1TFOA

Ribonuclease from escherichia coli complexed with its inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
LDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
molecule keywords Colicin D
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tfoA00
1TFOA 1TFKA 1V74A
chains in the Genus database with same CATH superfamily
1RGGA 2CG1A 1QAKA 2F56A 4GL6A 2BMQB 5ELJA 3CPOA 4R4KA 2MC8A 1VQ73 1FYSA 1OACA 2F86B 2CWVA 3DM8A 4FMAA 2Y73A 4FMBA 2W9QA 3JUNA 7STDA 2K54A 1IV7A 1K41A 4JRFA 3SLUA 3SVAA 3BNBA 2XEPA 3FF0A 3MWZA 1K734 3V92A 2CFGA 4X2OA 3OWUA 2CFLA 5IENA 1VQ43 1FGTA 2UGIA 3EBTA 3LTBA 4PEJA 1WNHA 3EC9A 1V58A 1FUWA 1VQ93 3CPW2 3F9SA 1I0XA 4R80A 1YGWA 2UX0A 3ROBA 1X1UA 3GZBA 1RGEA 4HM7B 2I9WA 5AIGA 1I0VA 5IG4A 1BRSA 1QMAA 3HOHA 3SXXA 1RNTA 5D83A 1K8A4 5IF6A 3MG1A 1A90A 5FGOA 3DGLA 1PY3A 1VQM3 1UGIA 1DMQA 1RGCA 2M7OA 3FH1A 5D81A 1BRHA 1CEWI 1RN7A 2E2TA 5KP1A 3CC43 3KFQC 3QRDA 3VF1A 2GBXB 2ZA4A 5CLKA 5KP4A 3AGOA 2XFTA 3CMA3 3BLZA 2E2UA 1GOUA 1U8CB 3LT9A 2K0MA 2KAAA 3F8HA 3CCQ3 3FLJA 3NV0A 3Q1CA 1MWUA 4CCVA 1W2ZA 2BMOB 3K7CA 1RN1A 4HKVB 1I2FA 5G2GA 2CHCA 1YJN3 1Q824 1HKXA 1US1A 1NNVA 1W4NA 1RRHA 2B1XB 1Y4KA 3LT8A 1DE3A 1EG9B 1UCLA 3GRDA 2OOVA 5JPPA 2W03A 2Z7AA 5LC7A 4EYCA 4K90B 4X2HA 4KFEA 3UJMA 3CCL3 1KD14 3VGNA 2XF3A 2GEXA 1PFPA 1B2XA 4RBNA 3Q3FA 2CW9A 4FCMA 4HM2B 3MHEA 2YX9A 4BTWA 1N5HA 2C4BA 3PS8A 3X3YA 2IMJA 1A67A 1NJI4 3WOFB 1BRKA 3A5EA 3M8CA 4EV2A 1BRIA 3EHCA 2OQEA 3I563 4N6MA 2HMMB 2ZHXB 4BIRA 1EEJA 2PZVA 1TJDA 1W01A 3LTAA 4MJDA 1KQS2 5M19A 3S29A 1O7MB 3X40A 5BIRA 2BHMA 2W9PA 1I2EA 1Q7Y4 1IDPA 4CDLA 1FGRA 4NREA 1JZDA 1UUGB 2WOFA 1EQKA 2W04A 1BUQA 5KP3A 1KSIA 5G1LA 1Z1SA 3K9MC 5IW9A 5CXOA 3CNMA 2AADA 4L8PA 1PU4A 4FCZA 2LQVA 4I5QA 1JB2A 1GOYA 2P38A 3HK4A 3TDGA 1IVUA 3MG3A 5EVHA 3RGAA 4CPKA 1N9JA 3I553 2F4YA 3OXAA 3WR2A 5D82A 1OF5A 1W6YA 2P05A 2CWUA 1AVLA 3D5GA 1IQXA 2CKFB 1MOLA 1G96A 3N9HA 3CME3 2BNGA 3NUVA 4IT7A 1HYFA 1VZZA 1DVCA 1FW7A 1RGFA 3LXUX 3SOAA 2HOHA 4HM5B 4J8TA 4HZBB 5I97A 3CCV3 1YIT3 3WA2X 1BNFA 1GY6A 3BB9A 3HIGA 1F8NA 1N9EA 1ZGXA 2MF7A 2WGOA 4GSPA 4ZM8A 4HM1B 3MPHA 3LTDA 1TFKA 1IVXA 4HVNA 4MEIA 1JZOA 3MYTA 4KFDA 3KN4A 4BL2A 2CG0A 3B4OA 4NHFA 1FGQA 3D79A 1JNQA 1AR0A 1OH0A 2C10A 2XGLA 2O3OA 3BNEA 3LH4A 1AY7A 2K3DA 3GZRA 3IPTA 3SYUA 4HAAA 3NX0A 1IK3A 2UUGC 2P0XA 1UDII 4XBTA 1NO3A 3UNLA 1M904 9RNTA 1LOWA 2CX1A 1BNIA 2QIYA 4J9AA 5RNTA 4XM4A 2CX0A 3G0KA 2QGUA 4N6NB 1BNSA 3DH2A 3E99A 5IG5A 1IT8A 1ULIB 4N6UA 3ZG0A 2HMLB 1VQ83 1B20A 1UCIA 3PGBA 4WWUC 3OV4A 1BNGA 3EB8A 3DUKA 2AAEA 1WTHA 4QWTA 4J5KA 1NB3I 4WYKB 4WHAA 4XB5A 5STDA 2CIUA 3GSPA 3QK9A 1J2BA 3F7XA 1T5YA 3EJVA 4FR9A 1JRQA 2WGQA 4GHOA 2BIRA 1L5GB 1A2KA 5DRVA 6STDA 2RBIA 2L4VA 3X3ZA 1VQQA 1NWWA 1D6ZA 2H0IA 2KXGA 1BRGA 1DYUA 1O7GB 3Q90A 3RGRA 2R4IA 3LTCA 1W6CA 3B4PA 3GZXB 2SBLA 4HOHA 3SX1A 2GBWB 1PYLA 1YNVX 1YJW3 1E3RA 1B2ZA 2XFSA 4FMDA 1EUIC 3KE7A 3V98A 4N6OB 3F7SA 4IPBA 5IERA 1I3IA 2JQ5A 1OHOA 4BL3A 4LZIA 1IYYA 2XH9A 1C7HA 3RDEA 3BU4A 3UL6A 3D3LA 8RNTA 4NPBA 1Q9EA 1RLSA 1QAFA 5AIFA 3F14A 3FF2A 1YVBI 1Q864 2R41A 2B24B 5HOHA 3BNDA 5A0OB 5TGNA 2Z76A 1OF5B 1UI8A 1G02A 1O7WB 2KF4A 2H0HA 3H51A 4FMCA 1BRJA 3LYGA 5AIHA 1RMSA 1OUNA 2IY2A 3G4S3 1N8QA 2IA7A 1JN5A 4TX4A 1EKMA 1JKGA 2XGNA 3X3XA 5JPUA 2C11A 4O8SA 4L8OA 1UCKA 3D4AA 2IUJA 2OOVC 1O7PB 4XDWA 5CF2A 1CQSA 2XRXB 1Q40A 3H3HA 4N6TA 2XSOB 8CHOA 1LQGC 2Z77A 2J8XB 2W56A 3Q2PA 1STFI 1RKYA 2F5MA 2KF5A 2ZDJA 4MMYB 5M18A 2ML6A 3LMLA 3NBJA 3D5IA 1N5PA 4BTXA 1FA3A 2V1LA 3SEDA 3NV0B 2STDA 1RJOA 1W6GA 3EF8A 2ZL8A 1RGLA 3EQQB 1RN4A 4LGQA 2QA43 4KT3B 1UUVB 1YVSA 4R9LA 1VQN3 1FUTA 1LXEA 2O9UX 2QEX3 2KF6A 3DXOA 1DMNA 1MGRA 4RZMA 3U97A 2XSHB 3WOEB 5IEPA 3G713 4XBXA 1GOVA 2FXTA 1X1YA 3PXMA 1KC84 1BSEA 1E3VA 3JUOA 1MGWA 3NQZA 3CCE3 3U1WA 1YJ93 1RGHA 1TP6A 1SPUA 2P09A 2CFKA 3KZTA 2W0QA 1SIIA 1V57A 4H3UA 3CCM3 2CK3H 3B7CA 3CCU3 1B2MA 1ZS7A 4EBGA 1BGSA 1ZO2A 1VQL3 2W56B 1JB4A 1ROVA 1B27A 3T8NA 1LNHA 1OPYA 1QALA 5FW5A 3FZWA 4HM3B 1I70A 4CJNA 1LOYA 3S67A 1NDOB 3MKIA 1R4CA 3EN8A 3O8YA 3JVCA 1YHQ3 3FSDA 3FG1A 5AEWB 3FCSB 3G8ZA 1EA2A 1GD4A 1U5OA 5AYRB 3DY5A 2F5WA 1OHSA 2OTL3 4RNYA 1BVIA 4DKIA 4BTYA 2D1WA 3HI7A 3FG3A 1X1WA 1AVKA 3WHOA 2L1SA 1STDA 1VQK3 2GEYA 1B3SA 1BAOA 1WMOA 2RNTA 1BSCA 1A2VA 1BANA 2LYXA 2OWPA 1K28A 4K1VA 3WODG 1VQO3 3NHXA 1RGKA 3EX9A 2W2CA 3PYJA 3UB1A 4K61A 3V99A 3STDA 1RCLA 1W02A 1IVWA 3A76A 2FNQA 1IU7A 5G1KA 1D6UA 2HMOB 3CC23 1FGOA 1IQ8A 1BU4A 3N54B 4N6LA 1DVDA 1OCVA 1BNJA 3EBYA 4I4KA 1CYVA 1ULJB 1IV9A 1WMNA 2FGTA 1GS3A 2YFJB 3X41A 7RNTA 4XDVA 1QJGA 4RNTA 1FZUA 2RGQA 1DETA 1JBTA 3OWYA 1YIJ3 1GY5A 2WOHA 1B21A 3DGYA 4G1MB 3K63A 2ML5A 3WDGB 1VQ53 1GY7A 3CD63 2KF3A 3NM2A 1D6YA 3SOYA 2BT3A 1UI7A 4ILFA 4Q53A 3S5CA 3MSOA 3IJEB 1ISKA 1LVNA 1X1XA 2YFIB 1IVVA 4HJLB 5BXQA 1BNEA 7GSPA 1OGXA 1FUSA 1T3BA 1LRAA 3S28A 2BU4A 4O02B 5LC6A 1BSAA 4OVMA 2BO9B 2PNCA 3F8XA 3S27A 3AHSA 4N6V0 3AGNA 3AMOB 2BMRB 3B8LA 3HZPA 4HZ9B 1W00A 3WMDA 1AV4A 4HM6B 1ASKA 1TIJA 1RCKA 2F99A 4O2HA 1WQLB 3OX9A 1FGMA 2GSPA 3NM7A 3JUPA 1MWRA 4WP5A 3J7Yd 1B2SA 3VSYA 2KCDA 4ORLA 3AHWA 1GMRA 1RTUA 1RSNA 4EXRA 2KRTA 5AIIA 3FG4A 3NBRA 4LEHA 1MNLA 3FGYA 2CWTA 1Q7HA 3ZG5A 3NXJA 3CCR3 1JN5B 1I2GA 1SIHA 3PZWA 1JKGB 2IYJA 4K1UA 1GD3A 2JDIH 6RNTA 2P0MA 4LYLB 3N8BA 5AI1A 1UW1A 1IT7A 3K0ZA 2WO0A 1RRLA 2E2VA 4HYZA 3T0UA 5ELUA 3IMAB 1BIRA 5JBSA 3CC73 1JBRA 2OQEC 3DGNA 3DGMA 4HM0B 5DREA 2GU1A 4GB5A 2OTJ3 3T8UA 4LMIA 3ZFZA 3ECFA 1VQ63 1JB5A 3ALAA 2Z6BA 1JJ22 4XBYA 2A15A 1TTOA 3CCJ3 3NBBA 3NQYA 5CK6A 1CH0A 1T2HA 3GZYB 3DZLA 2XR8B 1SARA 4IIAA 1I3FA 4FCJA 3PCRA 3X42A 1UGHI 3BNCA 5EQLA 1QVG2 1LQMB 4MMXB 3CXC2 4R1KA 1RDSA 4HBRA 1OHPA 1RNBA 1JV2B 1ZX2A 1IQYA 4AEQA 3KCHA 3BIRA 4OK0A 5GSPA 1JBSA 1AQZA 2GXFA 3RNTA 3JUQA 2RSXA 5AEUB 2CC3A 2D42A 1BNRA 4LSOA 1S723 1A2PA 2HMNB 3FKAA 3HX8A 4KFFA 1BOXA 4R9KA 4H61A 3AMOA 2RFRA 3DMCA 4WYKA 1LNIA 1GYBA 1TRPA 2YFLB 3D9RA 3HIIA 3I0YA 1RHLA 4N3VA 5AYSC 5HGRA 3CCS3 3KKGA 2W6JH 4RNZA 3GAXA 1K9M4 5EEOA 1BRNL 1OGZA 1N8R4 4WFOA 1TFOA 3KIIA 3KSPA 5CF1A 3OWSA 1HZ1A 4AKYA 4KZ1A 3EN1B 1UUWB 1W2B2 1M9GA 6GSPA 2OCTA 4L7KA 1E97A 3JUMA 1NB5I 3OW22 4KVHA 2SARA 1C54A 1WMPA 4HM8B 1Q814 3L0RA 2CH9A 4U13A 3LZAA 1S5AA 1GMPA 1GSPA 4STDA 2INXA 3MG2A 3G16A 3LOYA 5BVBA 1BSDA 1BSBA 3CU3A 3PCSA 1QVF2 2CFDA 2HMKB 5IG3A 3G6E3 4EC6A 2GU3A 1GMQA 4HM4B 5IEOA 1O7NB 3GWRA 2HMJB 3URPA 1UCJA 1BUJA 1R4YA 2Q07A 1ROAA 1VQP3 4OUQA 2IUKA 4MMZB 5IG0A 2H0GA 3ER7A 1Q42A 5M1AA 1T2IA 2Y74A 1W5ZA 1NU3A 4BU4A 1I8VA 1W7CA 1TUHA 1O7HB 1V74A 3DGOA 1CYUA 2F98A 1G0TA 3F40A 5BU4A 4EV5A 3CNXA 4EW5A 4AKZA 3KSED 4J5GA 1MWTA 1TU5A 1KWIA 3EE1A 1M1XB 1B2UA 1RGAA 4JF8A 1LOXA 1Q40B 3WA3A 3UL5A 3K5TA 2CFWA 4O3VA 1YGEA 1TRQA 1SQWA 1DMMA 1MWSA 1SJWA 1YI23 2RCDA 1HU9A 1M1K4 1LOVA
chains in the Genus database with same CATH topology
2CG1A 1QAKA 4GL6A 2BMQB 5ELJA 3CPOA 4R4KA 2MC8A 1VQ73 1OACA 2F86B 2CWVA 3DM8A 4FMAA 2Y73A 4FMBA 2W9QA 3JUNA 7STDA 2K54A 1IV7A 1K41A 4JRFA 3SLUA 3SVAA 3BNBA 2XEPA 3FF0A 3MWZA 1K734 3V92A 2CFGA 4X2OA 3OWUA 2CFLA 5IENA 1VQ43 1FGTA 3EBTA 3LTBA 4PEJA 1WNHA 3EC9A 1FUWA 1VQ93 3CPW2 3F9SA 4R80A 2UX0A 3ROBA 3GZBA 4HM7B 2I9WA 5AIGA 5IG4A 1QMAA 3SXXA 5D83A 1K8A4 5IF6A 3MG1A 1A90A 5FGOA 3DGLA 1VQM3 1DMQA 2M7OA 3FH1A 5D81A 1CEWI 1RN7A 2E2TA 5KP1A 3CC43 3KFQC 3QRDA 3VF1A 2GBXB 5CLKA 5KP4A 2XFTA 3CMA3 3BLZA 2E2UA 1U8CB 3LT9A 2K0MA 3F8HA 3CCQ3 3FLJA 3NV0A 3Q1CA 4CCVA 1W2ZA 2BMOB 3K7CA 4HKVB 1YJN3 5G2GA 2CHCA 1Q824 1HKXA 1US1A 1W4NA 1RRHA 2B1XB 1Y4KA 3LT8A 1EG9B 3GRDA 2OOVA 5JPPA 2W03A 2Z7AA 5LC7A 4EYCA 4K90B 4X2HA 4KFEA 3UJMA 3CCL3 1KD14 3VGNA 2XF3A 2GEXA 1PFPA 4RBNA 2CW9A 4FCMA 4HM2B 3MHEA 2YX9A 4BTWA 1N5HA 3PS8A 3X3YA 2IMJA 1A67A 1NJI4 3WOFB 3M8CA 4EV2A 3EHCA 2OQEA 3I563 4N6MA 2HMMB 2PZVA 3LTAA 1W01A 4MJDA 1KQS2 3S29A 1O7MB 3X40A 2BHMA 2W9PA 1Q7Y4 1IDPA 4CDLA 1FGRA 4NREA 2WOFA 1EQKA 2W04A 1BUQA 5KP3A 1KSIA 1Z1SA 3K9MC 5IW9A 5CXOA 3CNMA 4L8PA 1PU4A 4FCZA 2LQVA 1JB2A 2P38A 3HK4A 3TDGA 1IVUA 3MG3A 5EVHA 3RGAA 3I553 1N9JA 3OXAA 5D82A 1OF5A 1W6YA 2P05A 2CWUA 1AVLA 1IQXA 1MOLA 1G96A 2CKFB 3N9HA 2BNGA 3NUVA 4IT7A 1VZZA 1DVCA 3LXUX 3SOAA 4J8TA 4HM5B 5I97A 4HZBB 3CCV3 1YIT3 3WA2X 1GY6A 3BB9A 3HIGA 1F8NA 1N9EA 2WGOA 2MF7A 4ZM8A 4HM1B 3MPHA 3LTDA 1TFKA 1IVXA 4HVNA 4MEIA 3MYTA 4KFDA 3KN4A 2CG0A 3B4OA 4NHFA 1FGQA 1JNQA 1AR0A 1OH0A 2C10A 2XGLA 2O3OA 3BNEA 3LH4A 3GZRA 3IPTA 1IK3A 3NX0A 2P0XA 4XBTA 1NO3A 3UNLA 1M904 2QIYA 4J9AA 4XM4A 3G0KA 2QGUA 4N6NB 3E99A 5IG5A 1IT8A 1ULIB 4N6UA 2HMLB 1VQ83 3PGBA 4WWUC 3OV4A 3EB8A 3DUKA 4WYKB 1WTHA 4QWTA 4WHAA 1NB3I 4XB5A 5STDA 2CIUA 1J2BA 3QK9A 3F7XA 1T5YA 3EJVA 4FR9A 1JRQA 2WGQA 1A2KA 5DRVA 6STDA 2L4VA 3X3ZA 1NWWA 1D6ZA 2KXGA 1O7GB 1DYUA 3Q90A 3RGRA 2R4IA 3LTCA 1W6CA 3B4PA 3GZXB 2SBLA 3SX1A 2GBWB 1YJW3 1E3RA 2XFSA 4FMDA 3V98A 3KE7A 4N6OB 3F7SA 4IPBA 5IERA 2JQ5A 1OHOA 4LZIA 2XH9A 1C7HA 3RDEA 3UL6A 3D3LA 1QAFA 5AIFA 3F14A 3FF2A 1YVBI 1Q864 2B24B 3BNDA 5A0OB 5TGNA 2Z76A 1OF5B 1UI8A 1O7WB 3CME3 4FMCA 3H51A 5AIHA 3LYGA 1OUNA 3G4S3 1N8QA 2IA7A 1JN5A 4TX4A 1EKMA 1JKGA 2XGNA 3X3XA 5JPUA 2C11A 4O8SA 4L8OA 2IUJA 2OOVC 1O7PB 4XDWA 5CF2A 1CQSA 2XRXB 1Q40A 3H3HA 4N6TA 2XSOB 8CHOA 2Z77A 1RKYA 2W56A 3Q2PA 1STFI 2ZDJA 4MMYB 2ML6A 3LMLA 3NBJA 1N5PA 4BTXA 1FA3A 2V1LA 3SEDA 3NV0B 2STDA 1RJOA 1W6GA 3EF8A 2ZL8A 3EQQB 4LGQA 2QA43 1UUVB 4R9LA 1VQN3 1LXEA 2O9UX 2QEX3 3DXOA 3G713 1DMNA 4RZMA 3U97A 5IEPA 2XSHB 3WOEB 4XBXA 3PXMA 1KC84 1E3VA 3JUOA 3NQZA 3CCE3 3U1WA 1YJ93 1TP6A 1SPUA 2P09A 2CFKA 3KZTA 2W0QA 1SIIA 3CCM3 4H3UA 3CCU3 2CK3H 3B7CA 4EBGA 1ZO2A 1VQL3 2W56B 1JB4A 1ROVA 3T8NA 1LNHA 1OPYA 1QALA 5FW5A 3FZWA 4HM3B 3S67A 1NDOB 3MKIA 1R4CA 3EN8A 3O8YA 3JVCA 3FSDA 3FG1A 5AEWB 3FCSB 3G8ZA 1EA2A 1GD4A 1U5OA 5AYRB 3DY5A 2OTL3 1OHSA 4RNYA 4BTYA 2D1WA 3HI7A 3FG3A 1AVKA 1STDA 1VQK3 2GEYA 1WMOA 1VQO3 2LYXA 1A2VA 2OWPA 4K1VA 3WODG 1K28A 3NHXA 3EX9A 2W2CA 3PYJA 3UB1A 4K61A 3V99A 3STDA 1W02A 1IVWA 3A76A 2FNQA 1IU7A 3CC23 1D6UA 2HMOB 1FGOA 1IQ8A 3N54B 4N6LA 1DVDA 1OCVA 3EBYA 4I4KA 1CYVA 1ULJB 1IV9A 1WMNA 2FGTA 1GS3A 2YFJB 3X41A 4XDVA 1QJGA 2RGQA 3OWYA 1YIJ3 1GY5A 2WOHA 4G1MB 3K63A 2ML5A 3WDGB 1VQ53 1GY7A 3CD63 3NM2A 1D6YA 3SOYA 2BT3A 1UI7A 4Q53A 3S5CA 3MSOA 3IJEB 1ISKA 1LVNA 2YFIB 4HJLB 1IVVA 5BXQA 1OGXA 3S28A 4O02B 5LC6A 4OVMA 2BO9B 2PNCA 3F8XA 3S27A 4N6V0 3B8LA 3AMOB 2BMRB 3HZPA 4HZ9B 3WMDA 1W00A 1AV4A 4HM6B 1ASKA 1TIJA 2F99A 4O2HA 1WQLB 3OX9A 1FGMA 3NM7A 3JUPA 3J7Yd 4WP5A 3VSYA 2KCDA 4ORLA 4EXRA 2KRTA 5AIIA 3FG4A 3NBRA 4LEHA 1MNLA 3FGYA 2CWTA 3NXJA 3CCR3 1JN5B 3PZWA 1SIHA 4K1UA 1JKGB 1GD3A 2JDIH 2P0MA 5AI1A 3N8BA 1UW1A 1IT7A 3K0ZA 2WO0A 1RRLA 2E2VA 4HYZA 3T0UA 5ELUA 3IMAB 5JBSA 3CC73 2OQEC 3DGNA 3DGMA 4HM0B 5DREA 2GU1A 4GB5A 2OTJ3 3T8UA 4LMIA 3ECFA 1VQ63 1JB5A 3ALAA 2Z6BA 1JJ22 4XBYA 2A15A 3CCJ3 3NBBA 3NQYA 5CK6A 3GZYB 3DZLA 2XR8B 4IIAA 3X42A 4FCJA 3PCRA 3BNCA 5EQLA 1QVG2 4MMXB 3CXC2 4R1KA 4HBRA 1OHPA 1JV2B 1ZX2A 1IQYA 4AEQA 4OK0A 2GXFA 3JUQA 2RSXA 5AEUB 2CC3A 2D42A 4LSOA 1S723 2HMNB 3FKAA 3HX8A 4KFFA 4R9KA 4H61A 3AMOA 2RFRA 3DMCA 4WYKA 1GYBA 3HIIA 2YFLB 3D9RA 3I0YA 4N3VA 5AYSC 5HGRA 1L5GB 1YHQ3 3CCS3 3KKGA 2W6JH 4RNZA 3GAXA 1K9M4 5EEOA 1OGZA 1N8R4 4WFOA 1TFOA 3KIIA 3KSPA 5CF1A 3OWSA 4AKYA 4KZ1A 3EN1B 1UUWB 1W2B2 1M9GA 2OCTA 4L7KA 1E97A 3JUMA 1NB5I 3OW22 4KVHA 1WMPA 4HM8B 1Q814 3L0RA 2CH9A 4U13A 3LZAA 1S5AA 4STDA 2INXA 3MG2A 3G16A 3LOYA 5BVBA 3CU3A 3PCSA 1QVF2 2CFDA 2HMKB 5IG3A 3G6E3 4EC6A 2GU3A 4HM4B 5IEOA 1O7NB 3GWRA 2HMJB 2Q07A 1ROAA 1VQP3 4OUQA 2IUKA 4MMZB 5IG0A 3ER7A 1Q42A 2Y74A 1W5ZA 1NU3A 1W7CA 1TUHA 1O7HB 1V74A 3DGOA 1CYUA 2F98A 3F40A 4EV5A 3CNXA 4AKZA 3KSED 1TU5A 1KWIA 3EE1A 1M1XB 4JF8A 1LOXA 1Q40B 3WA3A 3UL5A 3K5TA 2CFWA 4O3VA 1YGEA 1SQWA 1DMMA 1SJWA 1YI23 2RCDA 1HU9A 1M1K4 2FXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFO A;  1TFK A;  1V74 A; 
#chains in the Genus database with same CATH topology
 1RGG A;  2CG1 A;  1QAK A;  2F56 A;  4GL6 A;  2BMQ B;  5ELJ A;  3CPO A;  4R4K A;  2MC8 A;  1VQ7 3;  1FYS A;  1OAC A;  2F86 B;  2CWV A;  3DM8 A;  4FMA A;  2Y73 A;  4FMB A;  2W9Q A;  3JUN A;  7STD A;  2K54 A;  1IV7 A;  1K41 A;  4JRF A;  3SLU A;  3SVA A;  3BNB A;  2XEP A;  3FF0 A;  3MWZ A;  1K73 4;  3V92 A;  2CFG A;  4X2O A;  3OWU A;  2CFL A;  5IEN A;  1VQ4 3;  1FGT A;  2UGI A;  3EBT A;  3LTB A;  4PEJ A;  1WNH A;  3EC9 A;  1V58 A;  1FUW A;  1VQ9 3;  3CPW 2;  3F9S A;  1I0X A;  4R80 A;  1YGW A;  2UX0 A;  3ROB A;  1X1U A;  3GZB A;  1RGE A;  4HM7 B;  2I9W A;  5AIG A;  1I0V A;  5IG4 A;  1BRS A;  1QMA A;  3HOH A;  3SXX A;  1RNT A;  5D83 A;  1K8A 4;  5IF6 A;  3MG1 A;  1A90 A;  5FGO A;  3DGL A;  1PY3 A;  1VQM 3;  1UGI A;  1DMQ A;  1RGC A;  2M7O A;  3FH1 A;  5D81 A;  1BRH A;  1CEW I;  1RN7 A;  2E2T A;  5KP1 A;  3CC4 3;  3KFQ C;  3QRD A;  3VF1 A;  2GBX B;  2ZA4 A;  5CLK A;  5KP4 A;  3AGO A;  2XFT A;  3CMA 3;  3BLZ A;  2E2U A;  1GOU A;  1U8C B;  3LT9 A;  2K0M A;  2KAA A;  3F8H A;  3CCQ 3;  3FLJ A;  3NV0 A;  3Q1C A;  1MWU A;  4CCV A;  1W2Z A;  2BMO B;  3K7C A;  1RN1 A;  4HKV B;  1I2F A;  5G2G A;  2CHC A;  1YJN 3;  1Q82 4;  1HKX A;  1US1 A;  1NNV A;  1W4N A;  1RRH A;  2B1X B;  1Y4K A;  3LT8 A;  1DE3 A;  1EG9 B;  1UCL A;  3GRD A;  2OOV A;  5JPP A;  2W03 A;  2Z7A A;  5LC7 A;  4EYC A;  4K90 B;  4X2H A;  4KFE A;  3UJM A;  3CCL 3;  1KD1 4;  3VGN A;  2XF3 A;  2GEX A;  1PFP A;  1B2X A;  4RBN A;  3Q3F A;  2CW9 A;  4FCM A;  4HM2 B;  3MHE A;  2YX9 A;  4BTW A;  1N5H A;  2C4B A;  3PS8 A;  3X3Y A;  2IMJ A;  1A67 A;  1NJI 4;  3WOF B;  1BRK A;  3A5E A;  3M8C A;  4EV2 A;  1BRI A;  3EHC A;  2OQE A;  3I56 3;  4N6M A;  2HMM B;  2ZHX B;  4BIR A;  1EEJ A;  2PZV A;  1TJD A;  1W01 A;  3LTA A;  4MJD A;  1KQS 2;  5M19 A;  3S29 A;  1O7M B;  3X40 A;  5BIR A;  2BHM A;  2W9P A;  1I2E A;  1Q7Y 4;  1IDP A;  4CDL A;  1FGR A;  4NRE A;  1JZD A;  1UUG B;  2WOF A;  1EQK A;  2W04 A;  1BUQ A;  5KP3 A;  1KSI A;  5G1L A;  1Z1S A;  3K9M C;  5IW9 A;  5CXO A;  3CNM A;  2AAD A;  4L8P A;  1PU4 A;  4FCZ A;  2LQV A;  4I5Q A;  1JB2 A;  1GOY A;  2P38 A;  3HK4 A;  3TDG A;  1IVU A;  3MG3 A;  5EVH A;  3RGA A;  4CPK A;  1N9J A;  3I55 3;  2F4Y A;  3OXA A;  3WR2 A;  5D82 A;  1OF5 A;  1W6Y A;  2P05 A;  2CWU A;  1AVL A;  3D5G A;  1IQX A;  2CKF B;  1MOL A;  1G96 A;  3N9H A;  3CME 3;  2BNG A;  3NUV A;  4IT7 A;  1HYF A;  1VZZ A;  1DVC A;  1FW7 A;  1RGF A;  3LXU X;  3SOA A;  2HOH A;  4HM5 B;  4J8T A;  4HZB B;  5I97 A;  3CCV 3;  1YIT 3;  3WA2 X;  1BNF A;  1GY6 A;  3BB9 A;  3HIG A;  1F8N A;  1N9E A;  1ZGX A;  2MF7 A;  2WGO A;  4GSP A;  4ZM8 A;  4HM1 B;  3MPH A;  3LTD A;  1TFK A;  1IVX A;  4HVN A;  4MEI A;  1JZO A;  3MYT A;  4KFD A;  3KN4 A;  4BL2 A;  2CG0 A;  3B4O A;  4NHF A;  1FGQ A;  3D79 A;  1JNQ A;  1AR0 A;  1OH0 A;  2C10 A;  2XGL A;  2O3O A;  3BNE A;  3LH4 A;  1AY7 A;  2K3D A;  3GZR A;  3IPT A;  3SYU A;  4HAA A;  3NX0 A;  1IK3 A;  2UUG C;  2P0X A;  1UDI I;  4XBT A;  1NO3 A;  3UNL A;  1M90 4;  9RNT A;  1LOW A;  2CX1 A;  1BNI A;  2QIY A;  4J9A A;  5RNT A;  4XM4 A;  2CX0 A;  3G0K A;  2QGU A;  4N6N B;  1BNS A;  3DH2 A;  3E99 A;  5IG5 A;  1IT8 A;  1ULI B;  4N6U A;  3ZG0 A;  2HML B;  1VQ8 3;  1B20 A;  1UCI A;  3PGB A;  4WWU C;  3OV4 A;  1BNG A;  3EB8 A;  3DUK A;  2AAE A;  1WTH A;  4QWT A;  4J5K A;  1NB3 I;  4WYK B;  4WHA A;  4XB5 A;  5STD A;  2CIU A;  3GSP A;  3QK9 A;  1J2B A;  3F7X A;  1T5Y A;  3EJV A;  4FR9 A;  1JRQ A;  2WGQ A;  4GHO A;  2BIR A;  1L5G B;  1A2K A;  5DRV A;  6STD A;  2RBI A;  2L4V A;  3X3Z A;  1VQQ A;  1NWW A;  1D6Z A;  2H0I A;  2KXG A;  1BRG A;  1DYU A;  1O7G B;  3Q90 A;  3RGR A;  2R4I A;  3LTC A;  1W6C A;  3B4P A;  3GZX B;  2SBL A;  4HOH A;  3SX1 A;  2GBW B;  1PYL A;  1YNV X;  1YJW 3;  1E3R A;  1B2Z A;  2XFS A;  4FMD A;  1EUI C;  3KE7 A;  3V98 A;  4N6O B;  3F7S A;  4IPB A;  5IER A;  1I3I A;  2JQ5 A;  1OHO A;  4BL3 A;  4LZI A;  1IYY A;  2XH9 A;  1C7H A;  3RDE A;  3BU4 A;  3UL6 A;  3D3L A;  8RNT A;  4NPB A;  1Q9E A;  1RLS A;  1QAF A;  5AIF A;  3F14 A;  3FF2 A;  1YVB I;  1Q86 4;  2R41 A;  2B24 B;  5HOH A;  3BND A;  5A0O B;  5TGN A;  2Z76 A;  1OF5 B;  1UI8 A;  1G02 A;  1O7W B;  2KF4 A;  2H0H A;  3H51 A;  4FMC A;  1BRJ A;  3LYG A;  5AIH A;  1RMS A;  1OUN A;  2IY2 A;  3G4S 3;  1N8Q A;  2IA7 A;  1JN5 A;  4TX4 A;  1EKM A;  1JKG A;  2XGN A;  3X3X A;  5JPU A;  2C11 A;  4O8S A;  4L8O A;  1UCK A;  3D4A A;  2IUJ A;  2OOV C;  1O7P B;  4XDW A;  5CF2 A;  1CQS A;  2XRX B;  1Q40 A;  3H3H A;  4N6T A;  2XSO B;  8CHO A;  1LQG C;  2Z77 A;  2J8X B;  2W56 A;  3Q2P A;  1STF I;  1RKY A;  2F5M A;  2KF5 A;  2ZDJ A;  4MMY B;  5M18 A;  2ML6 A;  3LML A;  3NBJ A;  3D5I A;  1N5P A;  4BTX A;  1FA3 A;  2V1L A;  3SED A;  3NV0 B;  2STD A;  1RJO A;  1W6G A;  3EF8 A;  2ZL8 A;  1RGL A;  3EQQ B;  1RN4 A;  4LGQ A;  2QA4 3;  4KT3 B;  1UUV B;  1YVS A;  4R9L A;  1VQN 3;  1FUT A;  1LXE A;  2O9U X;  2QEX 3;  2KF6 A;  3DXO A;  1DMN A;  1MGR A;  4RZM A;  3U97 A;  2XSH B;  3WOE B;  5IEP A;  3G71 3;  4XBX A;  1GOV A;  2FXT A;  1X1Y A;  3PXM A;  1KC8 4;  1BSE A;  1E3V A;  3JUO A;  1MGW A;  3NQZ A;  3CCE 3;  3U1W A;  1YJ9 3;  1RGH A;  1TP6 A;  1SPU A;  2P09 A;  2CFK A;  3KZT A;  2W0Q A;  1SII A;  1V57 A;  4H3U A;  3CCM 3;  2CK3 H;  3B7C A;  3CCU 3;  1B2M A;  1ZS7 A;  4EBG A;  1BGS A;  1ZO2 A;  1VQL 3;  2W56 B;  1JB4 A;  1ROV A;  1B27 A;  3T8N A;  1LNH A;  1OPY A;  1QAL A;  5FW5 A;  3FZW A;  4HM3 B;  1I70 A;  4CJN A;  1LOY A;  3S67 A;  1NDO B;  3MKI A;  1R4C A;  3EN8 A;  3O8Y A;  3JVC A;  1YHQ 3;  3FSD A;  3FG1 A;  5AEW B;  3FCS B;  3G8Z A;  1EA2 A;  1GD4 A;  1U5O A;  5AYR B;  3DY5 A;  2F5W A;  1OHS A;  2OTL 3;  4RNY A;  1BVI A;  4DKI A;  4BTY A;  2D1W A;  3HI7 A;  3FG3 A;  1X1W A;  1AVK A;  3WHO A;  2L1S A;  1STD A;  1VQK 3;  2GEY A;  1B3S A;  1BAO A;  1WMO A;  2RNT A;  1BSC A;  1A2V A;  1BAN A;  2LYX A;  2OWP A;  1K28 A;  4K1V A;  3WOD G;  1VQO 3;  3NHX A;  1RGK A;  3EX9 A;  2W2C A;  3PYJ A;  3UB1 A;  4K61 A;  3V99 A;  3STD A;  1RCL A;  1W02 A;  1IVW A;  3A76 A;  2FNQ A;  1IU7 A;  5G1K A;  1D6U A;  2HMO B;  3CC2 3;  1FGO A;  1IQ8 A;  1BU4 A;  3N54 B;  4N6L A;  1DVD A;  1OCV A;  1BNJ A;  3EBY A;  4I4K A;  1CYV A;  1ULJ B;  1IV9 A;  1WMN A;  2FGT A;  1GS3 A;  2YFJ B;  3X41 A;  7RNT A;  4XDV A;  1QJG A;  4RNT A;  1FZU A;  2RGQ A;  1DET A;  1JBT A;  3OWY A;  1YIJ 3;  1GY5 A;  2WOH A;  1B21 A;  3DGY A;  4G1M B;  3K63 A;  2ML5 A;  3WDG B;  1VQ5 3;  1GY7 A;  3CD6 3;  2KF3 A;  3NM2 A;  1D6Y A;  3SOY A;  2BT3 A;  1UI7 A;  4ILF A;  4Q53 A;  3S5C A;  3MSO A;  3IJE B;  1ISK A;  1LVN A;  1X1X A;  2YFI B;  1IVV A;  4HJL B;  5BXQ A;  1BNE A;  7GSP A;  1OGX A;  1FUS A;  1T3B A;  1LRA A;  3S28 A;  2BU4 A;  4O02 B;  5LC6 A;  1BSA A;  4OVM A;  2BO9 B;  2PNC A;  3F8X A;  3S27 A;  3AHS A;  4N6V 0;  3AGN A;  3AMO B;  2BMR B;  3B8L A;  3HZP A;  4HZ9 B;  1W00 A;  3WMD A;  1AV4 A;  4HM6 B;  1ASK A;  1TIJ A;  1RCK A;  2F99 A;  4O2H A;  1WQL B;  3OX9 A;  1FGM A;  2GSP A;  3NM7 A;  3JUP A;  1MWR A;  4WP5 A;  3J7Y d;  1B2S A;  3VSY A;  2KCD A;  4ORL A;  3AHW A;  1GMR A;  1RTU A;  1RSN A;  4EXR A;  2KRT A;  5AII A;  3FG4 A;  3NBR A;  4LEH A;  1MNL A;  3FGY A;  2CWT A;  1Q7H A;  3ZG5 A;  3NXJ A;  3CCR 3;  1JN5 B;  1I2G A;  1SIH A;  3PZW A;  1JKG B;  2IYJ A;  4K1U A;  1GD3 A;  2JDI H;  6RNT A;  2P0M A;  4LYL B;  3N8B A;  5AI1 A;  1UW1 A;  1IT7 A;  3K0Z A;  2WO0 A;  1RRL A;  2E2V A;  4HYZ A;  3T0U A;  5ELU A;  3IMA B;  1BIR A;  5JBS A;  3CC7 3;  1JBR A;  2OQE C;  3DGN A;  3DGM A;  4HM0 B;  5DRE A;  2GU1 A;  4GB5 A;  2OTJ 3;  3T8U A;  4LMI A;  3ZFZ A;  3ECF A;  1VQ6 3;  1JB5 A;  3ALA A;  2Z6B A;  1JJ2 2;  4XBY A;  2A15 A;  1TTO A;  3CCJ 3;  3NBB A;  3NQY A;  5CK6 A;  1CH0 A;  1T2H A;  3GZY B;  3DZL A;  2XR8 B;  1SAR A;  4IIA A;  1I3F A;  4FCJ A;  3PCR A;  3X42 A;  1UGH I;  3BNC A;  5EQL A;  1QVG 2;  1LQM B;  4MMX B;  3CXC 2;  4R1K A;  1RDS A;  4HBR A;  1OHP A;  1RNB A;  1JV2 B;  1ZX2 A;  1IQY A;  4AEQ A;  3KCH A;  3BIR A;  4OK0 A;  5GSP A;  1JBS A;  1AQZ A;  2GXF A;  3RNT A;  3JUQ A;  2RSX A;  5AEU B;  2CC3 A;  2D42 A;  1BNR A;  4LSO A;  1S72 3;  1A2P A;  2HMN B;  3FKA A;  3HX8 A;  4KFF A;  1BOX A;  4R9K A;  4H61 A;  3AMO A;  2RFR A;  3DMC A;  4WYK A;  1LNI A;  1GYB A;  1TRP A;  2YFL B;  3D9R A;  3HII A;  3I0Y A;  1RHL A;  4N3V A;  5AYS C;  5HGR A;  3CCS 3;  3KKG A;  2W6J H;  4RNZ A;  3GAX A;  1K9M 4;  5EEO A;  1BRN L;  1OGZ A;  1N8R 4;  4WFO A;  1TFO A;  3KII A;  3KSP A;  5CF1 A;  3OWS A;  1HZ1 A;  4AKY A;  4KZ1 A;  3EN1 B;  1UUW B;  1W2B 2;  1M9G A;  6GSP A;  2OCT A;  4L7K A;  1E97 A;  3JUM A;  1NB5 I;  3OW2 2;  4KVH A;  2SAR A;  1C54 A;  1WMP A;  4HM8 B;  1Q81 4;  3L0R A;  2CH9 A;  4U13 A;  3LZA A;  1S5A A;  1GMP A;  1GSP A;  4STD A;  2INX A;  3MG2 A;  3G16 A;  3LOY A;  5BVB A;  1BSD A;  1BSB A;  3CU3 A;  3PCS A;  1QVF 2;  2CFD A;  2HMK B;  5IG3 A;  3G6E 3;  4EC6 A;  2GU3 A;  1GMQ A;  4HM4 B;  5IEO A;  1O7N B;  3GWR A;  2HMJ B;  3URP A;  1UCJ A;  1BUJ A;  1R4Y A;  2Q07 A;  1ROA A;  1VQP 3;  4OUQ A;  2IUK A;  4MMZ B;  5IG0 A;  2H0G A;  3ER7 A;  1Q42 A;  5M1A A;  1T2I A;  2Y74 A;  1W5Z A;  1NU3 A;  4BU4 A;  1I8V A;  1W7C A;  1TUH A;  1O7H B;  1V74 A;  3DGO A;  1CYU A;  2F98 A;  1G0T A;  3F40 A;  5BU4 A;  4EV5 A;  3CNX A;  4EW5 A;  4AKZ A;  3KSE D;  4J5G A;  1MWT A;  1TU5 A;  1KWI A;  3EE1 A;  1M1X B;  1B2U A;  1RGA A;  4JF8 A;  1LOX A;  1Q40 B;  3WA3 A;  3UL5 A;  3K5T A;  2CFW A;  4O3V A;  1YGE A;  1TRQ A;  1SQW A;  1DMM A;  1MWS A;  1SJW A;  1YI2 3;  2RCD A;  1HU9 A;  1M1K 4;  1LOV A; 
#chains in the Genus database with same CATH homology
 2CG1 A;  1QAK A;  4GL6 A;  2BMQ B;  5ELJ A;  3CPO A;  4R4K A;  2MC8 A;  1VQ7 3;  1OAC A;  2F86 B;  2CWV A;  3DM8 A;  4FMA A;  2Y73 A;  4FMB A;  2W9Q A;  3JUN A;  7STD A;  2K54 A;  1IV7 A;  1K41 A;  4JRF A;  3SLU A;  3SVA A;  3BNB A;  2XEP A;  3FF0 A;  3MWZ A;  1K73 4;  3V92 A;  2CFG A;  4X2O A;  3OWU A;  2CFL A;  5IEN A;  1VQ4 3;  1FGT A;  3EBT A;  3LTB A;  4PEJ A;  1WNH A;  3EC9 A;  1FUW A;  1VQ9 3;  3CPW 2;  3F9S A;  4R80 A;  2UX0 A;  3ROB A;  3GZB A;  4HM7 B;  2I9W A;  5AIG A;  5IG4 A;  1QMA A;  3SXX A;  5D83 A;  1K8A 4;  5IF6 A;  3MG1 A;  1A90 A;  5FGO A;  3DGL A;  1VQM 3;  1DMQ A;  2M7O A;  3FH1 A;  5D81 A;  1CEW I;  1RN7 A;  2E2T A;  5KP1 A;  3CC4 3;  3KFQ C;  3QRD A;  3VF1 A;  2GBX B;  5CLK A;  5KP4 A;  2XFT A;  3CMA 3;  3BLZ A;  2E2U A;  1U8C B;  3LT9 A;  2K0M A;  3F8H A;  3CCQ 3;  3FLJ A;  3NV0 A;  3Q1C A;  4CCV A;  1W2Z A;  2BMO B;  3K7C A;  4HKV B;  1YJN 3;  5G2G A;  2CHC A;  1Q82 4;  1HKX A;  1US1 A;  1W4N A;  1RRH A;  2B1X B;  1Y4K A;  3LT8 A;  1EG9 B;  3GRD A;  2OOV A;  5JPP A;  2W03 A;  2Z7A A;  5LC7 A;  4EYC A;  4K90 B;  4X2H A;  4KFE A;  3UJM A;  3CCL 3;  1KD1 4;  3VGN A;  2XF3 A;  2GEX A;  1PFP A;  4RBN A;  2CW9 A;  4FCM A;  4HM2 B;  3MHE A;  2YX9 A;  4BTW A;  1N5H A;  3PS8 A;  3X3Y A;  2IMJ A;  1A67 A;  1NJI 4;  3WOF B;  3M8C A;  4EV2 A;  3EHC A;  2OQE A;  3I56 3;  4N6M A;  2HMM B;  2PZV A;  3LTA A;  1W01 A;  4MJD A;  1KQS 2;  3S29 A;  1O7M B;  3X40 A;  2BHM A;  2W9P A;  1Q7Y 4;  1IDP A;  4CDL A;  1FGR A;  4NRE A;  2WOF A;  1EQK A;  2W04 A;  1BUQ A;  5KP3 A;  1KSI A;  1Z1S A;  3K9M C;  5IW9 A;  5CXO A;  3CNM A;  4L8P A;  1PU4 A;  4FCZ A;  2LQV A;  1JB2 A;  2P38 A;  3HK4 A;  3TDG A;  1IVU A;  3MG3 A;  5EVH A;  3RGA A;  3I55 3;  1N9J A;  3OXA A;  5D82 A;  1OF5 A;  1W6Y A;  2P05 A;  2CWU A;  1AVL A;  1IQX A;  1MOL A;  1G96 A;  2CKF B;  3N9H A;  2BNG A;  3NUV A;  4IT7 A;  1VZZ A;  1DVC A;  3LXU X;  3SOA A;  4J8T A;  4HM5 B;  5I97 A;  4HZB B;  3CCV 3;  1YIT 3;  3WA2 X;  1GY6 A;  3BB9 A;  3HIG A;  1F8N A;  1N9E A;  2WGO A;  2MF7 A;  4ZM8 A;  4HM1 B;  3MPH A;  3LTD A;  1TFK A;  1IVX A;  4HVN A;  4MEI A;  3MYT A;  4KFD A;  3KN4 A;  2CG0 A;  3B4O A;  4NHF A;  1FGQ A;  1JNQ A;  1AR0 A;  1OH0 A;  2C10 A;  2XGL A;  2O3O A;  3BNE A;  3LH4 A;  3GZR A;  3IPT A;  1IK3 A;  3NX0 A;  2P0X A;  4XBT A;  1NO3 A;  3UNL A;  1M90 4;  2QIY A;  4J9A A;  4XM4 A;  3G0K A;  2QGU A;  4N6N B;  3E99 A;  5IG5 A;  1IT8 A;  1ULI B;  4N6U A;  2HML B;  1VQ8 3;  3PGB A;  4WWU C;  3OV4 A;  3EB8 A;  3DUK A;  4WYK B;  1WTH A;  4QWT A;  4WHA A;  1NB3 I;  4XB5 A;  5STD A;  2CIU A;  1J2B A;  3QK9 A;  3F7X A;  1T5Y A;  3EJV A;  4FR9 A;  1JRQ A;  2WGQ A;  1A2K A;  5DRV A;  6STD A;  2L4V A;  3X3Z A;  1NWW A;  1D6Z A;  2KXG A;  1O7G B;  1DYU A;  3Q90 A;  3RGR A;  2R4I A;  3LTC A;  1W6C A;  3B4P A;  3GZX B;  2SBL A;  3SX1 A;  2GBW B;  1YJW 3;  1E3R A;  2XFS A;  4FMD A;  3V98 A;  3KE7 A;  4N6O B;  3F7S A;  4IPB A;  5IER A;  2JQ5 A;  1OHO A;  4LZI A;  2XH9 A;  1C7H A;  3RDE A;  3UL6 A;  3D3L A;  1QAF A;  5AIF A;  3F14 A;  3FF2 A;  1YVB I;  1Q86 4;  2B24 B;  3BND A;  5A0O B;  5TGN A;  2Z76 A;  1OF5 B;  1UI8 A;  1O7W B;  3CME 3;  4FMC A;  3H51 A;  5AIH A;  3LYG A;  1OUN A;  3G4S 3;  1N8Q A;  2IA7 A;  1JN5 A;  4TX4 A;  1EKM A;  1JKG A;  2XGN A;  3X3X A;  5JPU A;  2C11 A;  4O8S A;  4L8O A;  2IUJ A;  2OOV C;  1O7P B;  4XDW A;  5CF2 A;  1CQS A;  2XRX B;  1Q40 A;  3H3H A;  4N6T A;  2XSO B;  8CHO A;  2Z77 A;  1RKY A;  2W56 A;  3Q2P A;  1STF I;  2ZDJ A;  4MMY B;  2ML6 A;  3LML A;  3NBJ A;  1N5P A;  4BTX A;  1FA3 A;  2V1L A;  3SED A;  3NV0 B;  2STD A;  1RJO A;  1W6G A;  3EF8 A;  2ZL8 A;  3EQQ B;  4LGQ A;  2QA4 3;  1UUV B;  4R9L A;  1VQN 3;  1LXE A;  2O9U X;  2QEX 3;  3DXO A;  3G71 3;  1DMN A;  4RZM A;  3U97 A;  5IEP A;  2XSH B;  3WOE B;  4XBX A;  3PXM A;  1KC8 4;  1E3V A;  3JUO A;  3NQZ A;  3CCE 3;  3U1W A;  1YJ9 3;  1TP6 A;  1SPU A;  2P09 A;  2CFK A;  3KZT A;  2W0Q A;  1SII A;  3CCM 3;  4H3U A;  3CCU 3;  2CK3 H;  3B7C A;  4EBG A;  1ZO2 A;  1VQL 3;  2W56 B;  1JB4 A;  1ROV A;  3T8N A;  1LNH A;  1OPY A;  1QAL A;  5FW5 A;  3FZW A;  4HM3 B;  3S67 A;  1NDO B;  3MKI A;  1R4C A;  3EN8 A;  3O8Y A;  3JVC A;  3FSD A;  3FG1 A;  5AEW B;  3FCS B;  3G8Z A;  1EA2 A;  1GD4 A;  1U5O A;  5AYR B;  3DY5 A;  2OTL 3;  1OHS A;  4RNY A;  4BTY A;  2D1W A;  3HI7 A;  3FG3 A;  1AVK A;  1STD A;  1VQK 3;  2GEY A;  1WMO A;  1VQO 3;  2LYX A;  1A2V A;  2OWP A;  4K1V A;  3WOD G;  1K28 A;  3NHX A;  3EX9 A;  2W2C A;  3PYJ A;  3UB1 A;  4K61 A;  3V99 A;  3STD A;  1W02 A;  1IVW A;  3A76 A;  2FNQ A;  1IU7 A;  3CC2 3;  1D6U A;  2HMO B;  1FGO A;  1IQ8 A;  3N54 B;  4N6L A;  1DVD A;  1OCV A;  3EBY A;  4I4K A;  1CYV A;  1ULJ B;  1IV9 A;  1WMN A;  2FGT A;  1GS3 A;  2YFJ B;  3X41 A;  4XDV A;  1QJG A;  2RGQ A;  3OWY A;  1YIJ 3;  1GY5 A;  2WOH A;  4G1M B;  3K63 A;  2ML5 A;  3WDG B;  1VQ5 3;  1GY7 A;  3CD6 3;  3NM2 A;  1D6Y A;  3SOY A;  2BT3 A;  1UI7 A;  4Q53 A;  3S5C A;  3MSO A;  3IJE B;  1ISK A;  1LVN A;  2YFI B;  4HJL B;  1IVV A;  5BXQ A;  1OGX A;  3S28 A;  4O02 B;  5LC6 A;  4OVM A;  2BO9 B;  2PNC A;  3F8X A;  3S27 A;  4N6V 0;  3B8L A;  3AMO B;  2BMR B;  3HZP A;  4HZ9 B;  3WMD A;  1W00 A;  1AV4 A;  4HM6 B;  1ASK A;  1TIJ A;  2F99 A;  4O2H A;  1WQL B;  3OX9 A;  1FGM A;  3NM7 A;  3JUP A;  3J7Y d;  4WP5 A;  3VSY A;  2KCD A;  4ORL A;  4EXR A;  2KRT A;  5AII A;  3FG4 A;  3NBR A;  4LEH A;  1MNL A;  3FGY A;  2CWT A;  3NXJ A;  3CCR 3;  1JN5 B;  3PZW A;  1SIH A;  4K1U A;  1JKG B;  1GD3 A;  2JDI H;  2P0M A;  5AI1 A;  3N8B A;  1UW1 A;  1IT7 A;  3K0Z A;  2WO0 A;  1RRL A;  2E2V A;  4HYZ A;  3T0U A;  5ELU A;  3IMA B;  5JBS A;  3CC7 3;  2OQE C;  3DGN A;  3DGM A;  4HM0 B;  5DRE A;  2GU1 A;  4GB5 A;  2OTJ 3;  3T8U A;  4LMI A;  3ECF A;  1VQ6 3;  1JB5 A;  3ALA A;  2Z6B A;  1JJ2 2;  4XBY A;  2A15 A;  3CCJ 3;  3NBB A;  3NQY A;  5CK6 A;  3GZY B;  3DZL A;  2XR8 B;  4IIA A;  3X42 A;  4FCJ A;  3PCR A;  3BNC A;  5EQL A;  1QVG 2;  4MMX B;  3CXC 2;  4R1K A;  4HBR A;  1OHP A;  1JV2 B;  1ZX2 A;  1IQY A;  4AEQ A;  4OK0 A;  2GXF A;  3JUQ A;  2RSX A;  5AEU B;  2CC3 A;  2D42 A;  4LSO A;  1S72 3;  2HMN B;  3FKA A;  3HX8 A;  4KFF A;  4R9K A;  4H61 A;  3AMO A;  2RFR A;  3DMC A;  4WYK A;  1GYB A;  3HII A;  2YFL B;  3D9R A;  3I0Y A;  4N3V A;  5AYS C;  5HGR A;  1L5G B;  1YHQ 3;  3CCS 3;  3KKG A;  2W6J H;  4RNZ A;  3GAX A;  1K9M 4;  5EEO A;  1OGZ A;  1N8R 4;  4WFO A;  1TFO A;  3KII A;  3KSP A;  5CF1 A;  3OWS A;  4AKY A;  4KZ1 A;  3EN1 B;  1UUW B;  1W2B 2;  1M9G A;  2OCT A;  4L7K A;  1E97 A;  3JUM A;  1NB5 I;  3OW2 2;  4KVH A;  1WMP A;  4HM8 B;  1Q81 4;  3L0R A;  2CH9 A;  4U13 A;  3LZA A;  1S5A A;  4STD A;  2INX A;  3MG2 A;  3G16 A;  3LOY A;  5BVB A;  3CU3 A;  3PCS A;  1QVF 2;  2CFD A;  2HMK B;  5IG3 A;  3G6E 3;  4EC6 A;  2GU3 A;  4HM4 B;  5IEO A;  1O7N B;  3GWR A;  2HMJ B;  2Q07 A;  1ROA A;  1VQP 3;  4OUQ A;  2IUK A;  4MMZ B;  5IG0 A;  3ER7 A;  1Q42 A;  2Y74 A;  1W5Z A;  1NU3 A;  1W7C A;  1TUH A;  1O7H B;  1V74 A;  3DGO A;  1CYU A;  2F98 A;  3F40 A;  4EV5 A;  3CNX A;  4AKZ A;  3KSE D;  1TU5 A;  1KWI A;  3EE1 A;  1M1X B;  4JF8 A;  1LOX A;  1Q40 B;  3WA3 A;  3UL5 A;  3K5T A;  2CFW A;  4O3V A;  1YGE A;  1SQW A;  1DMM A;  1SJW A;  1YI2 3;  2RCD A;  1HU9 A;  1M1K 4;  2FXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...