQV A;  1IV9 A;  1FGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...