1TFOA

Ribonuclease from escherichia coli complexed with its inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
LDSGRFSRKQLDKKYKHAGDFGISDTKKNRETLTKFRDAIEEHLSDKDTVEKGTYRREKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLETGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
molecule keywords Colicin D
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11429 Colicin_D Colicin D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.200 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tfoA00
1V74A 1TFKA 1TFOA
chains in the Genus database with same CATH superfamily
1YGEA 4RNYA 2KF6A 1OCVA 1GD4A 2BO9B 4GSPA 3EX9A 5AYRB 4R4KA 3N9HA 1S723 1MWUA 1UGHI 4HM1B 4K1VA 4O02B 1JBSA 4EV5A 6RNTA 1CEWI 1G02A 1AVLA 1TIJA 2IUKA 1M904 2P38A 1AVKA 1UDII 1W02A 3X42A 4L7KA 1IDPA 2HOHA 1YNVX 1NJI4 1W7CA 2CFWA 2JQ5A 1JB2A 1VQ43 3MG2A 3NM7A 2ZA4A 3ALAA 3STDA 4O2HA 3F7SA 2J8XB 5DRVA 1BAOA 5AIGA 1KC84 1LOXA 1BUQA 1YVSA 7STDA 1ISKA 5A0OB 1BNJA 2CWUA 2GU1A 1MOLA 1WMOA 1BGSA 3DGMA 2B24B 1BNSA 3KSED 4R9LA 3BNEA 3LT9A 3WA3A 1GMPA 1FW7A 3EB8A 3SX1A 2BIRA 4OUQA 1FYSA 3MYTA 3CCU3 1GS3A 1RNTA 1RKYA 2XF3A 3LXUX 5LC7A 1Q864 3AHSA 3Q90A 4LEHA 1TRPA 1B27A 1LOWA 1QALA 4BTXA 1B2MA 1A2PA 3NUVA 4J9AA 1FUWA 4ZM8A 1LNIA 1B2ZA 2GSPA 1RNBA 4KFFA 2O3OA 1ROAA 3N8BA 4XB5A 2KRTA 1RRLA 1A67A 1AV4A 2R41A 2D42A 1NWWA 5CXOA 2CX0A 5AEUB 1RCLA 2M7OA 4WYKA 1VQ53 2E2VA 3LMLA 1GOVA 2PNCA 3CU3A 3GZRA 5I97A 1X1YA 3FG4A 4X2OA 3CC43 2F5MA 1YIJ3 3GAXA 3LTAA 2R4IA 5FW5A 4RNZA 3DGYA 4KVHA 3WOFB 1YJ93 1BRSA 1G96A 2BMQB 4HZBB 5EEOA 1UI7A 3T8UA 2FGTA 3FKAA 3G16A 3URPA 4FR9A 3X3ZA 3DH2A 5BVBA 3F7XA 1W2ZA 4HYZA 1BNGA 4R80A 1RGFA 3WHOA 2IUJA 1RN1A 3JVCA 3Q3FA 4FCMA 3D9RA 3CCE3 2F99A 3FLJA 4RNTA 1W6GA 9RNTA 1N8QA 1IT8A 4ILFA 3DMCA 4WWUC 5AIFA 1K734 3SLUA 1RN7A 4HZ9B 1QVF2 1I2EA 2OCTA 2A15A 2BNGA 2OQEA 1FGOA 2CW9A 2HMMB 1CYUA 5IF6A 1VZZA 4N6LA 3EC9A 1W00A 3CCS3 1OPYA 1BU4A 2CG1A 2BU4A 4NREA 4OVMA 3TDGA 2UGIA 3HX8A 2XRXB 3EHCA 5IEPA 3VF1A 3EJVA 1W01A 3KN4A 2FXTA 5AI1A 1JBTA 1FUSA 1B21A 1N5PA 3X41A 3F40A 1RGLA 4BU4A 1JRQA 1FUTA 1IU7A 1QAKA 2GEXA 4PEJA 3UL6A 1A2VA 2RFRA 1B2UA 5KP1A 2WGOA 4HVNA 4BL2A 1IV7A 1PU4A 3OXAA 2CFLA 3FG1A 3S29A 4WFOA 2L4VA 1NB3I 1OHSA 1MWTA 3NX0A 3MPHA 3CCR3 1IVXA 4BTYA 4CDLA 1NU3A 5CF1A 1Q824 1NO3A 1JBRA 3CMA3 4R9KA 1BRJA 2AAEA 1AQZA 4ORLA 4BL3A 4CJNA 3SYUA 4N6V0 4FMAA 3LYGA 1DMQA 1BNIA 1Q40A 4GHOA 4WP5A 5G1LA 3I553 4HAAA 3JUQA 4G1MB 3D5IA 5CLKA 3NHXA 1BNEA 3NBBA 3BU4A 3LZAA 3G8ZA 4K61A 4MEIA 5HGRA 2RCDA 4NPBA 1QAFA 4IPBA 1G0TA 1KWIA 1Y4KA 1BRIA 3MSOA 5CF2A 3SVAA 1BSBA 5JBSA 3CD63 2B1XB 3H51A 1RGAA 3J7Yd 1PFPA 1BRKA 4AEQA 1I2FA 4XDWA 1D6UA 1YJN3 3LTBA 4J5GA 1J2BA 1NB5I 1IQYA 1OF5A 1RJOA 1MNLA 3I563 1JN5B 5STDA 3DXOA 1BIRA 4N6NB 6GSPA 3OWUA 3CPW2 1N9JA 1VQP3 1ZO2A 3H3HA 3GZYB 3D4AA 4HM5B 4XM4A 1C54A 1OACA 4LYLB 1KD14 1X1UA 5JPUA 2Z7AA 3F9SA 3O8YA 4I5QA 1UUGB 1RGCA 2K3DA 1N8R4 3LTDA 2Y74A 2CFDA 1VQK3 3I0YA 3QRDA 1WQLB 2CWTA 2HMLB 3E99A 3K0ZA 3DGLA 2F86B 4FCJA 1O7MB 3ROBA 5M19A 3JUNA 1VQ63 2XSHB 1BUJA 2YFIB 1SIIA 4LMIA 1B20A 1RRHA 3MHEA 5IG5A 4FMDA 1DE3A 3KCHA 1IK3A 1IT7A 4GB5A 3B4OA 2P05A 2IYJA 2BMRB 1LQGC 1ZX2A 3AGOA 3B7CA 3BNDA 1GSPA 3ECFA 3EBYA 1EQKA 1B3SA 1JB5A 3MKIA 2ML6A 3S67A 1UCLA 4AKYA 4JRFA 3PS8A 2W56B 4MMYB 4EV2A 4XBXA 2W9QA 4RBNA 3WMDA 4BTWA 3RDEA 7RNTA 1RCKA 1KQS2 1T2IA 1RN4A 3G6E3 1ULJB 4HM8B 1O7GB 2KF5A 3WR2A 1T5YA 4K90B 2GU3A 1OHOA 4MMZB 3X40A 2IA7A 3VSYA 1LVNA 1YJW3 1SQWA 2HMKB 3KIIA 3PXMA 4EBGA 1HZ1A 1JKGB 3GSPA 3S5CA 2V1LA 2OWPA 2CKFB 3AHWA 3LTCA 1N9EA 4KZ1A 1CH0A 2Y73A 3K9MC 5ELUA 3B8LA 1IVWA 3GRDA 4HM7B 4I4KA 2C11A 4N3VA 1I0XA 5M1AA 2OOVA 1Q42A 2E2TA 5GSPA 3CCM3 1N5HA 1O7PB 1MGWA 3S27A 1MWRA 2INXA 2UUGC 1I2GA 2RBIA 2OQEC 4KFDA 5CK6A 2XFTA 3EE1A 2P09A 3NBJA 4N6TA 2GXFA 1C7HA 4KT3B 3U97A 1BNRA 4AKZA 3WOEB 3OWYA 1VQN3 6STDA 1TRQA 3T0UA 5IERA 2OTJ3 5IG3A 1Q40B 3CPOA 1BANA 2W9PA 3G4S3 2HMJB 1LNHA 1A90A 4Q53A 1HYFA 2ZL8A 3Q1CA 2W0QA 2GEYA 2HMOB 2ZDJA 1VQM3 1ROVA 2E2UA 1GMQA 2RGQA 3BB9A 4MJDA 1EA2A 1RMSA 5KP3A 1TP6A 4XDVA 1IV9A 3BLZA 1FGMA 4LGQA 5IEOA 1T3BA 4N6OB 1Q814 2W56A 2D1WA 1LOVA 4XBTA 5JPPA 3A76A 1RGEA 3K7CA 1JV2B 1K8A4 1T2HA 2Q07A 3FCSB 3GZBA 2KCDA 2BT3A 4J8TA 3RGAA 2K54A 3FF0A 4WYKB 1UCJA 1M1XB 1V58A 3BIRA 1O7NB 1TU5A 4DKIA 1MWSA 3X3XA 1W4NA 1FGQA 3MG3A 3ZG0A 1RTUA 4HM2B 5AYSC 1NNVA 3EN8A 3FG3A 3V92A 3OW22 1GOYA 1V57A 3FF2A 1GY7A 1K28A 5AIHA 5TGNA 1ZGXA 3M8CA 2AADA 2CIUA 3PCSA 4L8PA 4X2HA 3WA2X 5D82A 2GBWB 1W6CA 1EG9B 2Z77A 5AIIA 3CCV3 1VQO3 4HM6B 1JZOA 1RDSA 5KP4A 1RSNA 3MG1A 3Q2PA 1R4CA 2KF3A 5BU4A 2P0XA 2ZHXB 3CCJ3 4H3UA 5DREA 3V98A 2BMOB 3FZWA 1PY3A 2LQVA 1EEJA 1TFKA 3KSPA 1JN5A 2GBXB 3GZXB 3FGYA 4J5KA 1B2XA 3JUOA 1BSAA 1I8VA 2KAAA 4GL6A 2RNTA 1DMMA 4QWTA 5IG4A 2H0IA 3EBTA 3S28A 1JNQA 3GWRA 3U1WA 2PZVA 4WHAA 4EC6A 2CG0A 2XEPA 3A5EA 2SBLA 2QIYA 1OH0A 5M18A 1W2B2 1MGRA 1STDA 3NQZA 1R4YA 5ELJA 3IJEB 1DETA 2QEX3 4HBRA 4HJLB 5IENA 3WODG 3NV0A 2WGQA 3FH1A 1BOXA 1EKMA 1M9GA 2HMNB 3DY5A 4HM4B 3HOHA 3B4PA 1VQQA 2CC3A 3N54B 2ML5A 3PCRA 3CNMA 4IIAA 4KFEA 3V99A 3PYJA 4BIRA 3NV0B 4HM3B 8RNTA 1TFOA 1LOYA 1TUHA 2P0MA 1X1XA 2CH9A 1HU9A 3SOYA 2XGLA 2C4BA 1OF5B 1TJDA 3F8XA 4OK0A 5IW9A 1GD3A 1IQXA 3HZPA 1RGHA 5IG0A 1UCIA 3CME3 8CHOA 1U5OA 3X3YA 2YFLB 3JUMA 1JJ22 1I3FA 1QMAA 2BHMA 2MF7A 3D3LA 1E3RA 3DGOA 4LZIA 3ER7A 5D81A 4U13A 5LC6A 1GY6A 1E3VA 1BSCA 3WDGB 4HOHA 3NQYA 2CWVA 1IYYA 4N6MA 1QJGA 3KFQC 3EQQB 3BNBA 3SEDA 1UGIA 1GY5A 1WNHA 1ULIB 2YX9A 3ZG5A 3CCQ3 3PGBA 1I70A 3ZFZA 1NDOB 4L8OA 1ZS7A 1FGTA 5D83A 1U8CB 2XGNA 4LSOA 1Q7Y4 3SOAA 2OOVC 1TTOA 3AMOB 3LT8A 1K41A 4EW5A 5G2GA 2F4YA 2W04A 4EYCA 1M1K4 1RGGA 3F8HA 1VQL3 1DYUA 3UJMA 2Z76A 3MWZA 3BNCA 1CYVA 2MC8A 1UW1A 2CK3H 1GYBA 4R1KA 1SIHA 2XR8B 4XBYA 3LOYA 2KXGA 3K5TA 3SXXA 1GMRA 7GSPA 3F14A 3T8NA 1K9M4 3HI7A 2XSOB 3CCL3 3EF8A 1Q7HA 3NBRA 1FA3A 2UX0A 3CC73 3OX9A 1BSDA 2YFJB 2Z6BA 1I3IA 2WO0A 1OHPA 2KF4A 2XFSA 1YHQ3 1DMNA 1RLSA 2C10A 4O3VA 4O8SA 4H61A 5BXQA 2L1SA 1YIT3 1DVCA 1SARA 2I9WA 1JB4A 2F5WA 3D5GA 3KKGA 2OTL3 4K1UA 3DUKA 1S5AA 2F56A 4N6UA 1A2KA 2O9UX 3AMOA 1YGWA 3NM2A 1Q9EA 1D6ZA 2CHCA 4CCVA 1VQ93 3FSDA 3UL5A 2W6JH 1RHLA 2QGUA 2WOHA 1KSIA 1CQSA 3VGNA 1EUIC 1VQ83 1RGKA 4MMXB 1WTHA 4NHFA 2QA43 1WMPA 3UB1A 3LH4A 1ASKA 1VQ73 1WMNA 1YVBI 3PZWA 1SPUA 2CFKA 3CC23 1UUWB 3DM8A 3DZLA 3UNLA 4FCZA 2FNQA 1V74A 1O7WB 1W6YA 1D6YA 2IMJA 4FMBA 1LRAA 1W5ZA 4CPKA 2CX1A 4JF8A 1UI8A 1YI23 1JKGA 1FGRA 1OGZA 4EXRA 1E97A 2WOFA 3K63A 4RZMA 1IQ8A 1QVG2 1DVDA 5G1KA 4STDA 1B2SA 3IMAB 3G0KA 1BSEA 1GOUA 3NXJA 3G713 2XH9A 2JDIH 1F8NA 1IVVA 1O7HB 1PYLA 2IY2A 1AY7A 1BRHA 1Z1SA 4IT7A 3IPTA 3QK9A 3DGNA 2W03A 2LYXA 3KZTA 1STFI 1SJWA 3EN1B 1LXEA 1US1A 5BIRA 2K0MA 2RSXA 3AGNA 3D79A 1FZUA 1BRGA 2STDA 3HIIA 1HKXA 1OGXA 2SARA 4FMCA 3L0RA 1I0VA 3OV4A 1BVIA 2H0HA 1UCKA 3JUPA 3KE7A 1OUNA 5EVHA 5EQLA 2CFGA 3RNTA 2F98A 5FGOA 1L5GB 3CXC2 3RGRA 4TX4A 1AR0A 1UUVB 1BRNL 2H0GA 2W2CA 1X1WA 1JZDA 5RNTA 5AEWB 5HOHA 3HK4A 3CNXA 3OWSA 4HKVB 1LQMB 1IVUA 3HIGA 4HM0B 1BNFA
chains in the Genus database with same CATH topology
1YGEA 4RNYA 1OCVA 1GD4A 2BO9B 3EX9A 5AYRB 4R4KA 3N9HA 1S723 4HM1B 4K1VA 4O02B 4EV5A 1CEWI 1AVLA 1TIJA 2IUKA 1M904 2P38A 1AVKA 1W02A 3X42A 4L7KA 1IDPA 1NJI4 1W7CA 2CFWA 2JQ5A 1JB2A 1VQ43 3MG2A 3NM7A 3ALAA 3STDA 4O2HA 3F7SA 5DRVA 5AIGA 1KC84 1LOXA 1BUQA 7STDA 1ISKA 5A0OB 2CWUA 2GU1A 1MOLA 1WMOA 3DGMA 3KSED 2B24B 4R9LA 1PU4A 3WA3A 3BNEA 3LT9A 3EB8A 3SX1A 4OUQA 3MYTA 3CCU3 1GS3A 1RKYA 2XF3A 3LXUX 5LC7A 1Q864 3Q90A 4LEHA 1QALA 4BTXA 3NUVA 4J9AA 1FUWA 4ZM8A 4KFFA 2O3OA 1ROAA 3N8BA 4XB5A 2KRTA 1RRLA 1A67A 1AV4A 2D42A 1NWWA 5CXOA 5AEUB 2M7OA 4WYKA 1VQ53 2E2VA 3LMLA 5I97A 2PNCA 3CU3A 3GZRA 3FG4A 4X2OA 3CC43 1YIJ3 3GAXA 3LTAA 2R4IA 5FW5A 4RNZA 1YJ93 4KVHA 3WOFB 1G96A 2BMQB 4HZBB 5EEOA 1UI7A 3T8UA 2FGTA 3FKAA 3G16A 3X3ZA 4FR9A 5BVBA 3F7XA 1W2ZA 4HYZA 4R80A 2IUJA 3JVCA 4FCMA 3CCE3 3D9RA 2F99A 3FLJA 1W6GA 1N8QA 1IT8A 3DMCA 4WWUC 5AIFA 1K734 3SLUA 1RN7A 4HZ9B 1QVF2 2OCTA 2A15A 2BNGA 2OQEA 1FGOA 2CW9A 2HMMB 1CYUA 5IF6A 1VZZA 4N6LA 3EC9A 1W00A 3CCS3 1OPYA 2CG1A 4OVMA 4NREA 3TDGA 3HX8A 2XRXB 3EHCA 5IEPA 3VF1A 3EJVA 1W01A 3KN4A 2FXTA 5AI1A 3X41A 1N5PA 3F40A 1JRQA 1IU7A 1QAKA 2GEXA 4PEJA 3UL6A 1A2VA 2RFRA 5KP1A 2WGOA 4HVNA 1IV7A 3OXAA 2CFLA 3FG1A 3S29A 4WFOA 2L4VA 1NB3I 1OHSA 3NX0A 3MPHA 3CCR3 1IVXA 4BTYA 4CDLA 1NU3A 5CF1A 1Q824 1NO3A 3CMA3 4R9KA 4ORLA 4N6V0 4FMAA 3LYGA 1DMQA 1Q40A 4WP5A 3I553 1Q814 3JUQA 4G1MB 5CLKA 3NHXA 3NBBA 3LZAA 3G8ZA 4K61A 4MEIA 5HGRA 2RCDA 1QAFA 4IPBA 1KWIA 1Y4KA 5JBSA 3MSOA 5CF2A 3SVAA 3CD63 2B1XB 3H51A 3J7Yd 1PFPA 4AEQA 4XDWA 1YJN3 1D6UA 3LTBA 1J2BA 1NB5I 1IQYA 1OF5A 1RJOA 1MNLA 3I563 1JN5B 3DXOA 4N6NB 3OWUA 3CPW2 1N9JA 1VQP3 1ZO2A 3H3HA 3GZYB 4XM4A 4HM5B 1OACA 1KD14 5JPUA 2Z7AA 3F9SA 3O8YA 1N8R4 3LTDA 2Y74A 2CFDA 1VQK3 3I0YA 3QRDA 1WQLB 2CWTA 2HMLB 3E99A 3K0ZA 3DGLA 2F86B 4FCJA 1O7MB 3ROBA 3JUNA 1VQ63 2XSHB 2YFIB 1SIIA 4LMIA 1RRHA 3MHEA 5IG5A 4FMDA 1IK3A 1IT7A 4GB5A 3B4OA 2P05A 2BMRB 1ZX2A 3B7CA 3BNDA 3ECFA 3EBYA 1EQKA 1JB5A 3MKIA 3S67A 2ML6A 4AKYA 4JRFA 3PS8A 2W56B 4MMYB 4EV2A 4XBXA 2W9QA 4RBNA 3WMDA 4BTWA 3RDEA 1KQS2 3G6E3 1ULJB 4HM8B 1O7GB 1T5YA 4K90B 2GU3A 1OHOA 4MMZB 3X40A 2IA7A 3VSYA 1LVNA 1YJW3 1SQWA 2HMKB 3KIIA 3PXMA 4EBGA 1JKGB 3S5CA 2V1LA 2OWPA 2CKFB 3LTCA 1N9EA 4KZ1A 2Y73A 3K9MC 5ELUA 3B8LA 1IVWA 3GRDA 4HM7B 4I4KA 2C11A 4N3VA 2OOVA 1Q42A 2E2TA 3CCM3 1N5HA 1O7PB 3S27A 2INXA 4KFDA 5CK6A 2OQEC 2XFTA 3EE1A 2P09A 3NBJA 4N6TA 2GXFA 1C7HA 3U97A 4AKZA 3WOEB 3OWYA 1VQN3 6STDA 3T0UA 5IERA 2OTJ3 5IG3A 1Q40B 3CPOA 2W9PA 3G4S3 2HMJB 1LNHA 1A90A 4Q53A 2ZL8A 3Q1CA 2W0QA 2GEYA 2HMOB 2ZDJA 1VQM3 1ROVA 2E2UA 2RGQA 3BB9A 4MJDA 1EA2A 5KP3A 1TP6A 4XDVA 1IV9A 3BLZA 1FGMA 4LGQA 5IEOA 4N6OB 2W56A 2D1WA 4XBTA 5JPPA 3A76A 3K7CA 1JV2B 1K8A4 2Q07A 3FCSB 3GZBA 2KCDA 2BT3A 4J8TA 3RGAA 2K54A 3FF0A 4WYKB 1M1XB 1TU5A 1O7NB 3X3XA 1W4NA 1FGQA 3MG3A 4HM2B 5AYSC 3EN8A 3FG3A 3V92A 3OW22 3FF2A 1GY7A 1K28A 5AIHA 5TGNA 3M8CA 2CIUA 3PCSA 4L8PA 4X2HA 3WA2X 5D82A 2GBWB 1W6CA 1EG9B 2Z77A 5AIIA 3CCV3 1VQO3 4HM6B 5KP4A 3MG1A 3Q2PA 1R4CA 2P0XA 3CCJ3 4H3UA 5DREA 3V98A 2BMOB 3FZWA 2LQVA 1TFKA 3KSPA 1JN5A 2GBXB 3GZXB 3FGYA 3JUOA 4GL6A 4QWTA 5IG4A 1DMMA 3S28A 3EBTA 1JNQA 3GWRA 3U1WA 2PZVA 4WHAA 4EC6A 2CG0A 2XEPA 2SBLA 2QIYA 1OH0A 1W2B2 5ELJA 1STDA 3NQZA 3IJEB 2QEX3 4HBRA 4HJLB 5IENA 3WODG 2WGQA 3FH1A 1M9GA 1EKMA 2HMNB 3DY5A 4HM4B 3B4PA 2CC3A 3N54B 2ML5A 3PCRA 3CNMA 4IIAA 4KFEA 3V99A 3PYJA 3NV0B 4HM3B 1TFOA 1TUHA 2P0MA 2CH9A 1HU9A 3SOYA 2XGLA 3F8XA 1OF5B 4OK0A 5IW9A 1GD3A 1IQXA 3HZPA 5IG0A 3CME3 8CHOA 1U5OA 3X3YA 2YFLB 3JUMA 1JJ22 1QMAA 2BHMA 2MF7A 3D3LA 1E3RA 3DGOA 4LZIA 3ER7A 5D81A 4U13A 5LC6A 1GY6A 1E3VA 3WDGB 3NQYA 2CWVA 4N6MA 1QJGA 3KFQC 3EQQB 3BNBA 3SEDA 1GY5A 1WNHA 1ULIB 2YX9A 3CCQ3 3PGBA 1NDOB 4L8OA 1FGTA 5D83A 1U8CB 2XGNA 4LSOA 1Q7Y4 3SOAA 2OOVC 3AMOB 3LT8A 1K41A 5G2GA 2W04A 4EYCA 1M1K4 3F8HA 1VQL3 1DYUA 3UJMA 2Z76A 3MWZA 3BNCA 1CYVA 2MC8A 1UW1A 2CK3H 1GYBA 4R1KA 1SIHA 2XR8B 4XBYA 3LOYA 2KXGA 3K5TA 3SXXA 3F14A 3T8NA 1K9M4 3HI7A 2XSOB 3CCL3 3EF8A 3NBRA 1FA3A 2UX0A 3CC73 3OX9A 2YFJB 2Z6BA 2WO0A 1OHPA 2XFSA 1YHQ3 1DMNA 2C10A 4O3VA 1YIT3 4O8SA 4H61A 5BXQA 1DVCA 2I9WA 3KKGA 1JB4A 2OTL3 4K1UA 3DUKA 1S5AA 4N6UA 1A2KA 2O9UX 3AMOA 3NM2A 1D6ZA 2CHCA 4CCVA 1VQ93 3FSDA 3UL5A 2W6JH 2QGUA 2WOHA 1KSIA 1CQSA 3VGNA 1VQ83 4MMXB 1WTHA 4NHFA 2QA43 1WMPA 3UB1A 3LH4A 1ASKA 1VQ73 1WMNA 1YVBI 3PZWA 1SPUA 2CFKA 3CC23 1UUWB 3DM8A 3DZLA 3UNLA 4FCZA 2FNQA 1V74A 1O7WB 1W6YA 1D6YA 2IMJA 4FMBA 1W5ZA 4JF8A 1UI8A 1YI23 1JKGA 1FGRA 1OGZA 4EXRA 1E97A 2WOFA 3K63A 4RZMA 1IQ8A 1QVG2 1DVDA 4STDA 3IMAB 3G0KA 3NXJA 3G713 2XH9A 2JDIH 1F8NA 1O7HB 1IVVA 1Z1SA 4IT7A 3IPTA 3QK9A 3DGNA 2W03A 2LYXA 3KZTA 1STFI 1SJWA 3EN1B 1LXEA 1US1A 2K0MA 2RSXA 3HIIA 4FMCA 5STDA 2STDA 1HKXA 1OGXA 3L0RA 3OV4A 3JUPA 3KE7A 1OUNA 5EVHA 5EQLA 2CFGA 2F98A 5FGOA 1L5GB 3CXC2 3RGRA 4TX4A 1AR0A 1UUVB 2W2CA 5AEWB 3HK4A 3CNXA 3OWSA 4HKVB 1IVUA 3HIGA 4HM0B 3NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V74 A;  1TFK A;  1TFO A; 
#chains in the Genus database with same CATH topology
 1YGE A;  4RNY A;  2KF6 A;  1OCV A;  1GD4 A;  2BO9 B;  4GSP A;  3EX9 A;  5AYR B;  4R4K A;  3N9H A;  1S72 3;  1MWU A;  1UGH I;  4HM1 B;  4K1V A;  4O02 B;  1JBS A;  4EV5 A;  6RNT A;  1CEW I;  1G02 A;  1AVL A;  1TIJ A;  2IUK A;  1M90 4;  2P38 A;  1AVK A;  1UDI I;  1W02 A;  3X42 A;  4L7K A;  1IDP A;  2HOH A;  1YNV X;  1NJI 4;  1W7C A;  2CFW A;  2JQ5 A;  1JB2 A;  1VQ4 3;  3MG2 A;  3NM7 A;  2ZA4 A;  3ALA A;  3STD A;  4O2H A;  3F7S A;  2J8X B;  5DRV A;  1BAO A;  5AIG A;  1KC8 4;  1LOX A;  1BUQ A;  1YVS A;  7STD A;  1ISK A;  5A0O B;  1BNJ A;  2CWU A;  2GU1 A;  1MOL A;  1WMO A;  1BGS A;  3DGM A;  2B24 B;  1BNS A;  3KSE D;  4R9L A;  3BNE A;  3LT9 A;  3WA3 A;  1GMP A;  1FW7 A;  3EB8 A;  3SX1 A;  2BIR A;  4OUQ A;  1FYS A;  3MYT A;  3CCU 3;  1GS3 A;  1RNT A;  1RKY A;  2XF3 A;  3LXU X;  5LC7 A;  1Q86 4;  3AHS A;  3Q90 A;  4LEH A;  1TRP A;  1B27 A;  1LOW A;  1QAL A;  4BTX A;  1B2M A;  1A2P A;  3NUV A;  4J9A A;  1FUW A;  4ZM8 A;  1LNI A;  1B2Z A;  2GSP A;  1RNB A;  4KFF A;  2O3O A;  1ROA A;  3N8B A;  4XB5 A;  2KRT A;  1RRL A;  1A67 A;  1AV4 A;  2R41 A;  2D42 A;  1NWW A;  5CXO A;  2CX0 A;  5AEU B;  1RCL A;  2M7O A;  4WYK A;  1VQ5 3;  2E2V A;  3LML A;  1GOV A;  2PNC A;  3CU3 A;  3GZR A;  5I97 A;  1X1Y A;  3FG4 A;  4X2O A;  3CC4 3;  2F5M A;  1YIJ 3;  3GAX A;  3LTA A;  2R4I A;  5FW5 A;  4RNZ A;  3DGY A;  4KVH A;  3WOF B;  1YJ9 3;  1BRS A;  1G96 A;  2BMQ B;  4HZB B;  5EEO A;  1UI7 A;  3T8U A;  2FGT A;  3FKA A;  3G16 A;  3URP A;  4FR9 A;  3X3Z A;  3DH2 A;  5BVB A;  3F7X A;  1W2Z A;  4HYZ A;  1BNG A;  4R80 A;  1RGF A;  3WHO A;  2IUJ A;  1RN1 A;  3JVC A;  3Q3F A;  4FCM A;  3D9R A;  3CCE 3;  2F99 A;  3FLJ A;  4RNT A;  1W6G A;  9RNT A;  1N8Q A;  1IT8 A;  4ILF A;  3DMC A;  4WWU C;  5AIF A;  1K73 4;  3SLU A;  1RN7 A;  4HZ9 B;  1QVF 2;  1I2E A;  2OCT A;  2A15 A;  2BNG A;  2OQE A;  1FGO A;  2CW9 A;  2HMM B;  1CYU A;  5IF6 A;  1VZZ A;  4N6L A;  3EC9 A;  1W00 A;  3CCS 3;  1OPY A;  1BU4 A;  2CG1 A;  2BU4 A;  4NRE A;  4OVM A;  3TDG A;  2UGI A;  3HX8 A;  2XRX B;  3EHC A;  5IEP A;  3VF1 A;  3EJV A;  1W01 A;  3KN4 A;  2FXT A;  5AI1 A;  1JBT A;  1FUS A;  1B21 A;  1N5P A;  3X41 A;  3F40 A;  1RGL A;  4BU4 A;  1JRQ A;  1FUT A;  1IU7 A;  1QAK A;  2GEX A;  4PEJ A;  3UL6 A;  1A2V A;  2RFR A;  1B2U A;  5KP1 A;  2WGO A;  4HVN A;  4BL2 A;  1IV7 A;  1PU4 A;  3OXA A;  2CFL A;  3FG1 A;  3S29 A;  4WFO A;  2L4V A;  1NB3 I;  1OHS A;  1MWT A;  3NX0 A;  3MPH A;  3CCR 3;  1IVX A;  4BTY A;  4CDL A;  1NU3 A;  5CF1 A;  1Q82 4;  1NO3 A;  1JBR A;  3CMA 3;  4R9K A;  1BRJ A;  2AAE A;  1AQZ A;  4ORL A;  4BL3 A;  4CJN A;  3SYU A;  4N6V 0;  4FMA A;  3LYG A;  1DMQ A;  1BNI A;  1Q40 A;  4GHO A;  4WP5 A;  5G1L A;  3I55 3;  4HAA A;  3JUQ A;  4G1M B;  3D5I A;  5CLK A;  3NHX A;  1BNE A;  3NBB A;  3BU4 A;  3LZA A;  3G8Z A;  4K61 A;  4MEI A;  5HGR A;  2RCD A;  4NPB A;  1QAF A;  4IPB A;  1G0T A;  1KWI A;  1Y4K A;  1BRI A;  3MSO A;  5CF2 A;  3SVA A;  1BSB A;  5JBS A;  3CD6 3;  2B1X B;  3H51 A;  1RGA A;  3J7Y d;  1PFP A;  1BRK A;  4AEQ A;  1I2F A;  4XDW A;  1D6U A;  1YJN 3;  3LTB A;  4J5G A;  1J2B A;  1NB5 I;  1IQY A;  1OF5 A;  1RJO A;  1MNL A;  3I56 3;  1JN5 B;  5STD A;  3DXO A;  1BIR A;  4N6N B;  6GSP A;  3OWU A;  3CPW 2;  1N9J A;  1VQP 3;  1ZO2 A;  3H3H A;  3GZY B;  3D4A A;  4HM5 B;  4XM4 A;  1C54 A;  1OAC A;  4LYL B;  1KD1 4;  1X1U A;  5JPU A;  2Z7A A;  3F9S A;  3O8Y A;  4I5Q A;  1UUG B;  1RGC A;  2K3D A;  1N8R 4;  3LTD A;  2Y74 A;  2CFD A;  1VQK 3;  3I0Y A;  3QRD A;  1WQL B;  2CWT A;  2HML B;  3E99 A;  3K0Z A;  3DGL A;  2F86 B;  4FCJ A;  1O7M B;  3ROB A;  5M19 A;  3JUN A;  1VQ6 3;  2XSH B;  1BUJ A;  2YFI B;  1SII A;  4LMI A;  1B20 A;  1RRH A;  3MHE A;  5IG5 A;  4FMD A;  1DE3 A;  3KCH A;  1IK3 A;  1IT7 A;  4GB5 A;  3B4O A;  2P05 A;  2IYJ A;  2BMR B;  1LQG C;  1ZX2 A;  3AGO A;  3B7C A;  3BND A;  1GSP A;  3ECF A;  3EBY A;  1EQK A;  1B3S A;  1JB5 A;  3MKI A;  2ML6 A;  3S67 A;  1UCL A;  4AKY A;  4JRF A;  3PS8 A;  2W56 B;  4MMY B;  4EV2 A;  4XBX A;  2W9Q A;  4RBN A;  3WMD A;  4BTW A;  3RDE A;  7RNT A;  1RCK A;  1KQS 2;  1T2I A;  1RN4 A;  3G6E 3;  1ULJ B;  4HM8 B;  1O7G B;  2KF5 A;  3WR2 A;  1T5Y A;  4K90 B;  2GU3 A;  1OHO A;  4MMZ B;  3X40 A;  2IA7 A;  3VSY A;  1LVN A;  1YJW 3;  1SQW A;  2HMK B;  3KII A;  3PXM A;  4EBG A;  1HZ1 A;  1JKG B;  3GSP A;  3S5C A;  2V1L A;  2OWP A;  2CKF B;  3AHW A;  3LTC A;  1N9E A;  4KZ1 A;  1CH0 A;  2Y73 A;  3K9M C;  5ELU A;  3B8L A;  1IVW A;  3GRD A;  4HM7 B;  4I4K A;  2C11 A;  4N3V A;  1I0X A;  5M1A A;  2OOV A;  1Q42 A;  2E2T A;  5GSP A;  3CCM 3;  1N5H A;  1O7P B;  1MGW A;  3S27 A;  1MWR A;  2INX A;  2UUG C;  1I2G A;  2RBI A;  2OQE C;  4KFD A;  5CK6 A;  2XFT A;  3EE1 A;  2P09 A;  3NBJ A;  4N6T A;  2GXF A;  1C7H A;  4KT3 B;  3U97 A;  1BNR A;  4AKZ A;  3WOE B;  3OWY A;  1VQN 3;  6STD A;  1TRQ A;  3T0U A;  5IER A;  2OTJ 3;  5IG3 A;  1Q40 B;  3CPO A;  1BAN A;  2W9P A;  3G4S 3;  2HMJ B;  1LNH A;  1A90 A;  4Q53 A;  1HYF A;  2ZL8 A;  3Q1C A;  2W0Q A;  2GEY A;  2HMO B;  2ZDJ A;  1VQM 3;  1ROV A;  2E2U A;  1GMQ A;  2RGQ A;  3BB9 A;  4MJD A;  1EA2 A;  1RMS A;  5KP3 A;  1TP6 A;  4XDV A;  1IV9 A;  3BLZ A;  1FGM A;  4LGQ A;  5IEO A;  1T3B A;  4N6O B;  1Q81 4;  2W56 A;  2D1W A;  1LOV A;  4XBT A;  5JPP A;  3A76 A;  1RGE A;  3K7C A;  1JV2 B;  1K8A 4;  1T2H A;  2Q07 A;  3FCS B;  3GZB A;  2KCD A;  2BT3 A;  4J8T A;  3RGA A;  2K54 A;  3FF0 A;  4WYK B;  1UCJ A;  1M1X B;  1V58 A;  3BIR A;  1O7N B;  1TU5 A;  4DKI A;  1MWS A;  3X3X A;  1W4N A;  1FGQ A;  3MG3 A;  3ZG0 A;  1RTU A;  4HM2 B;  5AYS C;  1NNV A;  3EN8 A;  3FG3 A;  3V92 A;  3OW2 2;  1GOY A;  1V57 A;  3FF2 A;  1GY7 A;  1K28 A;  5AIH A;  5TGN A;  1ZGX A;  3M8C A;  2AAD A;  2CIU A;  3PCS A;  4L8P A;  4X2H A;  3WA2 X;  5D82 A;  2GBW B;  1W6C A;  1EG9 B;  2Z77 A;  5AII A;  3CCV 3;  1VQO 3;  4HM6 B;  1JZO A;  1RDS A;  5KP4 A;  1RSN A;  3MG1 A;  3Q2P A;  1R4C A;  2KF3 A;  5BU4 A;  2P0X A;  2ZHX B;  3CCJ 3;  4H3U A;  5DRE A;  3V98 A;  2BMO B;  3FZW A;  1PY3 A;  2LQV A;  1EEJ A;  1TFK A;  3KSP A;  1JN5 A;  2GBX B;  3GZX B;  3FGY A;  4J5K A;  1B2X A;  3JUO A;  1BSA A;  1I8V A;  2KAA A;  4GL6 A;  2RNT A;  1DMM A;  4QWT A;  5IG4 A;  2H0I A;  3EBT A;  3S28 A;  1JNQ A;  3GWR A;  3U1W A;  2PZV A;  4WHA A;  4EC6 A;  2CG0 A;  2XEP A;  3A5E A;  2SBL A;  2QIY A;  1OH0 A;  5M18 A;  1W2B 2;  1MGR A;  1STD A;  3NQZ A;  1R4Y A;  5ELJ A;  3IJE B;  1DET A;  2QEX 3;  4HBR A;  4HJL B;  5IEN A;  3WOD G;  3NV0 A;  2WGQ A;  3FH1 A;  1BOX A;  1EKM A;  1M9G A;  2HMN B;  3DY5 A;  4HM4 B;  3HOH A;  3B4P A;  1VQQ A;  2CC3 A;  3N54 B;  2ML5 A;  3PCR A;  3CNM A;  4IIA A;  4KFE A;  3V99 A;  3PYJ A;  4BIR A;  3NV0 B;  4HM3 B;  8RNT A;  1TFO A;  1LOY A;  1TUH A;  2P0M A;  1X1X A;  2CH9 A;  1HU9 A;  3SOY A;  2XGL A;  2C4B A;  1OF5 B;  1TJD A;  3F8X A;  4OK0 A;  5IW9 A;  1GD3 A;  1IQX A;  3HZP A;  1RGH A;  5IG0 A;  1UCI A;  3CME 3;  8CHO A;  1U5O A;  3X3Y A;  2YFL B;  3JUM A;  1JJ2 2;  1I3F A;  1QMA A;  2BHM A;  2MF7 A;  3D3L A;  1E3R A;  3DGO A;  4LZI A;  3ER7 A;  5D81 A;  4U13 A;  5LC6 A;  1GY6 A;  1E3V A;  1BSC A;  3WDG B;  4HOH A;  3NQY A;  2CWV A;  1IYY A;  4N6M A;  1QJG A;  3KFQ C;  3EQQ B;  3BNB A;  3SED A;  1UGI A;  1GY5 A;  1WNH A;  1ULI B;  2YX9 A;  3ZG5 A;  3CCQ 3;  3PGB A;  1I70 A;  3ZFZ A;  1NDO B;  4L8O A;  1ZS7 A;  1FGT A;  5D83 A;  1U8C B;  2XGN A;  4LSO A;  1Q7Y 4;  3SOA A;  2OOV C;  1TTO A;  3AMO B;  3LT8 A;  1K41 A;  4EW5 A;  5G2G A;  2F4Y A;  2W04 A;  4EYC A;  1M1K 4;  1RGG A;  3F8H A;  1VQL 3;  1DYU A;  3UJM A;  2Z76 A;  3MWZ A;  3BNC A;  1CYV A;  2MC8 A;  1UW1 A;  2CK3 H;  1GYB A;  4R1K A;  1SIH A;  2XR8 B;  4XBY A;  3LOY A;  2KXG A;  3K5T A;  3SXX A;  1GMR A;  7GSP A;  3F14 A;  3T8N A;  1K9M 4;  3HI7 A;  2XSO B;  3CCL 3;  3EF8 A;  1Q7H A;  3NBR A;  1FA3 A;  2UX0 A;  3CC7 3;  3OX9 A;  1BSD A;  2YFJ B;  2Z6B A;  1I3I A;  2WO0 A;  1OHP A;  2KF4 A;  2XFS A;  1YHQ 3;  1DMN A;  1RLS A;  2C10 A;  4O3V A;  4O8S A;  4H61 A;  5BXQ A;  2L1S A;  1YIT 3;  1DVC A;  1SAR A;  2I9W A;  1JB4 A;  2F5W A;  3D5G A;  3KKG A;  2OTL 3;  4K1U A;  3DUK A;  1S5A A;  2F56 A;  4N6U A;  1A2K A;  2O9U X;  3AMO A;  1YGW A;  3NM2 A;  1Q9E A;  1D6Z A;  2CHC A;  4CCV A;  1VQ9 3;  3FSD A;  3UL5 A;  2W6J H;  1RHL A;  2QGU A;  2WOH A;  1KSI A;  1CQS A;  3VGN A;  1EUI C;  1VQ8 3;  1RGK A;  4MMX B;  1WTH A;  4NHF A;  2QA4 3;  1WMP A;  3UB1 A;  3LH4 A;  1ASK A;  1VQ7 3;  1WMN A;  1YVB I;  3PZW A;  1SPU A;  2CFK A;  3CC2 3;  1UUW B;  3DM8 A;  3DZL A;  3UNL A;  4FCZ A;  2FNQ A;  1V74 A;  1O7W B;  1W6Y A;  1D6Y A;  2IMJ A;  4FMB A;  1LRA A;  1W5Z A;  4CPK A;  2CX1 A;  4JF8 A;  1UI8 A;  1YI2 3;  1JKG A;  1FGR A;  1OGZ A;  4EXR A;  1E97 A;  2WOF A;  3K63 A;  4RZM A;  1IQ8 A;  1QVG 2;  1DVD A;  5G1K A;  4STD A;  1B2S A;  3IMA B;  3G0K A;  1BSE A;  1GOU A;  3NXJ A;  3G71 3;  2XH9 A;  2JDI H;  1F8N A;  1IVV A;  1O7H B;  1PYL A;  2IY2 A;  1AY7 A;  1BRH A;  1Z1S A;  4IT7 A;  3IPT A;  3QK9 A;  3DGN A;  2W03 A;  2LYX A;  3KZT A;  1STF I;  1SJW A;  3EN1 B;  1LXE A;  1US1 A;  5BIR A;  2K0M A;  2RSX A;  3AGN A;  3D79 A;  1FZU A;  1BRG A;  2STD A;  3HII A;  1HKX A;  1OGX A;  2SAR A;  4FMC A;  3L0R A;  1I0V A;  3OV4 A;  1BVI A;  2H0H A;  1UCK A;  3JUP A;  3KE7 A;  1OUN A;  5EVH A;  5EQL A;  2CFG A;  3RNT A;  2F98 A;  5FGO A;  1L5G B;  3CXC 2;  3RGR A;  4TX4 A;  1AR0 A;  1UUV B;  1BRN L;  2H0G A;  2W2C A;  1X1W A;  1JZD A;  5RNT A;  5AEW B;  5HOH A;  3HK4 A;  3CNX A;  3OWS A;  4HKV B;  1LQM B;  1IVU A;  3HIG A;  4HM0 B;  1BNF A; 
#chains in the Genus database with same CATH homology
 1YGE A;  4RNY A;  1OCV A;  1GD4 A;  2BO9 B;  3EX9 A;  5AYR B;  4R4K A;  3N9H A;  1S72 3;  4HM1 B;  4K1V A;  4O02 B;  4EV5 A;  1CEW I;  1AVL A;  1TIJ A;  2IUK A;  1M90 4;  2P38 A;  1AVK A;  1W02 A;  3X42 A;  4L7K A;  1IDP A;  1NJI 4;  1W7C A;  2CFW A;  2JQ5 A;  1JB2 A;  1VQ4 3;  3MG2 A;  3NM7 A;  3ALA A;  3STD A;  4O2H A;  3F7S A;  5DRV A;  5AIG A;  1KC8 4;  1LOX A;  1BUQ A;  7STD A;  1ISK A;  5A0O B;  2CWU A;  2GU1 A;  1MOL A;  1WMO A;  3DGM A;  3KSE D;  2B24 B;  4R9L A;  1PU4 A;  3WA3 A;  3BNE A;  3LT9 A;  3EB8 A;  3SX1 A;  4OUQ A;  3MYT A;  3CCU 3;  1GS3 A;  1RKY A;  2XF3 A;  3LXU X;  5LC7 A;  1Q86 4;  3Q90 A;  4LEH A;  1QAL A;  4BTX A;  3NUV A;  4J9A A;  1FUW A;  4ZM8 A;  4KFF A;  2O3O A;  1ROA A;  3N8B A;  4XB5 A;  2KRT A;  1RRL A;  1A67 A;  1AV4 A;  2D42 A;  1NWW A;  5CXO A;  5AEU B;  2M7O A;  4WYK A;  1VQ5 3;  2E2V A;  3LML A;  5I97 A;  2PNC A;  3CU3 A;  3GZR A;  3FG4 A;  4X2O A;  3CC4 3;  1YIJ 3;  3GAX A;  3LTA A;  2R4I A;  5FW5 A;  4RNZ A;  1YJ9 3;  4KVH A;  3WOF B;  1G96 A;  2BMQ B;  4HZB B;  5EEO A;  1UI7 A;  3T8U A;  2FGT A;  3FKA A;  3G16 A;  3X3Z A;  4FR9 A;  5BVB A;  3F7X A;  1W2Z A;  4HYZ A;  4R80 A;  2IUJ A;  3JVC A;  4FCM A;  3CCE 3;  3D9R A;  2F99 A;  3FLJ A;  1W6G A;  1N8Q A;  1IT8 A;  3DMC A;  4WWU C;  5AIF A;  1K73 4;  3SLU A;  1RN7 A;  4HZ9 B;  1QVF 2;  2OCT A;  2A15 A;  2BNG A;  2OQE A;  1FGO A;  2CW9 A;  2HMM B;  1CYU A;  5IF6 A;  1VZZ A;  4N6L A;  3EC9 A;  1W00 A;  3CCS 3;  1OPY A;  2CG1 A;  4OVM A;  4NRE A;  3TDG A;  3HX8 A;  2XRX B;  3EHC A;  5IEP A;  3VF1 A;  3EJV A;  1W01 A;  3KN4 A;  2FXT A;  5AI1 A;  3X41 A;  1N5P A;  3F40 A;  1JRQ A;  1IU7 A;  1QAK A;  2GEX A;  4PEJ A;  3UL6 A;  1A2V A;  2RFR A;  5KP1 A;  2WGO A;  4HVN A;  1IV7 A;  3OXA A;  2CFL A;  3FG1 A;  3S29 A;  4WFO A;  2L4V A;  1NB3 I;  1OHS A;  3NX0 A;  3MPH A;  3CCR 3;  1IVX A;  4BTY A;  4CDL A;  1NU3 A;  5CF1 A;  1Q82 4;  1NO3 A;  3CMA 3;  4R9K A;  4ORL A;  4N6V 0;  4FMA A;  3LYG A;  1DMQ A;  1Q40 A;  4WP5 A;  3I55 3;  1Q81 4;  3JUQ A;  4G1M B;  5CLK A;  3NHX A;  3NBB A;  3LZA A;  3G8Z A;  4K61 A;  4MEI A;  5HGR A;  2RCD A;  1QAF A;  4IPB A;  1KWI A;  1Y4K A;  5JBS A;  3MSO A;  5CF2 A;  3SVA A;  3CD6 3;  2B1X B;  3H51 A;  3J7Y d;  1PFP A;  4AEQ A;  4XDW A;  1YJN 3;  1D6U A;  3LTB A;  1J2B A;  1NB5 I;  1IQY A;  1OF5 A;  1RJO A;  1MNL A;  3I56 3;  1JN5 B;  3DXO A;  4N6N B;  3OWU A;  3CPW 2;  1N9J A;  1VQP 3;  1ZO2 A;  3H3H A;  3GZY B;  4XM4 A;  4HM5 B;  1OAC A;  1KD1 4;  5JPU A;  2Z7A A;  3F9S A;  3O8Y A;  1N8R 4;  3LTD A;  2Y74 A;  2CFD A;  1VQK 3;  3I0Y A;  3QRD A;  1WQL B;  2CWT A;  2HML B;  3E99 A;  3K0Z A;  3DGL A;  2F86 B;  4FCJ A;  1O7M B;  3ROB A;  3JUN A;  1VQ6 3;  2XSH B;  2YFI B;  1SII A;  4LMI A;  1RRH A;  3MHE A;  5IG5 A;  4FMD A;  1IK3 A;  1IT7 A;  4GB5 A;  3B4O A;  2P05 A;  2BMR B;  1ZX2 A;  3B7C A;  3BND A;  3ECF A;  3EBY A;  1EQK A;  1JB5 A;  3MKI A;  3S67 A;  2ML6 A;  4AKY A;  4JRF A;  3PS8 A;  2W56 B;  4MMY B;  4EV2 A;  4XBX A;  2W9Q A;  4RBN A;  3WMD A;  4BTW A;  3RDE A;  1KQS 2;  3G6E 3;  1ULJ B;  4HM8 B;  1O7G B;  1T5Y A;  4K90 B;  2GU3 A;  1OHO A;  4MMZ B;  3X40 A;  2IA7 A;  3VSY A;  1LVN A;  1YJW 3;  1SQW A;  2HMK B;  3KII A;  3PXM A;  4EBG A;  1JKG B;  3S5C A;  2V1L A;  2OWP A;  2CKF B;  3LTC A;  1N9E A;  4KZ1 A;  2Y73 A;  3K9M C;  5ELU A;  3B8L A;  1IVW A;  3GRD A;  4HM7 B;  4I4K A;  2C11 A;  4N3V A;  2OOV A;  1Q42 A;  2E2T A;  3CCM 3;  1N5H A;  1O7P B;  3S27 A;  2INX A;  4KFD A;  5CK6 A;  2OQE C;  2XFT A;  3EE1 A;  2P09 A;  3NBJ A;  4N6T A;  2GXF A;  1C7H A;  3U97 A;  4AKZ A;  3WOE B;  3OWY A;  1VQN 3;  6STD A;  3T0U A;  5IER A;  2OTJ 3;  5IG3 A;  1Q40 B;  3CPO A;  2W9P A;  3G4S 3;  2HMJ B;  1LNH A;  1A90 A;  4Q53 A;  2ZL8 A;  3Q1C A;  2W0Q A;  2GEY A;  2HMO B;  2ZDJ A;  1VQM 3;  1ROV A;  2E2U A;  2RGQ A;  3BB9 A;  4MJD A;  1EA2 A;  5KP3 A;  1TP6 A;  4XDV A;  1IV9 A;  3BLZ A;  1FGM A;  4LGQ A;  5IEO A;  4N6O B;  2W56 A;  2D1W A;  4XBT A;  5JPP A;  3A76 A;  3K7C A;  1JV2 B;  1K8A 4;  2Q07 A;  3FCS B;  3GZB A;  2KCD A;  2BT3 A;  4J8T A;  3RGA A;  2K54 A;  3FF0 A;  4WYK B;  1M1X B;  1TU5 A;  1O7N B;  3X3X A;  1W4N A;  1FGQ A;  3MG3 A;  4HM2 B;  5AYS C;  3EN8 A;  3FG3 A;  3V92 A;  3OW2 2;  3FF2 A;  1GY7 A;  1K28 A;  5AIH A;  5TGN A;  3M8C A;  2CIU A;  3PCS A;  4L8P A;  4X2H A;  3WA2 X;  5D82 A;  2GBW B;  1W6C A;  1EG9 B;  2Z77 A;  5AII A;  3CCV 3;  1VQO 3;  4HM6 B;  5KP4 A;  3MG1 A;  3Q2P A;  1R4C A;  2P0X A;  3CCJ 3;  4H3U A;  5DRE A;  3V98 A;  2BMO B;  3FZW A;  2LQV A;  1TFK A;  3KSP A;  1JN5 A;  2GBX B;  3GZX B;  3FGY A;  3JUO A;  4GL6 A;  4QWT A;  5IG4 A;  1DMM A;  3S28 A;  3EBT A;  1JNQ A;  3GWR A;  3U1W A;  2PZV A;  4WHA A;  4EC6 A;  2CG0 A;  2XEP A;  2SBL A;  2QIY A;  1OH0 A;  1W2B 2;  5ELJ A;  1STD A;  3NQZ A;  3IJE B;  2QEX 3;  4HBR A;  4HJL B;  5IEN A;  3WOD G;  2WGQ A;  3FH1 A;  1M9G A;  1EKM A;  2HMN B;  3DY5 A;  4HM4 B;  3B4P A;  2CC3 A;  3N54 B;  2ML5 A;  3PCR A;  3CNM A;  4IIA A;  4KFE A;  3V99 A;  3PYJ A;  3NV0 B;  4HM3 B;  1TFO A;  1TUH A;  2P0M A;  2CH9 A;  1HU9 A;  3SOY A;  2XGL A;  3F8X A;  1OF5 B;  4OK0 A;  5IW9 A;  1GD3 A;  1IQX A;  3HZP A;  5IG0 A;  3CME 3;  8CHO A;  1U5O A;  3X3Y A;  2YFL B;  3JUM A;  1JJ2 2;  1QMA A;  2BHM A;  2MF7 A;  3D3L A;  1E3R A;  3DGO A;  4LZI A;  3ER7 A;  5D81 A;  4U13 A;  5LC6 A;  1GY6 A;  1E3V A;  3WDG B;  3NQY A;  2CWV A;  4N6M A;  1QJG A;  3KFQ C;  3EQQ B;  3BNB A;  3SED A;  1GY5 A;  1WNH A;  1ULI B;  2YX9 A;  3CCQ 3;  3PGB A;  1NDO B;  4L8O A;  1FGT A;  5D83 A;  1U8C B;  2XGN A;  4LSO A;  1Q7Y 4;  3SOA A;  2OOV C;  3AMO B;  3LT8 A;  1K41 A;  5G2G A;  2W04 A;  4EYC A;  1M1K 4;  3F8H A;  1VQL 3;  1DYU A;  3UJM A;  2Z76 A;  3MWZ A;  3BNC A;  1CYV A;  2MC8 A;  1UW1 A;  2CK3 H;  1GYB A;  4R1K A;  1SIH A;  2XR8 B;  4XBY A;  3LOY A;  2KXG A;  3K5T A;  3SXX A;  3F14 A;  3T8N A;  1K9M 4;  3HI7 A;  2XSO B;  3CCL 3;  3EF8 A;  3NBR A;  1FA3 A;  2UX0 A;  3CC7 3;  3OX9 A;  2YFJ B;  2Z6B A;  2WO0 A;  1OHP A;  2XFS A;  1YHQ 3;  1DMN A;  2C10 A;  4O3V A;  1YIT 3;  4O8S A;  4H61 A;  5BXQ A;  1DVC A;  2I9W A;  3KKG A;  1JB4 A;  2OTL 3;  4K1U A;  3DUK A;  1S5A A;  4N6U A;  1A2K A;  2O9U X;  3AMO A;  3NM2 A;  1D6Z A;  2CHC A;  4CCV A;  1VQ9 3;  3FSD A;  3UL5 A;  2W6J H;  2QGU A;  2WOH A;  1KSI A;  1CQS A;  3VGN A;  1VQ8 3;  4MMX B;  1WTH A;  4NHF A;  2QA4 3;  1WMP A;  3UB1 A;  3LH4 A;  1ASK A;  1VQ7 3;  1WMN A;  1YVB I;  3PZW A;  1SPU A;  2CFK A;  3CC2 3;  1UUW B;  3DM8 A;  3DZL A;  3UNL A;  4FCZ A;  2FNQ A;  1V74 A;  1O7W B;  1W6Y A;  1D6Y A;  2IMJ A;  4FMB A;  1W5Z A;  4JF8 A;  1UI8 A;  1YI2 3;  1JKG A;  1FGR A;  1OGZ A;  4EXR A;  1E97 A;  2WOF A;  3K63 A;  4RZM A;  1IQ8 A;  1QVG 2;  1DVD A;  4STD A;  3IMA B;  3G0K A;  3NXJ A;  3G71 3;  2XH9 A;  2JDI H;  1F8N A;  1O7H B;  1IVV A;  1Z1S A;  4IT7 A;  3IPT A;  3QK9 A;  3DGN A;  2W03 A;  2LYX A;  3KZT A;  1STF I;  1SJW A;  3EN1 B;  1LXE A;  1US1 A;  2K0M A;  2RSX A;  3HII A;  4FMC A;  5STD A;  2STD A;  1HKX A;  1OGX A;  3L0R A;  3OV4 A;  3JUP A;  3KE7 A;  1OUN A;  5EVH A;  5EQL A;  2CFG A;  2F98 A;  5FGO A;  1L5G B;  3CXC 2;  3RGR A;  4TX4 A;  1AR0 A;  1UUV B;  2W2C A;  5AEW B;  3HK4 A;  3CNX A;  3OWS A;  4HKV B;  1IVU A;  3HIG A;  4HM0 B;  3NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...