1TGXA

X-ray structure at 1.55 a of toxin gamma, a cardiotoxin from naja nigricollis venom. crystal packing reveals a model for insertion into membranes
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-CARDIOTOXIN
publication title X-ray structure at 1.55 A of toxin gamma, a cardiotoxin from Naja nigricollis venom. Crystal packing reveals a model for insertion into membranes.
pubmed doi rcsb
source organism Naja nigricollis
molecule tags Cytotoxin
total genus 10
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1tgxA00
3EVSC 3HH7A 1HC9B 1TXAA 2QC1A 2QJ9C 4QTIU 2H64C 1TFSA 1CB9A 1CTXA 1H0JA 2H64B 1IDGA 1CDRA 3PLCA 1IDHA 2VLWA 4XJJA 2UWRA 1VB0A 6EBXA 1IKCA 4HQPF 2OFSA 1IQ9A 2K3GA 3NH7A 1KFHA 1CCQA 1YWHA 1KC4A 1NTXA 1KBAA 2GOOC 1FRAA 1F8UB 1CXNA 2BHIA 2HLQA 1REWC 2GOOB 4RUDA 2MFAA 1NYUA 2H8UA 4FAOC 1PLOA 1BXPA 5IMYC 1QM7A 2ABXA 2CCXA 1ONJA 4OM5A 1HOYA 1W6BA 1FF4A 1V6PA 1ERAA 1KXIA 1IDLA 1KBTA 2LA1A 1CDTA 3ERAA 2JQPA 1CODA 1MAHF 2N99A 1CRFA 1ABTA 1ES7B 3BT1U 1FASA 3VTSA 2QJBC 2H62D 2I9BE 2LCRA 4UY2C 3U73U 2MHYA 1NEAA 2FD6U 4IYEA 2CTXA 1JGKA 4FAOE 1JE9A 1B41B 1NORA 4AEAA 1CREA 3FEVA 2BTXA 1LX5B 1XT3A 3LAQU 3KFDE 1QKDA 1G6MA 2ERAA 1FSSB 1RL5A 2J8BA 1DRSA 4LFTA 5DZ5A 1QKEA 1NXBA 2CRSA 1S4YA 5DU1A 1KU6B 1COEA 1HAJA 1KBSA 1FSCA 1LSIA 2H7ZA 2JVEA 3KFDI 1LXHA 1LXGA 2UX2A 4ZQYA 1I02A 4P7UA 2H5FA 2H62C 1FFJA 1KS6A 3QB4B 2L03A 1TGXA 3NDSA 4OM4A 1TXBA 2X8BB 5IMTD 1HC9A 1L4WA 1NTNA 1ZADA 2MUOA 2L5SA 4EY8B 1CHVS 1IJCA 1MR6A 1CDQA 3BT2U 1RGJA 2MUPA 1LJZA 3NEQA 1F94A 1HAAA 3EBXA 1M9ZA 4DO8A 1KL8A 2CRTA 2MJ0A 2H7ZB 1NYSA 3U74U 1CXOA 1ERGA 1KTZB 1IK8A 4BIKB 2QJAC 2CDXA 2MJ4A 2NBTA 1JBDA 5EBXA 2HLRA 1IDIA 4BDTB 1CDSA 2MJYA 2PJYC 1CVOA 1BTEA 5DO6A 2PJYB 1UG4A
chains in the Genus database with same CATH superfamily
3EVSC 3HH7A 1HC9B 1TXAA 2QC1A 2QJ9C 4QTIU 2H64C 1TFSA 1CB9A 1CTXA 1H0JA 2H64B 1IDGA 1CDRA 3PLCA 1IDHA 2VLWA 4XJJA 2UWRA 1VB0A 6EBXA 1IKCA 4HQPF 2OFSA 1IQ9A 2K3GA 3NH7A 1KFHA 1CCQA 1YWHA 1KC4A 1NTXA 1KBAA 2GOOC 1FRAA 1F8UB 1CXNA 2BHIA 2HLQA 1REWC 2GOOB 4RUDA 2MFAA 1NYUA 2H8UA 4FAOC 1PLOA 1BXPA 5IMYC 1QM7A 2ABXA 2CCXA 1ONJA 4OM5A 1HOYA 1W6BA 1FF4A 1V6PA 1ERAA 1KXIA 1IDLA 1KBTA 2LA1A 1CDTA 3ERAA 2JQPA 1CODA 1MAHF 2N99A 1CRFA 1ABTA 1ES7B 3BT1U 1FASA 4KSNA 3VTSA 2QJBC 2H62D 2I9BE 2LCRA 4UY2C 3U73U 2MHYA 1NEAA 2FD6U 4IYEA 2CTXA 1JGKA 4FAOE 1JE9A 1B41B 1NORA 4AEAA 1CREA 3FEVA 2BTXA 1LX5B 1XT3A 3LAQU 3KFDE 1QKDA 1G6MA 2ERAA 1FSSB 1RL5A 2J8BA 1DRSA 4LFTA 5DZ5A 1QKEA 1NXBA 2CRSA 1S4YA 5DU1A 1KU6B 1COEA 1HAJA 1KBSA 1FSCA 1LSIA 2H7ZA 2JVEA 3KFDI 1LXHA 1LXGA 2UX2A 4ZQYA 1I02A 4P7UA 2H5FA 2H62C 1FFJA 1KS6A 3QB4B 2L03A 1TGXA 3NDSA 4OM4A 1TXBA 2X8BB 5IMTD 1HC9A 1L4WA 1NTNA 1ZADA 2MUOA 2L5SA 4EY8B 1CHVS 1IJCA 1MR6A 1CDQA 3BT2U 1RGJA 2MUPA 1LJZA 3NEQA 1F94A 1HAAA 3EBXA 1M9ZA 4DO8A 1KL8A 2CRTA 2MJ0A 2H7ZB 1NYSA 3U74U 1CXOA 1ERGA 1KTZB 1IK8A 4BIKB 2QJAC 2CDXA 2MJ4A 2NBTA 1JBDA 5EBXA 2HLRA 1IDIA 4BDTB 1CDSA 2MJYA 2PJYC 1CVOA 1BTEA 5DO6A 2PJYB 1UG4A
chains in the Genus database with same CATH topology
3EVSC 3HH7A 1HC9B 1TXAA 2QC1A 2QJ9C 4QTIU 2H64C 1TFSA 1CB9A 1CTXA 1H0JA 2H64B 1IDGA 1CDRA 3PLCA 1IDHA 2VLWA 4XJJA 2UWRA 1VB0A 6EBXA 1IKCA 4HQPF 2OFSA 1IQ9A 2K3GA 3NH7A 1KFHA 1CCQA 1YWHA 1KC4A 1NTXA 1KBAA 2GOOC 1FRAA 1F8UB 1CXNA 2BHIA 2HLQA 1REWC 2GOOB 4RUDA 2MFAA 1NYUA 2H8UA 4FAOC 1PLOA 1BXPA 5IMYC 1QM7A 2ABXA 2CCXA 1ONJA 4OM5A 1HOYA 1W6BA 1FF4A 1V6PA 1ERAA 1KXIA 1IDLA 1KBTA 2LA1A 1CDTA 3ERAA 2JQPA 1CODA 1MAHF 2N99A 1CRFA 1ABTA 1ES7B 3BT1U 1FASA 4KSNA 3VTSA 2QJBC 2H62D 2I9BE 2LCRA 4UY2C 3U73U 2MHYA 1NEAA 2FD6U 4IYEA 2CTXA 1JGKA 4FAOE 1JE9A 1B41B 1NORA 4AEAA 1CREA 3FEVA 2BTXA 1LX5B 1XT3A 3LAQU 3KFDE 1QKDA 1G6MA 2ERAA 1FSSB 1RL5A 2J8BA 1DRSA 4LFTA 5DZ5A 1QKEA 1NXBA 2CRSA 1S4YA 5DU1A 1KU6B 1COEA 1HAJA 1KBSA 1FSCA 1LSIA 2H7ZA 2JVEA 3KFDI 1LXHA 1LXGA 2UX2A 4ZQYA 1I02A 4P7UA 2H5FA 2H62C 1FFJA 1KS6A 3QB4B 2L03A 1TGXA 3NDSA 4OM4A 1TXBA 2X8BB 5IMTD 1HC9A 1L4WA 1NTNA 1ZADA 2MUOA 2L5SA 4EY8B 1CHVS 1IJCA 1MR6A 1CDQA 3BT2U 1RGJA 2MUPA 1LJZA 3NEQA 1F94A 1HAAA 3EBXA 1M9ZA 4DO8A 1KL8A 2CRTA 2MJ0A 2H7ZB 1NYSA 3U74U 1CXOA 1ERGA 1KTZB 1IK8A 4BIKB 2QJAC 2CDXA 2MJ4A 2NBTA 1JBDA 5EBXA 2HLRA 1IDIA 4BDTB 1CDSA 2MJYA 2PJYC 1CVOA 1BTEA 5DO6A 2PJYB 1UG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVS C;  3HH7 A;  1HC9 B;  1TXA A;  2QC1 A;  2QJ9 C;  4QTI U;  2H64 C;  1TFS A;  1CB9 A;  1CTX A;  1H0J A;  2H64 B;  1IDG A;  1CDR A;  3PLC A;  1IDH A;  2VLW A;  4XJJ A;  2UWR A;  1VB0 A;  6EBX A;  1IKC A;  4HQP F;  2OFS A;  1IQ9 A;  2K3G A;  3NH7 A;  1KFH A;  1CCQ A;  1YWH A;  1KC4 A;  1NTX A;  1KBA A;  2GOO C;  1FRA A;  1F8U B;  1CXN A;  2BHI A;  2HLQ A;  1REW C;  2GOO B;  4RUD A;  2MFA A;  1NYU A;  2H8U A;  4FAO C;  1PLO A;  1BXP A;  5IMY C;  1QM7 A;  2ABX A;  2CCX A;  1ONJ A;  4OM5 A;  1HOY A;  1W6B A;  1FF4 A;  1V6P A;  1ERA A;  1KXI A;  1IDL A;  1KBT A;  2LA1 A;  1CDT A;  3ERA A;  2JQP A;  1COD A;  1MAH F;  2N99 A;  1CRF A;  1ABT A;  1ES7 B;  3BT1 U;  1FAS A;  3VTS A;  2QJB C;  2H62 D;  2I9B E;  2LCR A;  4UY2 C;  3U73 U;  2MHY A;  1NEA A;  2FD6 U;  4IYE A;  2CTX A;  1JGK A;  4FAO E;  1JE9 A;  1B41 B;  1NOR A;  4AEA A;  1CRE A;  3FEV A;  2BTX A;  1LX5 B;  1XT3 A;  3LAQ U;  3KFD E;  1QKD A;  1G6M A;  2ERA A;  1FSS B;  1RL5 A;  2J8B A;  1DRS A;  4LFT A;  5DZ5 A;  1QKE A;  1NXB A;  2CRS A;  1S4Y A;  5DU1 A;  1KU6 B;  1COE A;  1HAJ A;  1KBS A;  1FSC A;  1LSI A;  2H7Z A;  2JVE A;  3KFD I;  1LXH A;  1LXG A;  2UX2 A;  4ZQY A;  1I02 A;  4P7U A;  2H5F A;  2H62 C;  1FFJ A;  1KS6 A;  3QB4 B;  2L03 A;  1TGX A;  3NDS A;  4OM4 A;  1TXB A;  2X8B B;  5IMT D;  1HC9 A;  1L4W A;  1NTN A;  1ZAD A;  2MUO A;  2L5S A;  4EY8 B;  1CHV S;  1IJC A;  1MR6 A;  1CDQ A;  3BT2 U;  1RGJ A;  2MUP A;  1LJZ A;  3NEQ A;  1F94 A;  1HAA A;  3EBX A;  1M9Z A;  4DO8 A;  1KL8 A;  2CRT A;  2MJ0 A;  2H7Z B;  1NYS A;  3U74 U;  1CXO A;  1ERG A;  1KTZ B;  1IK8 A;  4BIK B;  2QJA C;  2CDX A;  2MJ4 A;  2NBT A;  1JBD A;  5EBX A;  2HLR A;  1IDI A;  4BDT B;  1CDS A;  2MJY A;  2PJY C;  1CVO A;  1BTE A;  5DO6 A;  2PJY B;  1UG4 A; 
#chains in the Genus database with same CATH topology
 3EVS C;  3HH7 A;  1HC9 B;  1TXA A;  2QC1 A;  2QJ9 C;  4QTI U;  2H64 C;  1TFS A;  1CB9 A;  1CTX A;  1H0J A;  2H64 B;  1IDG A;  1CDR A;  3PLC A;  1IDH A;  2VLW A;  4XJJ A;  2UWR A;  1VB0 A;  6EBX A;  1IKC A;  4HQP F;  2OFS A;  1IQ9 A;  2K3G A;  3NH7 A;  1KFH A;  1CCQ A;  1YWH A;  1KC4 A;  1NTX A;  1KBA A;  2GOO C;  1FRA A;  1F8U B;  1CXN A;  2BHI A;  2HLQ A;  1REW C;  2GOO B;  4RUD A;  2MFA A;  1NYU A;  2H8U A;  4FAO C;  1PLO A;  1BXP A;  5IMY C;  1QM7 A;  2ABX A;  2CCX A;  1ONJ A;  4OM5 A;  1HOY A;  1W6B A;  1FF4 A;  1V6P A;  1ERA A;  1KXI A;  1IDL A;  1KBT A;  2LA1 A;  1CDT A;  3ERA A;  2JQP A;  1COD A;  1MAH F;  2N99 A;  1CRF A;  1ABT A;  1ES7 B;  3BT1 U;  1FAS A;  4KSN A;  3VTS A;  2QJB C;  2H62 D;  2I9B E;  2LCR A;  4UY2 C;  3U73 U;  2MHY A;  1NEA A;  2FD6 U;  4IYE A;  2CTX A;  1JGK A;  4FAO E;  1JE9 A;  1B41 B;  1NOR A;  4AEA A;  1CRE A;  3FEV A;  2BTX A;  1LX5 B;  1XT3 A;  3LAQ U;  3KFD E;  1QKD A;  1G6M A;  2ERA A;  1FSS B;  1RL5 A;  2J8B A;  1DRS A;  4LFT A;  5DZ5 A;  1QKE A;  1NXB A;  2CRS A;  1S4Y A;  5DU1 A;  1KU6 B;  1COE A;  1HAJ A;  1KBS A;  1FSC A;  1LSI A;  2H7Z A;  2JVE A;  3KFD I;  1LXH A;  1LXG A;  2UX2 A;  4ZQY A;  1I02 A;  4P7U A;  2H5F A;  2H62 C;  1FFJ A;  1KS6 A;  3QB4 B;  2L03 A;  1TGX A;  3NDS A;  4OM4 A;  1TXB A;  2X8B B;  5IMT D;  1HC9 A;  1L4W A;  1NTN A;  1ZAD A;  2MUO A;  2L5S A;  4EY8 B;  1CHV S;  1IJC A;  1MR6 A;  1CDQ A;  3BT2 U;  1RGJ A;  2MUP A;  1LJZ A;  3NEQ A;  1F94 A;  1HAA A;  3EBX A;  1M9Z A;  4DO8 A;  1KL8 A;  2CRT A;  2MJ0 A;  2H7Z B;  1NYS A;  3U74 U;  1CXO A;  1ERG A;  1KTZ B;  1IK8 A;  4BIK B;  2QJA C;  2CDX A;  2MJ4 A;  2NBT A;  1JBD A;  5EBX A;  2HLR A;  1IDI A;  4BDT B;  1CDS A;  2MJY A;  2PJY C;  1CVO A;  1BTE A;  5DO6 A;  2PJY B;  1UG4 A; 
#chains in the Genus database with same CATH homology
 3EVS C;  3HH7 A;  1HC9 B;  1TXA A;  2QC1 A;  2QJ9 C;  4QTI U;  2H64 C;  1TFS A;  1CB9 A;  1CTX A;  1H0J A;  2H64 B;  1IDG A;  1CDR A;  3PLC A;  1IDH A;  2VLW A;  4XJJ A;  2UWR A;  1VB0 A;  6EBX A;  1IKC A;  4HQP F;  2OFS A;  1IQ9 A;  2K3G A;  3NH7 A;  1KFH A;  1CCQ A;  1YWH A;  1KC4 A;  1NTX A;  1KBA A;  2GOO C;  1FRA A;  1F8U B;  1CXN A;  2BHI A;  2HLQ A;  1REW C;  2GOO B;  4RUD A;  2MFA A;  1NYU A;  2H8U A;  4FAO C;  1PLO A;  1BXP A;  5IMY C;  1QM7 A;  2ABX A;  2CCX A;  1ONJ A;  4OM5 A;  1HOY A;  1W6B A;  1FF4 A;  1V6P A;  1ERA A;  1KXI A;  1IDL A;  1KBT A;  2LA1 A;  1CDT A;  3ERA A;  2JQP A;  1COD A;  1MAH F;  2N99 A;  1CRF A;  1ABT A;  1ES7 B;  3BT1 U;  1FAS A;  4KSN A;  3VTS A;  2QJB C;  2H62 D;  2I9B E;  2LCR A;  4UY2 C;  3U73 U;  2MHY A;  1NEA A;  2FD6 U;  4IYE A;  2CTX A;  1JGK A;  4FAO E;  1JE9 A;  1B41 B;  1NOR A;  4AEA A;  1CRE A;  3FEV A;  2BTX A;  1LX5 B;  1XT3 A;  3LAQ U;  3KFD E;  1QKD A;  1G6M A;  2ERA A;  1FSS B;  1RL5 A;  2J8B A;  1DRS A;  4LFT A;  5DZ5 A;  1QKE A;  1NXB A;  2CRS A;  1S4Y A;  5DU1 A;  1KU6 B;  1COE A;  1HAJ A;  1KBS A;  1FSC A;  1LSI A;  2H7Z A;  2JVE A;  3KFD I;  1LXH A;  1LXG A;  2UX2 A;  4ZQY A;  1I02 A;  4P7U A;  2H5F A;  2H62 C;  1FFJ A;  1KS6 A;  3QB4 B;  2L03 A;  1TGX A;  3NDS A;  4OM4 A;  1TXB A;  2X8B B;  5IMT D;  1HC9 A;  1L4W A;  1NTN A;  1ZAD A;  2MUO A;  2L5S A;  4EY8 B;  1CHV S;  1IJC A;  1MR6 A;  1CDQ A;  3BT2 U;  1RGJ A;  2MUP A;  1LJZ A;  3NEQ A;  1F94 A;  1HAA A;  3EBX A;  1M9Z A;  4DO8 A;  1KL8 A;  2CRT A;  2MJ0 A;  2H7Z B;  1NYS A;  3U74 U;  1CXO A;  1ERG A;  1KTZ B;  1IK8 A;  4BIK B;  2QJA C;  2CDX A;  2MJ4 A;  2NBT A;  1JBD A;  5EBX A;  2HLR A;  1IDI A;  4BDT B;  1CDS A;  2MJY A;  2PJY C;  1CVO A;  1BTE A;  5DO6 A;  2PJY B;  1UG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...