1THXA

Thioredoxin-2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structure of thioredoxin-2 from Anabaena.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1995-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1thxA00
1M9BA 3RHCA 1PMTA 1MEKA 4V2NA 4ACSA 2JZRA 5G1KA 2KOKA 1ZMAA 3JCML 4HU9A 4F82A 4HJMA 2WGRA 4YQMA 3ZIVA 5C00A 4MZBA 4TXOB 1H75A 2HI7A 1N8JA 2IMDA 2CVBA 2OA7A 3VURA 3IRAA 2VM2A 2DJ1A 3I6AA 3J7Yb 4ZL7A 3DGQA 3GNJA 1OE7A 2FA8A 3KTBA 2FD3A 2DIYA 4GQFA 3F4RA 3PGTA 3UVTA 2YZHA 4RQXA 5F06A 2JACA 1F2EA 1XWCA 2CQ9A 1OC8A 2X64A 2B7KA 4K7IA 2F51A 3HVVA 4PGTA 3TB2A 4XRDA 5DAKB 3ME8A 2LNSA 5ECQB 2ON7A 1GLPA 2LJAA 2B3SA 3R2QA 2AAWA 4WBRD 2ZUPA 3PR8A 2IMFA 3VWVA 3VI5A 2IPAA 1T4YA 4OCFA 1EWXA 3UVHA 4AF2A 2XPDA 3FYGA 4KE3A 5ECSA 2GZPA 3LEFA 4K0GA 2RLIA 5A4WA 2FWGA 4PQHA 1ERVA 1BAYA 3D22A 1J0FA 4ML1A 5DQSA 4DSSA 1A2LA 2HXKA 1Z7RA 4D73A 2V6OA 3GX0A 4DSRA 4FYCA 5CP1A 5IMZA 2AYTA 1YQ1A 3GTUA 2J9HA 3D21A 4GWRA 4OD7A 3LWAA 2E0QA 4TR0A 2GSRA 4OFNA 6GSWA 5GZZB 1ACVA 1TKDB 2H73A 4WR4A 1NSWA 2LV3A 4HS1A 3BOAA 3FRCA 3O3TA 3DXBA 2C0GA 1WPIA 4FO5A 1U3IA 2GT6A 3E9JB 3EWLA 3IR4A 5C04A 3FHKA 4FH8A 2V6KA 4IHUA 3FK8A 2KP1A 1EGRA 5IMAA 1GUKA 4OWYA 4GLTA 1GNWA 3H1NA 2F8AA 1M7TA 1GTBA 1YKCA 5FT3A 5FWGA 1ZCPA 3ZRDA 3GHAA 2L6DA 1T3BA 2YWMA 2LS5A 1V58A 4IBPA 2DJKA 1XZOA 4ECIA 1VGLA 2DIZA 3LXTA 4HJ2A 2NPBA 1U87A 4XCSA 3GL3A 3GSSA 2JZSA 2ON5A 4I8BA 4OMVA 1XFLA 2YZUA 5D9TA 5KEJA 3LQ7A 2LSTA 3BCIA 1ERWA 4IN0A 5ECPB 1BG5A 1GWCA 1PX6A 2L57A 3FR6A 4XS4A 4JE1A 2HSHA 3LYKA 2JL4A 5JCGA 9GSSA 1B48A 4HUAA 5ECMB 1TI1A 1V98A 2FGXA 5E59A 3CSHA 1SKWB 4L0WA 5DALA 1F3BA 1EV4A 4X1UA 3DWVA 3A2VA 4MMMA 2HFDA 1F9MA 1ZL9A 1HNAA 1OE8A 2GVPA 1XXUA 3GL5A 1M0UA 3VI7A 5DJMA 5J3RA 3VFIA 1AC1A 4O92A 4MF6A 1PL1A 2E2GA 4PURA 3TGZA 1SJIA 4IQAA 4KX4A 2FA4A 5ECHB 1TRUA 2WFCA 1A0RP 3ZVJD 5CRGA 4NV2A 2GZZA 1F3AA 2DJJA 3FZ9A 2FWHA 5DDLA 3LSZA 3WD6A 1OC3A 2D2ZA 2IFQB 4DEJA 2C4JA 4XS1A 1USBA 1EOHA 5JWOB 1M2AA 3GKNA 2KLXA 2C80A 5J9CA 2EIQA 2PPTA 1O85A 4BA7A 1OC9A 4EF0A 1C72A 2VCVA 3GKMA 2LNTA 4POKA 2CV4A 3P7XA 2E7PA 1O8XA 2MZCA 1M99A 2CAIA 3D5JA 2JSZA 4E8HA 1UC7A 2R37A 4G10A 5IMVA 4IJ3A 3U6VA 2KP2A 2VL2A 1EEJA 3A3TA 5CNWA 4NMUA 4KSMA 1Z3EA 5B8BA 14GSA 3KMOA 1K0AA 1FO5A 3DKSA 4CHSA 1YF1A 5ECKB 1SD8A 5GSSA 1CQGA 6GSVA 3ZVJA 1A0FA 2VL3A 2XHFA 3HXSA 18GSA 2GT5A 1G6YA 1JZDA 2N5BA 3KMNA 3L9SA 1GTAA 2VM1A 3KP8A 1WMJA 6GSXA 5IO2A 1BEDA 4BVYA 4WF4A 1KNGA 4NPBA 2CVKA 5JCWA 2XC2A 4HEA2 2H70A 2HT9A 1GP1A 3PINA 2K8SA 2I1UA 2R5GA 2C8UA 2C1YA 3DEXA 2YP6A 1AUCA 2VLUA 2C0DA 1U3AA 4OO5A 1O8WA 3QAWA 1VRSD 2WDUA 4EE0A 3E3EA 5IOWA 20GSA 1NW2A 2H6XA 4CDOA 1F6MC 1I5GA 4ILFA 1X5EA 4MDCA 1QXHA 3TJJA 4MZWA 3EMPA 3CYNA 4K2DA 3TKQA 1R5PA 3IV4A 2HSYA 4BPYA 2V32A 3SBCA 5CREA 4TR3A 3C71A 2B5YA 3UJ1A 3RAZA 4YQUA 3QR6A 1ZYQB 1AQVA 1PKZA 1SL1B 1EOGA 1CQHA 1GTIA 5CRWA 2I4AA 3TUEA 3IDVA 2YWNA 3QOUA 2IMKA 1GUHA 2B6MA 1M2BA 4L8EA 3QPMA 1DE2A 2DSAA 4ECBA 6GSUA 3EYTA 4LMWA 2VIMA 4ML6A 2PMTA 3ZREA 1MDJA 1OAZA 3HZ8A 4NHWA 1GL8A 3CTGA 4RI6A 2VCTA 3IOSA 2C3QA 5DCGA 4IVFA 3F6DA 2B1LA 4NXIA 1YZXA 2YNXA 3LFLA 5AN1A 3F6FA 3VWXA 4RUVA 4K8MA 4LA1A 1FB6A 3W6GA 2YANA 2M72A 4K7OA 3HKRA 4MK3A 2YPMA 2LJKA 5DQYA 1NHOA 1GSYA 4YH2A 1FOVA 3MSZA 5LD0A 4EDZA 4F2IA 1SU9A 1X0RA 1M9AA 5A4VA 3CRUA 3LORA 4X0XA 17GSA 2LRTA 5DCHA 4TXOA 5COHA 2A2RA 2TIRA 2G2QA 5GAPD 3C7MA 1NHYA 1XWKA 5F8BA 2F3MA 1K0MA 3ZZXA 5KN2A 2B5EA 4MZCA 4TR4A 2H66A 1ZZYA 4HI7A 4KCEA 1KEBA 3K8NA 1JZOA 2G0FA 1TRSA 1W89A 1MD3A 3KZQA 5ECNB 5HFKA 2L59A 2P5QA 1IYHA 1GSQA 2HE3A 5J5NA 4ZBBA 4ZB6A 2PERA 1R26A 2DMMA 3N5OA 2K6VA 1B8XA 3TKSE 3A2XA 4TVEA 4F9ZA 2CX3A 1JLWA 3MAKA 3V1WA 3DYRA 5AIXA 3KTLA 2VCWA 3APQA 3ZYWA 4ZB9A 1SD9A 4N0ZA 5ECLB 1DE1A 5IMDA 1M2DA 2GSQA 1YDKA 4IQ1A 1V57A 4ZIJA 2HZEA 2H01A 2GQLA 1GTUA 2H30A 5ELGA 3F63A 4ZXGA 3KH7A 1KTEA 1BQ7A 4HU7A 2OBIA 1YEXA 4KUNA 1EP7A 2QGVA 1YF0A 4PX1A 4EL1A 1UVZA 2TRXA 2X8HA 1QK8A 4WBJA 4DSQA 3LG6A 3F4TA 3TKPA 1SK0A 3EURA 1V2AA 1E6BA 1ON4A 3IAS2 4GF0A 1TP9A 5ID2A 2LRNA 2VL2C 3U5RE 10GSA 2OACA 3HDCA 2PVQA 3GX8A 3DVXA 1T1VA 2M46A 2PUKC 3L4NA 4BWSA 3FZ5A 4EUYA 2R3XA 2AB6A 3Q19A 3Q6OA 1A2MA 3GTUB 2H71A 2IJYA 2O8VB 2DBCA 1Y25A 1QUWA 3QAVA 4O5RA 5B7CA 2ES7A 3L78A 4HQZA 1TJDA 3CTFA 3ZITA 3ERFA 1TRVA 3LJRA 2GQMA 3CSJA 3F9UA 3IK9A 4BVXA 3VWUA 1URMA 1TOFA 4LL1B 1HQOA 3KP9A 3NZNA 5ABRA 3GKKA 4L0UA 5G30A 2YV9A 3QFAC 4V2MA 2DJ0A 4EVMA 1TI3A 2WB9A 4JRRA 3C8EA 1K0NA 1PQNA 2DLXA 4ISDA 4J56E 4LLRA 3M9JA 3ME7A 3AY8A 2TRCP 3RDWA 4I2TA 1GSUA 3VPQA 1Q4JA 3IHQA 4AJ7A 3I69A 1NM3A 3HZ4A 2BMXA 4HDEA 3L9UA 1Z6NA 1AQWA 2CZ3A 5AIVA 3M3MA 2OJLA 1UA5A 3F4SA 1DUGA 5IM9A 1RW1A 4NAXA 3IE3A 1X5DA 2WULA 3HJOA 4KCAA 2GSSA 4TW5A 3ZL5A 2H0IA 1K0BA 1T4ZA 5J41A 4GTUA 1ILOA 5DALB 2HLSA 2L5OA 3GURA 1SKRB 1IYIA 1PSQA 1J9BA 1EEMA 1GRXA 1JZRA 3M8NA 1TW9A 4MCUA 4OCEA 4L5LA 4MLYA 4KA0A 1E2YA 3G9BA 2PN8A 2KUCA 3HVSA 1XW6A 2VCQA 5HR1A 2YWIA 1XPVA 4AGSA 2K8VA 3TJGA 2N5AA 1EV9A 4BWQA 2AV4A 3IBHA 2GGTA 3F8UA 3D6IA 1K3LA 2RM6A 2LKUA 1HYUA 1W4VA 6GSYA 4EO3A 1I9DA 1PN9A 3HY2A 3WGDA 4V1Ap 2V2GA 4MPGA 4YAPA 2N5FA 3I9V2 1XIYA 2IL3A 2MBTA 1OKDA 1BYEA 1LU4A 1SJZA 1XW5A 3VWWA 2B5XA 3ISOA 3H79A 3GRXA 1A23A 1VF1A 5LNKe 2R6KA 5F0GA 2CZ2A 1RQMA 4HOJA 2AJQB 1PL2A 1THOA 1T7PB 4KSOA 2JADA 4ECCA 4GSSA 5ECRB 3PH9A 3KEBA 3HCZA 4ZL9A 2PU9C 5CRHA 4Z7XA 4K9ZA 1A8LA 4N10A 1TRWA 2LUSA 4RI7A 1LJRA 2BTOT 2IWTA 1XWBA 2AUVA 1WRYA 4J2FA 1QFNA 1WOUA 2C3NA 2HYXA 5ENUA 2C0FA 3SWLA 2ZCTA 4HZ4A 4CW9A 1X5CA 4MABA 2WCIA 4POLA 1SYRA 1AW9A 3QFBC 1RK4A 2H1DA 5ELAA 2YCDA 1K3OA 2GTUA 3FZAA 3TKSA 5KN1A 5F05A 1V9WA 1TDIA 2L4QA 3ZTLA 3MNGA 1LBKA 1ZYEA 3GN3A 4DVCA 2LEGA 3ED3A 19GSA 3KJYA 4ZL8A 1R7HA 1ZGNA 4TRXA 1H4OA 3FKFA 4V1Ag 5L71A 4WKWA 4KNDA 1O73A 2FHEA 2GZYA 3WT2A 3ZFLA 2H1AA 2P5RA 3I43A 3OR5A 3GUSA 1MDIA 3TJKA 2VCZA 1YJ6A 3LXZA 1G7OA 2IMEA 16GSA 4I2UA 3TKRA 3EU3A 4H86A 4ZBDA 2VL9A 4QQ7A 2K18A 1XW9A 3IAM2 1SL0B 3O76A 2NVLA 1G6WA 3UOMA 3G7JA 3FEUA 5AISA 5H5SA 4GSNA 1B9XC 5ECOB 1GULA 2MMNA 1TK5B 4MP4A 2O85A 2DC5A 2JSYA 2H1GA 1A24A 4JU5A 4GXZA 4TN8A 4N30A 3G7YA 5DVBA 2J23A 1EZKA 4GSTA 3HYPA 5AGYA 3BBYA 2P31A 2FUG2 5H5QA 2OE3A 5HR2A 3W8JA 1N2AA 1Z5YE 4G9HA 2NTOA 3DVWA 8GSSA 2YN1A 4KDYA 2YJ7A 3D4TA 1GSSA 2YJHA 2BJXA 4Q5NA 1PA3A 12GSA 4YQVA 3EMXA 5G2ZA 4TR1B 1F37A 4POMA 4G19A 1SL2B 4KGIA 4KAEA 4IW9A 3QMXA 2FWFA 3ZMLA 1Q98A 2IIYA 2O87A 4IKHA 5J4UA 1FW1A 2H0GA 2RM5A 1TXXA 3IK7A 1U6TA 1XWGA 1PKWA 2CVDA 3VPTA 5A4UA 1WP0A 4TKYA 3MWHA 1WE0A 4LL4B 2VCXA 2QKEA 1G0TA 2WRTA 4OFTA 3RBTA 3ERWA 2KHPA 5D9WA 1BJXA 2GQKA 4JR6A 2MBSA 1FG4A 1O81A 2MYGA 3EU4A 1GH2A 5D96A 2NDOA 3KIJA 5DAKA 5E4WA 2HRFA 2H75A 2YWOA 3ZFBA 4KH7A 1SK1A 2R4VA 2RIIA 1SENA 1Z6MA 1R4WA 1WJKA 2V1MA 3FR9A 4YAVA 5IO0A 3EC3A 5B8AA 3TRQA 3NIVA 1K0OA 2OKAA 2PBJA 2HRNA 3C1RA 2I9HA 1XOBA 4ULXA 1AAZA 1QQ2A 5D73A 3RPNA 3UL3A 5CO3A 3ZMKA 2L6CA 3N9JA 3QDNA 1J08A 4Q5FA 3FY7A 3TDGA 2LQQA 5EY6A 1UN2A 6GSTA 5EPFA 4K6XA 3H93A 3HVXA 4POBA 4EXJA 4AJ8A 5D93A 4I6XA 3A2WA 2CX4A 1DSBA 1AQXA 3DMLA 4ECJA 2ZNMA 3KM6A 1HD2A 5A5KA 1O7UA 2E2MA 2WS2A 5G31A 3H8QA 3APSA 3UBKA 3LYPA 1FB0A 1DBYA 1OKTA 5B6NA 2R2JA 4TOPA 3IXRA 1B4QA 4GCIA 3J7Yk 4E8EA 2FY6A 3GYKA 1HNBA 4HZ2A 4EKZA 3TOTA 3IPZA 1MD4A 5CYYA 2PVOC 1A8YA 2O7KA 1S3DA 2YOIA 3GH6A 2HZEB 2VOCA 1XWAA 1SKSB 1S3AA 1YEPA 4XTSA 4IGJA 4PQIA 1XVWA 5EVOA 3QCPA 2EC4A 3C73A 5CRDA 3DD3A 2M80A 5INYA 1GSDA 4DSSB 2F9SA 4D73B 5HQPA 1TU7A 1SJ6A 4O32A 3ZIJA 3Q18A 3UEMA 3H4KA 1TK0B 3F3RA 4PUAA 3EINA 3WGXA 1XVQA 3FW2A 2VD0A 1FVJA 4MH2A 5ID2B 3L9VA 3WT1A 4WEYA 3CRTA 5HR3A 4KW6A 1JLVA 3RPPA 2VUPA 7GSSA 1WWJA 4FYUA 4N11A 4KB3A 4ZBAA 1V40A 1PX7A 2PGTA 4P3YB 3IA1A 5CAXA 3GMFA 2LQOA 4O7HA 3P2AA 3IC4A 2MMAA 4F03A 4K1FA 1PRXA 4MPFA 3UMAA 3KCMA 2F8FA 4G2EA 2C3TA 3NOFA 4KDUA 4JZQA 2QSIA 5IOXA 3FZ4A 2I3YA 1ERUA 3KD0A 3EE2A 1FAAA 3G7IA 4F0CA 3L0HA 3LGCA 3TKSC 4MJBA 3UIWA 4OO4A 1G7EA 3D0ZA 2XPEA 1YY7A 2IFQA 5GAND 4GRFA 3DIEA 3QD9A 1VF3A 1MDKA 1QMVA 4HQSA 4MJEA 2V41A 4XS4B 3HHVA 3ERGA 1FVKA 3GIXA 3A5WA 1PD21 3P90A 4MJCA 1TU8A 1JFUA 3TJBA 5JWRB 4AJ6A 3GKXA 3E0UA 3CMIA 1O6JA 2FWEA 3CXGA 2AHEA 1B4PA 2H0HA 2H6YA 3QAGA 3KXOA 2PWJA 5D9XA 3KH9A 2DJ2A 1THXA 2O89A 2WJUA 2IN3A 13GSA 4NV5A 5IMFA 2VLVA 4PNFA 1OYJA 4BL7A 1Z9HA 3M9KA 4EC0A 3GSTA 2X8GA 4WR5A 4QL7A 3TJFA 2H72A 3UARA 3EVIA 1Z7PA 4MF7A 2H6ZA 1ML6A 2OE1A 4IS0A 1OC9B 4ID0A 3GA4A 2GS3A 3CBUA 2LRCA 4N0VA 1ZOFA 3WYWA 1K0CA 1ST9A 2QC7A 5J9BA 11GSA 4K7NA 5FHIA 2HZFA 2WZ9A 2VLTA 2X99A 4JR4A 5IMCA 4QL9A 1FHEA 3TRXA 5KN3A 2H74A 2ALBA 4XS6A 4MH3A 1XOAA 5D9VA 2LJRA 2RUEA 2EIOA 1U88A 2A2SA 4V2LA 3CSIA 2CAQA 3BCKA 3VK9A 1GLQA 4NHZA 2L4CA 4PUFC 3HJPA 1WIKA 1AIUA 3M1GA 3HJMA 4X43A 2IMIA 4IP6A 4IELA 22GSA 1AXDA 3W8SA 2OE0A 2YV7A 4Q5RA 3ZLPA 1KBNA 3S9FA 1GNEA 4RQRA 3F3QA 5G5FA 4JEDA 2GLRA 4F0BA 4I97A 1X9MB 1B9YC 5LCZA 2RUFA 3C1SA 1TK8B 4IJIA 4FYBA 2JZTA 4K0NA 1A2JA 3MDKA 1T00A 4XRAA 2CA8A 5IQYA 2HNLA 3WGEA 4OFMA 1JZWA 3FR3A 4XHMA 2EIRA 3KGKA 1T8EB 5IPHA 2B7JA 2MMOA 4MJAA 6GSSA 2K9FA 1OVNA 5B6MA 2LTKA 4J57E 4EDYA 1S3CA 2VAFA 2OBKA 5IPGA 5GSTA 3DRNA 2DJ3A 2NBSA 1SK2A 2B1KA 2XBIA 3M0FA 3TCOA 2X8CA 1R5AA 1JHBA 1VF2A 1TTZA 4MA9A 1SYXA 5JCUA 5HR0A 1Y6EA 3TRPA 2A4VA 2H76A 4WXTA 3UBLA 4TXVA 4KDXA 3D4MA 1XBSA 2REMA 4PXOA 4NWYA 1BX9A 5HFIA 4JBBA 4IP1A 4WF5A 3GV1A 2L5LA 4MF5A 5G5EA 4Q5QA 5G1LA 1PGTA 2XBQA 1XCCA 4ZB8A 1K3YA 3VLNA 1X9WB 4I5QA 4L5OA 1GSFA 4TR1A 2OADA 3Q74A 3O6TA 1GUMA 2JU5A 1ABAA 4PNGA 2Z9SA 2FCHA 2C0EA 2MMZA 1GSEA 5ECIB 5IIZA 4WETA 2VD1A 2VO4A 3P8WA 5D8IA 2H19A 5HFGA 1K0DA 3RHBA 3UAPA 2FLSA 3BD2A 1EGOA 2GSTA 2DMLA 1HNCA 2I81A 1VF4A 4ZILA 3US3A 3APOA 5KN0A 1MTCA 4FIWA 5DJLA 3GFKA 4XIHA 2GDRA 2H1BA 2FNOA 1YKAA 4PQ1A 3HA9A 5JWQB 3HD5A 4LMVA 5EL8A 3GH9A 2P0GA 1X9SB 1EP8A 3TOUA 4GQCA 3BJ5A 2H8LA 1QGVA 1ERTA 5DBQA 5H5RA 2CT6A 3F0IA 5F07A
chains in the Genus database with same CATH superfamily
1M9BA 3RHCA 1PMTA 1MEKA 4V2NA 4ACSA 2JZRA 5G1KA 2KOKA 1ZMAA 3JCML 4HU9A 4F82A 4HJMA 2WGRA 4YQMA 3ZIVA 5C00A 4MZBA 4TXOB 1H75A 2HI7A 1N8JA 2IMDA 2CVBA 2OA7A 3VURA 3IRAA 2VM2A 2DJ1A 3I6AA 3J7Yb 4ZL7A 3DGQA 3GNJA 1OE7A 2FA8A 3KTBA 2FD3A 2DIYA 4GQFA 3F4RA 3PGTA 3UVTA 2YZHA 4RQXA 5F06A 2JACA 1F2EA 1XWCA 2CQ9A 1OC8A 2X64A 2B7KA 4K7IA 2F51A 3HVVA 4PGTA 3TB2A 4XRDA 5DAKB 4MNNA 3ME8A 2LNSA 5ECQB 2ON7A 1GLPA 2HSMA 2LJAA 2B3SA 3R2QA 2AAWA 4WBRD 3LW9A 2ZUPA 3PR8A 2IMFA 3VWVA 3VI5A 2IPAA 1T4YA 4OCFA 1EWXA 3UVHA 4AF2A 2XPDA 2X49A 3FYGA 4KE3A 5ECSA 2GZPA 3LEFA 4K0GA 2RLIA 5A4WA 2FWGA 4PQHA 1ERVA 1BAYA 3D22A 1J0FA 4ML1A 5DQSA 4DSSA 1A2LA 2HXKA 1Z7RA 4D73A 2V6OA 3GX0A 4DSRA 4FYCA 5CP1A 5IMZA 3HVNA 2AYTA 1YQ1A 3GTUA 2J9HA 3D21A 4GWRA 4OD7A 3LWAA 2E0QA 4TR0A 2GSRA 4OFNA 6GSWA 5GZZB 1ACVA 1TKDB 2H73A 5KOXA 4WR4A 1NSWA 2LV3A 4HS1A 3BOAA 3FRCA 3O3TA 3DXBA 2C0GA 1WPIA 4FO5A 1U3IA 2GT6A 3E9JB 3EWLA 3IR4A 5C04A 3FHKA 4FH8A 2V6KA 4IHUA 3FK8A 2KP1A 1EGRA 5IMAA 1GUKA 4OWYA 4GLTA 1GNWA 3H1NA 2F8AA 1M7TA 1GTBA 1YKCA 5FT3A 5FWGA 1ZCPA 3ZRDA 3GHAA 2L6DA 1ZYPA 1T3BA 2YWMA 2LS5A 1V58A 4IBPA 2DJKA 1XZOA 4ECIA 1VGLA 2DIZA 3LXTA 4HJ2A 2NPBA 1U87A 4XCSA 3GL3A 3GSSA 2JZSA 2ON5A 4I8BA 4OMVA 1XFLA 2YZUA 5D9TA 5KEJA 3LQ7A 2LSTA 3BCIA 1ERWA 4IN0A 5ECPB 1BG5A 1GWCA 1PX6A 2L57A 3FR6A 4XS4A 2R0GA 4JE1A 2HSHA 3LYKA 2JL4A 5JCGA 9GSSA 1B48A 4HUAA 5ECMB 1TI1A 1V98A 2FGXA 5E59A 3CSHA 1SKWB 4L0WA 5DALA 1F3BA 1EV4A 4X1UA 3DWVA 3A2VA 4MMMA 2HFDA 1F9MA 1ZL9A 1HNAA 1OE8A 2GVPA 1XXUA 3GL5A 1M0UA 3VI7A 5DJMA 5J3RA 3VFIA 2QA1A 1AC1A 4O92A 4MF6A 1PL1A 2E2GA 4PURA 3TGZA 1SJIA 4IQAA 4KX4A 2FA4A 5ECHB 1TRUA 2WFCA 1A0RP 3ZVJD 5CRGA 4NV2A 2GZZA 1F3AA 2DJJA 3FZ9A 2FWHA 5DDLA 3LSZA 3WD6A 1OC3A 2D2ZA 2IFQB 4DEJA 2C4JA 4XS1A 1USBA 1EOHA 5JWOB 1M2AA 3GKNA 2KLXA 2C80A 2DKIA 5J9CA 2EIQA 2PPTA 1O85A 4BA7A 1OC9A 4EF0A 1C72A 2VCVA 3GKMA 2LNTA 4POKA 2CV4A 3P7XA 2E7PA 1O8XA 2MZCA 1M99A 2CAIA 3D5JA 2JSZA 4E8HA 1UC7A 2R37A 4G10A 5IMVA 4Z2UA 4IJ3A 3U6VA 2KP2A 2VL2A 1EEJA 3A3TA 5CNWA 4NMUA 4KSMA 1Z3EA 5B8BA 14GSA 4O5UA 3KMOA 1K0AA 1FO5A 3DKSA 4CHSA 1YF1A 5ECKB 1SD8A 5GSSA 1CQGA 6GSVA 3ZVJA 1A0FA 2QA2A 4G0KA 2VL3A 2XHFA 3HXSA 18GSA 2GT5A 1G6YA 1JZDA 2N5BA 3KMNA 3L9SA 1GTAA 2VM1A 3KP8A 1WMJA 6GSXA 4FQUA 5IO2A 1BEDA 4BVYA 4WF4A 1KNGA 4NPBA 2CVKA 5JCWA 2XC2A 4HEA2 2H70A 2HT9A 1GP1A 2A2PA 4YKFA 3PINA 2K8SA 2I1UA 2R5GA 2C8UA 2C1YA 1XG8A 3DEXA 2YP6A 1AUCA 2VLUA 2C0DA 1U3AA 4OO5A 1O8WA 3QAWA 1VRSD 2WDUA 4EE0A 3E3EA 4KF9A 5IOWA 20GSA 1NW2A 2H6XA 4ICYA 4CDOA 1F6MC 1I5GA 4ILFA 1X5EA 4MDCA 1QXHA 3TJJA 4MZWA 3EMPA 3CYNA 4K2DA 3TKQA 1R5PA 3IV4A 2HSYA 4BPYA 2V32A 3SBCA 5CREA 4TR3A 3C71A 2B5YA 3UJ1A 3RAZA 4YQUA 3QR6A 1ZYQB 1AQVA 1PKZA 4O5QA 1SL1B 1EOGA 1CQHA 1GTIA 5CRWA 2I4AA 3TUEA 3IDVA 2YWNA 3QOUA 2IMKA 1GUHA 2B6MA 1M2BA 4L8EA 3QPMA 1DE2A 2DSAA 4ECBA 6GSUA 3EYTA 4LMWA 2VIMA 4ML6A 2PMTA 3ZREA 1MDJA 1OAZA 3PPUA 3HZ8A 4NHWA 1GL8A 3CTGA 4RI6A 2VCTA 3IOSA 2C3QA 5DCGA 4IVFA 3F6DA 2B1LA 4CY8A 4NXIA 1YZXA 2YNXA 3LFLA 5AN1A 3F6FA 3VWXA 4RUVA 4K8MA 4LA1A 1FB6A 3W6GA 2YANA 2M72A 4K7OA 3HKRA 4MK3A 2YPMA 2LJKA 3A5IA 5DQYA 1NHOA 1GSYA 2HRKA 4YH2A 1FOVA 3MSZA 4USSA 5LD0A 4EDZA 4F2IA 1SU9A 1X0RA 1M9AA 5A4VA 3CRUA 3LORA 4X0XA 17GSA 2LRTA 5DCHA 4TXOA 5COHA 2A2RA 2TIRA 2G2QA 5GAPD 3C7MA 1NHYA 1XWKA 5F8BA 2F3MA 1K0MA 3ZZXA 5KN2A 2B5EA 4MZCA 4TR4A 2H66A 1ZZYA 4HI7A 4KCEA 1KEBA 3K8NA 1JZOA 2G0FA 1TRSA 1W89A 1MD3A 3KZQA 5ECNB 5HFKA 2L59A 2P5QA 1IYHA 1GSQA 2HE3A 5J5NA 4ZBBA 4ZB6A 2PERA 1R26A 2DMMA 3N5OA 2K6VA 1B8XA 3TKSE 3A2XA 4TVEA 4F9ZA 2CX3A 1JLWA 3MAKA 3V1WA 3DYRA 5AIXA 3KTLA 2VCWA 3APQA 3ZYWA 4ZB9A 1SD9A 4N0ZA 5ECLB 4G0LA 1DE1A 5IMDA 1M2DA 2GSQA 1YDKA 4IQ1A 1V57A 4ZIJA 2HZEA 2H01A 2GQLA 1GTUA 2H30A 5ELGA 3F63A 4ZXGA 3KH7A 1KTEA 1BQ7A 4HU7A 2OBIA 1YEXA 4KUNA 1EP7A 2QGVA 1YF0A 4PX1A 4EL1A 1UVZA 2TRXA 2X8HA 1QK8A 4WBJA 4DSQA 3LG6A 3F4TA 3TKPA 1SK0A 3EURA 1V2AA 1E6BA 1ON4A 3IAS2 4GF0A 1TP9A 5ID2A 2LRNA 2VL2C 3U5RE 10GSA 2OACA 3HDCA 2PVQA 1PN0A 3GX8A 4K5SA 3DVXA 1T1VA 2M46A 2PUKC 3L4NA 4BWSA 3FZ5A 4EUYA 2R3XA 2AB6A 3Q19A 3Q6OA 1A2MA 3GTUB 2H71A 2IJYA 2O8VB 2DBCA 1Y25A 1QUWA 3QAVA 4O5RA 5B7CA 2ES7A 3L78A 4HQZA 1TJDA 3CTFA 3ZITA 3ERFA 1TRVA 3LJRA 2GQMA 3CSJA 3F9UA 3IK9A 4BVXA 3VWUA 1URMA 1TOFA 4LL1B 1HQOA 3KP9A 3NZNA 5ABRA 3GKKA 4L0UA 4PTSA 5G30A 2YV9A 3QFAC 4V2MA 2DJ0A 4EVMA 1TI3A 2WB9A 4JRRA 3C8EA 1K0NA 1PQNA 2DLXA 4ISDA 4J56E 4LLRA 3M9JA 3ME7A 3AY8A 2TRCP 3RDWA 4I2TA 1GSUA 3VPQA 1Q4JA 3IHQA 4AJ7A 3I69A 1NM3A 3HZ4A 2BMXA 2R0CA 4HDEA 3L9UA 1Z6NA 1AQWA 2CZ3A 5AIVA 2HRAA 3M3MA 2OJLA 1UA5A 3F4SA 1DUGA 5IM9A 1RW1A 4NAXA 3IE3A 1X5DA 2WULA 3HJOA 4KCAA 2GSSA 1ZYNA 4TW5A 3ZL5A 2H0IA 1K0BA 1T4ZA 5J41A 4GTUA 1ILOA 5DALB 2HLSA 2L5OA 3GURA 1SKRB 1IYIA 1PSQA 1J9BA 1EEMA 1GRXA 1JZRA 3M8NA 1TW9A 5BMUA 4MCUA 4OCEA 4L5LA 4MLYA 4K2XA 4KA0A 1E2YA 3G9BA 2PN8A 2KUCA 3HVSA 1XW6A 2VCQA 5HR1A 2YWIA 1XPVA 4AGSA 2K8VA 3TJGA 2N5AA 1EV9A 4BWQA 2AV4A 3IBHA 2GGTA 3F8UA 3D6IA 1K3LA 2RM6A 2LKUA 1HYUA 1W4VA 6GSYA 4EO3A 1I9DA 1PN9A 3HY2A 3WGDA 4V1Ap 2V2GA 4MPGA 4YAPA 3MIXA 2N5FA 3I9V2 1XIYA 2IL3A 2MBTA 1OKDA 1BYEA 1LU4A 1SJZA 1XW5A 3VWWA 2B5XA 3ISOA 3CQFA 3H79A 3GRXA 1A23A 1VF1A 5LNKe 2R6KA 4BL7B 5F0GA 2CZ2A 1RQMA 4HOJA 2AJQB 1PL2A 1THOA 1T7PB 4KSOA 2JADA 4ECCA 4GSSA 5ECRB 3PH9A 3KEBA 3HCZA 4ZL9A 2PU9C 5CRHA 4Z7XA 4K9ZA 1A8LA 4N10A 1TRWA 2LUSA 4RI7A 1LJRA 2BTOT 2IWTA 1XWBA 2AUVA 1WRYA 4J2FA 1QFNA 1WOUA 2DKHA 2C3NA 2HYXA 5ENUA 2C0FA 3SWLA 2ZCTA 4HZ4A 4CW9A 1X5CA 4MABA 2WCIA 4POLA 1SYRA 1AW9A 3QFBC 1RK4A 2H1DA 5ELAA 2YCDA 1K3OA 2GTUA 3FZAA 3TKSA 5KN1A 1M3JA 5F05A 1V9WA 1TDIA 2L4QA 3ZTLA 3MNGA 1LBKA 4BVYB 1ZYEA 3GN3A 4DVCA 2LEGA 3ED3A 19GSA 3KJYA 4ZL8A 1R7HA 1ZGNA 4TRXA 1H4OA 1PFOA 3FKFA 4V1Ag 5L71A 4WKWA 4KNDA 1O73A 2FHEA 2GZYA 3WT2A 3ZFLA 2H1AA 2P5RA 3I43A 3OR5A 3GUSA 1MDIA 3TJKA 2VCZA 1YJ6A 3LXZA 1G7OA 2IMEA 16GSA 4I2UA 3TKRA 3EU3A 4H86A 4ZBDA 2VL9A 4QQ7A 2X4AA 2K18A 1XW9A 3IAM2 1SL0B 3O76A 2NVLA 1G6WA 3UOMA 3G7JA 3FEUA 5AISA 5H5SA 4GSNA 1B9XC 5ECOB 1GULA 2MMNA 4K5RA 1TK5B 4MP4A 2O85A 3IC8A 2DC5A 2JSYA 2H1GA 1A24A 4JU5A 4GXZA 4TN8A 4N30A 4Z2TA 3G7YA 5DVBA 2J23A 1EZKA 4GSTA 3HYPA 5AGYA 3BBYA 2P31A 2FUG2 5H5QA 2OE3A 5HR2A 3W8JA 1N2AA 1Z5YE 4G9HA 2NTOA 3DVWA 8GSSA 2YN1A 4KDYA 2YJ7A 4EIQA 3D4TA 1GSSA 2YJHA 2BJXA 4Q5NA 1PA3A 12GSA 4YQVA 3EMXA 5G2ZA 1M3IA 4TR1B 1F37A 4POMA 4G19A 1SL2B 4KGIA 4KAEA 4IW9A 3QMXA 2FWFA 3ZMLA 1Q98A 2IIYA 2O87A 4IKHA 5J4UA 1FW1A 2H0GA 2RM5A 1TXXA 3IK7A 1U6TA 1XWGA 1PKWA 2CVDA 3VPTA 5A4UA 1WP0A 4TKYA 3MWHA 1WE0A 4LL4B 2VCXA 2QKEA 1G0TA 2WRTA 4OFTA 3RBTA 3ERWA 2KHPA 5D9WA 1BJXA 2GQKA 4JR6A 2MBSA 1FG4A 1O81A 2MYGA 3EU4A 1GH2A 5D96A 2NDOA 3KIJA 5DAKA 5E4WA 2HRFA 2H75A 2YWOA 3ZFBA 4KH7A 1SK1A 2R4VA 2RIIA 1SENA 1Z6MA 1R4WA 1WJKA 2V1MA 3FR9A 4YAVA 5IO0A 3EC3A 5B8AA 3TRQA 3NIVA 1K0OA 2OKAA 2PBJA 2HRNA 3C1RA 2I9HA 1XOBA 4ULXA 1AAZA 1QQ2A 5D73A 3RPNA 3UL3A 5CO3A 3ZMKA 2L6CA 3N9JA 1S3RA 3QDNA 1J08A 4Q5FA 3FY7A 3TDGA 2LQQA 5EY6A 1UN2A 6GSTA 5EPFA 4K6XA 3H93A 3HVXA 4POBA 4EXJA 4AJ8A 5D93A 4I6XA 3A2WA 2CX4A 1DSBA 1AQXA 3DMLA 4ECJA 2ZNMA 3KM6A 1HD2A 5A5KA 1O7UA 2E2MA 4A5PA 2WS2A 5G31A 4CY6A 3H8QA 3APSA 3UBKA 3LYPA 1FB0A 1DBYA 1OKTA 5B6NA 2R2JA 4TOPA 3IXRA 1B4QA 4GCIA 3J7Yk 4E8EA 2FY6A 3GYKA 1HNBA 4HZ2A 4EKZA 3TOTA 3IPZA 1MD4A 5CYYA 2PVOC 1A8YA 2O7KA 1S3DA 2YOIA 3GH6A 2HZEB 2VOCA 1XWAA 1SKSB 1S3AA 1YEPA 4XTSA 4IGJA 4PQIA 1XVWA 5EVOA 3QCPA 2EC4A 3C73A 5CRDA 3DD3A 2M80A 5INYA 1GSDA 4DSSB 2F9SA 4D73B 5HQPA 1TU7A 1SJ6A 4O32A 3ZIJA 3Q18A 3UEMA 3H4KA 1TK0B 3F3RA 4PUAA 3EINA 3WGXA 1XVQA 3FW2A 2VD0A 1FVJA 4MH2A 5ID2B 3L9VA 3WT1A 4WEYA 3CRTA 5HR3A 4KW6A 1JLVA 3RPPA 2VUPA 7GSSA 1WWJA 4FYUA 4N11A 4YKGA 4KB3A 4ZBAA 1V40A 1PX7A 2PGTA 4P3YB 3IA1A 5CAXA 3GMFA 2LQOA 4O7HA 3P2AA 3IC4A 2MMAA 4F03A 4K1FA 1PRXA 4MPFA 3UMAA 3KCMA 2F8FA 4G2EA 2C3TA 3NOFA 4KDUA 4JZQA 5BRTA 2QSIA 5IOXA 3FZ4A 2I3YA 1ERUA 3KD0A 3R3EA 3EE2A 4BVXB 1FAAA 3G7IA 4F0CA 3L0HA 3LGCA 3TKSC 4MJBA 3UIWA 4OO4A 1G7EA 3D0ZA 2XPEA 1YY7A 4G0IA 2IFQA 5GAND 4GRFA 3DIEA 3QD9A 1VF3A 1MDKA 1QMVA 4HQSA 4MJEA 2UZ8A 2V41A 4XS4B 3HHVA 3ERGA 1FVKA 3GIXA 3A5WA 1PD21 3P90A 4MJCA 1TU8A 1JFUA 3TJBA 5JWRB 4AJ6A 3GKXA 3E0UA 3CMIA 1FOHA 1O6JA 2FWEA 3CXGA 2AHEA 1B4PA 2H0HA 2H6YA 4EIPA 3QAGA 3KXOA 2PWJA 5D9XA 3KH9A 2DJ2A 4HSCX 1THXA 2O89A 2WJUA 2IN3A 13GSA 4NV5A 5IMFA 2VLVA 4BIKA 3MYDA 4PNFA 1OYJA 4BL7A 1Z9HA 3M9KA 4EC0A 3GSTA 2X8GA 4WR5A 4QL7A 3TJFA 2H72A 3UARA 3EVIA 4X4JA 1Z7PA 4MF7A 2H6ZA 1ML6A 2OE1A 4IS0A 1OC9B 4ID0A 3GA4A 2GS3A 3CBUA 2LRCA 4N0VA 1ZOFA 3WYWA 1K0CA 1ST9A 2QC7A 5J9BA 11GSA 4K7NA 5FHIA 2HZFA 2WZ9A 2VLTA 2X99A 4JR4A 5IMCA 4QL9A 1FHEA 3TRXA 5KN3A 2H74A 2ALBA 4XS6A 4MH3A 1XOAA 5D9VA 2LJRA 2RUEA 2EIOA 1U88A 2A2SA 4V2LA 3CSIA 2CAQA 3BCKA 3VK9A 1GLQA 4NHZA 2L4CA 4PUFC 3HJPA 1WIKA 1AIUA 3M1GA 3HJMA 4X43A 2IMIA 4IP6A 4IELA 22GSA 1AXDA 3W8SA 2OE0A 2YV7A 4Q5RA 3ZLPA 5KOWA 1KBNA 3S9FA 1GNEA 4RQRA 3F3QA 5G5FA 4JEDA 2GLRA 4F0BA 4I97A 1X9MB 1B9YC 5LCZA 2RUFA 3C1SA 1TK8B 4IJIA 4FYBA 2JZTA 4K0NA 1A2JA 3MDKA 1T00A 4XRAA 2CA8A 5IQYA 2HNLA 3WGEA 4OFMA 1JZWA 3FR3A 4XHMA 2EIRA 3KGKA 1T8EB 5IPHA 2B7JA 2MMOA 4MJAA 2R0PA 6GSSA 2K9FA 1OVNA 3FMWA 5B6MA 2LTKA 4J57E 4EDYA 1S3CA 2VAFA 3EPTA 2OBKA 5IPGA 5GSTA 3DRNA 2DJ3A 2NBSA 1SK2A 2B1KA 2XBIA 3M0FA 3TCOA 2X8CA 1R5AA 1JHBA 1VF2A 1TTZA 4MA9A 1SYXA 5JCUA 2A4HA 5HR0A 1Y6EA 3TRPA 2A4VA 2H76A 4WXTA 3UBLA 4TXVA 4KDXA 3D4MA 1XBSA 2REMA 4PXOA 4NWYA 1BX9A 5HFIA 4JBBA 4IP1A 4WF5A 3GV1A 2L5LA 4MF5A 5G5EA 4Q5QA 5G1LA 1PGTA 2XBQA 4Z2RA 1XCCA 4ZB8A 1K3YA 3VLNA 1X9WB 4I5QA 4L5OA 1GSFA 4TR1A 2OADA 3Q74A 3O6TA 1GUMA 2JU5A 1ABAA 4PNGA 2Z9SA 2FCHA 2C0EA 2MMZA 1GSEA 5ECIB 5IIZA 4WETA 2VD1A 2VO4A 3P8WA 5D8IA 2H19A 5HFGA 1K0DA 3RHBA 3UAPA 2FLSA 3BD2A 1EGOA 3IHGA 2GSTA 2DMLA 1HNCA 2I81A 1VF4A 4ZILA 3US3A 3APOA 5KN0A 1MTCA 4FIWA 5DJLA 3GFKA 4XIHA 2GDRA 2H1BA 2FNOA 1YKAA 4PQ1A 3HA9A 5JWQB 3HD5A 4LMVA 5EL8A 3GH9A 2P0GA 1X9SB 1EP8A 3TOUA 4GQCA 3BJ5A 2H8LA 1QGVA 1ERTA 5DBQA 5H5RA 2CT6A 3F0IA 5F07A
chains in the Genus database with same CATH topology
1M9BA 3RHCA 1PMTA 1MEKA 4V2NA 4ACSA 2JZRA 5G1KA 2KOKA 1ZMAA 3JCML 4HU9A 4F82A 4HJMA 2WGRA 4YQMA 3ZIVA 5C00A 4MZBA 4TXOB 1H75A 2HI7A 1N8JA 2IMDA 2CVBA 2OA7A 3VURA 3IRAA 2VM2A 2DJ1A 3I6AA 3J7Yb 4ZL7A 3DGQA 3GNJA 1OE7A 2FA8A 3KTBA 2FD3A 2DIYA 4GQFA 3F4RA 3PGTA 3UVTA 2YZHA 4RQXA 5F06A 2JACA 1F2EA 1XWCA 2CQ9A 1OC8A 2X64A 2B7KA 4K7IA 2F51A 3HVVA 4PGTA 3TB2A 4XRDA 5DAKB 4MNNA 3ME8A 2LNSA 5ECQB 2ON7A 1GLPA 2HSMA 2LJAA 2B3SA 3R2QA 2AAWA 4WBRD 3LW9A 2ZUPA 3PR8A 2IMFA 3VWVA 3VI5A 2IPAA 1T4YA 4OCFA 1EWXA 3UVHA 4AF2A 2XPDA 2X49A 3FYGA 4KE3A 5ECSA 2GZPA 3LEFA 4K0GA 2RLIA 5A4WA 2FWGA 4PQHA 1ERVA 1BAYA 3D22A 1J0FA 4ML1A 5DQSA 4DSSA 1A2LA 2HXKA 1Z7RA 4D73A 2V6OA 3GX0A 4DSRA 4FYCA 5CP1A 5IMZA 2AYTA 1YQ1A 3GTUA 2J9HA 3D21A 4GWRA 4OD7A 3LWAA 2E0QA 4TR0A 2GSRA 4OFNA 6GSWA 5GZZB 1ACVA 1TKDB 2H73A 5KOXA 4WR4A 1NSWA 2LV3A 4HS1A 3BOAA 3FRCA 3O3TA 3DXBA 2C0GA 1WPIA 4FO5A 1U3IA 2GT6A 3E9JB 3EWLA 3IR4A 5C04A 3FHKA 4FH8A 2V6KA 4IHUA 3FK8A 2KP1A 1EGRA 5IMAA 1GUKA 4OWYA 4GLTA 1GNWA 3H1NA 2F8AA 1M7TA 1GTBA 1YKCA 5FT3A 5FWGA 1ZCPA 3ZRDA 3GHAA 2L6DA 1ZYPA 1T3BA 2YWMA 2LS5A 1V58A 4IBPA 2DJKA 1XZOA 4ECIA 1VGLA 2DIZA 3LXTA 4HJ2A 2NPBA 1U87A 4XCSA 3GL3A 3GSSA 2JZSA 2ON5A 4I8BA 4OMVA 1XFLA 2YZUA 5D9TA 5KEJA 3LQ7A 2LSTA 3BCIA 1ERWA 4IN0A 5ECPB 1BG5A 1GWCA 1PX6A 2L57A 3FR6A 4XS4A 2R0GA 4JE1A 2HSHA 3LYKA 2JL4A 5JCGA 9GSSA 1B48A 4HUAA 5ECMB 1TI1A 1V98A 2FGXA 5E59A 3CSHA 1SKWB 4L0WA 5DALA 1F3BA 1EV4A 4X1UA 3DWVA 3A2VA 4MMMA 2HFDA 1F9MA 1ZL9A 1HNAA 1OE8A 2GVPA 1XXUA 3GL5A 1M0UA 3VI7A 5DJMA 5J3RA 3VFIA 2QA1A 1AC1A 4O92A 4MF6A 1PL1A 2E2GA 4PURA 3TGZA 1SJIA 4IQAA 4KX4A 2FA4A 5ECHB 1TRUA 2WFCA 1A0RP 3ZVJD 5CRGA 4NV2A 2GZZA 1F3AA 2DJJA 3FZ9A 2FWHA 5DDLA 3LSZA 3WD6A 1OC3A 2D2ZA 2IFQB 4DEJA 2C4JA 4XS1A 1USBA 1EOHA 5JWOB 1M2AA 3GKNA 2KLXA 2C80A 2DKIA 5J9CA 2EIQA 2PPTA 1O85A 4BA7A 1OC9A 4EF0A 1C72A 2VCVA 3GKMA 2LNTA 4POKA 2CV4A 3P7XA 2E7PA 1O8XA 2MZCA 1M99A 2CAIA 3D5JA 2JSZA 4E8HA 1UC7A 2R37A 4G10A 5IMVA 4Z2UA 4IJ3A 3U6VA 2KP2A 2VL2A 1EEJA 3A3TA 5CNWA 4NMUA 4KSMA 1Z3EA 5B8BA 14GSA 4O5UA 3KMOA 1K0AA 1FO5A 3DKSA 4CHSA 1YF1A 5ECKB 1SD8A 5GSSA 1CQGA 6GSVA 3ZVJA 1A0FA 2QA2A 4G0KA 2VL3A 2XHFA 3HXSA 18GSA 2GT5A 1G6YA 1JZDA 2N5BA 3KMNA 3L9SA 1GTAA 2VM1A 3KP8A 1WMJA 6GSXA 4FQUA 5IO2A 1BEDA 4BVYA 4WF4A 1KNGA 4NPBA 2CVKA 5JCWA 2XC2A 4HEA2 2H70A 2HT9A 1GP1A 2A2PA 4YKFA 3PINA 2K8SA 2I1UA 2R5GA 2C8UA 2C1YA 3DEXA 2YP6A 1AUCA 2VLUA 2C0DA 1U3AA 4OO5A 1O8WA 3QAWA 1VRSD 2WDUA 4EE0A 3E3EA 4KF9A 5IOWA 20GSA 1NW2A 2H6XA 4ICYA 4CDOA 1F6MC 1I5GA 4ILFA 1X5EA 4MDCA 1QXHA 3TJJA 4MZWA 3EMPA 3CYNA 4K2DA 3TKQA 1R5PA 3IV4A 2HSYA 4BPYA 2V32A 3SBCA 5CREA 4TR3A 3C71A 2B5YA 3UJ1A 3RAZA 4YQUA 3QR6A 1ZYQB 1AQVA 1PKZA 4O5QA 1SL1B 1EOGA 1CQHA 1GTIA 5CRWA 2I4AA 3TUEA 3IDVA 2YWNA 3QOUA 2IMKA 1GUHA 2B6MA 1M2BA 4L8EA 3QPMA 1DE2A 2DSAA 4ECBA 6GSUA 3EYTA 4LMWA 2VIMA 4ML6A 2PMTA 3ZREA 1MDJA 1OAZA 3PPUA 3HZ8A 4NHWA 1GL8A 3CTGA 4RI6A 2VCTA 3IOSA 2C3QA 5DCGA 4IVFA 3F6DA 2B1LA 4CY8A 4NXIA 1YZXA 2YNXA 3LFLA 5AN1A 3F6FA 3VWXA 4RUVA 4K8MA 4LA1A 1FB6A 3W6GA 2YANA 2M72A 4K7OA 3HKRA 4MK3A 2YPMA 2LJKA 3A5IA 5DQYA 1NHOA 1GSYA 2HRKA 4YH2A 1FOVA 3MSZA 4USSA 5LD0A 4EDZA 4F2IA 1SU9A 1X0RA 1M9AA 5A4VA 3CRUA 3LORA 4X0XA 17GSA 2LRTA 5DCHA 4TXOA 5COHA 2A2RA 2TIRA 2G2QA 5GAPD 3C7MA 1NHYA 1XWKA 5F8BA 2F3MA 1K0MA 3ZZXA 5KN2A 2B5EA 4MZCA 4TR4A 2H66A 1ZZYA 4HI7A 4KCEA 1KEBA 3K8NA 1JZOA 2G0FA 1TRSA 1W89A 1MD3A 3KZQA 5ECNB 5HFKA 2L59A 2P5QA 1IYHA 1GSQA 2HE3A 5J5NA 4ZBBA 4ZB6A 2PERA 1R26A 2DMMA 3N5OA 2K6VA 1B8XA 3TKSE 3A2XA 4TVEA 4F9ZA 2CX3A 1JLWA 3MAKA 3V1WA 3DYRA 5AIXA 3KTLA 2VCWA 3APQA 3ZYWA 4ZB9A 1SD9A 4N0ZA 5ECLB 4G0LA 1DE1A 5IMDA 1M2DA 2GSQA 1YDKA 4IQ1A 1V57A 4ZIJA 2HZEA 2H01A 2GQLA 1GTUA 2H30A 5ELGA 3F63A 4ZXGA 3KH7A 1KTEA 1BQ7A 4HU7A 2OBIA 1YEXA 4KUNA 1EP7A 2QGVA 1YF0A 4PX1A 4EL1A 1UVZA 2TRXA 2X8HA 1QK8A 4WBJA 4DSQA 3LG6A 3F4TA 3TKPA 1SK0A 3EURA 1V2AA 1E6BA 1ON4A 3IAS2 4GF0A 1TP9A 5ID2A 2LRNA 2VL2C 3U5RE 10GSA 2OACA 3HDCA 2PVQA 1PN0A 3GX8A 4K5SA 3DVXA 1T1VA 2M46A 2PUKC 3L4NA 4BWSA 3FZ5A 4EUYA 2R3XA 2AB6A 3Q19A 3Q6OA 1A2MA 3GTUB 2H71A 2IJYA 2O8VB 2DBCA 1Y25A 1QUWA 3QAVA 4O5RA 5B7CA 2ES7A 3L78A 4HQZA 1TJDA 3CTFA 3ZITA 3ERFA 1TRVA 3LJRA 2GQMA 3CSJA 3F9UA 3IK9A 4BVXA 3VWUA 1URMA 1TOFA 4LL1B 1HQOA 3KP9A 3NZNA 5ABRA 3GKKA 4L0UA 4PTSA 5G30A 2YV9A 3QFAC 4V2MA 2DJ0A 4EVMA 1TI3A 2WB9A 4JRRA 3C8EA 1K0NA 1PQNA 2DLXA 4ISDA 4J56E 4LLRA 3M9JA 3ME7A 3AY8A 2TRCP 3RDWA 4I2TA 1GSUA 3VPQA 1Q4JA 3IHQA 4AJ7A 3I69A 1NM3A 3HZ4A 2BMXA 2R0CA 4HDEA 3L9UA 1Z6NA 1AQWA 2CZ3A 5AIVA 2HRAA 3M3MA 2OJLA 1UA5A 3F4SA 1DUGA 5IM9A 1RW1A 4NAXA 3IE3A 1X5DA 2WULA 3HJOA 4KCAA 2GSSA 1ZYNA 4TW5A 3ZL5A 2H0IA 1K0BA 1T4ZA 5J41A 4GTUA 1ILOA 5DALB 2HLSA 2L5OA 3GURA 1SKRB 1IYIA 1PSQA 1J9BA 1EEMA 1GRXA 1JZRA 3M8NA 1TW9A 5BMUA 4MCUA 4OCEA 4L5LA 4MLYA 4K2XA 4KA0A 1E2YA 3G9BA 2PN8A 2KUCA 3HVSA 1XW6A 2VCQA 5HR1A 2YWIA 1XPVA 4AGSA 2K8VA 3TJGA 2N5AA 1EV9A 4BWQA 2AV4A 3IBHA 2GGTA 3F8UA 3D6IA 1K3LA 2RM6A 2LKUA 1HYUA 1W4VA 6GSYA 4EO3A 1I9DA 1PN9A 3HY2A 3WGDA 4V1Ap 2V2GA 4MPGA 4YAPA 3MIXA 2N5FA 3I9V2 1XIYA 2IL3A 2MBTA 1OKDA 1BYEA 1LU4A 1SJZA 1XW5A 3VWWA 2B5XA 3ISOA 3H79A 3GRXA 1A23A 1VF1A 5LNKe 2R6KA 4BL7B 5F0GA 2CZ2A 1RQMA 4HOJA 2AJQB 1PL2A 1THOA 1T7PB 4KSOA 2JADA 4ECCA 4GSSA 5ECRB 3PH9A 3KEBA 3HCZA 4ZL9A 2PU9C 5CRHA 4Z7XA 4K9ZA 1A8LA 4N10A 1TRWA 2LUSA 4RI7A 1LJRA 2BTOT 2IWTA 1XWBA 2AUVA 1WRYA 4J2FA 1QFNA 1WOUA 2DKHA 2C3NA 2HYXA 5ENUA 2C0FA 3SWLA 2ZCTA 4HZ4A 4CW9A 1X5CA 4MABA 2WCIA 4POLA 1SYRA 1AW9A 3QFBC 1RK4A 2H1DA 5ELAA 2YCDA 1K3OA 2GTUA 3FZAA 3TKSA 5KN1A 5F05A 1V9WA 1TDIA 2L4QA 3ZTLA 3MNGA 1LBKA 4BVYB 1ZYEA 3GN3A 4DVCA 2LEGA 3ED3A 19GSA 3KJYA 4ZL8A 1R7HA 1ZGNA 4TRXA 1H4OA 3FKFA 4V1Ag 5L71A 4WKWA 4KNDA 1O73A 2FHEA 2GZYA 3WT2A 3ZFLA 2H1AA 2P5RA 3I43A 3OR5A 3GUSA 1MDIA 3TJKA 2VCZA 1YJ6A 3LXZA 1G7OA 2IMEA 16GSA 4I2UA 3TKRA 3EU3A 4H86A 4ZBDA 2VL9A 4QQ7A 2X4AA 2K18A 1XW9A 3IAM2 1SL0B 3O76A 2NVLA 1G6WA 3UOMA 3G7JA 3FEUA 5AISA 5H5SA 4GSNA 1B9XC 5ECOB 1GULA 2MMNA 4K5RA 1TK5B 4MP4A 2O85A 3IC8A 2DC5A 2JSYA 2H1GA 1A24A 4JU5A 4GXZA 4TN8A 4N30A 4Z2TA 3G7YA 5DVBA 2J23A 1EZKA 4GSTA 3HYPA 5AGYA 3BBYA 2P31A 2FUG2 5H5QA 2OE3A 5HR2A 3W8JA 1N2AA 1Z5YE 4G9HA 2NTOA 3DVWA 8GSSA 2YN1A 4KDYA 2YJ7A 4EIQA 3D4TA 1GSSA 2YJHA 2BJXA 4Q5NA 1PA3A 12GSA 4YQVA 3EMXA 5G2ZA 4TR1B 1F37A 4POMA 4G19A 1SL2B 4KGIA 4KAEA 4IW9A 3QMXA 2FWFA 3ZMLA 1Q98A 2IIYA 2O87A 4IKHA 5J4UA 1FW1A 2H0GA 2RM5A 1TXXA 3IK7A 1U6TA 1XWGA 1PKWA 2CVDA 3VPTA 5A4UA 1WP0A 4TKYA 3MWHA 1WE0A 4LL4B 2VCXA 2QKEA 1G0TA 2WRTA 4OFTA 3RBTA 3ERWA 2KHPA 5D9WA 1BJXA 2GQKA 4JR6A 2MBSA 1FG4A 1O81A 2MYGA 3EU4A 1GH2A 5D96A 2NDOA 3KIJA 5DAKA 5E4WA 2HRFA 2H75A 2YWOA 3ZFBA 4KH7A 1SK1A 2R4VA 2RIIA 1SENA 1Z6MA 1R4WA 1WJKA 2V1MA 3FR9A 4YAVA 5IO0A 3EC3A 5B8AA 3TRQA 3NIVA 1K0OA 2OKAA 2PBJA 2HRNA 3C1RA 2I9HA 1XOBA 4ULXA 1AAZA 1QQ2A 5D73A 3RPNA 3UL3A 5CO3A 3ZMKA 2L6CA 3N9JA 3QDNA 1J08A 4Q5FA 3FY7A 3TDGA 2LQQA 5EY6A 1UN2A 6GSTA 5EPFA 4K6XA 3H93A 3HVXA 4POBA 4EXJA 4AJ8A 5D93A 4I6XA 3A2WA 2CX4A 1DSBA 1AQXA 3DMLA 4ECJA 2ZNMA 3KM6A 1HD2A 5A5KA 1O7UA 2E2MA 4A5PA 2WS2A 5G31A 4CY6A 3H8QA 3APSA 3UBKA 3LYPA 1FB0A 1DBYA 1OKTA 5B6NA 2R2JA 4TOPA 3IXRA 1B4QA 4GCIA 3J7Yk 4E8EA 2FY6A 3GYKA 1HNBA 4HZ2A 4EKZA 3TOTA 3IPZA 1MD4A 5CYYA 2PVOC 1A8YA 2O7KA 1S3DA 2YOIA 3GH6A 2HZEB 2VOCA 1XWAA 1SKSB 1S3AA 1YEPA 4XTSA 4IGJA 4PQIA 1XVWA 5EVOA 3QCPA 2EC4A 3C73A 5CRDA 3DD3A 2M80A 5INYA 1GSDA 4DSSB 2F9SA 4D73B 5HQPA 1TU7A 1SJ6A 4O32A 3ZIJA 3Q18A 3UEMA 3H4KA 1TK0B 3F3RA 4PUAA 3EINA 3WGXA 1XVQA 3FW2A 2VD0A 1FVJA 4MH2A 5ID2B 3L9VA 3WT1A 4WEYA 3CRTA 5HR3A 4KW6A 1JLVA 3RPPA 2VUPA 7GSSA 1WWJA 4FYUA 4N11A 4YKGA 4KB3A 4ZBAA 1V40A 1PX7A 2PGTA 4P3YB 3IA1A 5CAXA 3GMFA 2LQOA 4O7HA 3P2AA 3IC4A 2MMAA 4F03A 4K1FA 1PRXA 4MPFA 3UMAA 3KCMA 2F8FA 4G2EA 2C3TA 3NOFA 4KDUA 4JZQA 5BRTA 2QSIA 5IOXA 3FZ4A 2I3YA 1ERUA 3KD0A 3R3EA 3EE2A 4BVXB 1FAAA 3G7IA 4F0CA 3L0HA 3LGCA 3TKSC 4MJBA 3UIWA 4OO4A 1G7EA 3D0ZA 2XPEA 1YY7A 4G0IA 2IFQA 5GAND 4GRFA 3DIEA 3QD9A 1VF3A 1MDKA 1QMVA 4HQSA 4MJEA 2UZ8A 2V41A 4XS4B 3HHVA 3ERGA 1FVKA 3GIXA 3A5WA 1PD21 3P90A 4MJCA 1TU8A 1JFUA 3TJBA 5JWRB 4AJ6A 3GKXA 3E0UA 3CMIA 1FOHA 1O6JA 2FWEA 3CXGA 2AHEA 1B4PA 2H0HA 2H6YA 4EIPA 3QAGA 3KXOA 2PWJA 5D9XA 3KH9A 2DJ2A 1THXA 2O89A 2WJUA 2IN3A 13GSA 4NV5A 5IMFA 2VLVA 3MYDA 4PNFA 1OYJA 4BL7A 1Z9HA 3M9KA 4EC0A 3GSTA 2X8GA 4WR5A 4QL7A 3TJFA 2H72A 3UARA 3EVIA 4X4JA 1Z7PA 4MF7A 2H6ZA 1ML6A 2OE1A 4IS0A 1OC9B 4ID0A 3GA4A 2GS3A 3CBUA 2LRCA 4N0VA 1ZOFA 3WYWA 1K0CA 1ST9A 2QC7A 5J9BA 11GSA 4K7NA 5FHIA 2HZFA 2WZ9A 2VLTA 2X99A 4JR4A 5IMCA 4QL9A 1FHEA 3TRXA 5KN3A 2H74A 2ALBA 4XS6A 4MH3A 1XOAA 5D9VA 2LJRA 2RUEA 2EIOA 1U88A 2A2SA 4V2LA 3CSIA 2CAQA 3BCKA 3VK9A 1GLQA 4NHZA 2L4CA 4PUFC 3HJPA 1WIKA 1AIUA 3M1GA 3HJMA 4X43A 2IMIA 4IP6A 4IELA 22GSA 1AXDA 3W8SA 2OE0A 2YV7A 4Q5RA 3ZLPA 5KOWA 1KBNA 3S9FA 1GNEA 4RQRA 3F3QA 5G5FA 4JEDA 2GLRA 4F0BA 4I97A 1X9MB 1B9YC 5LCZA 2RUFA 3C1SA 1TK8B 4IJIA 4FYBA 2JZTA 4K0NA 1A2JA 3MDKA 1T00A 4XRAA 2CA8A 5IQYA 2HNLA 3WGEA 4OFMA 1JZWA 3FR3A 4XHMA 2EIRA 3KGKA 1T8EB 5IPHA 2B7JA 2MMOA 4MJAA 2R0PA 6GSSA 2K9FA 1OVNA 3FMWA 5B6MA 2LTKA 4J57E 4EDYA 1S3CA 2VAFA 3EPTA 2OBKA 5IPGA 5GSTA 3DRNA 2DJ3A 2NBSA 1SK2A 2B1KA 2XBIA 3M0FA 3TCOA 2X8CA 1R5AA 1JHBA 1VF2A 1TTZA 4MA9A 1SYXA 5JCUA 2A4HA 5HR0A 1Y6EA 3TRPA 2A4VA 2H76A 4WXTA 3UBLA 4TXVA 4KDXA 3D4MA 1XBSA 2REMA 4PXOA 4NWYA 1BX9A 5HFIA 4JBBA 4IP1A 4WF5A 3GV1A 2L5LA 4MF5A 5G5EA 4Q5QA 5G1LA 1PGTA 2XBQA 4Z2RA 1XCCA 4ZB8A 1K3YA 3VLNA 1X9WB 4I5QA 4L5OA 1GSFA 4TR1A 2OADA 3Q74A 3O6TA 1GUMA 2JU5A 1ABAA 4PNGA 2Z9SA 2FCHA 2C0EA 2MMZA 1GSEA 5ECIB 5IIZA 4WETA 2VD1A 2VO4A 3P8WA 5D8IA 2H19A 5HFGA 1K0DA 3RHBA 3UAPA 2FLSA 3BD2A 1EGOA 3IHGA 2GSTA 2DMLA 1HNCA 2I81A 1VF4A 4ZILA 3US3A 3APOA 5KN0A 1MTCA 4FIWA 5DJLA 3GFKA 4XIHA 2GDRA 2H1BA 2FNOA 1YKAA 4PQ1A 3HA9A 5JWQB 3HD5A 4LMVA 5EL8A 3GH9A 2P0GA 1X9SB 1EP8A 3TOUA 4GQCA 3BJ5A 2H8LA 1QGVA 1ERTA 5DBQA 5H5RA 2CT6A 3F0IA 5F07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9B A;  3RHC A;  1PMT A;  1MEK A;  4V2N A;  4ACS A;  2JZR A;  5G1K A;  2KOK A;  1ZMA A;  3JCM L;  4HU9 A;  4F82 A;  4HJM A;  2WGR A;  4YQM A;  3ZIV A;  5C00 A;  4MZB A;  4TXO B;  1H75 A;  2HI7 A;  1N8J A;  2IMD A;  2CVB A;  2OA7 A;  3VUR A;  3IRA A;  2VM2 A;  2DJ1 A;  3I6A A;  3J7Y b;  4ZL7 A;  3DGQ A;  3GNJ A;  1OE7 A;  2FA8 A;  3KTB A;  2FD3 A;  2DIY A;  4GQF A;  3F4R A;  3PGT A;  3UVT A;  2YZH A;  4RQX A;  5F06 A;  2JAC A;  1F2E A;  1XWC A;  2CQ9 A;  1OC8 A;  2X64 A;  2B7K A;  4K7I A;  2F51 A;  3HVV A;  4PGT A;  3TB2 A;  4XRD A;  5DAK B;  3ME8 A;  2LNS A;  5ECQ B;  2ON7 A;  1GLP A;  2LJA A;  2B3S A;  3R2Q A;  2AAW A;  4WBR D;  2ZUP A;  3PR8 A;  2IMF A;  3VWV A;  3VI5 A;  2IPA A;  1T4Y A;  4OCF A;  1EWX A;  3UVH A;  4AF2 A;  2XPD A;  3FYG A;  4KE3 A;  5ECS A;  2GZP A;  3LEF A;  4K0G A;  2RLI A;  5A4W A;  2FWG A;  4PQH A;  1ERV A;  1BAY A;  3D22 A;  1J0F A;  4ML1 A;  5DQS A;  4DSS A;  1A2L A;  2HXK A;  1Z7R A;  4D73 A;  2V6O A;  3GX0 A;  4DSR A;  4FYC A;  5CP1 A;  5IMZ A;  2AYT A;  1YQ1 A;  3GTU A;  2J9H A;  3D21 A;  4GWR A;  4OD7 A;  3LWA A;  2E0Q A;  4TR0 A;  2GSR A;  4OFN A;  6GSW A;  5GZZ B;  1ACV A;  1TKD B;  2H73 A;  4WR4 A;  1NSW A;  2LV3 A;  4HS1 A;  3BOA A;  3FRC A;  3O3T A;  3DXB A;  2C0G A;  1WPI A;  4FO5 A;  1U3I A;  2GT6 A;  3E9J B;  3EWL A;  3IR4 A;  5C04 A;  3FHK A;  4FH8 A;  2V6K A;  4IHU A;  3FK8 A;  2KP1 A;  1EGR A;  5IMA A;  1GUK A;  4OWY A;  4GLT A;  1GNW A;  3H1N A;  2F8A A;  1M7T A;  1GTB A;  1YKC A;  5FT3 A;  5FWG A;  1ZCP A;  3ZRD A;  3GHA A;  2L6D A;  1T3B A;  2YWM A;  2LS5 A;  1V58 A;  4IBP A;  2DJK A;  1XZO A;  4ECI A;  1VGL A;  2DIZ A;  3LXT A;  4HJ2 A;  2NPB A;  1U87 A;  4XCS A;  3GL3 A;  3GSS A;  2JZS A;  2ON5 A;  4I8B A;  4OMV A;  1XFL A;  2YZU A;  5D9T A;  5KEJ A;  3LQ7 A;  2LST A;  3BCI A;  1ERW A;  4IN0 A;  5ECP B;  1BG5 A;  1GWC A;  1PX6 A;  2L57 A;  3FR6 A;  4XS4 A;  4JE1 A;  2HSH A;  3LYK A;  2JL4 A;  5JCG A;  9GSS A;  1B48 A;  4HUA A;  5ECM B;  1TI1 A;  1V98 A;  2FGX A;  5E59 A;  3CSH A;  1SKW B;  4L0W A;  5DAL A;  1F3B A;  1EV4 A;  4X1U A;  3DWV A;  3A2V A;  4MMM A;  2HFD A;  1F9M A;  1ZL9 A;  1HNA A;  1OE8 A;  2GVP A;  1XXU A;  3GL5 A;  1M0U A;  3VI7 A;  5DJM A;  5J3R A;  3VFI A;  1AC1 A;  4O92 A;  4MF6 A;  1PL1 A;  2E2G A;  4PUR A;  3TGZ A;  1SJI A;  4IQA A;  4KX4 A;  2FA4 A;  5ECH B;  1TRU A;  2WFC A;  1A0R P;  3ZVJ D;  5CRG A;  4NV2 A;  2GZZ A;  1F3A A;  2DJJ A;  3FZ9 A;  2FWH A;  5DDL A;  3LSZ A;  3WD6 A;  1OC3 A;  2D2Z A;  2IFQ B;  4DEJ A;  2C4J A;  4XS1 A;  1USB A;  1EOH A;  5JWO B;  1M2A A;  3GKN A;  2KLX A;  2C80 A;  5J9C A;  2EIQ A;  2PPT A;  1O85 A;  4BA7 A;  1OC9 A;  4EF0 A;  1C72 A;  2VCV A;  3GKM A;  2LNT A;  4POK A;  2CV4 A;  3P7X A;  2E7P A;  1O8X A;  2MZC A;  1M99 A;  2CAI A;  3D5J A;  2JSZ A;  4E8H A;  1UC7 A;  2R37 A;  4G10 A;  5IMV A;  4IJ3 A;  3U6V A;  2KP2 A;  2VL2 A;  1EEJ A;  3A3T A;  5CNW A;  4NMU A;  4KSM A;  1Z3E A;  5B8B A;  14GS A;  3KMO A;  1K0A A;  1FO5 A;  3DKS A;  4CHS A;  1YF1 A;  5ECK B;  1SD8 A;  5GSS A;  1CQG A;  6GSV A;  3ZVJ A;  1A0F A;  2VL3 A;  2XHF A;  3HXS A;  18GS A;  2GT5 A;  1G6Y A;  1JZD A;  2N5B A;  3KMN A;  3L9S A;  1GTA A;  2VM1 A;  3KP8 A;  1WMJ A;  6GSX A;  5IO2 A;  1BED A;  4BVY A;  4WF4 A;  1KNG A;  4NPB A;  2CVK A;  5JCW A;  2XC2 A;  4HEA 2;  2H70 A;  2HT9 A;  1GP1 A;  3PIN A;  2K8S A;  2I1U A;  2R5G A;  2C8U A;  2C1Y A;  3DEX A;  2YP6 A;  1AUC A;  2VLU A;  2C0D A;  1U3A A;  4OO5 A;  1O8W A;  3QAW A;  1VRS D;  2WDU A;  4EE0 A;  3E3E A;  5IOW A;  20GS A;  1NW2 A;  2H6X A;  4CDO A;  1F6M C;  1I5G A;  4ILF A;  1X5E A;  4MDC A;  1QXH A;  3TJJ A;  4MZW A;  3EMP A;  3CYN A;  4K2D A;  3TKQ A;  1R5P A;  3IV4 A;  2HSY A;  4BPY A;  2V32 A;  3SBC A;  5CRE A;  4TR3 A;  3C71 A;  2B5Y A;  3UJ1 A;  3RAZ A;  4YQU A;  3QR6 A;  1ZYQ B;  1AQV A;  1PKZ A;  1SL1 B;  1EOG A;  1CQH A;  1GTI A;  5CRW A;  2I4A A;  3TUE A;  3IDV A;  2YWN A;  3QOU A;  2IMK A;  1GUH A;  2B6M A;  1M2B A;  4L8E A;  3QPM A;  1DE2 A;  2DSA A;  4ECB A;  6GSU A;  3EYT A;  4LMW A;  2VIM A;  4ML6 A;  2PMT A;  3ZRE A;  1MDJ A;  1OAZ A;  3HZ8 A;  4NHW A;  1GL8 A;  3CTG A;  4RI6 A;  2VCT A;  3IOS A;  2C3Q A;  5DCG A;  4IVF A;  3F6D A;  2B1L A;  4NXI A;  1YZX A;  2YNX A;  3LFL A;  5AN1 A;  3F6F A;  3VWX A;  4RUV A;  4K8M A;  4LA1 A;  1FB6 A;  3W6G A;  2YAN A;  2M72 A;  4K7O A;  3HKR A;  4MK3 A;  2YPM A;  2LJK A;  5DQY A;  1NHO A;  1GSY A;  4YH2 A;  1FOV A;  3MSZ A;  5LD0 A;  4EDZ A;  4F2I A;  1SU9 A;  1X0R A;  1M9A A;  5A4V A;  3CRU A;  3LOR A;  4X0X A;  17GS A;  2LRT A;  5DCH A;  4TXO A;  5COH A;  2A2R A;  2TIR A;  2G2Q A;  5GAP D;  3C7M A;  1NHY A;  1XWK A;  5F8B A;  2F3M A;  1K0M A;  3ZZX A;  5KN2 A;  2B5E A;  4MZC A;  4TR4 A;  2H66 A;  1ZZY A;  4HI7 A;  4KCE A;  1KEB A;  3K8N A;  1JZO A;  2G0F A;  1TRS A;  1W89 A;  1MD3 A;  3KZQ A;  5ECN B;  5HFK A;  2L59 A;  2P5Q A;  1IYH A;  1GSQ A;  2HE3 A;  5J5N A;  4ZBB A;  4ZB6 A;  2PER A;  1R26 A;  2DMM A;  3N5O A;  2K6V A;  1B8X A;  3TKS E;  3A2X A;  4TVE A;  4F9Z A;  2CX3 A;  1JLW A;  3MAK A;  3V1W A;  3DYR A;  5AIX A;  3KTL A;  2VCW A;  3APQ A;  3ZYW A;  4ZB9 A;  1SD9 A;  4N0Z A;  5ECL B;  1DE1 A;  5IMD A;  1M2D A;  2GSQ A;  1YDK A;  4IQ1 A;  1V57 A;  4ZIJ A;  2HZE A;  2H01 A;  2GQL A;  1GTU A;  2H30 A;  5ELG A;  3F63 A;  4ZXG A;  3KH7 A;  1KTE A;  1BQ7 A;  4HU7 A;  2OBI A;  1YEX A;  4KUN A;  1EP7 A;  2QGV A;  1YF0 A;  4PX1 A;  4EL1 A;  1UVZ A;  2TRX A;  2X8H A;  1QK8 A;  4WBJ A;  4DSQ A;  3LG6 A;  3F4T A;  3TKP A;  1SK0 A;  3EUR A;  1V2A A;  1E6B A;  1ON4 A;  3IAS 2;  4GF0 A;  1TP9 A;  5ID2 A;  2LRN A;  2VL2 C;  3U5R E;  10GS A;  2OAC A;  3HDC A;  2PVQ A;  3GX8 A;  3DVX A;  1T1V A;  2M46 A;  2PUK C;  3L4N A;  4BWS A;  3FZ5 A;  4EUY A;  2R3X A;  2AB6 A;  3Q19 A;  3Q6O A;  1A2M A;  3GTU B;  2H71 A;  2IJY A;  2O8V B;  2DBC A;  1Y25 A;  1QUW A;  3QAV A;  4O5R A;  5B7C A;  2ES7 A;  3L78 A;  4HQZ A;  1TJD A;  3CTF A;  3ZIT A;  3ERF A;  1TRV A;  3LJR A;  2GQM A;  3CSJ A;  3F9U A;  3IK9 A;  4BVX A;  3VWU A;  1URM A;  1TOF A;  4LL1 B;  1HQO A;  3KP9 A;  3NZN A;  5ABR A;  3GKK A;  4L0U A;  5G30 A;  2YV9 A;  3QFA C;  4V2M A;  2DJ0 A;  4EVM A;  1TI3 A;  2WB9 A;  4JRR A;  3C8E A;  1K0N A;  1PQN A;  2DLX A;  4ISD A;  4J56 E;  4LLR A;  3M9J A;  3ME7 A;  3AY8 A;  2TRC P;  3RDW A;  4I2T A;  1GSU A;  3VPQ A;  1Q4J A;  3IHQ A;  4AJ7 A;  3I69 A;  1NM3 A;  3HZ4 A;  2BMX A;  4HDE A;  3L9U A;  1Z6N A;  1AQW A;  2CZ3 A;  5AIV A;  3M3M A;  2OJL A;  1UA5 A;  3F4S A;  1DUG A;  5IM9 A;  1RW1 A;  4NAX A;  3IE3 A;  1X5D A;  2WUL A;  3HJO A;  4KCA A;  2GSS A;  4TW5 A;  3ZL5 A;  2H0I A;  1K0B A;  1T4Z A;  5J41 A;  4GTU A;  1ILO A;  5DAL B;  2HLS A;  2L5O A;  3GUR A;  1SKR B;  1IYI A;  1PSQ A;  1J9B A;  1EEM A;  1GRX A;  1JZR A;  3M8N A;  1TW9 A;  4MCU A;  4OCE A;  4L5L A;  4MLY A;  4KA0 A;  1E2Y A;  3G9B A;  2PN8 A;  2KUC A;  3HVS A;  1XW6 A;  2VCQ A;  5HR1 A;  2YWI A;  1XPV A;  4AGS A;  2K8V A;  3TJG A;  2N5A A;  1EV9 A;  4BWQ A;  2AV4 A;  3IBH A;  2GGT A;  3F8U A;  3D6I A;  1K3L A;  2RM6 A;  2LKU A;  1HYU A;  1W4V A;  6GSY A;  4EO3 A;  1I9D A;  1PN9 A;  3HY2 A;  3WGD A;  4V1A p;  2V2G A;  4MPG A;  4YAP A;  2N5F A;  3I9V 2;  1XIY A;  2IL3 A;  2MBT A;  1OKD A;  1BYE A;  1LU4 A;  1SJZ A;  1XW5 A;  3VWW A;  2B5X A;  3ISO A;  3H79 A;  3GRX A;  1A23 A;  1VF1 A;  5LNK e;  2R6K A;  5F0G A;  2CZ2 A;  1RQM A;  4HOJ A;  2AJQ B;  1PL2 A;  1THO A;  1T7P B;  4KSO A;  2JAD A;  4ECC A;  4GSS A;  5ECR B;  3PH9 A;  3KEB A;  3HCZ A;  4ZL9 A;  2PU9 C;  5CRH A;  4Z7X A;  4K9Z A;  1A8L A;  4N10 A;  1TRW A;  2LUS A;  4RI7 A;  1LJR A;  2BTO T;  2IWT A;  1XWB A;  2AUV A;  1WRY A;  4J2F A;  1QFN A;  1WOU A;  2C3N A;  2HYX A;  5ENU A;  2C0F A;  3SWL A;  2ZCT A;  4HZ4 A;  4CW9 A;  1X5C A;  4MAB A;  2WCI A;  4POL A;  1SYR A;  1AW9 A;  3QFB C;  1RK4 A;  2H1D A;  5ELA A;  2YCD A;  1K3O A;  2GTU A;  3FZA A;  3TKS A;  5KN1 A;  5F05 A;  1V9W A;  1TDI A;  2L4Q A;  3ZTL A;  3MNG A;  1LBK A;  1ZYE A;  3GN3 A;  4DVC A;  2LEG A;  3ED3 A;  19GS A;  3KJY A;  4ZL8 A;  1R7H A;  1ZGN A;  4TRX A;  1H4O A;  3FKF A;  4V1A g;  5L71 A;  4WKW A;  4KND A;  1O73 A;  2FHE A;  2GZY A;  3WT2 A;  3ZFL A;  2H1A A;  2P5R A;  3I43 A;  3OR5 A;  3GUS A;  1MDI A;  3TJK A;  2VCZ A;  1YJ6 A;  3LXZ A;  1G7O A;  2IME A;  16GS A;  4I2U A;  3TKR A;  3EU3 A;  4H86 A;  4ZBD A;  2VL9 A;  4QQ7 A;  2K18 A;  1XW9 A;  3IAM 2;  1SL0 B;  3O76 A;  2NVL A;  1G6W A;  3UOM A;  3G7J A;  3FEU A;  5AIS A;  5H5S A;  4GSN A;  1B9X C;  5ECO B;  1GUL A;  2MMN A;  1TK5 B;  4MP4 A;  2O85 A;  2DC5 A;  2JSY A;  2H1G A;  1A24 A;  4JU5 A;  4GXZ A;  4TN8 A;  4N30 A;  3G7Y A;  5DVB A;  2J23 A;  1EZK A;  4GST A;  3HYP A;  5AGY A;  3BBY A;  2P31 A;  2FUG 2;  5H5Q A;  2OE3 A;  5HR2 A;  3W8J A;  1N2A A;  1Z5Y E;  4G9H A;  2NTO A;  3DVW A;  8GSS A;  2YN1 A;  4KDY A;  2YJ7 A;  3D4T A;  1GSS A;  2YJH A;  2BJX A;  4Q5N A;  1PA3 A;  12GS A;  4YQV A;  3EMX A;  5G2Z A;  4TR1 B;  1F37 A;  4POM A;  4G19 A;  1SL2 B;  4KGI A;  4KAE A;  4IW9 A;  3QMX A;  2FWF A;  3ZML A;  1Q98 A;  2IIY A;  2O87 A;  4IKH A;  5J4U A;  1FW1 A;  2H0G A;  2RM5 A;  1TXX A;  3IK7 A;  1U6T A;  1XWG A;  1PKW A;  2CVD A;  3VPT A;  5A4U A;  1WP0 A;  4TKY A;  3MWH A;  1WE0 A;  4LL4 B;  2VCX A;  2QKE A;  1G0T A;  2WRT A;  4OFT A;  3RBT A;  3ERW A;  2KHP A;  5D9W A;  1BJX A;  2GQK A;  4JR6 A;  2MBS A;  1FG4 A;  1O81 A;  2MYG A;  3EU4 A;  1GH2 A;  5D96 A;  2NDO A;  3KIJ A;  5DAK A;  5E4W A;  2HRF A;  2H75 A;  2YWO A;  3ZFB A;  4KH7 A;  1SK1 A;  2R4V A;  2RII A;  1SEN A;  1Z6M A;  1R4W A;  1WJK A;  2V1M A;  3FR9 A;  4YAV A;  5IO0 A;  3EC3 A;  5B8A A;  3TRQ A;  3NIV A;  1K0O A;  2OKA A;  2PBJ A;  2HRN A;  3C1R A;  2I9H A;  1XOB A;  4ULX A;  1AAZ A;  1QQ2 A;  5D73 A;  3RPN A;  3UL3 A;  5CO3 A;  3ZMK A;  2L6C A;  3N9J A;  3QDN A;  1J08 A;  4Q5F A;  3FY7 A;  3TDG A;  2LQQ A;  5EY6 A;  1UN2 A;  6GST A;  5EPF A;  4K6X A;  3H93 A;  3HVX A;  4POB A;  4EXJ A;  4AJ8 A;  5D93 A;  4I6X A;  3A2W A;  2CX4 A;  1DSB A;  1AQX A;  3DML A;  4ECJ A;  2ZNM A;  3KM6 A;  1HD2 A;  5A5K A;  1O7U A;  2E2M A;  2WS2 A;  5G31 A;  3H8Q A;  3APS A;  3UBK A;  3LYP A;  1FB0 A;  1DBY A;  1OKT A;  5B6N A;  2R2J A;  4TOP A;  3IXR A;  1B4Q A;  4GCI A;  3J7Y k;  4E8E A;  2FY6 A;  3GYK A;  1HNB A;  4HZ2 A;  4EKZ A;  3TOT A;  3IPZ A;  1MD4 A;  5CYY A;  2PVO C;  1A8Y A;  2O7K A;  1S3D A;  2YOI A;  3GH6 A;  2HZE B;  2VOC A;  1XWA A;  1SKS B;  1S3A A;  1YEP A;  4XTS A;  4IGJ A;  4PQI A;  1XVW A;  5EVO A;  3QCP A;  2EC4 A;  3C73 A;  5CRD A;  3DD3 A;  2M80 A;  5INY A;  1GSD A;  4DSS B;  2F9S A;  4D73 B;  5HQP A;  1TU7 A;  1SJ6 A;  4O32 A;  3ZIJ A;  3Q18 A;  3UEM A;  3H4K A;  1TK0 B;  3F3R A;  4PUA A;  3EIN A;  3WGX A;  1XVQ A;  3FW2 A;  2VD0 A;  1FVJ A;  4MH2 A;  5ID2 B;  3L9V A;  3WT1 A;  4WEY A;  3CRT A;  5HR3 A;  4KW6 A;  1JLV A;  3RPP A;  2VUP A;  7GSS A;  1WWJ A;  4FYU A;  4N11 A;  4KB3 A;  4ZBA A;  1V40 A;  1PX7 A;  2PGT A;  4P3Y B;  3IA1 A;  5CAX A;  3GMF A;  2LQO A;  4O7H A;  3P2A A;  3IC4 A;  2MMA A;  4F03 A;  4K1F A;  1PRX A;  4MPF A;  3UMA A;  3KCM A;  2F8F A;  4G2E A;  2C3T A;  3NOF A;  4KDU A;  4JZQ A;  2QSI A;  5IOX A;  3FZ4 A;  2I3Y A;  1ERU A;  3KD0 A;  3EE2 A;  1FAA A;  3G7I A;  4F0C A;  3L0H A;  3LGC A;  3TKS C;  4MJB A;  3UIW A;  4OO4 A;  1G7E A;  3D0Z A;  2XPE A;  1YY7 A;  2IFQ A;  5GAN D;  4GRF A;  3DIE A;  3QD9 A;  1VF3 A;  1MDK A;  1QMV A;  4HQS A;  4MJE A;  2V41 A;  4XS4 B;  3HHV A;  3ERG A;  1FVK A;  3GIX A;  3A5W A;  1PD2 1;  3P90 A;  4MJC A;  1TU8 A;  1JFU A;  3TJB A;  5JWR B;  4AJ6 A;  3GKX A;  3E0U A;  3CMI A;  1O6J A;  2FWE A;  3CXG A;  2AHE A;  1B4P A;  2H0H A;  2H6Y A;  3QAG A;  3KXO A;  2PWJ A;  5D9X A;  3KH9 A;  2DJ2 A;  1THX A;  2O89 A;  2WJU A;  2IN3 A;  13GS A;  4NV5 A;  5IMF A;  2VLV A;  4PNF A;  1OYJ A;  4BL7 A;  1Z9H A;  3M9K A;  4EC0 A;  3GST A;  2X8G A;  4WR5 A;  4QL7 A;  3TJF A;  2H72 A;  3UAR A;  3EVI A;  1Z7P A;  4MF7 A;  2H6Z A;  1ML6 A;  2OE1 A;  4IS0 A;  1OC9 B;  4ID0 A;  3GA4 A;  2GS3 A;  3CBU A;  2LRC A;  4N0V A;  1ZOF A;  3WYW A;  1K0C A;  1ST9 A;  2QC7 A;  5J9B A;  11GS A;  4K7N A;  5FHI A;  2HZF A;  2WZ9 A;  2VLT A;  2X99 A;  4JR4 A;  5IMC A;  4QL9 A;  1FHE A;  3TRX A;  5KN3 A;  2H74 A;  2ALB A;  4XS6 A;  4MH3 A;  1XOA A;  5D9V A;  2LJR A;  2RUE A;  2EIO A;  1U88 A;  2A2S A;  4V2L A;  3CSI A;  2CAQ A;  3BCK A;  3VK9 A;  1GLQ A;  4NHZ A;  2L4C A;  4PUF C;  3HJP A;  1WIK A;  1AIU A;  3M1G A;  3HJM A;  4X43 A;  2IMI A;  4IP6 A;  4IEL A;  22GS A;  1AXD A;  3W8S A;  2OE0 A;  2YV7 A;  4Q5R A;  3ZLP A;  1KBN A;  3S9F A;  1GNE A;  4RQR A;  3F3Q A;  5G5F A;  4JED A;  2GLR A;  4F0B A;  4I97 A;  1X9M B;  1B9Y C;  5LCZ A;  2RUF A;  3C1S A;  1TK8 B;  4IJI A;  4FYB A;  2JZT A;  4K0N A;  1A2J A;  3MDK A;  1T00 A;  4XRA A;  2CA8 A;  5IQY A;  2HNL A;  3WGE A;  4OFM A;  1JZW A;  3FR3 A;  4XHM A;  2EIR A;  3KGK A;  1T8E B;  5IPH A;  2B7J A;  2MMO A;  4MJA A;  6GSS A;  2K9F A;  1OVN A;  5B6M A;  2LTK A;  4J57 E;  4EDY A;  1S3C A;  2VAF A;  2OBK A;  5IPG A;  5GST A;  3DRN A;  2DJ3 A;  2NBS A;  1SK2 A;  2B1K A;  2XBI A;  3M0F A;  3TCO A;  2X8C A;  1R5A A;  1JHB A;  1VF2 A;  1TTZ A;  4MA9 A;  1SYX A;  5JCU A;  5HR0 A;  1Y6E A;  3TRP A;  2A4V A;  2H76 A;  4WXT A;  3UBL A;  4TXV A;  4KDX A;  3D4M A;  1XBS A;  2REM A;  4PXO A;  4NWY A;  1BX9 A;  5HFI A;  4JBB A;  4IP1 A;  4WF5 A;  3GV1 A;  2L5L A;  4MF5 A;  5G5E A;  4Q5Q A;  5G1L A;  1PGT A;  2XBQ A;  1XCC A;  4ZB8 A;  1K3Y A;  3VLN A;  1X9W B;  4I5Q A;  4L5O A;  1GSF A;  4TR1 A;  2OAD A;  3Q74 A;  3O6T A;  1GUM A;  2JU5 A;  1ABA A;  4PNG A;  2Z9S A;  2FCH A;  2C0E A;  2MMZ A;  1GSE A;  5ECI B;  5IIZ A;  4WET A;  2VD1 A;  2VO4 A;  3P8W A;  5D8I A;  2H19 A;  5HFG A;  1K0D A;  3RHB A;  3UAP A;  2FLS A;  3BD2 A;  1EGO A;  2GST A;  2DML A;  1HNC A;  2I81 A;  1VF4 A;  4ZIL A;  3US3 A;  3APO A;  5KN0 A;  1MTC A;  4FIW A;  5DJL A;  3GFK A;  4XIH A;  2GDR A;  2H1B A;  2FNO A;  1YKA A;  4PQ1 A;  3HA9 A;  5JWQ B;  3HD5 A;  4LMV A;  5EL8 A;  3GH9 A;  2P0G A;  1X9S B;  1EP8 A;  3TOU A;  4GQC A;  3BJ5 A;  2H8L A;  1QGV A;  1ERT A;  5DBQ A;  5H5R A;  2CT6 A;  3F0I A;  5F07 A; 
#chains in the Genus database with same CATH topology
 1M9B A;  3RHC A;  1PMT A;  1MEK A;  4V2N A;  4ACS A;  2JZR A;  5G1K A;  2KOK A;  1ZMA A;  3JCM L;  4HU9 A;  4F82 A;  4HJM A;  2WGR A;  4YQM A;  3ZIV A;  5C00 A;  4MZB A;  4TXO B;  1H75 A;  2HI7 A;  1N8J A;  2IMD A;  2CVB A;  2OA7 A;  3VUR A;  3IRA A;  2VM2 A;  2DJ1 A;  3I6A A;  3J7Y b;  4ZL7 A;  3DGQ A;  3GNJ A;  1OE7 A;  2FA8 A;  3KTB A;  2FD3 A;  2DIY A;  4GQF A;  3F4R A;  3PGT A;  3UVT A;  2YZH A;  4RQX A;  5F06 A;  2JAC A;  1F2E A;  1XWC A;  2CQ9 A;  1OC8 A;  2X64 A;  2B7K A;  4K7I A;  2F51 A;  3HVV A;  4PGT A;  3TB2 A;  4XRD A;  5DAK B;  4MNN A;  3ME8 A;  2LNS A;  5ECQ B;  2ON7 A;  1GLP A;  2HSM A;  2LJA A;  2B3S A;  3R2Q A;  2AAW A;  4WBR D;  3LW9 A;  2ZUP A;  3PR8 A;  2IMF A;  3VWV A;  3VI5 A;  2IPA A;  1T4Y A;  4OCF A;  1EWX A;  3UVH A;  4AF2 A;  2XPD A;  2X49 A;  3FYG A;  4KE3 A;  5ECS A;  2GZP A;  3LEF A;  4K0G A;  2RLI A;  5A4W A;  2FWG A;  4PQH A;  1ERV A;  1BAY A;  3D22 A;  1J0F A;  4ML1 A;  5DQS A;  4DSS A;  1A2L A;  2HXK A;  1Z7R A;  4D73 A;  2V6O A;  3GX0 A;  4DSR A;  4FYC A;  5CP1 A;  5IMZ A;  3HVN A;  2AYT A;  1YQ1 A;  3GTU A;  2J9H A;  3D21 A;  4GWR A;  4OD7 A;  3LWA A;  2E0Q A;  4TR0 A;  2GSR A;  4OFN A;  6GSW A;  5GZZ B;  1ACV A;  1TKD B;  2H73 A;  5KOX A;  4WR4 A;  1NSW A;  2LV3 A;  4HS1 A;  3BOA A;  3FRC A;  3O3T A;  3DXB A;  2C0G A;  1WPI A;  4FO5 A;  1U3I A;  2GT6 A;  3E9J B;  3EWL A;  3IR4 A;  5C04 A;  3FHK A;  4FH8 A;  2V6K A;  4IHU A;  3FK8 A;  2KP1 A;  1EGR A;  5IMA A;  1GUK A;  4OWY A;  4GLT A;  1GNW A;  3H1N A;  2F8A A;  1M7T A;  1GTB A;  1YKC A;  5FT3 A;  5FWG A;  1ZCP A;  3ZRD A;  3GHA A;  2L6D A;  1ZYP A;  1T3B A;  2YWM A;  2LS5 A;  1V58 A;  4IBP A;  2DJK A;  1XZO A;  4ECI A;  1VGL A;  2DIZ A;  3LXT A;  4HJ2 A;  2NPB A;  1U87 A;  4XCS A;  3GL3 A;  3GSS A;  2JZS A;  2ON5 A;  4I8B A;  4OMV A;  1XFL A;  2YZU A;  5D9T A;  5KEJ A;  3LQ7 A;  2LST A;  3BCI A;  1ERW A;  4IN0 A;  5ECP B;  1BG5 A;  1GWC A;  1PX6 A;  2L57 A;  3FR6 A;  4XS4 A;  2R0G A;  4JE1 A;  2HSH A;  3LYK A;  2JL4 A;  5JCG A;  9GSS A;  1B48 A;  4HUA A;  5ECM B;  1TI1 A;  1V98 A;  2FGX A;  5E59 A;  3CSH A;  1SKW B;  4L0W A;  5DAL A;  1F3B A;  1EV4 A;  4X1U A;  3DWV A;  3A2V A;  4MMM A;  2HFD A;  1F9M A;  1ZL9 A;  1HNA A;  1OE8 A;  2GVP A;  1XXU A;  3GL5 A;  1M0U A;  3VI7 A;  5DJM A;  5J3R A;  3VFI A;  2QA1 A;  1AC1 A;  4O92 A;  4MF6 A;  1PL1 A;  2E2G A;  4PUR A;  3TGZ A;  1SJI A;  4IQA A;  4KX4 A;  2FA4 A;  5ECH B;  1TRU A;  2WFC A;  1A0R P;  3ZVJ D;  5CRG A;  4NV2 A;  2GZZ A;  1F3A A;  2DJJ A;  3FZ9 A;  2FWH A;  5DDL A;  3LSZ A;  3WD6 A;  1OC3 A;  2D2Z A;  2IFQ B;  4DEJ A;  2C4J A;  4XS1 A;  1USB A;  1EOH A;  5JWO B;  1M2A A;  3GKN A;  2KLX A;  2C80 A;  2DKI A;  5J9C A;  2EIQ A;  2PPT A;  1O85 A;  4BA7 A;  1OC9 A;  4EF0 A;  1C72 A;  2VCV A;  3GKM A;  2LNT A;  4POK A;  2CV4 A;  3P7X A;  2E7P A;  1O8X A;  2MZC A;  1M99 A;  2CAI A;  3D5J A;  2JSZ A;  4E8H A;  1UC7 A;  2R37 A;  4G10 A;  5IMV A;  4Z2U A;  4IJ3 A;  3U6V A;  2KP2 A;  2VL2 A;  1EEJ A;  3A3T A;  5CNW A;  4NMU A;  4KSM A;  1Z3E A;  5B8B A;  14GS A;  4O5U A;  3KMO A;  1K0A A;  1FO5 A;  3DKS A;  4CHS A;  1YF1 A;  5ECK B;  1SD8 A;  5GSS A;  1CQG A;  6GSV A;  3ZVJ A;  1A0F A;  2QA2 A;  4G0K A;  2VL3 A;  2XHF A;  3HXS A;  18GS A;  2GT5 A;  1G6Y A;  1JZD A;  2N5B A;  3KMN A;  3L9S A;  1GTA A;  2VM1 A;  3KP8 A;  1WMJ A;  6GSX A;  4FQU A;  5IO2 A;  1BED A;  4BVY A;  4WF4 A;  1KNG A;  4NPB A;  2CVK A;  5JCW A;  2XC2 A;  4HEA 2;  2H70 A;  2HT9 A;  1GP1 A;  2A2P A;  4YKF A;  3PIN A;  2K8S A;  2I1U A;  2R5G A;  2C8U A;  2C1Y A;  1XG8 A;  3DEX A;  2YP6 A;  1AUC A;  2VLU A;  2C0D A;  1U3A A;  4OO5 A;  1O8W A;  3QAW A;  1VRS D;  2WDU A;  4EE0 A;  3E3E A;  4KF9 A;  5IOW A;  20GS A;  1NW2 A;  2H6X A;  4ICY A;  4CDO A;  1F6M C;  1I5G A;  4ILF A;  1X5E A;  4MDC A;  1QXH A;  3TJJ A;  4MZW A;  3EMP A;  3CYN A;  4K2D A;  3TKQ A;  1R5P A;  3IV4 A;  2HSY A;  4BPY A;  2V32 A;  3SBC A;  5CRE A;  4TR3 A;  3C71 A;  2B5Y A;  3UJ1 A;  3RAZ A;  4YQU A;  3QR6 A;  1ZYQ B;  1AQV A;  1PKZ A;  4O5Q A;  1SL1 B;  1EOG A;  1CQH A;  1GTI A;  5CRW A;  2I4A A;  3TUE A;  3IDV A;  2YWN A;  3QOU A;  2IMK A;  1GUH A;  2B6M A;  1M2B A;  4L8E A;  3QPM A;  1DE2 A;  2DSA A;  4ECB A;  6GSU A;  3EYT A;  4LMW A;  2VIM A;  4ML6 A;  2PMT A;  3ZRE A;  1MDJ A;  1OAZ A;  3PPU A;  3HZ8 A;  4NHW A;  1GL8 A;  3CTG A;  4RI6 A;  2VCT A;  3IOS A;  2C3Q A;  5DCG A;  4IVF A;  3F6D A;  2B1L A;  4CY8 A;  4NXI A;  1YZX A;  2YNX A;  3LFL A;  5AN1 A;  3F6F A;  3VWX A;  4RUV A;  4K8M A;  4LA1 A;  1FB6 A;  3W6G A;  2YAN A;  2M72 A;  4K7O A;  3HKR A;  4MK3 A;  2YPM A;  2LJK A;  3A5I A;  5DQY A;  1NHO A;  1GSY A;  2HRK A;  4YH2 A;  1FOV A;  3MSZ A;  4USS A;  5LD0 A;  4EDZ A;  4F2I A;  1SU9 A;  1X0R A;  1M9A A;  5A4V A;  3CRU A;  3LOR A;  4X0X A;  17GS A;  2LRT A;  5DCH A;  4TXO A;  5COH A;  2A2R A;  2TIR A;  2G2Q A;  5GAP D;  3C7M A;  1NHY A;  1XWK A;  5F8B A;  2F3M A;  1K0M A;  3ZZX A;  5KN2 A;  2B5E A;  4MZC A;  4TR4 A;  2H66 A;  1ZZY A;  4HI7 A;  4KCE A;  1KEB A;  3K8N A;  1JZO A;  2G0F A;  1TRS A;  1W89 A;  1MD3 A;  3KZQ A;  5ECN B;  5HFK A;  2L59 A;  2P5Q A;  1IYH A;  1GSQ A;  2HE3 A;  5J5N A;  4ZBB A;  4ZB6 A;  2PER A;  1R26 A;  2DMM A;  3N5O A;  2K6V A;  1B8X A;  3TKS E;  3A2X A;  4TVE A;  4F9Z A;  2CX3 A;  1JLW A;  3MAK A;  3V1W A;  3DYR A;  5AIX A;  3KTL A;  2VCW A;  3APQ A;  3ZYW A;  4ZB9 A;  1SD9 A;  4N0Z A;  5ECL B;  4G0L A;  1DE1 A;  5IMD A;  1M2D A;  2GSQ A;  1YDK A;  4IQ1 A;  1V57 A;  4ZIJ A;  2HZE A;  2H01 A;  2GQL A;  1GTU A;  2H30 A;  5ELG A;  3F63 A;  4ZXG A;  3KH7 A;  1KTE A;  1BQ7 A;  4HU7 A;  2OBI A;  1YEX A;  4KUN A;  1EP7 A;  2QGV A;  1YF0 A;  4PX1 A;  4EL1 A;  1UVZ A;  2TRX A;  2X8H A;  1QK8 A;  4WBJ A;  4DSQ A;  3LG6 A;  3F4T A;  3TKP A;  1SK0 A;  3EUR A;  1V2A A;  1E6B A;  1ON4 A;  3IAS 2;  4GF0 A;  1TP9 A;  5ID2 A;  2LRN A;  2VL2 C;  3U5R E;  10GS A;  2OAC A;  3HDC A;  2PVQ A;  1PN0 A;  3GX8 A;  4K5S A;  3DVX A;  1T1V A;  2M46 A;  2PUK C;  3L4N A;  4BWS A;  3FZ5 A;  4EUY A;  2R3X A;  2AB6 A;  3Q19 A;  3Q6O A;  1A2M A;  3GTU B;  2H71 A;  2IJY A;  2O8V B;  2DBC A;  1Y25 A;  1QUW A;  3QAV A;  4O5R A;  5B7C A;  2ES7 A;  3L78 A;  4HQZ A;  1TJD A;  3CTF A;  3ZIT A;  3ERF A;  1TRV A;  3LJR A;  2GQM A;  3CSJ A;  3F9U A;  3IK9 A;  4BVX A;  3VWU A;  1URM A;  1TOF A;  4LL1 B;  1HQO A;  3KP9 A;  3NZN A;  5ABR A;  3GKK A;  4L0U A;  4PTS A;  5G30 A;  2YV9 A;  3QFA C;  4V2M A;  2DJ0 A;  4EVM A;  1TI3 A;  2WB9 A;  4JRR A;  3C8E A;  1K0N A;  1PQN A;  2DLX A;  4ISD A;  4J56 E;  4LLR A;  3M9J A;  3ME7 A;  3AY8 A;  2TRC P;  3RDW A;  4I2T A;  1GSU A;  3VPQ A;  1Q4J A;  3IHQ A;  4AJ7 A;  3I69 A;  1NM3 A;  3HZ4 A;  2BMX A;  2R0C A;  4HDE A;  3L9U A;  1Z6N A;  1AQW A;  2CZ3 A;  5AIV A;  2HRA A;  3M3M A;  2OJL A;  1UA5 A;  3F4S A;  1DUG A;  5IM9 A;  1RW1 A;  4NAX A;  3IE3 A;  1X5D A;  2WUL A;  3HJO A;  4KCA A;  2GSS A;  1ZYN A;  4TW5 A;  3ZL5 A;  2H0I A;  1K0B A;  1T4Z A;  5J41 A;  4GTU A;  1ILO A;  5DAL B;  2HLS A;  2L5O A;  3GUR A;  1SKR B;  1IYI A;  1PSQ A;  1J9B A;  1EEM A;  1GRX A;  1JZR A;  3M8N A;  1TW9 A;  5BMU A;  4MCU A;  4OCE A;  4L5L A;  4MLY A;  4K2X A;  4KA0 A;  1E2Y A;  3G9B A;  2PN8 A;  2KUC A;  3HVS A;  1XW6 A;  2VCQ A;  5HR1 A;  2YWI A;  1XPV A;  4AGS A;  2K8V A;  3TJG A;  2N5A A;  1EV9 A;  4BWQ A;  2AV4 A;  3IBH A;  2GGT A;  3F8U A;  3D6I A;  1K3L A;  2RM6 A;  2LKU A;  1HYU A;  1W4V A;  6GSY A;  4EO3 A;  1I9D A;  1PN9 A;  3HY2 A;  3WGD A;  4V1A p;  2V2G A;  4MPG A;  4YAP A;  3MIX A;  2N5F A;  3I9V 2;  1XIY A;  2IL3 A;  2MBT A;  1OKD A;  1BYE A;  1LU4 A;  1SJZ A;  1XW5 A;  3VWW A;  2B5X A;  3ISO A;  3CQF A;  3H79 A;  3GRX A;  1A23 A;  1VF1 A;  5LNK e;  2R6K A;  4BL7 B;  5F0G A;  2CZ2 A;  1RQM A;  4HOJ A;  2AJQ B;  1PL2 A;  1THO A;  1T7P B;  4KSO A;  2JAD A;  4ECC A;  4GSS A;  5ECR B;  3PH9 A;  3KEB A;  3HCZ A;  4ZL9 A;  2PU9 C;  5CRH A;  4Z7X A;  4K9Z A;  1A8L A;  4N10 A;  1TRW A;  2LUS A;  4RI7 A;  1LJR A;  2BTO T;  2IWT A;  1XWB A;  2AUV A;  1WRY A;  4J2F A;  1QFN A;  1WOU A;  2DKH A;  2C3N A;  2HYX A;  5ENU A;  2C0F A;  3SWL A;  2ZCT A;  4HZ4 A;  4CW9 A;  1X5C A;  4MAB A;  2WCI A;  4POL A;  1SYR A;  1AW9 A;  3QFB C;  1RK4 A;  2H1D A;  5ELA A;  2YCD A;  1K3O A;  2GTU A;  3FZA A;  3TKS A;  5KN1 A;  1M3J A;  5F05 A;  1V9W A;  1TDI A;  2L4Q A;  3ZTL A;  3MNG A;  1LBK A;  4BVY B;  1ZYE A;  3GN3 A;  4DVC A;  2LEG A;  3ED3 A;  19GS A;  3KJY A;  4ZL8 A;  1R7H A;  1ZGN A;  4TRX A;  1H4O A;  1PFO A;  3FKF A;  4V1A g;  5L71 A;  4WKW A;  4KND A;  1O73 A;  2FHE A;  2GZY A;  3WT2 A;  3ZFL A;  2H1A A;  2P5R A;  3I43 A;  3OR5 A;  3GUS A;  1MDI A;  3TJK A;  2VCZ A;  1YJ6 A;  3LXZ A;  1G7O A;  2IME A;  16GS A;  4I2U A;  3TKR A;  3EU3 A;  4H86 A;  4ZBD A;  2VL9 A;  4QQ7 A;  2X4A A;  2K18 A;  1XW9 A;  3IAM 2;  1SL0 B;  3O76 A;  2NVL A;  1G6W A;  3UOM A;  3G7J A;  3FEU A;  5AIS A;  5H5S A;  4GSN A;  1B9X C;  5ECO B;  1GUL A;  2MMN A;  4K5R A;  1TK5 B;  4MP4 A;  2O85 A;  3IC8 A;  2DC5 A;  2JSY A;  2H1G A;  1A24 A;  4JU5 A;  4GXZ A;  4TN8 A;  4N30 A;  4Z2T A;  3G7Y A;  5DVB A;  2J23 A;  1EZK A;  4GST A;  3HYP A;  5AGY A;  3BBY A;  2P31 A;  2FUG 2;  5H5Q A;  2OE3 A;  5HR2 A;  3W8J A;  1N2A A;  1Z5Y E;  4G9H A;  2NTO A;  3DVW A;  8GSS A;  2YN1 A;  4KDY A;  2YJ7 A;  4EIQ A;  3D4T A;  1GSS A;  2YJH A;  2BJX A;  4Q5N A;  1PA3 A;  12GS A;  4YQV A;  3EMX A;  5G2Z A;  1M3I A;  4TR1 B;  1F37 A;  4POM A;  4G19 A;  1SL2 B;  4KGI A;  4KAE A;  4IW9 A;  3QMX A;  2FWF A;  3ZML A;  1Q98 A;  2IIY A;  2O87 A;  4IKH A;  5J4U A;  1FW1 A;  2H0G A;  2RM5 A;  1TXX A;  3IK7 A;  1U6T A;  1XWG A;  1PKW A;  2CVD A;  3VPT A;  5A4U A;  1WP0 A;  4TKY A;  3MWH A;  1WE0 A;  4LL4 B;  2VCX A;  2QKE A;  1G0T A;  2WRT A;  4OFT A;  3RBT A;  3ERW A;  2KHP A;  5D9W A;  1BJX A;  2GQK A;  4JR6 A;  2MBS A;  1FG4 A;  1O81 A;  2MYG A;  3EU4 A;  1GH2 A;  5D96 A;  2NDO A;  3KIJ A;  5DAK A;  5E4W A;  2HRF A;  2H75 A;  2YWO A;  3ZFB A;  4KH7 A;  1SK1 A;  2R4V A;  2RII A;  1SEN A;  1Z6M A;  1R4W A;  1WJK A;  2V1M A;  3FR9 A;  4YAV A;  5IO0 A;  3EC3 A;  5B8A A;  3TRQ A;  3NIV A;  1K0O A;  2OKA A;  2PBJ A;  2HRN A;  3C1R A;  2I9H A;  1XOB A;  4ULX A;  1AAZ A;  1QQ2 A;  5D73 A;  3RPN A;  3UL3 A;  5CO3 A;  3ZMK A;  2L6C A;  3N9J A;  1S3R A;  3QDN A;  1J08 A;  4Q5F A;  3FY7 A;  3TDG A;  2LQQ A;  5EY6 A;  1UN2 A;  6GST A;  5EPF A;  4K6X A;  3H93 A;  3HVX A;  4POB A;  4EXJ A;  4AJ8 A;  5D93 A;  4I6X A;  3A2W A;  2CX4 A;  1DSB A;  1AQX A;  3DML A;  4ECJ A;  2ZNM A;  3KM6 A;  1HD2 A;  5A5K A;  1O7U A;  2E2M A;  4A5P A;  2WS2 A;  5G31 A;  4CY6 A;  3H8Q A;  3APS A;  3UBK A;  3LYP A;  1FB0 A;  1DBY A;  1OKT A;  5B6N A;  2R2J A;  4TOP A;  3IXR A;  1B4Q A;  4GCI A;  3J7Y k;  4E8E A;  2FY6 A;  3GYK A;  1HNB A;  4HZ2 A;  4EKZ A;  3TOT A;  3IPZ A;  1MD4 A;  5CYY A;  2PVO C;  1A8Y A;  2O7K A;  1S3D A;  2YOI A;  3GH6 A;  2HZE B;  2VOC A;  1XWA A;  1SKS B;  1S3A A;  1YEP A;  4XTS A;  4IGJ A;  4PQI A;  1XVW A;  5EVO A;  3QCP A;  2EC4 A;  3C73 A;  5CRD A;  3DD3 A;  2M80 A;  5INY A;  1GSD A;  4DSS B;  2F9S A;  4D73 B;  5HQP A;  1TU7 A;  1SJ6 A;  4O32 A;  3ZIJ A;  3Q18 A;  3UEM A;  3H4K A;  1TK0 B;  3F3R A;  4PUA A;  3EIN A;  3WGX A;  1XVQ A;  3FW2 A;  2VD0 A;  1FVJ A;  4MH2 A;  5ID2 B;  3L9V A;  3WT1 A;  4WEY A;  3CRT A;  5HR3 A;  4KW6 A;  1JLV A;  3RPP A;  2VUP A;  7GSS A;  1WWJ A;  4FYU A;  4N11 A;  4YKG A;  4KB3 A;  4ZBA A;  1V40 A;  1PX7 A;  2PGT A;  4P3Y B;  3IA1 A;  5CAX A;  3GMF A;  2LQO A;  4O7H A;  3P2A A;  3IC4 A;  2MMA A;  4F03 A;  4K1F A;  1PRX A;  4MPF A;  3UMA A;  3KCM A;  2F8F A;  4G2E A;  2C3T A;  3NOF A;  4KDU A;  4JZQ A;  5BRT A;  2QSI A;  5IOX A;  3FZ4 A;  2I3Y A;  1ERU A;  3KD0 A;  3R3E A;  3EE2 A;  4BVX B;  1FAA A;  3G7I A;  4F0C A;  3L0H A;  3LGC A;  3TKS C;  4MJB A;  3UIW A;  4OO4 A;  1G7E A;  3D0Z A;  2XPE A;  1YY7 A;  4G0I A;  2IFQ A;  5GAN D;  4GRF A;  3DIE A;  3QD9 A;  1VF3 A;  1MDK A;  1QMV A;  4HQS A;  4MJE A;  2UZ8 A;  2V41 A;  4XS4 B;  3HHV A;  3ERG A;  1FVK A;  3GIX A;  3A5W A;  1PD2 1;  3P90 A;  4MJC A;  1TU8 A;  1JFU A;  3TJB A;  5JWR B;  4AJ6 A;  3GKX A;  3E0U A;  3CMI A;  1FOH A;  1O6J A;  2FWE A;  3CXG A;  2AHE A;  1B4P A;  2H0H A;  2H6Y A;  4EIP A;  3QAG A;  3KXO A;  2PWJ A;  5D9X A;  3KH9 A;  2DJ2 A;  4HSC X;  1THX A;  2O89 A;  2WJU A;  2IN3 A;  13GS A;  4NV5 A;  5IMF A;  2VLV A;  4BIK A;  3MYD A;  4PNF A;  1OYJ A;  4BL7 A;  1Z9H A;  3M9K A;  4EC0 A;  3GST A;  2X8G A;  4WR5 A;  4QL7 A;  3TJF A;  2H72 A;  3UAR A;  3EVI A;  4X4J A;  1Z7P A;  4MF7 A;  2H6Z A;  1ML6 A;  2OE1 A;  4IS0 A;  1OC9 B;  4ID0 A;  3GA4 A;  2GS3 A;  3CBU A;  2LRC A;  4N0V A;  1ZOF A;  3WYW A;  1K0C A;  1ST9 A;  2QC7 A;  5J9B A;  11GS A;  4K7N A;  5FHI A;  2HZF A;  2WZ9 A;  2VLT A;  2X99 A;  4JR4 A;  5IMC A;  4QL9 A;  1FHE A;  3TRX A;  5KN3 A;  2H74 A;  2ALB A;  4XS6 A;  4MH3 A;  1XOA A;  5D9V A;  2LJR A;  2RUE A;  2EIO A;  1U88 A;  2A2S A;  4V2L A;  3CSI A;  2CAQ A;  3BCK A;  3VK9 A;  1GLQ A;  4NHZ A;  2L4C A;  4PUF C;  3HJP A;  1WIK A;  1AIU A;  3M1G A;  3HJM A;  4X43 A;  2IMI A;  4IP6 A;  4IEL A;  22GS A;  1AXD A;  3W8S A;  2OE0 A;  2YV7 A;  4Q5R A;  3ZLP A;  5KOW A;  1KBN A;  3S9F A;  1GNE A;  4RQR A;  3F3Q A;  5G5F A;  4JED A;  2GLR A;  4F0B A;  4I97 A;  1X9M B;  1B9Y C;  5LCZ A;  2RUF A;  3C1S A;  1TK8 B;  4IJI A;  4FYB A;  2JZT A;  4K0N A;  1A2J A;  3MDK A;  1T00 A;  4XRA A;  2CA8 A;  5IQY A;  2HNL A;  3WGE A;  4OFM A;  1JZW A;  3FR3 A;  4XHM A;  2EIR A;  3KGK A;  1T8E B;  5IPH A;  2B7J A;  2MMO A;  4MJA A;  2R0P A;  6GSS A;  2K9F A;  1OVN A;  3FMW A;  5B6M A;  2LTK A;  4J57 E;  4EDY A;  1S3C A;  2VAF A;  3EPT A;  2OBK A;  5IPG A;  5GST A;  3DRN A;  2DJ3 A;  2NBS A;  1SK2 A;  2B1K A;  2XBI A;  3M0F A;  3TCO A;  2X8C A;  1R5A A;  1JHB A;  1VF2 A;  1TTZ A;  4MA9 A;  1SYX A;  5JCU A;  2A4H A;  5HR0 A;  1Y6E A;  3TRP A;  2A4V A;  2H76 A;  4WXT A;  3UBL A;  4TXV A;  4KDX A;  3D4M A;  1XBS A;  2REM A;  4PXO A;  4NWY A;  1BX9 A;  5HFI A;  4JBB A;  4IP1 A;  4WF5 A;  3GV1 A;  2L5L A;  4MF5 A;  5G5E A;  4Q5Q A;  5G1L A;  1PGT A;  2XBQ A;  4Z2R A;  1XCC A;  4ZB8 A;  1K3Y A;  3VLN A;  1X9W B;  4I5Q A;  4L5O A;  1GSF A;  4TR1 A;  2OAD A;  3Q74 A;  3O6T A;  1GUM A;  2JU5 A;  1ABA A;  4PNG A;  2Z9S A;  2FCH A;  2C0E A;  2MMZ A;  1GSE A;  5ECI B;  5IIZ A;  4WET A;  2VD1 A;  2VO4 A;  3P8W A;  5D8I A;  2H19 A;  5HFG A;  1K0D A;  3RHB A;  3UAP A;  2FLS A;  3BD2 A;  1EGO A;  3IHG A;  2GST A;  2DML A;  1HNC A;  2I81 A;  1VF4 A;  4ZIL A;  3US3 A;  3APO A;  5KN0 A;  1MTC A;  4FIW A;  5DJL A;  3GFK A;  4XIH A;  2GDR A;  2H1B A;  2FNO A;  1YKA A;  4PQ1 A;  3HA9 A;  5JWQ B;  3HD5 A;  4LMV A;  5EL8 A;  3GH9 A;  2P0G A;  1X9S B;  1EP8 A;  3TOU A;  4GQC A;  3BJ5 A;  2H8L A;  1QGV A;  1ERT A;  5DBQ A;  5H5R A;  2CT6 A;  3F0I A;  5F07 A; 
#chains in the Genus database with same CATH homology
 1M9B A;  3RHC A;  1PMT A;  1MEK A;  4V2N A;  4ACS A;  2JZR A;  5G1K A;  2KOK A;  1ZMA A;  3JCM L;  4HU9 A;  4F82 A;  4HJM A;  2WGR A;  4YQM A;  3ZIV A;  5C00 A;  4MZB A;  4TXO B;  1H75 A;  2HI7 A;  1N8J A;  2IMD A;  2CVB A;  2OA7 A;  3VUR A;  3IRA A;  2VM2 A;  2DJ1 A;  3I6A A;  3J7Y b;  4ZL7 A;  3DGQ A;  3GNJ A;  1OE7 A;  2FA8 A;  3KTB A;  2FD3 A;  2DIY A;  4GQF A;  3F4R A;  3PGT A;  3UVT A;  2YZH A;  4RQX A;  5F06 A;  2JAC A;  1F2E A;  1XWC A;  2CQ9 A;  1OC8 A;  2X64 A;  2B7K A;  4K7I A;  2F51 A;  3HVV A;  4PGT A;  3TB2 A;  4XRD A;  5DAK B;  4MNN A;  3ME8 A;  2LNS A;  5ECQ B;  2ON7 A;  1GLP A;  2HSM A;  2LJA A;  2B3S A;  3R2Q A;  2AAW A;  4WBR D;  3LW9 A;  2ZUP A;  3PR8 A;  2IMF A;  3VWV A;  3VI5 A;  2IPA A;  1T4Y A;  4OCF A;  1EWX A;  3UVH A;  4AF2 A;  2XPD A;  2X49 A;  3FYG A;  4KE3 A;  5ECS A;  2GZP A;  3LEF A;  4K0G A;  2RLI A;  5A4W A;  2FWG A;  4PQH A;  1ERV A;  1BAY A;  3D22 A;  1J0F A;  4ML1 A;  5DQS A;  4DSS A;  1A2L A;  2HXK A;  1Z7R A;  4D73 A;  2V6O A;  3GX0 A;  4DSR A;  4FYC A;  5CP1 A;  5IMZ A;  2AYT A;  1YQ1 A;  3GTU A;  2J9H A;  3D21 A;  4GWR A;  4OD7 A;  3LWA A;  2E0Q A;  4TR0 A;  2GSR A;  4OFN A;  6GSW A;  5GZZ B;  1ACV A;  1TKD B;  2H73 A;  5KOX A;  4WR4 A;  1NSW A;  2LV3 A;  4HS1 A;  3BOA A;  3FRC A;  3O3T A;  3DXB A;  2C0G A;  1WPI A;  4FO5 A;  1U3I A;  2GT6 A;  3E9J B;  3EWL A;  3IR4 A;  5C04 A;  3FHK A;  4FH8 A;  2V6K A;  4IHU A;  3FK8 A;  2KP1 A;  1EGR A;  5IMA A;  1GUK A;  4OWY A;  4GLT A;  1GNW A;  3H1N A;  2F8A A;  1M7T A;  1GTB A;  1YKC A;  5FT3 A;  5FWG A;  1ZCP A;  3ZRD A;  3GHA A;  2L6D A;  1ZYP A;  1T3B A;  2YWM A;  2LS5 A;  1V58 A;  4IBP A;  2DJK A;  1XZO A;  4ECI A;  1VGL A;  2DIZ A;  3LXT A;  4HJ2 A;  2NPB A;  1U87 A;  4XCS A;  3GL3 A;  3GSS A;  2JZS A;  2ON5 A;  4I8B A;  4OMV A;  1XFL A;  2YZU A;  5D9T A;  5KEJ A;  3LQ7 A;  2LST A;  3BCI A;  1ERW A;  4IN0 A;  5ECP B;  1BG5 A;  1GWC A;  1PX6 A;  2L57 A;  3FR6 A;  4XS4 A;  2R0G A;  4JE1 A;  2HSH A;  3LYK A;  2JL4 A;  5JCG A;  9GSS A;  1B48 A;  4HUA A;  5ECM B;  1TI1 A;  1V98 A;  2FGX A;  5E59 A;  3CSH A;  1SKW B;  4L0W A;  5DAL A;  1F3B A;  1EV4 A;  4X1U A;  3DWV A;  3A2V A;  4MMM A;  2HFD A;  1F9M A;  1ZL9 A;  1HNA A;  1OE8 A;  2GVP A;  1XXU A;  3GL5 A;  1M0U A;  3VI7 A;  5DJM A;  5J3R A;  3VFI A;  2QA1 A;  1AC1 A;  4O92 A;  4MF6 A;  1PL1 A;  2E2G A;  4PUR A;  3TGZ A;  1SJI A;  4IQA A;  4KX4 A;  2FA4 A;  5ECH B;  1TRU A;  2WFC A;  1A0R P;  3ZVJ D;  5CRG A;  4NV2 A;  2GZZ A;  1F3A A;  2DJJ A;  3FZ9 A;  2FWH A;  5DDL A;  3LSZ A;  3WD6 A;  1OC3 A;  2D2Z A;  2IFQ B;  4DEJ A;  2C4J A;  4XS1 A;  1USB A;  1EOH A;  5JWO B;  1M2A A;  3GKN A;  2KLX A;  2C80 A;  2DKI A;  5J9C A;  2EIQ A;  2PPT A;  1O85 A;  4BA7 A;  1OC9 A;  4EF0 A;  1C72 A;  2VCV A;  3GKM A;  2LNT A;  4POK A;  2CV4 A;  3P7X A;  2E7P A;  1O8X A;  2MZC A;  1M99 A;  2CAI A;  3D5J A;  2JSZ A;  4E8H A;  1UC7 A;  2R37 A;  4G10 A;  5IMV A;  4Z2U A;  4IJ3 A;  3U6V A;  2KP2 A;  2VL2 A;  1EEJ A;  3A3T A;  5CNW A;  4NMU A;  4KSM A;  1Z3E A;  5B8B A;  14GS A;  4O5U A;  3KMO A;  1K0A A;  1FO5 A;  3DKS A;  4CHS A;  1YF1 A;  5ECK B;  1SD8 A;  5GSS A;  1CQG A;  6GSV A;  3ZVJ A;  1A0F A;  2QA2 A;  4G0K A;  2VL3 A;  2XHF A;  3HXS A;  18GS A;  2GT5 A;  1G6Y A;  1JZD A;  2N5B A;  3KMN A;  3L9S A;  1GTA A;  2VM1 A;  3KP8 A;  1WMJ A;  6GSX A;  4FQU A;  5IO2 A;  1BED A;  4BVY A;  4WF4 A;  1KNG A;  4NPB A;  2CVK A;  5JCW A;  2XC2 A;  4HEA 2;  2H70 A;  2HT9 A;  1GP1 A;  2A2P A;  4YKF A;  3PIN A;  2K8S A;  2I1U A;  2R5G A;  2C8U A;  2C1Y A;  3DEX A;  2YP6 A;  1AUC A;  2VLU A;  2C0D A;  1U3A A;  4OO5 A;  1O8W A;  3QAW A;  1VRS D;  2WDU A;  4EE0 A;  3E3E A;  4KF9 A;  5IOW A;  20GS A;  1NW2 A;  2H6X A;  4ICY A;  4CDO A;  1F6M C;  1I5G A;  4ILF A;  1X5E A;  4MDC A;  1QXH A;  3TJJ A;  4MZW A;  3EMP A;  3CYN A;  4K2D A;  3TKQ A;  1R5P A;  3IV4 A;  2HSY A;  4BPY A;  2V32 A;  3SBC A;  5CRE A;  4TR3 A;  3C71 A;  2B5Y A;  3UJ1 A;  3RAZ A;  4YQU A;  3QR6 A;  1ZYQ B;  1AQV A;  1PKZ A;  4O5Q A;  1SL1 B;  1EOG A;  1CQH A;  1GTI A;  5CRW A;  2I4A A;  3TUE A;  3IDV A;  2YWN A;  3QOU A;  2IMK A;  1GUH A;  2B6M A;  1M2B A;  4L8E A;  3QPM A;  1DE2 A;  2DSA A;  4ECB A;  6GSU A;  3EYT A;  4LMW A;  2VIM A;  4ML6 A;  2PMT A;  3ZRE A;  1MDJ A;  1OAZ A;  3PPU A;  3HZ8 A;  4NHW A;  1GL8 A;  3CTG A;  4RI6 A;  2VCT A;  3IOS A;  2C3Q A;  5DCG A;  4IVF A;  3F6D A;  2B1L A;  4CY8 A;  4NXI A;  1YZX A;  2YNX A;  3LFL A;  5AN1 A;  3F6F A;  3VWX A;  4RUV A;  4K8M A;  4LA1 A;  1FB6 A;  3W6G A;  2YAN A;  2M72 A;  4K7O A;  3HKR A;  4MK3 A;  2YPM A;  2LJK A;  3A5I A;  5DQY A;  1NHO A;  1GSY A;  2HRK A;  4YH2 A;  1FOV A;  3MSZ A;  4USS A;  5LD0 A;  4EDZ A;  4F2I A;  1SU9 A;  1X0R A;  1M9A A;  5A4V A;  3CRU A;  3LOR A;  4X0X A;  17GS A;  2LRT A;  5DCH A;  4TXO A;  5COH A;  2A2R A;  2TIR A;  2G2Q A;  5GAP D;  3C7M A;  1NHY A;  1XWK A;  5F8B A;  2F3M A;  1K0M A;  3ZZX A;  5KN2 A;  2B5E A;  4MZC A;  4TR4 A;  2H66 A;  1ZZY A;  4HI7 A;  4KCE A;  1KEB A;  3K8N A;  1JZO A;  2G0F A;  1TRS A;  1W89 A;  1MD3 A;  3KZQ A;  5ECN B;  5HFK A;  2L59 A;  2P5Q A;  1IYH A;  1GSQ A;  2HE3 A;  5J5N A;  4ZBB A;  4ZB6 A;  2PER A;  1R26 A;  2DMM A;  3N5O A;  2K6V A;  1B8X A;  3TKS E;  3A2X A;  4TVE A;  4F9Z A;  2CX3 A;  1JLW A;  3MAK A;  3V1W A;  3DYR A;  5AIX A;  3KTL A;  2VCW A;  3APQ A;  3ZYW A;  4ZB9 A;  1SD9 A;  4N0Z A;  5ECL B;  4G0L A;  1DE1 A;  5IMD A;  1M2D A;  2GSQ A;  1YDK A;  4IQ1 A;  1V57 A;  4ZIJ A;  2HZE A;  2H01 A;  2GQL A;  1GTU A;  2H30 A;  5ELG A;  3F63 A;  4ZXG A;  3KH7 A;  1KTE A;  1BQ7 A;  4HU7 A;  2OBI A;  1YEX A;  4KUN A;  1EP7 A;  2QGV A;  1YF0 A;  4PX1 A;  4EL1 A;  1UVZ A;  2TRX A;  2X8H A;  1QK8 A;  4WBJ A;  4DSQ A;  3LG6 A;  3F4T A;  3TKP A;  1SK0 A;  3EUR A;  1V2A A;  1E6B A;  1ON4 A;  3IAS 2;  4GF0 A;  1TP9 A;  5ID2 A;  2LRN A;  2VL2 C;  3U5R E;  10GS A;  2OAC A;  3HDC A;  2PVQ A;  1PN0 A;  3GX8 A;  4K5S A;  3DVX A;  1T1V A;  2M46 A;  2PUK C;  3L4N A;  4BWS A;  3FZ5 A;  4EUY A;  2R3X A;  2AB6 A;  3Q19 A;  3Q6O A;  1A2M A;  3GTU B;  2H71 A;  2IJY A;  2O8V B;  2DBC A;  1Y25 A;  1QUW A;  3QAV A;  4O5R A;  5B7C A;  2ES7 A;  3L78 A;  4HQZ A;  1TJD A;  3CTF A;  3ZIT A;  3ERF A;  1TRV A;  3LJR A;  2GQM A;  3CSJ A;  3F9U A;  3IK9 A;  4BVX A;  3VWU A;  1URM A;  1TOF A;  4LL1 B;  1HQO A;  3KP9 A;  3NZN A;  5ABR A;  3GKK A;  4L0U A;  4PTS A;  5G30 A;  2YV9 A;  3QFA C;  4V2M A;  2DJ0 A;  4EVM A;  1TI3 A;  2WB9 A;  4JRR A;  3C8E A;  1K0N A;  1PQN A;  2DLX A;  4ISD A;  4J56 E;  4LLR A;  3M9J A;  3ME7 A;  3AY8 A;  2TRC P;  3RDW A;  4I2T A;  1GSU A;  3VPQ A;  1Q4J A;  3IHQ A;  4AJ7 A;  3I69 A;  1NM3 A;  3HZ4 A;  2BMX A;  2R0C A;  4HDE A;  3L9U A;  1Z6N A;  1AQW A;  2CZ3 A;  5AIV A;  2HRA A;  3M3M A;  2OJL A;  1UA5 A;  3F4S A;  1DUG A;  5IM9 A;  1RW1 A;  4NAX A;  3IE3 A;  1X5D A;  2WUL A;  3HJO A;  4KCA A;  2GSS A;  1ZYN A;  4TW5 A;  3ZL5 A;  2H0I A;  1K0B A;  1T4Z A;  5J41 A;  4GTU A;  1ILO A;  5DAL B;  2HLS A;  2L5O A;  3GUR A;  1SKR B;  1IYI A;  1PSQ A;  1J9B A;  1EEM A;  1GRX A;  1JZR A;  3M8N A;  1TW9 A;  5BMU A;  4MCU A;  4OCE A;  4L5L A;  4MLY A;  4K2X A;  4KA0 A;  1E2Y A;  3G9B A;  2PN8 A;  2KUC A;  3HVS A;  1XW6 A;  2VCQ A;  5HR1 A;  2YWI A;  1XPV A;  4AGS A;  2K8V A;  3TJG A;  2N5A A;  1EV9 A;  4BWQ A;  2AV4 A;  3IBH A;  2GGT A;  3F8U A;  3D6I A;  1K3L A;  2RM6 A;  2LKU A;  1HYU A;  1W4V A;  6GSY A;  4EO3 A;  1I9D A;  1PN9 A;  3HY2 A;  3WGD A;  4V1A p;  2V2G A;  4MPG A;  4YAP A;  3MIX A;  2N5F A;  3I9V 2;  1XIY A;  2IL3 A;  2MBT A;  1OKD A;  1BYE A;  1LU4 A;  1SJZ A;  1XW5 A;  3VWW A;  2B5X A;  3ISO A;  3H79 A;  3GRX A;  1A23 A;  1VF1 A;  5LNK e;  2R6K A;  4BL7 B;  5F0G A;  2CZ2 A;  1RQM A;  4HOJ A;  2AJQ B;  1PL2 A;  1THO A;  1T7P B;  4KSO A;  2JAD A;  4ECC A;  4GSS A;  5ECR B;  3PH9 A;  3KEB A;  3HCZ A;  4ZL9 A;  2PU9 C;  5CRH A;  4Z7X A;  4K9Z A;  1A8L A;  4N10 A;  1TRW A;  2LUS A;  4RI7 A;  1LJR A;  2BTO T;  2IWT A;  1XWB A;  2AUV A;  1WRY A;  4J2F A;  1QFN A;  1WOU A;  2DKH A;  2C3N A;  2HYX A;  5ENU A;  2C0F A;  3SWL A;  2ZCT A;  4HZ4 A;  4CW9 A;  1X5C A;  4MAB A;  2WCI A;  4POL A;  1SYR A;  1AW9 A;  3QFB C;  1RK4 A;  2H1D A;  5ELA A;  2YCD A;  1K3O A;  2GTU A;  3FZA A;  3TKS A;  5KN1 A;  5F05 A;  1V9W A;  1TDI A;  2L4Q A;  3ZTL A;  3MNG A;  1LBK A;  4BVY B;  1ZYE A;  3GN3 A;  4DVC A;  2LEG A;  3ED3 A;  19GS A;  3KJY A;  4ZL8 A;  1R7H A;  1ZGN A;  4TRX A;  1H4O A;  3FKF A;  4V1A g;  5L71 A;  4WKW A;  4KND A;  1O73 A;  2FHE A;  2GZY A;  3WT2 A;  3ZFL A;  2H1A A;  2P5R A;  3I43 A;  3OR5 A;  3GUS A;  1MDI A;  3TJK A;  2VCZ A;  1YJ6 A;  3LXZ A;  1G7O A;  2IME A;  16GS A;  4I2U A;  3TKR A;  3EU3 A;  4H86 A;  4ZBD A;  2VL9 A;  4QQ7 A;  2X4A A;  2K18 A;  1XW9 A;  3IAM 2;  1SL0 B;  3O76 A;  2NVL A;  1G6W A;  3UOM A;  3G7J A;  3FEU A;  5AIS A;  5H5S A;  4GSN A;  1B9X C;  5ECO B;  1GUL A;  2MMN A;  4K5R A;  1TK5 B;  4MP4 A;  2O85 A;  3IC8 A;  2DC5 A;  2JSY A;  2H1G A;  1A24 A;  4JU5 A;  4GXZ A;  4TN8 A;  4N30 A;  4Z2T A;  3G7Y A;  5DVB A;  2J23 A;  1EZK A;  4GST A;  3HYP A;  5AGY A;  3BBY A;  2P31 A;  2FUG 2;  5H5Q A;  2OE3 A;  5HR2 A;  3W8J A;  1N2A A;  1Z5Y E;  4G9H A;  2NTO A;  3DVW A;  8GSS A;  2YN1 A;  4KDY A;  2YJ7 A;  4EIQ A;  3D4T A;  1GSS A;  2YJH A;  2BJX A;  4Q5N A;  1PA3 A;  12GS A;  4YQV A;  3EMX A;  5G2Z A;  4TR1 B;  1F37 A;  4POM A;  4G19 A;  1SL2 B;  4KGI A;  4KAE A;  4IW9 A;  3QMX A;  2FWF A;  3ZML A;  1Q98 A;  2IIY A;  2O87 A;  4IKH A;  5J4U A;  1FW1 A;  2H0G A;  2RM5 A;  1TXX A;  3IK7 A;  1U6T A;  1XWG A;  1PKW A;  2CVD A;  3VPT A;  5A4U A;  1WP0 A;  4TKY A;  3MWH A;  1WE0 A;  4LL4 B;  2VCX A;  2QKE A;  1G0T A;  2WRT A;  4OFT A;  3RBT A;  3ERW A;  2KHP A;  5D9W A;  1BJX A;  2GQK A;  4JR6 A;  2MBS A;  1FG4 A;  1O81 A;  2MYG A;  3EU4 A;  1GH2 A;  5D96 A;  2NDO A;  3KIJ A;  5DAK A;  5E4W A;  2HRF A;  2H75 A;  2YWO A;  3ZFB A;  4KH7 A;  1SK1 A;  2R4V A;  2RII A;  1SEN A;  1Z6M A;  1R4W A;  1WJK A;  2V1M A;  3FR9 A;  4YAV A;  5IO0 A;  3EC3 A;  5B8A A;  3TRQ A;  3NIV A;  1K0O A;  2OKA A;  2PBJ A;  2HRN A;  3C1R A;  2I9H A;  1XOB A;  4ULX A;  1AAZ A;  1QQ2 A;  5D73 A;  3RPN A;  3UL3 A;  5CO3 A;  3ZMK A;  2L6C A;  3N9J A;  3QDN A;  1J08 A;  4Q5F A;  3FY7 A;  3TDG A;  2LQQ A;  5EY6 A;  1UN2 A;  6GST A;  5EPF A;  4K6X A;  3H93 A;  3HVX A;  4POB A;  4EXJ A;  4AJ8 A;  5D93 A;  4I6X A;  3A2W A;  2CX4 A;  1DSB A;  1AQX A;  3DML A;  4ECJ A;  2ZNM A;  3KM6 A;  1HD2 A;  5A5K A;  1O7U A;  2E2M A;  4A5P A;  2WS2 A;  5G31 A;  4CY6 A;  3H8Q A;  3APS A;  3UBK A;  3LYP A;  1FB0 A;  1DBY A;  1OKT A;  5B6N A;  2R2J A;  4TOP A;  3IXR A;  1B4Q A;  4GCI A;  3J7Y k;  4E8E A;  2FY6 A;  3GYK A;  1HNB A;  4HZ2 A;  4EKZ A;  3TOT A;  3IPZ A;  1MD4 A;  5CYY A;  2PVO C;  1A8Y A;  2O7K A;  1S3D A;  2YOI A;  3GH6 A;  2HZE B;  2VOC A;  1XWA A;  1SKS B;  1S3A A;  1YEP A;  4XTS A;  4IGJ A;  4PQI A;  1XVW A;  5EVO A;  3QCP A;  2EC4 A;  3C73 A;  5CRD A;  3DD3 A;  2M80 A;  5INY A;  1GSD A;  4DSS B;  2F9S A;  4D73 B;  5HQP A;  1TU7 A;  1SJ6 A;  4O32 A;  3ZIJ A;  3Q18 A;  3UEM A;  3H4K A;  1TK0 B;  3F3R A;  4PUA A;  3EIN A;  3WGX A;  1XVQ A;  3FW2 A;  2VD0 A;  1FVJ A;  4MH2 A;  5ID2 B;  3L9V A;  3WT1 A;  4WEY A;  3CRT A;  5HR3 A;  4KW6 A;  1JLV A;  3RPP A;  2VUP A;  7GSS A;  1WWJ A;  4FYU A;  4N11 A;  4YKG A;  4KB3 A;  4ZBA A;  1V40 A;  1PX7 A;  2PGT A;  4P3Y B;  3IA1 A;  5CAX A;  3GMF A;  2LQO A;  4O7H A;  3P2A A;  3IC4 A;  2MMA A;  4F03 A;  4K1F A;  1PRX A;  4MPF A;  3UMA A;  3KCM A;  2F8F A;  4G2E A;  2C3T A;  3NOF A;  4KDU A;  4JZQ A;  5BRT A;  2QSI A;  5IOX A;  3FZ4 A;  2I3Y A;  1ERU A;  3KD0 A;  3R3E A;  3EE2 A;  4BVX B;  1FAA A;  3G7I A;  4F0C A;  3L0H A;  3LGC A;  3TKS C;  4MJB A;  3UIW A;  4OO4 A;  1G7E A;  3D0Z A;  2XPE A;  1YY7 A;  4G0I A;  2IFQ A;  5GAN D;  4GRF A;  3DIE A;  3QD9 A;  1VF3 A;  1MDK A;  1QMV A;  4HQS A;  4MJE A;  2UZ8 A;  2V41 A;  4XS4 B;  3HHV A;  3ERG A;  1FVK A;  3GIX A;  3A5W A;  1PD2 1;  3P90 A;  4MJC A;  1TU8 A;  1JFU A;  3TJB A;  5JWR B;  4AJ6 A;  3GKX A;  3E0U A;  3CMI A;  1FOH A;  1O6J A;  2FWE A;  3CXG A;  2AHE A;  1B4P A;  2H0H A;  2H6Y A;  4EIP A;  3QAG A;  3KXO A;  2PWJ A;  5D9X A;  3KH9 A;  2DJ2 A;  1THX A;  2O89 A;  2WJU A;  2IN3 A;  13GS A;  4NV5 A;  5IMF A;  2VLV A;  3MYD A;  4PNF A;  1OYJ A;  4BL7 A;  1Z9H A;  3M9K A;  4EC0 A;  3GST A;  2X8G A;  4WR5 A;  4QL7 A;  3TJF A;  2H72 A;  3UAR A;  3EVI A;  4X4J A;  1Z7P A;  4MF7 A;  2H6Z A;  1ML6 A;  2OE1 A;  4IS0 A;  1OC9 B;  4ID0 A;  3GA4 A;  2GS3 A;  3CBU A;  2LRC A;  4N0V A;  1ZOF A;  3WYW A;  1K0C A;  1ST9 A;  2QC7 A;  5J9B A;  11GS A;  4K7N A;  5FHI A;  2HZF A;  2WZ9 A;  2VLT A;  2X99 A;  4JR4 A;  5IMC A;  4QL9 A;  1FHE A;  3TRX A;  5KN3 A;  2H74 A;  2ALB A;  4XS6 A;  4MH3 A;  1XOA A;  5D9V A;  2LJR A;  2RUE A;  2EIO A;  1U88 A;  2A2S A;  4V2L A;  3CSI A;  2CAQ A;  3BCK A;  3VK9 A;  1GLQ A;  4NHZ A;  2L4C A;  4PUF C;  3HJP A;  1WIK A;  1AIU A;  3M1G A;  3HJM A;  4X43 A;  2IMI A;  4IP6 A;  4IEL A;  22GS A;  1AXD A;  3W8S A;  2OE0 A;  2YV7 A;  4Q5R A;  3ZLP A;  5KOW A;  1KBN A;  3S9F A;  1GNE A;  4RQR A;  3F3Q A;  5G5F A;  4JED A;  2GLR A;  4F0B A;  4I97 A;  1X9M B;  1B9Y C;  5LCZ A;  2RUF A;  3C1S A;  1TK8 B;  4IJI A;  4FYB A;  2JZT A;  4K0N A;  1A2J A;  3MDK A;  1T00 A;  4XRA A;  2CA8 A;  5IQY A;  2HNL A;  3WGE A;  4OFM A;  1JZW A;  3FR3 A;  4XHM A;  2EIR A;  3KGK A;  1T8E B;  5IPH A;  2B7J A;  2MMO A;  4MJA A;  2R0P A;  6GSS A;  2K9F A;  1OVN A;  3FMW A;  5B6M A;  2LTK A;  4J57 E;  4EDY A;  1S3C A;  2VAF A;  3EPT A;  2OBK A;  5IPG A;  5GST A;  3DRN A;  2DJ3 A;  2NBS A;  1SK2 A;  2B1K A;  2XBI A;  3M0F A;  3TCO A;  2X8C A;  1R5A A;  1JHB A;  1VF2 A;  1TTZ A;  4MA9 A;  1SYX A;  5JCU A;  2A4H A;  5HR0 A;  1Y6E A;  3TRP A;  2A4V A;  2H76 A;  4WXT A;  3UBL A;  4TXV A;  4KDX A;  3D4M A;  1XBS A;  2REM A;  4PXO A;  4NWY A;  1BX9 A;  5HFI A;  4JBB A;  4IP1 A;  4WF5 A;  3GV1 A;  2L5L A;  4MF5 A;  5G5E A;  4Q5Q A;  5G1L A;  1PGT A;  2XBQ A;  4Z2R A;  1XCC A;  4ZB8 A;  1K3Y A;  3VLN A;  1X9W B;  4I5Q A;  4L5O A;  1GSF A;  4TR1 A;  2OAD A;  3Q74 A;  3O6T A;  1GUM A;  2JU5 A;  1ABA A;  4PNG A;  2Z9S A;  2FCH A;  2C0E A;  2MMZ A;  1GSE A;  5ECI B;  5IIZ A;  4WET A;  2VD1 A;  2VO4 A;  3P8W A;  5D8I A;  2H19 A;  5HFG A;  1K0D A;  3RHB A;  3UAP A;  2FLS A;  3BD2 A;  1EGO A;  3IHG A;  2GST A;  2DML A;  1HNC A;  2I81 A;  1VF4 A;  4ZIL A;  3US3 A;  3APO A;  5KN0 A;  1MTC A;  4FIW A;  5DJL A;  3GFK A;  4XIH A;  2GDR A;  2H1B A;  2FNO A;  1YKA A;  4PQ1 A;  3HA9 A;  5JWQ B;  3HD5 A;  4LMV A;  5EL8 A;  3GH9 A;  2P0G A;  1X9S B;  1EP8 A;  3TOU A;  4GQC A;  3BJ5 A;  2H8L A;  1QGV A;  1ERT A;  5DBQ A;  5H5R A;  2CT6 A;  3F0I A;  5F07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...