1TFSA

Nmr and restrained molecular dynamics study of the three-dimensional solution structure of toxin fs2, a specific blocker of the l-type calcium channel, isolated from black mamba venom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
RICYSHKASLPRATKTCVENTCYKMFIRTHREYISERGCGCPTAMWPYQTECCKGDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR and restrained molecular dynamics study of the three-dimensional solution structure of toxin FS2, a specific blocker of the L-type calcium channel, isolated from black mamba venom.
pubmed doi rcsb
source organism Dendroaspis polylepis polylepis
molecule tags Toxin
molecule keywords TOXIN FS2
total genus 16
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1995-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1tfsA00
2MFAA 6EBXA 1HOYA 1ERGA 1B41B 2UX2A 4BDTB 1IQ9A 2H62D 1CDTA 3EBXA 2L5SA 3U74U 1CB9A 1UG4A 1KBAA 1LX5B 1G6MA 2CTXA 2MJYA 2MUPA 4OM5A 2PJYC 1HC9A 1KL8A 1LXGA 2QJBC 1IDLA 1NEAA 3VTSA 4QTIU 1KC4A 4EY8B 2OFSA 4LFTA 1COEA 2BTXA 1DRSA 1CHVS 1F94A 2I9BE 4P7UA 2H7ZA 3U73U 5IMTD 2FD6U 3KFDI 2H64B 1FASA 4XJJA 1LSIA 4FAOC 1XT3A 2QJAC 3FEVA 2ABXA 1CCQA 5DZ5A 2H64C 2X8BB 5EBXA 2MJ0A 3HH7A 1KBSA 4IYEA 1ABTA 1QM7A 1JGKA 1FF4A 1NXBA 2BHIA 2CRTA 3PLCA 1KS6A 1NYUA 2JVEA 2GOOC 2CRSA 5IMYC 1IDHA 1F8UB 3BT2U 2MUOA 4BIKB 4DO8A 1IKCA 1CVOA 4OM4A 1LJZA 2GOOB 1FRAA 2LA1A 2ERAA 1CODA 1MR6A 2H62C 1H0JA 1M9ZA 1NTXA 2PJYB 1KXIA 1ES7B 1NYSA 2MHYA 5DU1A 1NTNA 1HC9B 2LCRA 2MJ4A 2QC1A 4UY2C 1KBTA 1FSCA 2H5FA 2H8UA 2J8BA 2UWRA 1FFJA 4ZQYA 1FSSB 2CDXA 1QKDA 4RUDA 2NBTA 1MAHF 1CREA 1CRFA 5DO6A 1CXOA 1ZADA 1TGXA 1CTXA 1BTEA 3QB4B 1LXHA 1S4YA 1KFHA 1RGJA 3NH7A 1ONJA 1IDIA 2N99A 1NORA 2HLQA 3EVSC 1W6BA 4FAOE 1JBDA 1CDRA 3NEQA 1PLOA 3LAQU 1CDQA 1RL5A 1ERAA 1REWC 1V6PA 2H7ZB 1KTZB 3ERAA 1JE9A 1QKEA 2L03A 1YWHA 1KU6B 3BT1U 1IDGA 1TXBA 4HQPF 1VB0A 1IJCA 2VLWA 1TXAA 1BXPA 3KFDE 3NDSA 2CCXA 1HAAA 4AEAA 1I02A 2K3GA 1IK8A 1CXNA 1L4WA 1CDSA 1TFSA 1HAJA 2HLRA 2QJ9C 2JQPA
chains in the Genus database with same CATH superfamily
2MFAA 6EBXA 1HOYA 1ERGA 1B41B 2UX2A 4BDTB 1IQ9A 2H62D 1CDTA 3EBXA 2L5SA 3U74U 1CB9A 1UG4A 1KBAA 1LX5B 1G6MA 2CTXA 2MJYA 2MUPA 4OM5A 2PJYC 1HC9A 1KL8A 1LXGA 2QJBC 1IDLA 1NEAA 3VTSA 4QTIU 1KC4A 4EY8B 2OFSA 4LFTA 1COEA 2BTXA 1DRSA 1CHVS 1F94A 2I9BE 4P7UA 2H7ZA 3U73U 5IMTD 2FD6U 3KFDI 2H64B 1FASA 4XJJA 1LSIA 4FAOC 1XT3A 2QJAC 3FEVA 2ABXA 1CCQA 5DZ5A 2H64C 2X8BB 5EBXA 2MJ0A 3HH7A 1KBSA 4IYEA 1ABTA 1QM7A 1JGKA 1FF4A 1NXBA 2BHIA 2CRTA 3PLCA 1KS6A 1NYUA 2JVEA 2GOOC 2CRSA 5IMYC 1IDHA 1F8UB 3BT2U 2MUOA 4BIKB 4DO8A 1IKCA 1CVOA 4OM4A 1LJZA 2GOOB 1FRAA 2LA1A 2ERAA 1CODA 1MR6A 2H62C 1H0JA 1M9ZA 1NTXA 2PJYB 1KXIA 1ES7B 1NYSA 2MHYA 5DU1A 1NTNA 1HC9B 2LCRA 2MJ4A 2QC1A 4UY2C 1KBTA 1FSCA 2H5FA 2H8UA 2J8BA 2UWRA 1FFJA 4ZQYA 1FSSB 2CDXA 1QKDA 4RUDA 2NBTA 1MAHF 1CREA 1CRFA 5DO6A 1CXOA 1ZADA 1TGXA 1CTXA 1BTEA 3QB4B 1LXHA 1S4YA 1KFHA 1RGJA 3NH7A 1ONJA 1IDIA 2N99A 1NORA 2HLQA 3EVSC 1W6BA 4FAOE 1JBDA 1CDRA 3NEQA 1PLOA 3LAQU 1CDQA 1RL5A 1ERAA 1REWC 1V6PA 2H7ZB 1KTZB 3ERAA 1JE9A 1QKEA 2L03A 1YWHA 4KSNA 1KU6B 3BT1U 1IDGA 1TXBA 4HQPF 1VB0A 1IJCA 2VLWA 1TXAA 1BXPA 3KFDE 3NDSA 2CCXA 1HAAA 4AEAA 1I02A 2K3GA 1IK8A 1CXNA 1L4WA 1CDSA 1TFSA 1HAJA 2HLRA 2QJ9C 2JQPA
chains in the Genus database with same CATH topology
2MFAA 6EBXA 1HOYA 1ERGA 1B41B 2UX2A 4BDTB 1IQ9A 2H62D 1CDTA 3EBXA 2L5SA 3U74U 1CB9A 1UG4A 1KBAA 1LX5B 1G6MA 2CTXA 2MJYA 2MUPA 4OM5A 2PJYC 1HC9A 1KL8A 1LXGA 2QJBC 1IDLA 1NEAA 3VTSA 4QTIU 1KC4A 4EY8B 2OFSA 4LFTA 1COEA 2BTXA 1DRSA 1CHVS 1F94A 2I9BE 4P7UA 2H7ZA 3U73U 5IMTD 2FD6U 3KFDI 2H64B 1FASA 4XJJA 1LSIA 4FAOC 1XT3A 2QJAC 3FEVA 2ABXA 1CCQA 5DZ5A 2H64C 2X8BB 5EBXA 2MJ0A 3HH7A 1KBSA 4IYEA 1ABTA 1QM7A 1JGKA 1FF4A 1NXBA 2BHIA 2CRTA 3PLCA 1KS6A 1NYUA 2JVEA 2GOOC 2CRSA 5IMYC 1IDHA 1F8UB 3BT2U 2MUOA 4BIKB 4DO8A 1IKCA 1CVOA 4OM4A 1LJZA 2GOOB 1FRAA 2LA1A 2ERAA 1CODA 1MR6A 2H62C 1H0JA 1M9ZA 1NTXA 2PJYB 1KXIA 1ES7B 1NYSA 2MHYA 5DU1A 1NTNA 1HC9B 2LCRA 2MJ4A 2QC1A 4UY2C 1KBTA 1FSCA 2H5FA 2H8UA 2J8BA 2UWRA 1FFJA 4ZQYA 1FSSB 2CDXA 1QKDA 4RUDA 2NBTA 1MAHF 1CREA 1CRFA 5DO6A 1CXOA 1ZADA 1TGXA 1CTXA 1BTEA 3QB4B 1LXHA 1S4YA 1KFHA 1RGJA 3NH7A 1ONJA 1IDIA 2N99A 1NORA 2HLQA 3EVSC 1W6BA 4FAOE 1JBDA 1CDRA 3NEQA 1PLOA 3LAQU 1CDQA 1RL5A 1ERAA 1REWC 1V6PA 2H7ZB 1KTZB 3ERAA 1JE9A 1QKEA 2L03A 1YWHA 4KSNA 1KU6B 3BT1U 1IDGA 1TXBA 4HQPF 1VB0A 1IJCA 2VLWA 1TXAA 1BXPA 3KFDE 3NDSA 2CCXA 1HAAA 4AEAA 1I02A 2K3GA 1IK8A 1CXNA 1L4WA 1CDSA 1TFSA 1HAJA 2HLRA 2QJ9C 2JQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFA A;  6EBX A;  1HOY A;  1ERG A;  1B41 B;  2UX2 A;  4BDT B;  1IQ9 A;  2H62 D;  1CDT A;  3EBX A;  2L5S A;  3U74 U;  1CB9 A;  1UG4 A;  1KBA A;  1LX5 B;  1G6M A;  2CTX A;  2MJY A;  2MUP A;  4OM5 A;  2PJY C;  1HC9 A;  1KL8 A;  1LXG A;  2QJB C;  1IDL A;  1NEA A;  3VTS A;  4QTI U;  1KC4 A;  4EY8 B;  2OFS A;  4LFT A;  1COE A;  2BTX A;  1DRS A;  1CHV S;  1F94 A;  2I9B E;  4P7U A;  2H7Z A;  3U73 U;  5IMT D;  2FD6 U;  3KFD I;  2H64 B;  1FAS A;  4XJJ A;  1LSI A;  4FAO C;  1XT3 A;  2QJA C;  3FEV A;  2ABX A;  1CCQ A;  5DZ5 A;  2H64 C;  2X8B B;  5EBX A;  2MJ0 A;  3HH7 A;  1KBS A;  4IYE A;  1ABT A;  1QM7 A;  1JGK A;  1FF4 A;  1NXB A;  2BHI A;  2CRT A;  3PLC A;  1KS6 A;  1NYU A;  2JVE A;  2GOO C;  2CRS A;  5IMY C;  1IDH A;  1F8U B;  3BT2 U;  2MUO A;  4BIK B;  4DO8 A;  1IKC A;  1CVO A;  4OM4 A;  1LJZ A;  2GOO B;  1FRA A;  2LA1 A;  2ERA A;  1COD A;  1MR6 A;  2H62 C;  1H0J A;  1M9Z A;  1NTX A;  2PJY B;  1KXI A;  1ES7 B;  1NYS A;  2MHY A;  5DU1 A;  1NTN A;  1HC9 B;  2LCR A;  2MJ4 A;  2QC1 A;  4UY2 C;  1KBT A;  1FSC A;  2H5F A;  2H8U A;  2J8B A;  2UWR A;  1FFJ A;  4ZQY A;  1FSS B;  2CDX A;  1QKD A;  4RUD A;  2NBT A;  1MAH F;  1CRE A;  1CRF A;  5DO6 A;  1CXO A;  1ZAD A;  1TGX A;  1CTX A;  1BTE A;  3QB4 B;  1LXH A;  1S4Y A;  1KFH A;  1RGJ A;  3NH7 A;  1ONJ A;  1IDI A;  2N99 A;  1NOR A;  2HLQ A;  3EVS C;  1W6B A;  4FAO E;  1JBD A;  1CDR A;  3NEQ A;  1PLO A;  3LAQ U;  1CDQ A;  1RL5 A;  1ERA A;  1REW C;  1V6P A;  2H7Z B;  1KTZ B;  3ERA A;  1JE9 A;  1QKE A;  2L03 A;  1YWH A;  1KU6 B;  3BT1 U;  1IDG A;  1TXB A;  4HQP F;  1VB0 A;  1IJC A;  2VLW A;  1TXA A;  1BXP A;  3KFD E;  3NDS A;  2CCX A;  1HAA A;  4AEA A;  1I02 A;  2K3G A;  1IK8 A;  1CXN A;  1L4W A;  1CDS A;  1TFS A;  1HAJ A;  2HLR A;  2QJ9 C;  2JQP A; 
#chains in the Genus database with same CATH topology
 2MFA A;  6EBX A;  1HOY A;  1ERG A;  1B41 B;  2UX2 A;  4BDT B;  1IQ9 A;  2H62 D;  1CDT A;  3EBX A;  2L5S A;  3U74 U;  1CB9 A;  1UG4 A;  1KBA A;  1LX5 B;  1G6M A;  2CTX A;  2MJY A;  2MUP A;  4OM5 A;  2PJY C;  1HC9 A;  1KL8 A;  1LXG A;  2QJB C;  1IDL A;  1NEA A;  3VTS A;  4QTI U;  1KC4 A;  4EY8 B;  2OFS A;  4LFT A;  1COE A;  2BTX A;  1DRS A;  1CHV S;  1F94 A;  2I9B E;  4P7U A;  2H7Z A;  3U73 U;  5IMT D;  2FD6 U;  3KFD I;  2H64 B;  1FAS A;  4XJJ A;  1LSI A;  4FAO C;  1XT3 A;  2QJA C;  3FEV A;  2ABX A;  1CCQ A;  5DZ5 A;  2H64 C;  2X8B B;  5EBX A;  2MJ0 A;  3HH7 A;  1KBS A;  4IYE A;  1ABT A;  1QM7 A;  1JGK A;  1FF4 A;  1NXB A;  2BHI A;  2CRT A;  3PLC A;  1KS6 A;  1NYU A;  2JVE A;  2GOO C;  2CRS A;  5IMY C;  1IDH A;  1F8U B;  3BT2 U;  2MUO A;  4BIK B;  4DO8 A;  1IKC A;  1CVO A;  4OM4 A;  1LJZ A;  2GOO B;  1FRA A;  2LA1 A;  2ERA A;  1COD A;  1MR6 A;  2H62 C;  1H0J A;  1M9Z A;  1NTX A;  2PJY B;  1KXI A;  1ES7 B;  1NYS A;  2MHY A;  5DU1 A;  1NTN A;  1HC9 B;  2LCR A;  2MJ4 A;  2QC1 A;  4UY2 C;  1KBT A;  1FSC A;  2H5F A;  2H8U A;  2J8B A;  2UWR A;  1FFJ A;  4ZQY A;  1FSS B;  2CDX A;  1QKD A;  4RUD A;  2NBT A;  1MAH F;  1CRE A;  1CRF A;  5DO6 A;  1CXO A;  1ZAD A;  1TGX A;  1CTX A;  1BTE A;  3QB4 B;  1LXH A;  1S4Y A;  1KFH A;  1RGJ A;  3NH7 A;  1ONJ A;  1IDI A;  2N99 A;  1NOR A;  2HLQ A;  3EVS C;  1W6B A;  4FAO E;  1JBD A;  1CDR A;  3NEQ A;  1PLO A;  3LAQ U;  1CDQ A;  1RL5 A;  1ERA A;  1REW C;  1V6P A;  2H7Z B;  1KTZ B;  3ERA A;  1JE9 A;  1QKE A;  2L03 A;  1YWH A;  4KSN A;  1KU6 B;  3BT1 U;  1IDG A;  1TXB A;  4HQP F;  1VB0 A;  1IJC A;  2VLW A;  1TXA A;  1BXP A;  3KFD E;  3NDS A;  2CCX A;  1HAA A;  4AEA A;  1I02 A;  2K3G A;  1IK8 A;  1CXN A;  1L4W A;  1CDS A;  1TFS A;  1HAJ A;  2HLR A;  2QJ9 C;  2JQP A; 
#chains in the Genus database with same CATH homology
 2MFA A;  6EBX A;  1HOY A;  1ERG A;  1B41 B;  2UX2 A;  4BDT B;  1IQ9 A;  2H62 D;  1CDT A;  3EBX A;  2L5S A;  3U74 U;  1CB9 A;  1UG4 A;  1KBA A;  1LX5 B;  1G6M A;  2CTX A;  2MJY A;  2MUP A;  4OM5 A;  2PJY C;  1HC9 A;  1KL8 A;  1LXG A;  2QJB C;  1IDL A;  1NEA A;  3VTS A;  4QTI U;  1KC4 A;  4EY8 B;  2OFS A;  4LFT A;  1COE A;  2BTX A;  1DRS A;  1CHV S;  1F94 A;  2I9B E;  4P7U A;  2H7Z A;  3U73 U;  5IMT D;  2FD6 U;  3KFD I;  2H64 B;  1FAS A;  4XJJ A;  1LSI A;  4FAO C;  1XT3 A;  2QJA C;  3FEV A;  2ABX A;  1CCQ A;  5DZ5 A;  2H64 C;  2X8B B;  5EBX A;  2MJ0 A;  3HH7 A;  1KBS A;  4IYE A;  1ABT A;  1QM7 A;  1JGK A;  1FF4 A;  1NXB A;  2BHI A;  2CRT A;  3PLC A;  1KS6 A;  1NYU A;  2JVE A;  2GOO C;  2CRS A;  5IMY C;  1IDH A;  1F8U B;  3BT2 U;  2MUO A;  4BIK B;  4DO8 A;  1IKC A;  1CVO A;  4OM4 A;  1LJZ A;  2GOO B;  1FRA A;  2LA1 A;  2ERA A;  1COD A;  1MR6 A;  2H62 C;  1H0J A;  1M9Z A;  1NTX A;  2PJY B;  1KXI A;  1ES7 B;  1NYS A;  2MHY A;  5DU1 A;  1NTN A;  1HC9 B;  2LCR A;  2MJ4 A;  2QC1 A;  4UY2 C;  1KBT A;  1FSC A;  2H5F A;  2H8U A;  2J8B A;  2UWR A;  1FFJ A;  4ZQY A;  1FSS B;  2CDX A;  1QKD A;  4RUD A;  2NBT A;  1MAH F;  1CRE A;  1CRF A;  5DO6 A;  1CXO A;  1ZAD A;  1TGX A;  1CTX A;  1BTE A;  3QB4 B;  1LXH A;  1S4Y A;  1KFH A;  1RGJ A;  3NH7 A;  1ONJ A;  1IDI A;  2N99 A;  1NOR A;  2HLQ A;  3EVS C;  1W6B A;  4FAO E;  1JBD A;  1CDR A;  3NEQ A;  1PLO A;  3LAQ U;  1CDQ A;  1RL5 A;  1ERA A;  1REW C;  1V6P A;  2H7Z B;  1KTZ B;  3ERA A;  1JE9 A;  1QKE A;  2L03 A;  1YWH A;  4KSN A;  1KU6 B;  3BT1 U;  1IDG A;  1TXB A;  4HQP F;  1VB0 A;  1IJC A;  2VLW A;  1TXA A;  1BXP A;  3KFD E;  3NDS A;  2CCX A;  1HAA A;  4AEA A;  1I02 A;  2K3G A;  1IK8 A;  1CXN A;  1L4W A;  1CDS A;  1TFS A;  1HAJ A;  2HLR A;  2QJ9 C;  2JQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...