1TGXA

X-ray structure at 1.55 a of toxin gamma, a cardiotoxin from naja nigricollis venom. crystal packing reveals a model for insertion into membranes
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
b'LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-CARDIOTOXIN
publication title X-ray structure at 1.55 A of toxin gamma, a cardiotoxin from Naja nigricollis venom. Crystal packing reveals a model for insertion into membranes.
pubmed doi rcsb
source organism Naja nigricollis
molecule tags Cytotoxin
total genus 10
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1993-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1tgxA00
1UG4A 2HLQA 4RUDA 2MJYA 1S4YA 1NYSA 1ONJA 1LSIA 3VTSA 2GOOB 1IDHA 1FFJA 1FSSB 4HQPF 1CDTA 1HAJA 1HC9B 3U74U 4OM4A 2NBTA 2CRSA 4OM5A 1NEAA 2QJ9C 1YWHA 2N99A 2I9BE 2MFAA 2VLWA 1XT3A 3NH7A 1IKCA 1BXPA 1ABTA 5DZ5A 1H0JA 5DO6A 2BTXA 1L4WA 1RGJA 1TGXA 1KU6B 1KL8A 3BT2U 4BDTB 1CCQA 1B41B 1KBAA 2PJYB 1FASA 1CHVS 1G6MA 2H62D 3NEQA 2X8BB 2MUOA 1JBDA 1CDQA 2H62C 1CXNA 1HOYA 2H8UA 1REWC 1CREA 3LAQU 2OFSA 2ABXA 4BIKB 1QKEA 2QJBC 1TFSA 1IK8A 2MUPA 4LFTA 1KS6A 2H64C 2H7ZA 1KTZB 3BT1U 1CDRA 1KC4A 4DO8A 5EBXA 2J8BA 1NYUA 2ERAA 1CXOA 1KFHA 2CRTA 2MJ4A 6EBXA 3PLCA 1LX5B 2LCRA 1MR6A 1TXAA 1KXIA 1NTXA 3NDSA 1CODA 2QC1A 2H5FA 2UWRA 2LA1A 5DU1A 1MAHF 2CCXA 4FAOE 4QTIU 2L03A 2FD6U 1ZADA 1CTXA 1JE9A 1HC9A 1ERGA 3FEVA 1VB0A 1V6PA 3QB4B 5IMTD 1NTNA 2H7ZB 1NXBA 1NORA 2K3GA 1COEA 3ERAA 1CVOA 1JGKA 3EBXA 4XJJA 1F8UB 2H64B 1IJCA 3EVSC 4ZQYA 2CDXA 2HLRA 1IDGA 2GOOC 1BTEA 1ES7B 4IYEA 1TXBA 4P7UA 1CB9A 1CDSA 1CRFA 1QM7A 4AEAA 1DRSA 1IQ9A 1LJZA 2MHYA 1IDLA 1FF4A 3KFDI 3HH7A 2BHIA 1M9ZA 3U73U 4EY8B 4UY2C 5IMYC 1RL5A 1I02A 2QJAC 3KFDE 4FAOC 1HAAA 1F94A 1W6BA 1KBTA 2JVEA 2CTXA 1LXHA 1LXGA 2MJ0A 1KBSA 1FSCA 2UX2A 1PLOA 2JQPA 1IDIA 1QKDA 1FRAA 1ERAA 2L5SA 2PJYC
chains in the Genus database with same CATH superfamily
1UG4A 2HLQA 4RUDA 2MJYA 1S4YA 1NYSA 1ONJA 1LSIA 3VTSA 2GOOB 1IDHA 1FFJA 1FSSB 4HQPF 1CDTA 1HAJA 1HC9B 3U74U 4OM4A 2NBTA 2CRSA 4OM5A 1NEAA 2QJ9C 1YWHA 2N99A 2I9BE 2MFAA 2VLWA 1XT3A 3NH7A 1IKCA 1BXPA 1ABTA 5DZ5A 1H0JA 5DO6A 2BTXA 1L4WA 1RGJA 1TGXA 1KU6B 1KL8A 3BT2U 4BDTB 1CCQA 1B41B 1KBAA 2PJYB 1FASA 1CHVS 1G6MA 2H62D 3NEQA 2X8BB 2MUOA 1JBDA 1CDQA 2H62C 1CXNA 1HOYA 2H8UA 1REWC 1CREA 3LAQU 2OFSA 2ABXA 4BIKB 1QKEA 2QJBC 1TFSA 1IK8A 2MUPA 4LFTA 1KS6A 2H64C 2H7ZA 1KTZB 3BT1U 1CDRA 1KC4A 4DO8A 5EBXA 2J8BA 1NYUA 2ERAA 1CXOA 1KFHA 2CRTA 2MJ4A 6EBXA 3PLCA 1LX5B 2LCRA 1MR6A 1TXAA 1KXIA 1NTXA 3NDSA 1CODA 2QC1A 2H5FA 2UWRA 2LA1A 5DU1A 1MAHF 2CCXA 4FAOE 4QTIU 2L03A 2FD6U 1ZADA 1CTXA 1JE9A 1HC9A 1ERGA 3FEVA 1VB0A 1V6PA 3QB4B 5IMTD 1NTNA 2H7ZB 1NXBA 1NORA 2K3GA 1COEA 3ERAA 1CVOA 1JGKA 3EBXA 4XJJA 1F8UB 2H64B 4KSNA 1IJCA 3EVSC 4ZQYA 2CDXA 2HLRA 1IDGA 2GOOC 1BTEA 1ES7B 4IYEA 1TXBA 4P7UA 1CB9A 1CDSA 1CRFA 1QM7A 4AEAA 1DRSA 1IQ9A 1LJZA 2MHYA 1IDLA 1FF4A 3KFDI 3HH7A 2BHIA 1M9ZA 3U73U 4EY8B 4UY2C 5IMYC 1RL5A 1I02A 2QJAC 3KFDE 4FAOC 1HAAA 1F94A 1W6BA 1KBTA 2JVEA 2CTXA 1LXHA 1LXGA 2MJ0A 1KBSA 1FSCA 2UX2A 1PLOA 2JQPA 1IDIA 1QKDA 1FRAA 1ERAA 2L5SA 2PJYC
chains in the Genus database with same CATH topology
1UG4A 2HLQA 4RUDA 2MJYA 1S4YA 1NYSA 1ONJA 1LSIA 3VTSA 2GOOB 1IDHA 1FFJA 1FSSB 4HQPF 1CDTA 1HAJA 1HC9B 3U74U 4OM4A 2NBTA 2CRSA 4OM5A 1NEAA 2QJ9C 1YWHA 2N99A 2I9BE 2MFAA 2VLWA 1XT3A 3NH7A 1IKCA 1BXPA 1ABTA 5DZ5A 1H0JA 5DO6A 2BTXA 1L4WA 1RGJA 1TGXA 1KU6B 1KL8A 3BT2U 4BDTB 1CCQA 1B41B 1KBAA 2PJYB 1FASA 1CHVS 1G6MA 2H62D 3NEQA 2X8BB 2MUOA 1JBDA 1CDQA 2H62C 1CXNA 1HOYA 2H8UA 1REWC 1CREA 3LAQU 2OFSA 2ABXA 4BIKB 1QKEA 2QJBC 1TFSA 1IK8A 2MUPA 4LFTA 1KS6A 2H64C 2H7ZA 1KTZB 3BT1U 1CDRA 1KC4A 4DO8A 5EBXA 2J8BA 1NYUA 2ERAA 1CXOA 1KFHA 2CRTA 2MJ4A 6EBXA 3PLCA 1LX5B 2LCRA 1MR6A 1TXAA 1KXIA 1NTXA 3NDSA 1CODA 2QC1A 2H5FA 2UWRA 2LA1A 5DU1A 1MAHF 2CCXA 4FAOE 4QTIU 2L03A 2FD6U 1ZADA 1CTXA 1JE9A 1HC9A 1ERGA 3FEVA 1VB0A 1V6PA 3QB4B 5IMTD 1NTNA 2H7ZB 1NXBA 1NORA 2K3GA 1COEA 3ERAA 1CVOA 1JGKA 3EBXA 4XJJA 1F8UB 2H64B 4KSNA 1IJCA 3EVSC 4ZQYA 2CDXA 2HLRA 1IDGA 2GOOC 1BTEA 1ES7B 4IYEA 1TXBA 4P7UA 1CB9A 1CDSA 1CRFA 1QM7A 4AEAA 1DRSA 1IQ9A 1LJZA 2MHYA 1IDLA 1FF4A 3KFDI 3HH7A 2BHIA 1M9ZA 3U73U 4EY8B 4UY2C 5IMYC 1RL5A 1I02A 2QJAC 3KFDE 4FAOC 1HAAA 1F94A 1W6BA 1KBTA 2JVEA 2CTXA 1LXHA 1LXGA 2MJ0A 1KBSA 1FSCA 2UX2A 1PLOA 2JQPA 1IDIA 1QKDA 1FRAA 1ERAA 2L5SA 2PJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG4 A;  2HLQ A;  4RUD A;  2MJY A;  1S4Y A;  1NYS A;  1ONJ A;  1LSI A;  3VTS A;  2GOO B;  1IDH A;  1FFJ A;  1FSS B;  4HQP F;  1CDT A;  1HAJ A;  1HC9 B;  3U74 U;  4OM4 A;  2NBT A;  2CRS A;  4OM5 A;  1NEA A;  2QJ9 C;  1YWH A;  2N99 A;  2I9B E;  2MFA A;  2VLW A;  1XT3 A;  3NH7 A;  1IKC A;  1BXP A;  1ABT A;  5DZ5 A;  1H0J A;  5DO6 A;  2BTX A;  1L4W A;  1RGJ A;  1TGX A;  1KU6 B;  1KL8 A;  3BT2 U;  4BDT B;  1CCQ A;  1B41 B;  1KBA A;  2PJY B;  1FAS A;  1CHV S;  1G6M A;  2H62 D;  3NEQ A;  2X8B B;  2MUO A;  1JBD A;  1CDQ A;  2H62 C;  1CXN A;  1HOY A;  2H8U A;  1REW C;  1CRE A;  3LAQ U;  2OFS A;  2ABX A;  4BIK B;  1QKE A;  2QJB C;  1TFS A;  1IK8 A;  2MUP A;  4LFT A;  1KS6 A;  2H64 C;  2H7Z A;  1KTZ B;  3BT1 U;  1CDR A;  1KC4 A;  4DO8 A;  5EBX A;  2J8B A;  1NYU A;  2ERA A;  1CXO A;  1KFH A;  2CRT A;  2MJ4 A;  6EBX A;  3PLC A;  1LX5 B;  2LCR A;  1MR6 A;  1TXA A;  1KXI A;  1NTX A;  3NDS A;  1COD A;  2QC1 A;  2H5F A;  2UWR A;  2LA1 A;  5DU1 A;  1MAH F;  2CCX A;  4FAO E;  4QTI U;  2L03 A;  2FD6 U;  1ZAD A;  1CTX A;  1JE9 A;  1HC9 A;  1ERG A;  3FEV A;  1VB0 A;  1V6P A;  3QB4 B;  5IMT D;  1NTN A;  2H7Z B;  1NXB A;  1NOR A;  2K3G A;  1COE A;  3ERA A;  1CVO A;  1JGK A;  3EBX A;  4XJJ A;  1F8U B;  2H64 B;  1IJC A;  3EVS C;  4ZQY A;  2CDX A;  2HLR A;  1IDG A;  2GOO C;  1BTE A;  1ES7 B;  4IYE A;  1TXB A;  4P7U A;  1CB9 A;  1CDS A;  1CRF A;  1QM7 A;  4AEA A;  1DRS A;  1IQ9 A;  1LJZ A;  2MHY A;  1IDL A;  1FF4 A;  3KFD I;  3HH7 A;  2BHI A;  1M9Z A;  3U73 U;  4EY8 B;  4UY2 C;  5IMY C;  1RL5 A;  1I02 A;  2QJA C;  3KFD E;  4FAO C;  1HAA A;  1F94 A;  1W6B A;  1KBT A;  2JVE A;  2CTX A;  1LXH A;  1LXG A;  2MJ0 A;  1KBS A;  1FSC A;  2UX2 A;  1PLO A;  2JQP A;  1IDI A;  1QKD A;  1FRA A;  1ERA A;  2L5S A;  2PJY C; 
#chains in the Genus database with same CATH topology
 1UG4 A;  2HLQ A;  4RUD A;  2MJY A;  1S4Y A;  1NYS A;  1ONJ A;  1LSI A;  3VTS A;  2GOO B;  1IDH A;  1FFJ A;  1FSS B;  4HQP F;  1CDT A;  1HAJ A;  1HC9 B;  3U74 U;  4OM4 A;  2NBT A;  2CRS A;  4OM5 A;  1NEA A;  2QJ9 C;  1YWH A;  2N99 A;  2I9B E;  2MFA A;  2VLW A;  1XT3 A;  3NH7 A;  1IKC A;  1BXP A;  1ABT A;  5DZ5 A;  1H0J A;  5DO6 A;  2BTX A;  1L4W A;  1RGJ A;  1TGX A;  1KU6 B;  1KL8 A;  3BT2 U;  4BDT B;  1CCQ A;  1B41 B;  1KBA A;  2PJY B;  1FAS A;  1CHV S;  1G6M A;  2H62 D;  3NEQ A;  2X8B B;  2MUO A;  1JBD A;  1CDQ A;  2H62 C;  1CXN A;  1HOY A;  2H8U A;  1REW C;  1CRE A;  3LAQ U;  2OFS A;  2ABX A;  4BIK B;  1QKE A;  2QJB C;  1TFS A;  1IK8 A;  2MUP A;  4LFT A;  1KS6 A;  2H64 C;  2H7Z A;  1KTZ B;  3BT1 U;  1CDR A;  1KC4 A;  4DO8 A;  5EBX A;  2J8B A;  1NYU A;  2ERA A;  1CXO A;  1KFH A;  2CRT A;  2MJ4 A;  6EBX A;  3PLC A;  1LX5 B;  2LCR A;  1MR6 A;  1TXA A;  1KXI A;  1NTX A;  3NDS A;  1COD A;  2QC1 A;  2H5F A;  2UWR A;  2LA1 A;  5DU1 A;  1MAH F;  2CCX A;  4FAO E;  4QTI U;  2L03 A;  2FD6 U;  1ZAD A;  1CTX A;  1JE9 A;  1HC9 A;  1ERG A;  3FEV A;  1VB0 A;  1V6P A;  3QB4 B;  5IMT D;  1NTN A;  2H7Z B;  1NXB A;  1NOR A;  2K3G A;  1COE A;  3ERA A;  1CVO A;  1JGK A;  3EBX A;  4XJJ A;  1F8U B;  2H64 B;  4KSN A;  1IJC A;  3EVS C;  4ZQY A;  2CDX A;  2HLR A;  1IDG A;  2GOO C;  1BTE A;  1ES7 B;  4IYE A;  1TXB A;  4P7U A;  1CB9 A;  1CDS A;  1CRF A;  1QM7 A;  4AEA A;  1DRS A;  1IQ9 A;  1LJZ A;  2MHY A;  1IDL A;  1FF4 A;  3KFD I;  3HH7 A;  2BHI A;  1M9Z A;  3U73 U;  4EY8 B;  4UY2 C;  5IMY C;  1RL5 A;  1I02 A;  2QJA C;  3KFD E;  4FAO C;  1HAA A;  1F94 A;  1W6B A;  1KBT A;  2JVE A;  2CTX A;  1LXH A;  1LXG A;  2MJ0 A;  1KBS A;  1FSC A;  2UX2 A;  1PLO A;  2JQP A;  1IDI A;  1QKD A;  1FRA A;  1ERA A;  2L5S A;  2PJY C; 
#chains in the Genus database with same CATH homology
 1UG4 A;  2HLQ A;  4RUD A;  2MJY A;  1S4Y A;  1NYS A;  1ONJ A;  1LSI A;  3VTS A;  2GOO B;  1IDH A;  1FFJ A;  1FSS B;  4HQP F;  1CDT A;  1HAJ A;  1HC9 B;  3U74 U;  4OM4 A;  2NBT A;  2CRS A;  4OM5 A;  1NEA A;  2QJ9 C;  1YWH A;  2N99 A;  2I9B E;  2MFA A;  2VLW A;  1XT3 A;  3NH7 A;  1IKC A;  1BXP A;  1ABT A;  5DZ5 A;  1H0J A;  5DO6 A;  2BTX A;  1L4W A;  1RGJ A;  1TGX A;  1KU6 B;  1KL8 A;  3BT2 U;  4BDT B;  1CCQ A;  1B41 B;  1KBA A;  2PJY B;  1FAS A;  1CHV S;  1G6M A;  2H62 D;  3NEQ A;  2X8B B;  2MUO A;  1JBD A;  1CDQ A;  2H62 C;  1CXN A;  1HOY A;  2H8U A;  1REW C;  1CRE A;  3LAQ U;  2OFS A;  2ABX A;  4BIK B;  1QKE A;  2QJB C;  1TFS A;  1IK8 A;  2MUP A;  4LFT A;  1KS6 A;  2H64 C;  2H7Z A;  1KTZ B;  3BT1 U;  1CDR A;  1KC4 A;  4DO8 A;  5EBX A;  2J8B A;  1NYU A;  2ERA A;  1CXO A;  1KFH A;  2CRT A;  2MJ4 A;  6EBX A;  3PLC A;  1LX5 B;  2LCR A;  1MR6 A;  1TXA A;  1KXI A;  1NTX A;  3NDS A;  1COD A;  2QC1 A;  2H5F A;  2UWR A;  2LA1 A;  5DU1 A;  1MAH F;  2CCX A;  4FAO E;  4QTI U;  2L03 A;  2FD6 U;  1ZAD A;  1CTX A;  1JE9 A;  1HC9 A;  1ERG A;  3FEV A;  1VB0 A;  1V6P A;  3QB4 B;  5IMT D;  1NTN A;  2H7Z B;  1NXB A;  1NOR A;  2K3G A;  1COE A;  3ERA A;  1CVO A;  1JGK A;  3EBX A;  4XJJ A;  1F8U B;  2H64 B;  4KSN A;  1IJC A;  3EVS C;  4ZQY A;  2CDX A;  2HLR A;  1IDG A;  2GOO C;  1BTE A;  1ES7 B;  4IYE A;  1TXB A;  4P7U A;  1CB9 A;  1CDS A;  1CRF A;  1QM7 A;  4AEA A;  1DRS A;  1IQ9 A;  1LJZ A;  2MHY A;  1IDL A;  1FF4 A;  3KFD I;  3HH7 A;  2BHI A;  1M9Z A;  3U73 U;  4EY8 B;  4UY2 C;  5IMY C;  1RL5 A;  1I02 A;  2QJA C;  3KFD E;  4FAO C;  1HAA A;  1F94 A;  1W6B A;  1KBT A;  2JVE A;  2CTX A;  1LXH A;  1LXG A;  2MJ0 A;  1KBS A;  1FSC A;  2UX2 A;  1PLO A;  2JQP A;  1IDI A;  1QKD A;  1FRA A;  1ERA A;  2L5S A;  2PJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...