1TI1A

Crystal structure of a mutant dsba
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
186
structure length
186
Chain Sequence
b'YEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Intriguing conformation changes associated with the trans/cis isomerization of a prolyl residue in the active site of the DsbA C33A mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 63
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ti1A00
1PKWA 4HJMA 3V1WA 1GRXA 4TRXA 2QSIA 1A0RP 1G6WA 2DJJA 2YP6A 5INYA 1EWXA 1MDJA 1X5EA 1DE2A 4IP6A 4MF7A 3TDGA 2H6XA 3TJFA 4WETA 3GN3A 3PGTA 2C3QA 3ZVJD 3L0HA 3VLNA 3FHKA 4FH8A 1Z7PA 2VCZA 2OJLA 5JWRB 3VWWA 4NHZA 5HFIA 1TI3A 1VRSD 2EIQA 1OKTA 2O85A 1SU9A 5KN3A 1SK2A 3C71A 1UA5A 1X5DA 4ZXGA 3QOUA 2HLSA 4KGIA 1GP1A 2GZZA 3ZRDA 2GSTA 3UVTA 4GCIA 4HJ2A 3DGQA 2XHFA 3TJKA 5G5EA 3M3MA 2HFDA 1GSYA 2YPMA 1PN9A 4ILFA 2MMNA 1YY7A 1W89A 4IS0A 2H74A 5FHIA 1MDKA 4HZ2A 3FZ9A 4WF4A 1K3LA 1HQOA 3HVXA 4JBBA 1PL1A 2I81A 1EZKA 1FAAA 4MDCA 3N9JA 1OE8A 4GWRA 4F2IA 1ON4A 2YWMA 4KW6A 2LRNA 1G7OA 2WRTA 2GSQA 2MBSA 2K9FA 5FWGA 2JSYA 4MP4A 3ZITA 2A2RA 3D21A 1CQGA 3UMAA 2F8AA 3KJYA 1W4VA 3WGXA 5CREA 2JSZA 4WXTA 2VLTA 4HU7A 4V2MA 3ZYWA 5GZZB 1OAZA 2GLRA 2IFQA 3O6TA 2G2QA 1QMVA 1SENA 2G0FA 4BWQA 4DEJA 2CA8A 2XPDA 4ID0A 3FW2A 3H79A 4OFMA 4G2EA 4E8EA 3HYPA 1ACVA 2VLUA 1EGRA 5ELGA 1G7EA 3KXOA 1N2AA 1SYRA 1FHEA 2AB6A 5HR3A 2H0IA 4IQ1A 1ML6A 2VAFA 3F8UA 4NAXA 5HR1A 3ME8A 1XOAA 2DC5A 4ZL9A 2O89A 1TK8B 6GSUA 2ES7A 3TB2A 2DIYA 2P31A 3IK7A 3TRQA 1M2DA 5F0GA 5IPHA 4MABA 4K7NA 2C8UA 4F9ZA 4EC0A 3UBLA 3UEMA 1JZDA 2V2GA 4XIHA 3DIEA 1ZOFA 1FO5A 2O8VB 4IVFA 3ME7A 3KTBA 3ZFLA 1OC8A 3CBUA 1YDKA 1WPIA 1ERUA 1V9WA 1FG4A 1LU4A 3F4TA 1DE1A 2PVOC 3JCML 3UAPA 4XCSA 3MAKA 4EO3A 1VF2A 2B1KA 5EL8A 4CW9A 4PGTA 3L4NA 4MPGA 1YKAA 2AV4A 4TR0A 4ZB8A 2YWIA 5EVOA 4CDOA 4BVXA 3UVHA 2HNLA 1TRVA 1XCCA 4TR1B 1WWJA 3VPQA 2H76A 2HRFA 1K0NA 2VL2C 3GTUB 4KDYA 1RK4A 5IPGA 1MD4A 3APSA 3BCKA 3G7JA 2YWOA 2ZCTA 2JADA 3FKFA 2LS5A 1GTIA 3UOMA 1DBYA 4OCFA 5IMDA 2YJHA 4JZQA 4N0ZA 3US3A 5F05A 2H0GA 4IKHA 2VO4A 2DMMA 3M0FA 4JU5A 4HZ4A 5D93A 2VOCA 5A5KA 3HXSA 1SK0A 2GSRA 4L0UA 2VM2A 1XPVA 4H86A 2MMAA 5JCWA 1XW5A 2K18A 1R5AA 3GUSA 2OKAA 4OWYA 2CX4A 5IO2A 1T7PB 4ECBA 2PBJA 1X9WB 5D96A 3FZ5A 1PD21 3D6IA 3RDWA 3WD6A 1MEKA 2VCTA 5KN1A 1QK8A 3TUEA 2EIRA 1SD8A 2NBSA 2HRNA 5IIZA 4XS6A 5E4WA 1OYJA 2LSTA 1BEDA 4JEDA 1THXA 1GLQA 1A2JA 4YQUA 2FWGA 5F8BA 1F2EA 1K3OA 4EDYA 1ILOA 4KA0A 2H01A 2KLXA 3ZREA 2HT9A 3W8JA 5ECHB 3ZMKA 3CSIA 1HNCA 5AISA 4N0VA 1T1VA 3F3QA 3HKRA 4D73B 1TJDA 1K0AA 3BOAA 5KN0A 3Q6OA 5CO3A 4HQSA 2GZYA 4MZCA 2OADA 1B4QA 1Y25A 2REMA 4YQMA 2HZEB 2DJ0A 1ZYEA 1BQ7A 4AJ6A 3KM6A 5IMCA 2B5XA 13GSA 1F6MC 5ID2A 5IMFA 2GVPA 3G9BA 1QQ2A 4EE0A 4ISDA 5H5QA 4V2NA 2BMXA 3I9V2 2OBKA 5ECQB 2H0HA 3GSTA 3GH9A 1MTCA 3UBKA 1I5GA 1AQXA 1TP9A 2AJQB 2I4AA 1OC9B 2CAIA 1O8XA 1LJRA 5B7CA 1O6JA 3UARA 4EXJA 2YCDA 5L71A 5J9BA 1YF1A 6GSXA 1J9BA 1RQMA 1IYHA 4JE1A 4O5RA 5D8IA 3TRPA 2HYXA 4KB3A 5EY6A 3HVVA 1K0CA 1M0UA 2HE3A 3DEXA 4NMUA 1JLWA 3QDNA 1F3AA 1ZMAA 4TXOA 3IE3A 2YNXA 17GSA 3OR5A 6GSVA 5G2ZA 5ABRA 4KCEA 1FVJA 2RLIA 3TOTA 3BCIA 2LNSA 2FHEA 2QKEA 1Y6EA 2X64A 3DXBA 4AGSA 5ECKB 9GSSA 3HJMA 1TOFA 2F3MA 1QGVA 2B3SA 5DCHA 2AHEA 3HVSA 3DVWA 5ECSA 3TKPA 2VM1A 3ZFBA 1G6YA 5B6MA 2V1MA 2YZUA 5CRHA 3F4RA 1THOA 2D2ZA 2E0QA 1B9XC 1ST9A 4ZL7A 2TRCP 2KP1A 2O7KA 4Q5RA 2RUFA 2GQKA 2LRCA 3IOSA 3LEFA 1TK5B 1WRYA 1UVZA 1ERVA 5GSSA 1N8JA 3H4KA 4K0GA 2C0DA 4AF2A 2L5OA 3FYGA 4ZILA 2KHPA 22GSA 8GSSA 2H1DA 1WOUA 2C1YA 1RW1A 3NZNA 1F3BA 2PWJA 4L0WA 3KMOA 2QGVA 2PMTA 4PUFC 5DQYA 2H73A 2FCHA 4EVMA 1AW9A 3D4MA 2L6CA 4KDUA 3UL3A 1Z6NA 4KAEA 3D22A 4RI6A 5G31A 3CTFA 5HR2A 3QFBC 1MD3A 1OC3A 4G10A 1T8EB 1GSSA 5J5NA 1TRWA 1M99A 1M2AA 4ZBBA 4PX1A 4TKYA 3QAWA 3A2WA 3C1SA 5DALB 1R26A 3TKSC 3KEBA 1Q4JA 4I6XA 4XTSA 2QC7A 4KSMA 1PMTA 2DBCA 1X9MB 3LYKA 16GSA 1Z6MA 5H5RA 2JACA 2E2GA 3GHAA 4X43A 4DSSA 3DKSA 5CNWA 1FVKA 3G7IA 3FZ4A 1PL2A 4JRRA 3KZQA 2I3YA 4HDEA 1H4OA 3S9FA 1O8WA 2N5AA 4MMMA 4EDZA 2IJYA 3E3EA 2PU9C 1XW6A 2HSHA 3KIJA 1O81A 3DVXA 3QFAC 3RBTA 5DCGA 1K3YA 4KDXA 1TW9A 1XWKA 4I8BA 4PXOA 4HQZA 5C04A 3TGZA 1TXXA 2VCVA 1GSQA 1A0FA 4MJAA 3M9JA 4LMWA 1S3CA 4I2UA 4O7HA 2ON7A 3O76A 1AUCA 4TR3A 4POMA 3MWHA 3CXGA 5DAKB 1SKWB 5B8BA 3GL5A 1EP7A 6GSYA 3CSJA 1XXUA 1DUGA 3N5OA 2XPEA 3IK9A 2VCXA 1TRUA 18GSA 4XS4A 3VK9A 4MH2A 2VL2A 5J41A 2RM5A 4K1FA 1QXHA 2WS2A 4F0BA 4GF0A 2I1UA 2VD0A 12GSA 3LQ7A 4L5OA 2L59A 4MLYA 3FY7A 2FA4A 4RQXA 2K8SA 3VWVA 1XWBA 2F8FA 1A8LA 4GQFA 2CVDA 1VF4A 3U6VA 2FLSA 1U88A 2CVKA 4JR6A 4O92A 3TJBA 3GNJA 3R2QA 3ISOA 4MH3A 1GH2A 3L9VA 2AUVA 4L8EA 3TOUA 3UIWA 1BYEA 5G1LA 4IHUA 2MMOA 4ECCA 3GRXA 5CRGA 1BX9A 2GT5A 1GUMA 3WGEA 3F9UA 1Z9HA 3DRNA 4MK3A 3HJOA 3IAS2 4TW5A 3D5JA 1TU7A 1FW1A 1ZGNA 3P8WA 4EL1A 1GSFA 2H6YA 4MPFA 1GTUA 5J3RA 4OMVA 2RUEA 1PGTA 1ZCPA 2FWEA 2PN8A 1SJIA 2R5GA 1J0FA 2IMEA 2VD1A 1KEBA 3PR8A 4ZB9A 1PQNA 4XHMA 1WP0A 2CZ2A 3IA1A 2DJ1A 5AGYA 3GFKA 1XBSA 1BJXA 1PA3A 4TOPA 5DQSA 1Z3EA 2C0GA 4BVYA 4LL4B 1XW9A 1JHBA 4IBPA 1E2YA 1YQ1A 3LFLA 1XIYA 1A2LA 2WB9A 1FB6A 2YN1A 3IDVA 5IOXA 1ERTA 2MBTA 3RAZA 3CTGA 4FYUA 3FR9A 1NSWA 3BD2A 5AIXA 1O85A 1U3AA 2DJ2A 2AAWA 1B48A 2P0GA 2MMZA 1B9YC 10GSA 3GKMA 1U87A 4WBJA 4V1Ag 1TTZA 2M46A 3CYNA 4FYCA 2AYTA 3ERGA 1Q98A 3ZLPA 3L78A 3Q18A 3MNGA 4KSOA 4ZIJA 2YWNA 2GQLA 4TN8A 4MA9A 3ZVJA 2OE1A 2YV9A 2IMKA 3GH6A 1A23A 1H75A 3WGDA 3KCMA 2B6MA 2ZNMA 6GSWA 3F6FA 3M8NA 3IR4A 3U5RE 4N30A 3APQA 3IHQA 4OO4A 1GUKA 5A4WA 2O87A 2H1AA 2LKUA 3HHVA 3NOFA 2B5YA 3TKRA 1AIUA 3EE2A 3HCZA 2GZPA 2L6DA 1M7TA 3MDKA 1I9DA 2FWHA 4J57E 1M9BA 1TKDB 1OE7A 2GSSA 2LEGA 3TRXA 2IMDA 2J9HA 4NV5A 1X5CA 2TRXA 4LLRA 3KP8A 1M2BA 4KNDA 1OKDA 5IO0A 1K0MA 2M80A 4Q5FA 2VCWA 5IMAA 1V2AA 2YANA 5E59A 1GSEA 5AN1A 3E9JB 5GSTA 3FRCA 3SWLA 2L5LA 4QL7A 1B8XA 2IIYA 2LV3A 3BBYA 2WCIA 2C4JA 1GL8A 3GKXA 5ECIB 2DMLA 3L9SA 1JZWA 4ACSA 1J08A 4MF5A 4TVEA 5B6NA 2OE3A 4PUAA 4BPYA 3C8EA 1O73A 5EPFA 3QPMA 2R3XA 1ZL9A 1EEJA 2M72A 1WJKA 3VWUA 4Z7XA 4LA1A 4MJBA 4IN0A 3HDCA 4IJIA 3L9UA 2WULA 2N5FA 4V1Ap 3F4SA 3IPZA 5IQYA 2IFQB 4NXIA 4ZBDA 3F3RA 1CQHA 2XC2A 3MSZA 3TKSA 3QMXA 1XVQA 2VL3A 4MF6A 1HD2A 2LJKA 3ED3A 2ZUPA 4J56E 1V98A 3VI5A 4WEYA 5HR0A 4X1UA 1UC7A 2HZFA 3GSSA 3LSZA 4EKZA 4HI7A 2CAQA 4YAVA 2WJUA 4PNFA 1EV4A 4O32A 1FOVA 1T4YA 2WDUA 2YOIA 2KUCA 2H75A 2GQMA 3G7YA 2E2MA 2OA7A 3GX0A 3HA9A 5JWOB 2R4VA 4PQIA 1K0OA 3GL3A 1WMJA 1S3DA 3Q19A 1XWGA 4YH2A 1HYUA 4ULXA 2YJ7A 2FGXA 1T3BA 3RPNA 3HD5A 1X9SB 1YJ6A 1U6TA 2IN3A 4TR1A 5JCGA 2CQ9A 3FEUA 3GTUA 1GTBA 5DJMA 1IYIA 4K0NA 4BA7A 1V40A 3F63A 3D4TA 2H6ZA 3EYTA 2RIIA 5HFKA 5JWQB 1NW2A 4PURA 3C1RA 7GSSA 2NTOA 2R2JA 2JZRA 5D9XA 3WYWA 4X0XA 5DVBA 2FNOA 1O7UA 4FYBA 3KH9A 4OCEA 3CRTA 4DSRA 4GQCA 2V41A 2KP2A 2HSYA 3KP9A 2YV7A 5G30A 1XVWA 2CT6A 3I6AA 4NHWA 5IMZA 3EINA 3ZMLA 4KUNA 3H1NA 1AQVA 4IGJA 3DYRA 4NPBA 4PQ1A 1X0RA 3WT2A 2NDOA 3APOA 2VUPA 4F82A 2K6VA 3W8SA 4XRAA 4ML6A 3IBHA 3KMNA 3TCOA 1HNAA 2B7JA 2H72A 4IP1A 2DIZA 2EIOA 3RHCA 1AC1A 3A2VA 4YAPA 2L4CA 3ZTLA 1EOHA 4XS1A 3GURA 2CVBA 2H66A 3CSHA 3W6GA 1F37A 4NWYA 2H19A 5IMVA 3GIXA 19GSA 1JFUA 5IOWA 2X8HA 3C7MA 4WR5A 3EWLA 4RUVA 4NV2A 3TJGA 4QL9A 3FR6A 4EUYA 5KN2A 4I2TA 3SBCA 3UJ1A 1YZXA 2X99A 1GWCA 5ENUA 1KTEA 3HZ4A 1URMA 5G1KA 4D73A 1A8YA 1JZOA 4WBRD 4QQ7A 2X8GA 5ECOB 1KNGA 2B5EA 2HZEA 3FK8A 4PQHA 4K6XA 3RHBA 4P3YB 1YKCA 3LYPA 2CZ3A 1AXDA 2GS3A 3J7Yb 1NM3A 3J7Yk 4HS1A 4BL7A 2GGTA 2VLVA 3PH9A 1VF3A 1R7HA 1DSBA 3HJPA 1SL2B 5CP1A 1B4PA 2TIRA 1QUWA 2C0FA 3DMLA 2OACA 3EC3A 2ALBA 5CRDA 1TDIA 1PRXA 5G5FA 1OC9A 2E7PA 3D0ZA 3EU3A 3IXRA 3VWXA 4K9ZA 3A5WA 2IMFA 1EP8A 1NHYA 5FT3A 5ID2B 4ZL8A 2NVLA 3BJ5A 1EV9A 5ECPB 2H1GA 1ABAA 5D9VA 5IM9A 5ECNB 1SL1B 2OBIA 2IWTA 3DD3A 5ECLB 1VGLA 3CMIA 5D9WA 2F9SA 1ZYQB 3EU4A 2C0EA 1G0TA 4ECIA 4MZWA 4L5LA 2PVQA 1XOBA 4HU9A 4MJCA 2C3TA 2N5BA 4OO5A 3ZZXA 1GTAA 1R5PA 2OE0A 4GLTA 5A4UA 3LWAA 2IL3A 1HNBA 2L57A 2PUKC 3RPPA 4PNGA 2Z9SA 4POBA 2JZSA 2KOKA 4FO5A 3E0UA 4EF0A 4TXOB 3H8QA 3Q74A 1YF0A 3EMPA 3GKKA 3KTLA 1GSUA 2VL9A 3GMFA 1AAZA 5GAND 3GYKA 1PSQA 2PERA 5HQPA 2H71A 2K8VA 2WFCA 4GSNA 2R37A 5DBQA 1TRSA 14GSA 4KH7A 4DSQA 4KE3A 1PX7A 1GULA 3VURA 1XWCA 4MZBA 4KCAA 2FWFA 2L4QA 2P5QA 5CYYA 2H30A 3VFIA 4ML1A 3TJJA 2GT6A 4N10A 2V32A 3P90A 1SL0B 3PINA 1R4WA 4YQVA 3I43A 1XFLA 5ELAA 2CV4A 2LNTA 3M9KA 4GXZA 4Q5NA 2C3NA 4IQAA 5COHA 3P2AA 2P5RA 4FIWA 3ZIVA 4Q5QA 4GRFA 5DJLA 1SYXA 3HY2A 2YZHA 2ON5A 2XBIA 11GSA 5D9TA 1A2MA 1EOGA 5DALA 2LQOA 3IV4A 4OD7A 4N11A 4K7IA 4K8MA 3F6DA 2B1LA 1SKSB 1SJZA 2VCQA 4OFNA 4E8HA 4G9HA 2MYGA 3KGKA 4JR4A 4ZBAA 1VF1A 2XBQA 1XZOA 2C80A 4MCUA 5LCZA 4HEA2 4RQRA 1BG5A 3O3TA 2A4VA 2DSAA 2DJ3A 2EC4A 2JZTA 1ZZYA 2WGRA 2MZCA 1GNWA 2PGTA 1XWAA 5JCUA 3KD0A 2RM6A 4LL1B 20GSA 2FUG2 2WZ9A 3IC4A 5DDLA 2CX3A 3LXZA 4KX4A 1Z7RA 2LUSA 4F0CA 6GSTA 3ERFA 4IJ3A 3QAGA 3C73A 4DSSB 2NPBA 4TXVA 4GTUA 2DJKA 1S3AA 1F9MA 1JZRA 3VI7A 3EVIA 5HFGA 1Z5YE 4HUAA 5CRWA 1PX6A 3ERWA 5D73A 1PKZA 4GSSA 4RI7A 1WE0A 4CHSA 2H8LA 1C72A 1TU8A 1USBA 5DAKA 3GA4A 5C00A 5F06A 3VPTA 2JL4A 2LQQA 1GLPA 2BJXA 1V57A 3DWVA 3I69A 5H5SA 3IAM2 2LRTA 3GX8A 1YEPA 1K0BA 1T4ZA 2H1BA 2LJRA 3AY8A 3QD9A 1GUHA 3NIVA 4MJEA 1MDIA 5J4UA 2GDRA 2LTKA 5ECRB 1FB0A 4K2DA 3LXTA 3KH7A 3F0IA 3EMXA 4AJ7A 3FZAA 4XS4B 1EGOA 3GV1A 3LJRA 1SJ6A 5LD0A 2IPAA 3ZIJA 1JLVA 4IELA 1SD9A 1BAYA 3P7XA 1V58A 4HOJA 1LBKA 1YEXA 4AJ8A 6GSSA 1T00A 3LORA 1UN2A 4IW9A 3WT1A 2X8CA 2J23A 2V6KA 2V6OA 2FD3A 1WIKA 3LG6A 5ECMB 1AQWA 3TKSE 2FA8A 5LNKe 3QCPA 1TK0B 4DVCA 2JU5A 1GNEA 2I9HA 3ZL5A 5A4VA 4J2FA 1QFNA 3H93A 5KEJA 4WF5A 2FY6A 2R6KA 1TI1A 4OFTA 2PPTA 2BTOT 1EEMA 1U3IA 2GTUA 4G19A 2VIMA 4BWSA 3EURA 4POLA 3A2XA 5CAXA 4V2LA 4I97A 2H70A 5B8AA 2F51A 2HXKA 4WKWA 1E6BA 4TR4A 4POKA 2DLXA 1OVNA 1K0DA 3CRUA 5F07A 4ZB6A 1ERWA 2LJAA 3LGCA 4LMVA 3M1GA 3GKNA 4GSTA 4XRDA 3TKQA 3A3TA 3FR3A 1GSDA 4F03A 1KBNA 5GAPD 2A2SA 1A24A 4ECJA 2B7KA 2IMIA 3IRAA 1M9AA 3K8NA 4I5QA 3QR6A 1SKRB 2HI7A 4K7OA 5J9CA 1SK1A 4WR4A 1NHOA 3HZ8A 3QAVA 5AIVA
chains in the Genus database with same CATH superfamily
1PKWA 4HJMA 3V1WA 1GRXA 4TRXA 2QSIA 1A0RP 1G6WA 2DJJA 2YP6A 5INYA 1EWXA 1MDJA 4X4JA 1X5EA 1DE2A 4IP6A 4MF7A 3TDGA 2H6XA 3TJFA 4WETA 3GN3A 3PGTA 2C3QA 4K5RA 3ZVJD 3L0HA 3VLNA 3FHKA 4FH8A 1Z7PA 2VCZA 2OJLA 5JWRB 3VWWA 4NHZA 5HFIA 1TI3A 1VRSD 2EIQA 1OKTA 2O85A 1SU9A 5KN3A 1SK2A 3C71A 1UA5A 1X5DA 4ZXGA 3QOUA 2HLSA 4KGIA 1GP1A 2GZZA 3ZRDA 2GSTA 3UVTA 4GCIA 4HJ2A 3DGQA 2XHFA 3TJKA 5G5EA 3M3MA 2HFDA 1GSYA 2YPMA 1PN9A 4ILFA 2MMNA 1YY7A 1W89A 4IS0A 2H74A 5FHIA 1MDKA 4HZ2A 3FZ9A 4WF4A 1K3LA 1HQOA 3HVXA 4JBBA 1PL1A 2I81A 1EZKA 1FAAA 4MDCA 3N9JA 1OE8A 4GWRA 4F2IA 1ON4A 2YWMA 4KW6A 4FQUA 2LRNA 1G7OA 2WRTA 4G0LA 2GSQA 2MBSA 2K9FA 5FWGA 2JSYA 4MP4A 3ZITA 2A2RA 3D21A 1CQGA 3UMAA 2F8AA 3KJYA 1W4VA 3WGXA 5CREA 2JSZA 4WXTA 2VLTA 4HU7A 4V2MA 3ZYWA 5GZZB 1OAZA 2GLRA 2IFQA 3O6TA 2G2QA 1QMVA 1SENA 2G0FA 4BWQA 4DEJA 2CA8A 2XPDA 4ID0A 3FW2A 3H79A 4OFMA 4G2EA 4E8EA 3HYPA 1ACVA 2VLUA 1EGRA 5ELGA 1G7EA 3KXOA 1N2AA 1SYRA 1FHEA 2AB6A 5HR3A 2H0IA 4IQ1A 1ML6A 2VAFA 3F8UA 4NAXA 5HR1A 3ME8A 1XOAA 2DC5A 4ZL9A 2O89A 1TK8B 6GSUA 2ES7A 3TB2A 2DIYA 2P31A 3IK7A 3TRQA 1M2DA 5F0GA 5IPHA 4MABA 4K7NA 2C8UA 4F9ZA 4EC0A 3UBLA 3UEMA 1JZDA 2V2GA 4XIHA 3DIEA 1ZOFA 1FO5A 2A2PA 2O8VB 4IVFA 3ME7A 4EIPA 3KTBA 3ZFLA 1OC8A 3CBUA 1YDKA 1WPIA 1ERUA 1V9WA 1FG4A 1LU4A 3F4TA 1DE1A 2PVOC 3JCML 3UAPA 4XCSA 3MAKA 4EO3A 1VF2A 2B1KA 5EL8A 4CW9A 4PGTA 3L4NA 4MPGA 1YKAA 2AV4A 4TR0A 4ZB8A 2YWIA 5EVOA 4CDOA 4BVXA 3UVHA 2HNLA 1TRVA 1XCCA 4TR1B 1PN0A 1WWJA 3VPQA 2H76A 2HRFA 1K0NA 2VL2C 3GTUB 4KDYA 1RK4A 5IPGA 1MD4A 3APSA 3BCKA 3G7JA 2YWOA 2ZCTA 2JADA 3FKFA 2QA2A 2LS5A 1GTIA 3UOMA 1DBYA 4OCFA 5IMDA 2YJHA 4JZQA 4N0ZA 3US3A 5F05A 2H0GA 4IKHA 2VO4A 2DMMA 3M0FA 4JU5A 4HZ4A 5D93A 2VOCA 5A5KA 3HXSA 1SK0A 2GSRA 4L0UA 2VM2A 1XPVA 4H86A 2MMAA 5JCWA 1XW5A 2K18A 1R5AA 3GUSA 2OKAA 4OWYA 2CX4A 5IO2A 1T7PB 4ECBA 2PBJA 1X9WB 5D96A 3FZ5A 1PD21 3D6IA 3RDWA 3WD6A 1MEKA 2VCTA 5KN1A 1QK8A 3TUEA 2EIRA 1SD8A 2NBSA 2HRNA 5IIZA 1M3JA 4XS6A 5E4WA 1OYJA 2LSTA 1BEDA 4JEDA 5BMUA 1THXA 1GLQA 1A2JA 4YQUA 2FWGA 4G0KA 5F8BA 1F2EA 1K3OA 4EDYA 1ILOA 4KA0A 2H01A 2KLXA 3ZREA 2HT9A 3W8JA 2HRAA 5ECHB 3ZMKA 3CSIA 1HNCA 4K2XA 5AISA 4N0VA 1T1VA 3F3QA 3HKRA 4D73B 1TJDA 1K0AA 3BOAA 5KN0A 3Q6OA 5CO3A 4HQSA 2GZYA 4MZCA 2OADA 1B4QA 1Y25A 2REMA 4YQMA 2HZEB 2DJ0A 1ZYEA 1BQ7A 4AJ6A 3KM6A 5IMCA 2B5XA 13GSA 1F6MC 5ID2A 5IMFA 2GVPA 3G9BA 2HSMA 1QQ2A 4EE0A 4BL7B 4ISDA 5H5QA 4V2NA 2BMXA 3I9V2 2OBKA 5ECQB 2H0HA 3GSTA 3GH9A 1MTCA 4Z2UA 3UBKA 1I5GA 1AQXA 1TP9A 2AJQB 2I4AA 1OC9B 2CAIA 1O8XA 1LJRA 5B7CA 1O6JA 3UARA 4EXJA 2YCDA 5L71A 5J9BA 1YF1A 6GSXA 1J9BA 1RQMA 1IYHA 4JE1A 4O5RA 5D8IA 3TRPA 2HYXA 4Z2RA 4KB3A 5EY6A 3HVVA 1K0CA 1M0UA 2HE3A 3DEXA 4NMUA 1JLWA 3QDNA 1F3AA 1ZMAA 4TXOA 3IE3A 2YNXA 17GSA 3OR5A 6GSVA 5G2ZA 5ABRA 4KCEA 1FVJA 2RLIA 3TOTA 3BCIA 2LNSA 2FHEA 2QKEA 1Y6EA 2X64A 3DXBA 4AGSA 5ECKB 9GSSA 3HJMA 1TOFA 2F3MA 1QGVA 2B3SA 5DCHA 2AHEA 2X49A 3HVSA 2R0GA 3DVWA 5ECSA 3TKPA 2VM1A 3ZFBA 1G6YA 5B6MA 2V1MA 2YZUA 5CRHA 3F4RA 1THOA 2D2ZA 2E0QA 1B9XC 1ST9A 4ZL7A 2TRCP 2KP1A 2O7KA 2X4AA 4Q5RA 2RUFA 2GQKA 2LRCA 3IOSA 3LEFA 1TK5B 1WRYA 1UVZA 1ERVA 5GSSA 1N8JA 3H4KA 4K0GA 2C0DA 4AF2A 2L5OA 3FYGA 4ZILA 2KHPA 22GSA 8GSSA 2H1DA 1WOUA 2C1YA 1RW1A 3NZNA 1FOHA 1F3BA 2PWJA 4L0WA 2UZ8A 3KMOA 2QGVA 2PMTA 4PUFC 5DQYA 2H73A 2FCHA 4EVMA 1AW9A 3D4MA 2L6CA 4KDUA 3UL3A 1Z6NA 4KAEA 3D22A 4RI6A 5G31A 3CTFA 5HR2A 3QFBC 1MD3A 1OC3A 4G10A 1T8EB 1GSSA 5J5NA 1TRWA 1M99A 1M2AA 4ZBBA 4PX1A 4TKYA 3QAWA 3A2WA 2DKIA 3C1SA 5DALB 1R26A 3TKSC 3KEBA 2R0CA 1Q4JA 4I6XA 4XTSA 2QC7A 4KSMA 1PMTA 2DBCA 1X9MB 3LYKA 16GSA 1Z6MA 5H5RA 2JACA 2E2GA 3GHAA 4X43A 4DSSA 3DKSA 5CNWA 1FVKA 3G7IA 3FZ4A 1PL2A 4JRRA 3KZQA 2I3YA 4HDEA 1H4OA 3S9FA 1O8WA 2N5AA 4MMMA 4EDZA 2IJYA 3E3EA 2PU9C 1XW6A 2HSHA 3KIJA 1O81A 3DVXA 3QFAC 3RBTA 5DCGA 1K3YA 4KDXA 1TW9A 1XWKA 4I8BA 4PXOA 3MYDA 4HQZA 5C04A 3TGZA 1TXXA 2VCVA 1GSQA 1A0FA 4MJAA 3M9JA 4LMWA 1S3CA 4I2UA 4O7HA 2ON7A 3O76A 1AUCA 4TR3A 4POMA 3MWHA 3CXGA 5DAKB 1SKWB 5B8BA 3GL5A 1EP7A 6GSYA 3CSJA 1XXUA 1DUGA 4O5UA 5KOWA 3N5OA 2XPEA 3IK9A 2VCXA 1TRUA 18GSA 4XS4A 3LW9A 3VK9A 4MH2A 2VL2A 5J41A 2RM5A 4K1FA 1QXHA 2WS2A 4F0BA 4GF0A 2I1UA 2VD0A 12GSA 3LQ7A 4L5OA 2L59A 4MLYA 3FY7A 4RQXA 2FA4A 2K8SA 3VWVA 1XWBA 2F8FA 1A8LA 4GQFA 2CVDA 1VF4A 3U6VA 2FLSA 1U88A 2CVKA 4JR6A 4O92A 3TJBA 3GNJA 3R2QA 3ISOA 4MH3A 1GH2A 3L9VA 2AUVA 4L8EA 3TOUA 3UIWA 4CY8A 1BYEA 5G1LA 4IHUA 2MMOA 4ECCA 3GRXA 3MIXA 5CRGA 1BX9A 2GT5A 1GUMA 3WGEA 3F9UA 5BRTA 1Z9HA 3DRNA 4MK3A 3HJOA 3IAS2 4TW5A 3D5JA 1TU7A 1FW1A 1ZGNA 3P8WA 4EL1A 1GSFA 2H6YA 4MPFA 1GTUA 5J3RA 4OMVA 2RUEA 1PGTA 1ZCPA 2FWEA 2PN8A 1SJIA 2R5GA 1J0FA 2IMEA 2VD1A 1KEBA 3PR8A 4ZB9A 1PQNA 4XHMA 1WP0A 2CZ2A 3IA1A 2DJ1A 5AGYA 3GFKA 1XBSA 1BJXA 1PA3A 4TOPA 5DQSA 1Z3EA 2C0GA 4BVYA 4LL4B 1XW9A 1JHBA 4IBPA 1E2YA 1YQ1A 3LFLA 1XIYA 1A2LA 2WB9A 1FB6A 2YN1A 3IDVA 5IOXA 1ERTA 2MBTA 3RAZA 3CTGA 4FYUA 3FR9A 1NSWA 3BD2A 5AIXA 1O85A 1U3AA 2DJ2A 2AAWA 1B48A 2P0GA 2MMZA 1B9YC 10GSA 3GKMA 1U87A 4WBJA 4V1Ag 1TTZA 2M46A 3CYNA 4FYCA 2AYTA 3ERGA 1Q98A 3ZLPA 3L78A 3Q18A 3MNGA 4KSOA 4ZIJA 2YWNA 2GQLA 4TN8A 4MA9A 3ZVJA 2OE1A 2YV9A 2IMKA 3GH6A 1A23A 1H75A 3WGDA 3KCMA 2B6MA 2ZNMA 6GSWA 3F6FA 3M8NA 3IR4A 3U5RE 4KF9A 4N30A 3APQA 3IHQA 4OO4A 1GUKA 5A4WA 2O87A 2H1AA 2LKUA 3HHVA 3NOFA 2B5YA 3TKRA 1AIUA 3EE2A 3HCZA 2GZPA 2L6DA 1M7TA 3MDKA 1I9DA 2FWHA 4J57E 1M9BA 1TKDB 1OE7A 2GSSA 2LEGA 3TRXA 2IMDA 2J9HA 4NV5A 1X5CA 2TRXA 4LLRA 3KP8A 1M2BA 4KNDA 1OKDA 5IO0A 2R0PA 1K0MA 2M80A 4Q5FA 2VCWA 5IMAA 1V2AA 2YANA 5E59A 1GSEA 5AN1A 3E9JB 5GSTA 3FRCA 3SWLA 1S3RA 2L5LA 4QL7A 1B8XA 2IIYA 2LV3A 3BBYA 2WCIA 2C4JA 1GL8A 3GKXA 5ECIB 2DMLA 3L9SA 4ICYA 1JZWA 4ACSA 1J08A 4MF5A 4TVEA 5B6NA 2OE3A 4PUAA 4BPYA 3C8EA 1O73A 5EPFA 3QPMA 2R3XA 1ZL9A 1EEJA 2M72A 1WJKA 3VWUA 4Z7XA 4LA1A 4MJBA 4IN0A 4EIQA 3HDCA 4IJIA 3L9UA 2WULA 2N5FA 4V1Ap 3F4SA 3IPZA 5IQYA 2IFQB 4NXIA 4ZBDA 3F3RA 1CQHA 2XC2A 3MSZA 3TKSA 3QMXA 1XVQA 2VL3A 4MF6A 1HD2A 2LJKA 3ED3A 2ZUPA 4J56E 1V98A 3VI5A 4WEYA 5HR0A 5KOXA 4X1UA 1UC7A 2HZFA 3GSSA 3LSZA 4EKZA 4HI7A 2CAQA 4YAVA 1XG8A 2WJUA 4PNFA 1EV4A 4O32A 2DKHA 1FOVA 1T4YA 2WDUA 2YOIA 2KUCA 2H75A 2GQMA 3G7YA 2E2MA 2OA7A 3GX0A 3HA9A 5JWOB 2R4VA 4PQIA 1K0OA 3GL3A 1WMJA 1S3DA 3Q19A 4YKGA 1XWGA 4YH2A 1HYUA 4ULXA 2YJ7A 2FGXA 1T3BA 3RPNA 3HD5A 1X9SB 1YJ6A 1U6TA 2IN3A 4TR1A 5JCGA 2CQ9A 3FEUA 3GTUA 3FMWA 1GTBA 5DJMA 1IYIA 4K0NA 4BA7A 1V40A 3F63A 3D4TA 2H6ZA 3EYTA 2RIIA 5HFKA 5JWQB 1NW2A 4PURA 3C1RA 7GSSA 2NTOA 2R2JA 2JZRA 5D9XA 3WYWA 4X0XA 5DVBA 2FNOA 1O7UA 4FYBA 3KH9A 4OCEA 3CRTA 4DSRA 4GQCA 2V41A 2KP2A 2HSYA 3KP9A 2YV7A 5G30A 1XVWA 4BVXB 2CT6A 3I6AA 4NHWA 5IMZA 3EINA 3ZMLA 4KUNA 3H1NA 1AQVA 4IGJA 3DYRA 4NPBA 4PQ1A 1ZYPA 2HRKA 1X0RA 3WT2A 2NDOA 2QA1A 3APOA 2VUPA 4F82A 2K6VA 3W8SA 4XRAA 4ML6A 3IBHA 3KMNA 3TCOA 1HNAA 2B7JA 2H72A 4IP1A 2DIZA 2EIOA 2A4HA 3RHCA 1AC1A 3A2VA 4YAPA 4MNNA 2L4CA 3ZTLA 1EOHA 4XS1A 3GURA 2CVBA 2H66A 3CSHA 3W6GA 1F37A 4NWYA 2H19A 5IMVA 3GIXA 19GSA 1JFUA 5IOWA 2X8HA 3C7MA 4WR5A 3EWLA 4RUVA 4NV2A 3TJGA 4QL9A 3FR6A 4EUYA 5KN2A 4I2TA 3SBCA 3UJ1A 1YZXA 2X99A 1GWCA 5ENUA 1KTEA 3HZ4A 1URMA 5G1KA 4D73A 1A8YA 1JZOA 4WBRD 4QQ7A 2X8GA 5ECOB 1KNGA 2B5EA 2HZEA 3FK8A 4PQHA 4K6XA 3RHBA 4P3YB 1YKCA 3LYPA 2CZ3A 1AXDA 2GS3A 3J7Yb 1NM3A 3HVNA 3J7Yk 4HS1A 4BL7A 2GGTA 2VLVA 3PH9A 1VF3A 1R7HA 1DSBA 3HJPA 4O5QA 1SL2B 5CP1A 1B4PA 2TIRA 1QUWA 2C0FA 3DMLA 2OACA 3EC3A 2ALBA 5CRDA 1TDIA 1PRXA 5G5FA 1OC9A 2E7PA 3D0ZA 3EU3A 3IXRA 3VWXA 4K9ZA 3A5WA 2IMFA 1EP8A 1NHYA 5FT3A 5ID2B 4ZL8A 1PFOA 2NVLA 3BJ5A 1EV9A 5ECPB 2H1GA 1ABAA 5D9VA 5IM9A 5ECNB 1SL1B 2OBIA 2IWTA 4G0IA 3DD3A 5ECLB 1VGLA 3CMIA 5D9WA 2F9SA 1ZYQB 3EU4A 2C0EA 1G0TA 4ECIA 4MZWA 4L5LA 2PVQA 1XOBA 4HU9A 4MJCA 2C3TA 2N5BA 4OO5A 3ZZXA 1GTAA 1R5PA 2OE0A 4GLTA 5A4UA 3LWAA 3A5IA 2IL3A 1HNBA 2L57A 2PUKC 3RPPA 4PNGA 2Z9SA 4POBA 2JZSA 2KOKA 4FO5A 1M3IA 3E0UA 4EF0A 4TXOB 3H8QA 3Q74A 1YF0A 3EMPA 3GKKA 3KTLA 1GSUA 1ZYNA 4CY6A 2VL9A 3GMFA 1AAZA 5GAND 3GYKA 1PSQA 4BIKA 2PERA 5HQPA 2H71A 2K8VA 2WFCA 4GSNA 2R37A 5DBQA 1TRSA 14GSA 4KH7A 4DSQA 4KE3A 1PX7A 1GULA 3VURA 4PTSA 1XWCA 4MZBA 4KCAA 2FWFA 4YKFA 2L4QA 2P5QA 5CYYA 2H30A 3VFIA 4ML1A 3TJJA 2GT6A 4N10A 2V32A 3P90A 1SL0B 3PINA 1R4WA 4YQVA 3I43A 1XFLA 5ELAA 2CV4A 2LNTA 3M9KA 4GXZA 4Q5NA 2C3NA 4IQAA 5COHA 3P2AA 2P5RA 4FIWA 3ZIVA 4Q5QA 4GRFA 5DJLA 1SYXA 3HY2A 2YZHA 2ON5A 2XBIA 11GSA 5D9TA 1A2MA 1EOGA 5DALA 2LQOA 4K5SA 3IV4A 4OD7A 4N11A 4K7IA 4K8MA 3F6DA 2B1LA 1SKSB 1SJZA 2VCQA 4OFNA 4E8HA 4G9HA 2MYGA 3KGKA 4JR4A 4ZBAA 1VF1A 2XBQA 1XZOA 2C80A 4MCUA 5LCZA 4HEA2 4RQRA 1BG5A 3O3TA 2A4VA 2DSAA 2DJ3A 2EC4A 2JZTA 1ZZYA 2WGRA 2MZCA 1GNWA 2PGTA 1XWAA 5JCUA 3KD0A 2RM6A 4LL1B 4A5PA 4HSCX 20GSA 2FUG2 2WZ9A 3IC4A 5DDLA 2CX3A 3LXZA 4KX4A 1Z7RA 2LUSA 4F0CA 6GSTA 3ERFA 4IJ3A 3QAGA 3C73A 4DSSB 2NPBA 4TXVA 4GTUA 2DJKA 1S3AA 1F9MA 1JZRA 3VI7A 3EVIA 5HFGA 1Z5YE 4HUAA 5CRWA 1PX6A 3ERWA 5D73A 1PKZA 4GSSA 4RI7A 1WE0A 4CHSA 2H8LA 1C72A 1TU8A 1USBA 5DAKA 3GA4A 3R3EA 5C00A 5F06A 3VPTA 2JL4A 2LQQA 1GLPA 2BJXA 1V57A 3DWVA 3I69A 5H5SA 3IAM2 2LRTA 3IHGA 3GX8A 1YEPA 1K0BA 3CQFA 1T4ZA 2H1BA 2LJRA 3AY8A 3QD9A 1GUHA 3NIVA 4MJEA 1MDIA 5J4UA 2GDRA 2LTKA 5ECRB 1FB0A 4K2DA 3LXTA 3KH7A 3F0IA 3EMXA 4AJ7A 3FZAA 3EPTA 4XS4B 1EGOA 3GV1A 3LJRA 1SJ6A 5LD0A 2IPAA 3ZIJA 1JLVA 4IELA 1SD9A 1BAYA 3P7XA 1V58A 4HOJA 1LBKA 1YEXA 4AJ8A 6GSSA 1T00A 3LORA 1UN2A 4IW9A 3WT1A 2X8CA 2J23A 2V6KA 2V6OA 2FD3A 3PPUA 1WIKA 3LG6A 5ECMB 1AQWA 3TKSE 2FA8A 5LNKe 3QCPA 1TK0B 4DVCA 2JU5A 1GNEA 2I9HA 3ZL5A 5A4VA 4J2FA 1QFNA 3H93A 5KEJA 4WF5A 2FY6A 2R6KA 1TI1A 4USSA 4OFTA 2PPTA 2BTOT 1EEMA 1U3IA 2GTUA 4G19A 2VIMA 4BWSA 3EURA 4POLA 3A2XA 5CAXA 4V2LA 4I97A 2H70A 5B8AA 2F51A 2HXKA 4WKWA 1E6BA 4TR4A 4POKA 2DLXA 1OVNA 1K0DA 4Z2TA 3CRUA 5F07A 4ZB6A 1ERWA 2LJAA 3LGCA 4LMVA 3M1GA 3GKNA 4GSTA 4XRDA 3TKQA 3A3TA 3FR3A 1GSDA 4F03A 1KBNA 5GAPD 2A2SA 4BVYB 1A24A 4ECJA 2B7KA 2IMIA 3IRAA 1M9AA 3K8NA 4I5QA 3QR6A 1SKRB 2HI7A 4K7OA 5J9CA 1SK1A 4WR4A 1NHOA 3IC8A 3HZ8A 3QAVA 5AIVA
chains in the Genus database with same CATH topology
1PKWA 4HJMA 3V1WA 1GRXA 4TRXA 2QSIA 1A0RP 1G6WA 2DJJA 2YP6A 5INYA 1EWXA 1MDJA 4X4JA 1X5EA 1DE2A 4IP6A 4MF7A 3TDGA 2H6XA 3TJFA 4WETA 3GN3A 3PGTA 2C3QA 4K5RA 3ZVJD 3L0HA 3VLNA 3FHKA 4FH8A 1Z7PA 2VCZA 2OJLA 5JWRB 3VWWA 4NHZA 5HFIA 1TI3A 1VRSD 2EIQA 1OKTA 2O85A 1SU9A 5KN3A 1SK2A 3C71A 1UA5A 1X5DA 4ZXGA 3QOUA 2HLSA 4KGIA 1GP1A 2GZZA 3ZRDA 2GSTA 3UVTA 4GCIA 4HJ2A 3DGQA 2XHFA 3TJKA 5G5EA 3M3MA 2HFDA 1GSYA 2YPMA 1PN9A 4ILFA 2MMNA 1YY7A 1W89A 4IS0A 2H74A 5FHIA 1MDKA 4HZ2A 3FZ9A 4WF4A 1K3LA 1HQOA 3HVXA 4JBBA 1PL1A 2I81A 1EZKA 1FAAA 4MDCA 3N9JA 1OE8A 4GWRA 4F2IA 1ON4A 2YWMA 4KW6A 4FQUA 2LRNA 1G7OA 2WRTA 4G0LA 2GSQA 2MBSA 2K9FA 5FWGA 2JSYA 4MP4A 3ZITA 2A2RA 3D21A 1CQGA 3UMAA 2F8AA 3KJYA 1W4VA 3WGXA 5CREA 2JSZA 4WXTA 2VLTA 4HU7A 4V2MA 3ZYWA 5GZZB 1OAZA 2GLRA 2IFQA 3O6TA 2G2QA 1QMVA 1SENA 2G0FA 4BWQA 4DEJA 2CA8A 2XPDA 4ID0A 3FW2A 3H79A 4OFMA 4G2EA 4E8EA 3HYPA 1ACVA 2VLUA 1EGRA 5ELGA 1G7EA 3KXOA 1N2AA 1SYRA 1FHEA 2AB6A 5HR3A 2H0IA 4IQ1A 1ML6A 2VAFA 3F8UA 4NAXA 5HR1A 3ME8A 1XOAA 2DC5A 4ZL9A 2O89A 1TK8B 6GSUA 2ES7A 3TB2A 2DIYA 2P31A 3IK7A 3TRQA 1M2DA 5F0GA 5IPHA 4MABA 4K7NA 2C8UA 4F9ZA 4EC0A 3UBLA 3UEMA 1JZDA 2V2GA 4XIHA 3DIEA 1ZOFA 1FO5A 2A2PA 2O8VB 4IVFA 3ME7A 4EIPA 3KTBA 3ZFLA 1OC8A 3CBUA 1YDKA 1WPIA 1ERUA 1V9WA 1FG4A 1LU4A 3F4TA 1DE1A 2PVOC 3JCML 3UAPA 4XCSA 3MAKA 4EO3A 1VF2A 2B1KA 5EL8A 4CW9A 4PGTA 3L4NA 4MPGA 1YKAA 2AV4A 4TR0A 4ZB8A 2YWIA 5EVOA 4CDOA 4BVXA 3UVHA 2HNLA 1TRVA 1XCCA 4TR1B 1PN0A 1WWJA 3VPQA 2H76A 2HRFA 1K0NA 2VL2C 3GTUB 4KDYA 1RK4A 5IPGA 1MD4A 3APSA 3BCKA 3G7JA 2YWOA 2ZCTA 2JADA 3FKFA 2QA2A 2LS5A 1GTIA 3UOMA 1DBYA 4OCFA 5IMDA 2YJHA 4JZQA 4N0ZA 3US3A 5F05A 2H0GA 4IKHA 2VO4A 2DMMA 3M0FA 4JU5A 4HZ4A 5D93A 2VOCA 5A5KA 3HXSA 1SK0A 2GSRA 4L0UA 2VM2A 1XPVA 4H86A 2MMAA 5JCWA 1XW5A 2K18A 1R5AA 3GUSA 2OKAA 4OWYA 2CX4A 5IO2A 1T7PB 4ECBA 2PBJA 1X9WB 5D96A 3FZ5A 1PD21 3D6IA 3RDWA 3WD6A 1MEKA 2VCTA 5KN1A 1QK8A 3TUEA 2EIRA 1SD8A 2NBSA 2HRNA 5IIZA 4XS6A 5E4WA 1OYJA 2LSTA 1BEDA 4JEDA 5BMUA 1THXA 1GLQA 1A2JA 4YQUA 2FWGA 4G0KA 5F8BA 1F2EA 1K3OA 4EDYA 1ILOA 4KA0A 2H01A 2KLXA 3ZREA 2HT9A 3W8JA 2HRAA 5ECHB 3ZMKA 3CSIA 1HNCA 4K2XA 5AISA 4N0VA 1T1VA 3F3QA 3HKRA 4D73B 1TJDA 1K0AA 3BOAA 5KN0A 3Q6OA 5CO3A 4HQSA 2GZYA 4MZCA 2OADA 1B4QA 1Y25A 2REMA 4YQMA 2HZEB 2DJ0A 1ZYEA 1BQ7A 4AJ6A 3KM6A 5IMCA 2B5XA 13GSA 1F6MC 5ID2A 5IMFA 2GVPA 3G9BA 2HSMA 1QQ2A 4EE0A 4BL7B 4ISDA 5H5QA 4V2NA 2BMXA 3I9V2 2OBKA 5ECQB 2H0HA 3GSTA 3GH9A 1MTCA 4Z2UA 3UBKA 1I5GA 1AQXA 1TP9A 2AJQB 2I4AA 1OC9B 2CAIA 1O8XA 1LJRA 5B7CA 1O6JA 3UARA 4EXJA 2YCDA 5L71A 5J9BA 1YF1A 6GSXA 1J9BA 1RQMA 1IYHA 4JE1A 4O5RA 5D8IA 3TRPA 2HYXA 4Z2RA 4KB3A 5EY6A 3HVVA 1K0CA 1M0UA 2HE3A 3DEXA 4NMUA 1JLWA 3QDNA 1F3AA 1ZMAA 4TXOA 3IE3A 2YNXA 17GSA 3OR5A 6GSVA 5G2ZA 5ABRA 4KCEA 1FVJA 2RLIA 3TOTA 3BCIA 2LNSA 2FHEA 2QKEA 1Y6EA 2X64A 3DXBA 4AGSA 5ECKB 9GSSA 3HJMA 1TOFA 2F3MA 1QGVA 2B3SA 5DCHA 2AHEA 2X49A 3HVSA 2R0GA 3DVWA 5ECSA 3TKPA 2VM1A 3ZFBA 1G6YA 5B6MA 2V1MA 2YZUA 5CRHA 3F4RA 1THOA 2D2ZA 2E0QA 1B9XC 1ST9A 4ZL7A 2TRCP 2KP1A 2O7KA 2X4AA 4Q5RA 2RUFA 2GQKA 2LRCA 3IOSA 3LEFA 1TK5B 1WRYA 1UVZA 1ERVA 5GSSA 1N8JA 3H4KA 4K0GA 2C0DA 4AF2A 2L5OA 3FYGA 4ZILA 2KHPA 22GSA 8GSSA 2H1DA 1WOUA 2C1YA 1RW1A 3NZNA 1FOHA 1F3BA 2PWJA 4L0WA 2UZ8A 3KMOA 2QGVA 2PMTA 4PUFC 5DQYA 2H73A 2FCHA 4EVMA 1AW9A 3D4MA 2L6CA 4KDUA 3UL3A 1Z6NA 4KAEA 3D22A 4RI6A 5G31A 3CTFA 5HR2A 3QFBC 1MD3A 1OC3A 4G10A 1T8EB 1GSSA 5J5NA 1TRWA 1M99A 1M2AA 4ZBBA 4PX1A 4TKYA 3QAWA 3A2WA 2DKIA 3C1SA 5DALB 1R26A 3TKSC 3KEBA 2R0CA 1Q4JA 4I6XA 4XTSA 2QC7A 4KSMA 1PMTA 2DBCA 1X9MB 3LYKA 16GSA 1Z6MA 5H5RA 2JACA 2E2GA 3GHAA 4X43A 4DSSA 3DKSA 5CNWA 1FVKA 3G7IA 3FZ4A 1PL2A 4JRRA 3KZQA 2I3YA 4HDEA 1H4OA 3S9FA 1O8WA 2N5AA 4MMMA 4EDZA 2IJYA 3E3EA 2PU9C 1XW6A 2HSHA 3KIJA 1O81A 3DVXA 3QFAC 3RBTA 5DCGA 1K3YA 4KDXA 1TW9A 1XWKA 4I8BA 4PXOA 3MYDA 4HQZA 5C04A 3TGZA 1TXXA 2VCVA 1GSQA 1A0FA 4MJAA 3M9JA 4LMWA 1S3CA 4I2UA 4O7HA 2ON7A 3O76A 1AUCA 4TR3A 4POMA 3MWHA 3CXGA 5DAKB 1SKWB 5B8BA 3GL5A 1EP7A 6GSYA 3CSJA 1XXUA 1DUGA 4O5UA 5KOWA 3N5OA 2XPEA 3IK9A 2VCXA 1TRUA 18GSA 4XS4A 3LW9A 3VK9A 4MH2A 2VL2A 5J41A 2RM5A 4K1FA 1QXHA 2WS2A 4F0BA 4GF0A 2I1UA 2VD0A 12GSA 3LQ7A 4L5OA 2L59A 4MLYA 3FY7A 4RQXA 2FA4A 2K8SA 3VWVA 1XWBA 2F8FA 1A8LA 4GQFA 2CVDA 1VF4A 3U6VA 2FLSA 1U88A 2CVKA 4JR6A 4O92A 3TJBA 3GNJA 3R2QA 3ISOA 4MH3A 1GH2A 3L9VA 2AUVA 4L8EA 3TOUA 3UIWA 4CY8A 1BYEA 5G1LA 4IHUA 2MMOA 4ECCA 3GRXA 3MIXA 5CRGA 1BX9A 2GT5A 1GUMA 3WGEA 3F9UA 5BRTA 1Z9HA 3DRNA 4MK3A 3HJOA 3IAS2 4TW5A 3D5JA 1TU7A 1FW1A 1ZGNA 3P8WA 4EL1A 1GSFA 2H6YA 4MPFA 1GTUA 5J3RA 4OMVA 2RUEA 1PGTA 1ZCPA 2FWEA 2PN8A 1SJIA 2R5GA 1J0FA 2IMEA 2VD1A 1KEBA 3PR8A 4ZB9A 1PQNA 4XHMA 1WP0A 2CZ2A 3IA1A 2DJ1A 5AGYA 3GFKA 1XBSA 1BJXA 1PA3A 4TOPA 5DQSA 1Z3EA 2C0GA 4BVYA 4LL4B 1XW9A 1JHBA 4IBPA 1E2YA 1YQ1A 3LFLA 1XIYA 1A2LA 2WB9A 1FB6A 2YN1A 3IDVA 5IOXA 1ERTA 2MBTA 3RAZA 3CTGA 4FYUA 3FR9A 1NSWA 3BD2A 5AIXA 1O85A 1U3AA 2DJ2A 2AAWA 1B48A 2P0GA 2MMZA 1B9YC 10GSA 3GKMA 1U87A 4WBJA 4V1Ag 1TTZA 2M46A 3CYNA 4FYCA 2AYTA 3ERGA 1Q98A 3ZLPA 3L78A 3Q18A 3MNGA 4KSOA 4ZIJA 2YWNA 2GQLA 4TN8A 4MA9A 3ZVJA 2OE1A 2YV9A 2IMKA 3GH6A 1A23A 1H75A 3WGDA 3KCMA 2B6MA 2ZNMA 6GSWA 3F6FA 3M8NA 3IR4A 3U5RE 4KF9A 4N30A 3APQA 3IHQA 4OO4A 1GUKA 5A4WA 2O87A 2H1AA 2LKUA 3HHVA 3NOFA 2B5YA 3TKRA 1AIUA 3EE2A 3HCZA 2GZPA 2L6DA 1M7TA 3MDKA 1I9DA 2FWHA 4J57E 1M9BA 1TKDB 1OE7A 2GSSA 2LEGA 3TRXA 2IMDA 2J9HA 4NV5A 1X5CA 2TRXA 4LLRA 3KP8A 1M2BA 4KNDA 1OKDA 5IO0A 2R0PA 1K0MA 2M80A 4Q5FA 2VCWA 5IMAA 1V2AA 2YANA 5E59A 1GSEA 5AN1A 3E9JB 5GSTA 3FRCA 3SWLA 2L5LA 4QL7A 1B8XA 2IIYA 2LV3A 3BBYA 2WCIA 2C4JA 1GL8A 3GKXA 5ECIB 2DMLA 3L9SA 4ICYA 1JZWA 4ACSA 1J08A 4MF5A 4TVEA 5B6NA 2OE3A 4PUAA 4BPYA 3C8EA 1O73A 5EPFA 3QPMA 2R3XA 1ZL9A 1EEJA 2M72A 1WJKA 3VWUA 4Z7XA 4LA1A 4MJBA 4IN0A 4EIQA 3HDCA 4IJIA 3L9UA 2WULA 2N5FA 4V1Ap 3F4SA 3IPZA 5IQYA 2IFQB 4NXIA 4ZBDA 3F3RA 1CQHA 2XC2A 3MSZA 3TKSA 3QMXA 1XVQA 2VL3A 4MF6A 1HD2A 2LJKA 3ED3A 2ZUPA 4J56E 1V98A 3VI5A 4WEYA 5HR0A 5KOXA 4X1UA 1UC7A 2HZFA 3GSSA 3LSZA 4EKZA 4HI7A 2CAQA 4YAVA 2WJUA 4PNFA 1EV4A 4O32A 2DKHA 1FOVA 1T4YA 2WDUA 2YOIA 2KUCA 2H75A 2GQMA 3G7YA 2E2MA 2OA7A 3GX0A 3HA9A 5JWOB 2R4VA 4PQIA 1K0OA 3GL3A 1WMJA 1S3DA 3Q19A 4YKGA 1XWGA 4YH2A 1HYUA 4ULXA 2YJ7A 2FGXA 1T3BA 3RPNA 3HD5A 1X9SB 1YJ6A 1U6TA 2IN3A 4TR1A 5JCGA 2CQ9A 3FEUA 3GTUA 3FMWA 1GTBA 5DJMA 1IYIA 4K0NA 4BA7A 1V40A 3F63A 3D4TA 2H6ZA 3EYTA 2RIIA 5HFKA 5JWQB 1NW2A 4PURA 3C1RA 7GSSA 2NTOA 2R2JA 2JZRA 5D9XA 3WYWA 4X0XA 5DVBA 2FNOA 1O7UA 4FYBA 3KH9A 4OCEA 3CRTA 4DSRA 4GQCA 2V41A 2KP2A 2HSYA 3KP9A 2YV7A 5G30A 1XVWA 4BVXB 2CT6A 3I6AA 4NHWA 5IMZA 3EINA 3ZMLA 4KUNA 3H1NA 1AQVA 4IGJA 3DYRA 4NPBA 4PQ1A 1ZYPA 2HRKA 1X0RA 3WT2A 2NDOA 2QA1A 3APOA 2VUPA 4F82A 2K6VA 3W8SA 4XRAA 4ML6A 3IBHA 3KMNA 3TCOA 1HNAA 2B7JA 2H72A 4IP1A 2DIZA 2EIOA 2A4HA 3RHCA 1AC1A 3A2VA 4YAPA 4MNNA 2L4CA 3ZTLA 1EOHA 4XS1A 3GURA 2CVBA 2H66A 3CSHA 3W6GA 1F37A 4NWYA 2H19A 5IMVA 3GIXA 19GSA 1JFUA 5IOWA 2X8HA 3C7MA 4WR5A 3EWLA 4RUVA 4NV2A 3TJGA 4QL9A 3FR6A 4EUYA 5KN2A 4I2TA 3SBCA 3UJ1A 1YZXA 2X99A 1GWCA 5ENUA 1KTEA 3HZ4A 1URMA 5G1KA 4D73A 1A8YA 1JZOA 4WBRD 4QQ7A 2X8GA 5ECOB 1KNGA 2B5EA 2HZEA 3FK8A 4PQHA 4K6XA 3RHBA 4P3YB 1YKCA 3LYPA 2CZ3A 1AXDA 2GS3A 3J7Yb 1NM3A 3J7Yk 4HS1A 4BL7A 2GGTA 2VLVA 3PH9A 1VF3A 1R7HA 1DSBA 3HJPA 4O5QA 1SL2B 5CP1A 1B4PA 2TIRA 1QUWA 2C0FA 3DMLA 2OACA 3EC3A 2ALBA 5CRDA 1TDIA 1PRXA 5G5FA 1OC9A 2E7PA 3D0ZA 3EU3A 3IXRA 3VWXA 4K9ZA 3A5WA 2IMFA 1EP8A 1NHYA 5FT3A 5ID2B 4ZL8A 2NVLA 3BJ5A 1EV9A 5ECPB 2H1GA 1ABAA 5D9VA 5IM9A 5ECNB 1SL1B 2OBIA 2IWTA 4G0IA 3DD3A 5ECLB 1VGLA 3CMIA 5D9WA 2F9SA 1ZYQB 3EU4A 2C0EA 1G0TA 4ECIA 4MZWA 4L5LA 2PVQA 1XOBA 4HU9A 4MJCA 2C3TA 2N5BA 4OO5A 3ZZXA 1GTAA 1R5PA 2OE0A 4GLTA 5A4UA 3LWAA 3A5IA 2IL3A 1HNBA 2L57A 2PUKC 3RPPA 4PNGA 2Z9SA 4POBA 2JZSA 2KOKA 4FO5A 3E0UA 4EF0A 4TXOB 3H8QA 3Q74A 1YF0A 3EMPA 3GKKA 3KTLA 1GSUA 1ZYNA 4CY6A 2VL9A 3GMFA 1AAZA 5GAND 3GYKA 1PSQA 2PERA 5HQPA 2H71A 2K8VA 2WFCA 4GSNA 2R37A 5DBQA 1TRSA 14GSA 4KH7A 4DSQA 4KE3A 1PX7A 1GULA 3VURA 4PTSA 1XWCA 4MZBA 4KCAA 2FWFA 4YKFA 2L4QA 2P5QA 5CYYA 2H30A 3VFIA 4ML1A 3TJJA 2GT6A 4N10A 2V32A 3P90A 1SL0B 3PINA 1R4WA 4YQVA 3I43A 1XFLA 5ELAA 2CV4A 2LNTA 3M9KA 4GXZA 4Q5NA 2C3NA 4IQAA 5COHA 3P2AA 2P5RA 4FIWA 3ZIVA 4Q5QA 4GRFA 5DJLA 1SYXA 3HY2A 2YZHA 2ON5A 2XBIA 11GSA 5D9TA 1A2MA 1EOGA 5DALA 2LQOA 4K5SA 3IV4A 4OD7A 4N11A 4K7IA 4K8MA 3F6DA 2B1LA 1SKSB 1SJZA 2VCQA 4OFNA 4E8HA 4G9HA 2MYGA 3KGKA 4JR4A 4ZBAA 1VF1A 2XBQA 1XZOA 2C80A 4MCUA 5LCZA 4HEA2 4RQRA 1BG5A 3O3TA 2A4VA 2DSAA 2DJ3A 2EC4A 2JZTA 1ZZYA 2WGRA 2MZCA 1GNWA 2PGTA 1XWAA 5JCUA 3KD0A 2RM6A 4LL1B 4A5PA 20GSA 2FUG2 2WZ9A 3IC4A 5DDLA 2CX3A 3LXZA 4KX4A 1Z7RA 2LUSA 4F0CA 6GSTA 3ERFA 4IJ3A 3QAGA 3C73A 4DSSB 2NPBA 4TXVA 4GTUA 2DJKA 1S3AA 1F9MA 1JZRA 3VI7A 3EVIA 5HFGA 1Z5YE 4HUAA 5CRWA 1PX6A 3ERWA 5D73A 1PKZA 4GSSA 4RI7A 1WE0A 4CHSA 2H8LA 1C72A 1TU8A 1USBA 5DAKA 3GA4A 3R3EA 5C00A 5F06A 3VPTA 2JL4A 2LQQA 1GLPA 2BJXA 1V57A 3DWVA 3I69A 5H5SA 3IAM2 2LRTA 3IHGA 3GX8A 1YEPA 1K0BA 1T4ZA 2H1BA 2LJRA 3AY8A 3QD9A 1GUHA 3NIVA 4MJEA 1MDIA 5J4UA 2GDRA 2LTKA 5ECRB 1FB0A 4K2DA 3LXTA 3KH7A 3F0IA 3EMXA 4AJ7A 3FZAA 3EPTA 4XS4B 1EGOA 3GV1A 3LJRA 1SJ6A 5LD0A 2IPAA 3ZIJA 1JLVA 4IELA 1SD9A 1BAYA 3P7XA 1V58A 4HOJA 1LBKA 1YEXA 4AJ8A 6GSSA 1T00A 3LORA 1UN2A 4IW9A 3WT1A 2X8CA 2J23A 2V6KA 2V6OA 2FD3A 3PPUA 1WIKA 3LG6A 5ECMB 1AQWA 3TKSE 2FA8A 5LNKe 3QCPA 1TK0B 4DVCA 2JU5A 1GNEA 2I9HA 3ZL5A 5A4VA 4J2FA 1QFNA 3H93A 5KEJA 4WF5A 2FY6A 2R6KA 1TI1A 4USSA 4OFTA 2PPTA 2BTOT 1EEMA 1U3IA 2GTUA 4G19A 2VIMA 4BWSA 3EURA 4POLA 3A2XA 5CAXA 4V2LA 4I97A 2H70A 5B8AA 2F51A 2HXKA 4WKWA 1E6BA 4TR4A 4POKA 2DLXA 1OVNA 1K0DA 4Z2TA 3CRUA 5F07A 4ZB6A 1ERWA 2LJAA 3LGCA 4LMVA 3M1GA 3GKNA 4GSTA 4XRDA 3TKQA 3A3TA 3FR3A 1GSDA 4F03A 1KBNA 5GAPD 2A2SA 4BVYB 1A24A 4ECJA 2B7KA 2IMIA 3IRAA 1M9AA 3K8NA 4I5QA 3QR6A 1SKRB 2HI7A 4K7OA 5J9CA 1SK1A 4WR4A 1NHOA 3IC8A 3HZ8A 3QAVA 5AIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKW A;  4HJM A;  3V1W A;  1GRX A;  4TRX A;  2QSI A;  1A0R P;  1G6W A;  2DJJ A;  2YP6 A;  5INY A;  1EWX A;  1MDJ A;  1X5E A;  1DE2 A;  4IP6 A;  4MF7 A;  3TDG A;  2H6X A;  3TJF A;  4WET A;  3GN3 A;  3PGT A;  2C3Q A;  3ZVJ D;  3L0H A;  3VLN A;  3FHK A;  4FH8 A;  1Z7P A;  2VCZ A;  2OJL A;  5JWR B;  3VWW A;  4NHZ A;  5HFI A;  1TI3 A;  1VRS D;  2EIQ A;  1OKT A;  2O85 A;  1SU9 A;  5KN3 A;  1SK2 A;  3C71 A;  1UA5 A;  1X5D A;  4ZXG A;  3QOU A;  2HLS A;  4KGI A;  1GP1 A;  2GZZ A;  3ZRD A;  2GST A;  3UVT A;  4GCI A;  4HJ2 A;  3DGQ A;  2XHF A;  3TJK A;  5G5E A;  3M3M A;  2HFD A;  1GSY A;  2YPM A;  1PN9 A;  4ILF A;  2MMN A;  1YY7 A;  1W89 A;  4IS0 A;  2H74 A;  5FHI A;  1MDK A;  4HZ2 A;  3FZ9 A;  4WF4 A;  1K3L A;  1HQO A;  3HVX A;  4JBB A;  1PL1 A;  2I81 A;  1EZK A;  1FAA A;  4MDC A;  3N9J A;  1OE8 A;  4GWR A;  4F2I A;  1ON4 A;  2YWM A;  4KW6 A;  2LRN A;  1G7O A;  2WRT A;  2GSQ A;  2MBS A;  2K9F A;  5FWG A;  2JSY A;  4MP4 A;  3ZIT A;  2A2R A;  3D21 A;  1CQG A;  3UMA A;  2F8A A;  3KJY A;  1W4V A;  3WGX A;  5CRE A;  2JSZ A;  4WXT A;  2VLT A;  4HU7 A;  4V2M A;  3ZYW A;  5GZZ B;  1OAZ A;  2GLR A;  2IFQ A;  3O6T A;  2G2Q A;  1QMV A;  1SEN A;  2G0F A;  4BWQ A;  4DEJ A;  2CA8 A;  2XPD A;  4ID0 A;  3FW2 A;  3H79 A;  4OFM A;  4G2E A;  4E8E A;  3HYP A;  1ACV A;  2VLU A;  1EGR A;  5ELG A;  1G7E A;  3KXO A;  1N2A A;  1SYR A;  1FHE A;  2AB6 A;  5HR3 A;  2H0I A;  4IQ1 A;  1ML6 A;  2VAF A;  3F8U A;  4NAX A;  5HR1 A;  3ME8 A;  1XOA A;  2DC5 A;  4ZL9 A;  2O89 A;  1TK8 B;  6GSU A;  2ES7 A;  3TB2 A;  2DIY A;  2P31 A;  3IK7 A;  3TRQ A;  1M2D A;  5F0G A;  5IPH A;  4MAB A;  4K7N A;  2C8U A;  4F9Z A;  4EC0 A;  3UBL A;  3UEM A;  1JZD A;  2V2G A;  4XIH A;  3DIE A;  1ZOF A;  1FO5 A;  2O8V B;  4IVF A;  3ME7 A;  3KTB A;  3ZFL A;  1OC8 A;  3CBU A;  1YDK A;  1WPI A;  1ERU A;  1V9W A;  1FG4 A;  1LU4 A;  3F4T A;  1DE1 A;  2PVO C;  3JCM L;  3UAP A;  4XCS A;  3MAK A;  4EO3 A;  1VF2 A;  2B1K A;  5EL8 A;  4CW9 A;  4PGT A;  3L4N A;  4MPG A;  1YKA A;  2AV4 A;  4TR0 A;  4ZB8 A;  2YWI A;  5EVO A;  4CDO A;  4BVX A;  3UVH A;  2HNL A;  1TRV A;  1XCC A;  4TR1 B;  1WWJ A;  3VPQ A;  2H76 A;  2HRF A;  1K0N A;  2VL2 C;  3GTU B;  4KDY A;  1RK4 A;  5IPG A;  1MD4 A;  3APS A;  3BCK A;  3G7J A;  2YWO A;  2ZCT A;  2JAD A;  3FKF A;  2LS5 A;  1GTI A;  3UOM A;  1DBY A;  4OCF A;  5IMD A;  2YJH A;  4JZQ A;  4N0Z A;  3US3 A;  5F05 A;  2H0G A;  4IKH A;  2VO4 A;  2DMM A;  3M0F A;  4JU5 A;  4HZ4 A;  5D93 A;  2VOC A;  5A5K A;  3HXS A;  1SK0 A;  2GSR A;  4L0U A;  2VM2 A;  1XPV A;  4H86 A;  2MMA A;  5JCW A;  1XW5 A;  2K18 A;  1R5A A;  3GUS A;  2OKA A;  4OWY A;  2CX4 A;  5IO2 A;  1T7P B;  4ECB A;  2PBJ A;  1X9W B;  5D96 A;  3FZ5 A;  1PD2 1;  3D6I A;  3RDW A;  3WD6 A;  1MEK A;  2VCT A;  5KN1 A;  1QK8 A;  3TUE A;  2EIR A;  1SD8 A;  2NBS A;  2HRN A;  5IIZ A;  4XS6 A;  5E4W A;  1OYJ A;  2LST A;  1BED A;  4JED A;  1THX A;  1GLQ A;  1A2J A;  4YQU A;  2FWG A;  5F8B A;  1F2E A;  1K3O A;  4EDY A;  1ILO A;  4KA0 A;  2H01 A;  2KLX A;  3ZRE A;  2HT9 A;  3W8J A;  5ECH B;  3ZMK A;  3CSI A;  1HNC A;  5AIS A;  4N0V A;  1T1V A;  3F3Q A;  3HKR A;  4D73 B;  1TJD A;  1K0A A;  3BOA A;  5KN0 A;  3Q6O A;  5CO3 A;  4HQS A;  2GZY A;  4MZC A;  2OAD A;  1B4Q A;  1Y25 A;  2REM A;  4YQM A;  2HZE B;  2DJ0 A;  1ZYE A;  1BQ7 A;  4AJ6 A;  3KM6 A;  5IMC A;  2B5X A;  13GS A;  1F6M C;  5ID2 A;  5IMF A;  2GVP A;  3G9B A;  1QQ2 A;  4EE0 A;  4ISD A;  5H5Q A;  4V2N A;  2BMX A;  3I9V 2;  2OBK A;  5ECQ B;  2H0H A;  3GST A;  3GH9 A;  1MTC A;  3UBK A;  1I5G A;  1AQX A;  1TP9 A;  2AJQ B;  2I4A A;  1OC9 B;  2CAI A;  1O8X A;  1LJR A;  5B7C A;  1O6J A;  3UAR A;  4EXJ A;  2YCD A;  5L71 A;  5J9B A;  1YF1 A;  6GSX A;  1J9B A;  1RQM A;  1IYH A;  4JE1 A;  4O5R A;  5D8I A;  3TRP A;  2HYX A;  4KB3 A;  5EY6 A;  3HVV A;  1K0C A;  1M0U A;  2HE3 A;  3DEX A;  4NMU A;  1JLW A;  3QDN A;  1F3A A;  1ZMA A;  4TXO A;  3IE3 A;  2YNX A;  17GS A;  3OR5 A;  6GSV A;  5G2Z A;  5ABR A;  4KCE A;  1FVJ A;  2RLI A;  3TOT A;  3BCI A;  2LNS A;  2FHE A;  2QKE A;  1Y6E A;  2X64 A;  3DXB A;  4AGS A;  5ECK B;  9GSS A;  3HJM A;  1TOF A;  2F3M A;  1QGV A;  2B3S A;  5DCH A;  2AHE A;  3HVS A;  3DVW A;  5ECS A;  3TKP A;  2VM1 A;  3ZFB A;  1G6Y A;  5B6M A;  2V1M A;  2YZU A;  5CRH A;  3F4R A;  1THO A;  2D2Z A;  2E0Q A;  1B9X C;  1ST9 A;  4ZL7 A;  2TRC P;  2KP1 A;  2O7K A;  4Q5R A;  2RUF A;  2GQK A;  2LRC A;  3IOS A;  3LEF A;  1TK5 B;  1WRY A;  1UVZ A;  1ERV A;  5GSS A;  1N8J A;  3H4K A;  4K0G A;  2C0D A;  4AF2 A;  2L5O A;  3FYG A;  4ZIL A;  2KHP A;  22GS A;  8GSS A;  2H1D A;  1WOU A;  2C1Y A;  1RW1 A;  3NZN A;  1F3B A;  2PWJ A;  4L0W A;  3KMO A;  2QGV A;  2PMT A;  4PUF C;  5DQY A;  2H73 A;  2FCH A;  4EVM A;  1AW9 A;  3D4M A;  2L6C A;  4KDU A;  3UL3 A;  1Z6N A;  4KAE A;  3D22 A;  4RI6 A;  5G31 A;  3CTF A;  5HR2 A;  3QFB C;  1MD3 A;  1OC3 A;  4G10 A;  1T8E B;  1GSS A;  5J5N A;  1TRW A;  1M99 A;  1M2A A;  4ZBB A;  4PX1 A;  4TKY A;  3QAW A;  3A2W A;  3C1S A;  5DAL B;  1R26 A;  3TKS C;  3KEB A;  1Q4J A;  4I6X A;  4XTS A;  2QC7 A;  4KSM A;  1PMT A;  2DBC A;  1X9M B;  3LYK A;  16GS A;  1Z6M A;  5H5R A;  2JAC A;  2E2G A;  3GHA A;  4X43 A;  4DSS A;  3DKS A;  5CNW A;  1FVK A;  3G7I A;  3FZ4 A;  1PL2 A;  4JRR A;  3KZQ A;  2I3Y A;  4HDE A;  1H4O A;  3S9F A;  1O8W A;  2N5A A;  4MMM A;  4EDZ A;  2IJY A;  3E3E A;  2PU9 C;  1XW6 A;  2HSH A;  3KIJ A;  1O81 A;  3DVX A;  3QFA C;  3RBT A;  5DCG A;  1K3Y A;  4KDX A;  1TW9 A;  1XWK A;  4I8B A;  4PXO A;  4HQZ A;  5C04 A;  3TGZ A;  1TXX A;  2VCV A;  1GSQ A;  1A0F A;  4MJA A;  3M9J A;  4LMW A;  1S3C A;  4I2U A;  4O7H A;  2ON7 A;  3O76 A;  1AUC A;  4TR3 A;  4POM A;  3MWH A;  3CXG A;  5DAK B;  1SKW B;  5B8B A;  3GL5 A;  1EP7 A;  6GSY A;  3CSJ A;  1XXU A;  1DUG A;  3N5O A;  2XPE A;  3IK9 A;  2VCX A;  1TRU A;  18GS A;  4XS4 A;  3VK9 A;  4MH2 A;  2VL2 A;  5J41 A;  2RM5 A;  4K1F A;  1QXH A;  2WS2 A;  4F0B A;  4GF0 A;  2I1U A;  2VD0 A;  12GS A;  3LQ7 A;  4L5O A;  2L59 A;  4MLY A;  3FY7 A;  2FA4 A;  4RQX A;  2K8S A;  3VWV A;  1XWB A;  2F8F A;  1A8L A;  4GQF A;  2CVD A;  1VF4 A;  3U6V A;  2FLS A;  1U88 A;  2CVK A;  4JR6 A;  4O92 A;  3TJB A;  3GNJ A;  3R2Q A;  3ISO A;  4MH3 A;  1GH2 A;  3L9V A;  2AUV A;  4L8E A;  3TOU A;  3UIW A;  1BYE A;  5G1L A;  4IHU A;  2MMO A;  4ECC A;  3GRX A;  5CRG A;  1BX9 A;  2GT5 A;  1GUM A;  3WGE A;  3F9U A;  1Z9H A;  3DRN A;  4MK3 A;  3HJO A;  3IAS 2;  4TW5 A;  3D5J A;  1TU7 A;  1FW1 A;  1ZGN A;  3P8W A;  4EL1 A;  1GSF A;  2H6Y A;  4MPF A;  1GTU A;  5J3R A;  4OMV A;  2RUE A;  1PGT A;  1ZCP A;  2FWE A;  2PN8 A;  1SJI A;  2R5G A;  1J0F A;  2IME A;  2VD1 A;  1KEB A;  3PR8 A;  4ZB9 A;  1PQN A;  4XHM A;  1WP0 A;  2CZ2 A;  3IA1 A;  2DJ1 A;  5AGY A;  3GFK A;  1XBS A;  1BJX A;  1PA3 A;  4TOP A;  5DQS A;  1Z3E A;  2C0G A;  4BVY A;  4LL4 B;  1XW9 A;  1JHB A;  4IBP A;  1E2Y A;  1YQ1 A;  3LFL A;  1XIY A;  1A2L A;  2WB9 A;  1FB6 A;  2YN1 A;  3IDV A;  5IOX A;  1ERT A;  2MBT A;  3RAZ A;  3CTG A;  4FYU A;  3FR9 A;  1NSW A;  3BD2 A;  5AIX A;  1O85 A;  1U3A A;  2DJ2 A;  2AAW A;  1B48 A;  2P0G A;  2MMZ A;  1B9Y C;  10GS A;  3GKM A;  1U87 A;  4WBJ A;  4V1A g;  1TTZ A;  2M46 A;  3CYN A;  4FYC A;  2AYT A;  3ERG A;  1Q98 A;  3ZLP A;  3L78 A;  3Q18 A;  3MNG A;  4KSO A;  4ZIJ A;  2YWN A;  2GQL A;  4TN8 A;  4MA9 A;  3ZVJ A;  2OE1 A;  2YV9 A;  2IMK A;  3GH6 A;  1A23 A;  1H75 A;  3WGD A;  3KCM A;  2B6M A;  2ZNM A;  6GSW A;  3F6F A;  3M8N A;  3IR4 A;  3U5R E;  4N30 A;  3APQ A;  3IHQ A;  4OO4 A;  1GUK A;  5A4W A;  2O87 A;  2H1A A;  2LKU A;  3HHV A;  3NOF A;  2B5Y A;  3TKR A;  1AIU A;  3EE2 A;  3HCZ A;  2GZP A;  2L6D A;  1M7T A;  3MDK A;  1I9D A;  2FWH A;  4J57 E;  1M9B A;  1TKD B;  1OE7 A;  2GSS A;  2LEG A;  3TRX A;  2IMD A;  2J9H A;  4NV5 A;  1X5C A;  2TRX A;  4LLR A;  3KP8 A;  1M2B A;  4KND A;  1OKD A;  5IO0 A;  1K0M A;  2M80 A;  4Q5F A;  2VCW A;  5IMA A;  1V2A A;  2YAN A;  5E59 A;  1GSE A;  5AN1 A;  3E9J B;  5GST A;  3FRC A;  3SWL A;  2L5L A;  4QL7 A;  1B8X A;  2IIY A;  2LV3 A;  3BBY A;  2WCI A;  2C4J A;  1GL8 A;  3GKX A;  5ECI B;  2DML A;  3L9S A;  1JZW A;  4ACS A;  1J08 A;  4MF5 A;  4TVE A;  5B6N A;  2OE3 A;  4PUA A;  4BPY A;  3C8E A;  1O73 A;  5EPF A;  3QPM A;  2R3X A;  1ZL9 A;  1EEJ A;  2M72 A;  1WJK A;  3VWU A;  4Z7X A;  4LA1 A;  4MJB A;  4IN0 A;  3HDC A;  4IJI A;  3L9U A;  2WUL A;  2N5F A;  4V1A p;  3F4S A;  3IPZ A;  5IQY A;  2IFQ B;  4NXI A;  4ZBD A;  3F3R A;  1CQH A;  2XC2 A;  3MSZ A;  3TKS A;  3QMX A;  1XVQ A;  2VL3 A;  4MF6 A;  1HD2 A;  2LJK A;  3ED3 A;  2ZUP A;  4J56 E;  1V98 A;  3VI5 A;  4WEY A;  5HR0 A;  4X1U A;  1UC7 A;  2HZF A;  3GSS A;  3LSZ A;  4EKZ A;  4HI7 A;  2CAQ A;  4YAV A;  2WJU A;  4PNF A;  1EV4 A;  4O32 A;  1FOV A;  1T4Y A;  2WDU A;  2YOI A;  2KUC A;  2H75 A;  2GQM A;  3G7Y A;  2E2M A;  2OA7 A;  3GX0 A;  3HA9 A;  5JWO B;  2R4V A;  4PQI A;  1K0O A;  3GL3 A;  1WMJ A;  1S3D A;  3Q19 A;  1XWG A;  4YH2 A;  1HYU A;  4ULX A;  2YJ7 A;  2FGX A;  1T3B A;  3RPN A;  3HD5 A;  1X9S B;  1YJ6 A;  1U6T A;  2IN3 A;  4TR1 A;  5JCG A;  2CQ9 A;  3FEU A;  3GTU A;  1GTB A;  5DJM A;  1IYI A;  4K0N A;  4BA7 A;  1V40 A;  3F63 A;  3D4T A;  2H6Z A;  3EYT A;  2RII A;  5HFK A;  5JWQ B;  1NW2 A;  4PUR A;  3C1R A;  7GSS A;  2NTO A;  2R2J A;  2JZR A;  5D9X A;  3WYW A;  4X0X A;  5DVB A;  2FNO A;  1O7U A;  4FYB A;  3KH9 A;  4OCE A;  3CRT A;  4DSR A;  4GQC A;  2V41 A;  2KP2 A;  2HSY A;  3KP9 A;  2YV7 A;  5G30 A;  1XVW A;  2CT6 A;  3I6A A;  4NHW A;  5IMZ A;  3EIN A;  3ZML A;  4KUN A;  3H1N A;  1AQV A;  4IGJ A;  3DYR A;  4NPB A;  4PQ1 A;  1X0R A;  3WT2 A;  2NDO A;  3APO A;  2VUP A;  4F82 A;  2K6V A;  3W8S A;  4XRA A;  4ML6 A;  3IBH A;  3KMN A;  3TCO A;  1HNA A;  2B7J A;  2H72 A;  4IP1 A;  2DIZ A;  2EIO A;  3RHC A;  1AC1 A;  3A2V A;  4YAP A;  2L4C A;  3ZTL A;  1EOH A;  4XS1 A;  3GUR A;  2CVB A;  2H66 A;  3CSH A;  3W6G A;  1F37 A;  4NWY A;  2H19 A;  5IMV A;  3GIX A;  19GS A;  1JFU A;  5IOW A;  2X8H A;  3C7M A;  4WR5 A;  3EWL A;  4RUV A;  4NV2 A;  3TJG A;  4QL9 A;  3FR6 A;  4EUY A;  5KN2 A;  4I2T A;  3SBC A;  3UJ1 A;  1YZX A;  2X99 A;  1GWC A;  5ENU A;  1KTE A;  3HZ4 A;  1URM A;  5G1K A;  4D73 A;  1A8Y A;  1JZO A;  4WBR D;  4QQ7 A;  2X8G A;  5ECO B;  1KNG A;  2B5E A;  2HZE A;  3FK8 A;  4PQH A;  4K6X A;  3RHB A;  4P3Y B;  1YKC A;  3LYP A;  2CZ3 A;  1AXD A;  2GS3 A;  3J7Y b;  1NM3 A;  3J7Y k;  4HS1 A;  4BL7 A;  2GGT A;  2VLV A;  3PH9 A;  1VF3 A;  1R7H A;  1DSB A;  3HJP A;  1SL2 B;  5CP1 A;  1B4P A;  2TIR A;  1QUW A;  2C0F A;  3DML A;  2OAC A;  3EC3 A;  2ALB A;  5CRD A;  1TDI A;  1PRX A;  5G5F A;  1OC9 A;  2E7P A;  3D0Z A;  3EU3 A;  3IXR A;  3VWX A;  4K9Z A;  3A5W A;  2IMF A;  1EP8 A;  1NHY A;  5FT3 A;  5ID2 B;  4ZL8 A;  2NVL A;  3BJ5 A;  1EV9 A;  5ECP B;  2H1G A;  1ABA A;  5D9V A;  5IM9 A;  5ECN B;  1SL1 B;  2OBI A;  2IWT A;  3DD3 A;  5ECL B;  1VGL A;  3CMI A;  5D9W A;  2F9S A;  1ZYQ B;  3EU4 A;  2C0E A;  1G0T A;  4ECI A;  4MZW A;  4L5L A;  2PVQ A;  1XOB A;  4HU9 A;  4MJC A;  2C3T A;  2N5B A;  4OO5 A;  3ZZX A;  1GTA A;  1R5P A;  2OE0 A;  4GLT A;  5A4U A;  3LWA A;  2IL3 A;  1HNB A;  2L57 A;  2PUK C;  3RPP A;  4PNG A;  2Z9S A;  4POB A;  2JZS A;  2KOK A;  4FO5 A;  3E0U A;  4EF0 A;  4TXO B;  3H8Q A;  3Q74 A;  1YF0 A;  3EMP A;  3GKK A;  3KTL A;  1GSU A;  2VL9 A;  3GMF A;  1AAZ A;  5GAN D;  3GYK A;  1PSQ A;  2PER A;  5HQP A;  2H71 A;  2K8V A;  2WFC A;  4GSN A;  2R37 A;  5DBQ A;  1TRS A;  14GS A;  4KH7 A;  4DSQ A;  4KE3 A;  1PX7 A;  1GUL A;  3VUR A;  1XWC A;  4MZB A;  4KCA A;  2FWF A;  2L4Q A;  2P5Q A;  5CYY A;  2H30 A;  3VFI A;  4ML1 A;  3TJJ A;  2GT6 A;  4N10 A;  2V32 A;  3P90 A;  1SL0 B;  3PIN A;  1R4W A;  4YQV A;  3I43 A;  1XFL A;  5ELA A;  2CV4 A;  2LNT A;  3M9K A;  4GXZ A;  4Q5N A;  2C3N A;  4IQA A;  5COH A;  3P2A A;  2P5R A;  4FIW A;  3ZIV A;  4Q5Q A;  4GRF A;  5DJL A;  1SYX A;  3HY2 A;  2YZH A;  2ON5 A;  2XBI A;  11GS A;  5D9T A;  1A2M A;  1EOG A;  5DAL A;  2LQO A;  3IV4 A;  4OD7 A;  4N11 A;  4K7I A;  4K8M A;  3F6D A;  2B1L A;  1SKS B;  1SJZ A;  2VCQ A;  4OFN A;  4E8H A;  4G9H A;  2MYG A;  3KGK A;  4JR4 A;  4ZBA A;  1VF1 A;  2XBQ A;  1XZO A;  2C80 A;  4MCU A;  5LCZ A;  4HEA 2;  4RQR A;  1BG5 A;  3O3T A;  2A4V A;  2DSA A;  2DJ3 A;  2EC4 A;  2JZT A;  1ZZY A;  2WGR A;  2MZC A;  1GNW A;  2PGT A;  1XWA A;  5JCU A;  3KD0 A;  2RM6 A;  4LL1 B;  20GS A;  2FUG 2;  2WZ9 A;  3IC4 A;  5DDL A;  2CX3 A;  3LXZ A;  4KX4 A;  1Z7R A;  2LUS A;  4F0C A;  6GST A;  3ERF A;  4IJ3 A;  3QAG A;  3C73 A;  4DSS B;  2NPB A;  4TXV A;  4GTU A;  2DJK A;  1S3A A;  1F9M A;  1JZR A;  3VI7 A;  3EVI A;  5HFG A;  1Z5Y E;  4HUA A;  5CRW A;  1PX6 A;  3ERW A;  5D73 A;  1PKZ A;  4GSS A;  4RI7 A;  1WE0 A;  4CHS A;  2H8L A;  1C72 A;  1TU8 A;  1USB A;  5DAK A;  3GA4 A;  5C00 A;  5F06 A;  3VPT A;  2JL4 A;  2LQQ A;  1GLP A;  2BJX A;  1V57 A;  3DWV A;  3I69 A;  5H5S A;  3IAM 2;  2LRT A;  3GX8 A;  1YEP A;  1K0B A;  1T4Z A;  2H1B A;  2LJR A;  3AY8 A;  3QD9 A;  1GUH A;  3NIV A;  4MJE A;  1MDI A;  5J4U A;  2GDR A;  2LTK A;  5ECR B;  1FB0 A;  4K2D A;  3LXT A;  3KH7 A;  3F0I A;  3EMX A;  4AJ7 A;  3FZA A;  4XS4 B;  1EGO A;  3GV1 A;  3LJR A;  1SJ6 A;  5LD0 A;  2IPA A;  3ZIJ A;  1JLV A;  4IEL A;  1SD9 A;  1BAY A;  3P7X A;  1V58 A;  4HOJ A;  1LBK A;  1YEX A;  4AJ8 A;  6GSS A;  1T00 A;  3LOR A;  1UN2 A;  4IW9 A;  3WT1 A;  2X8C A;  2J23 A;  2V6K A;  2V6O A;  2FD3 A;  1WIK A;  3LG6 A;  5ECM B;  1AQW A;  3TKS E;  2FA8 A;  5LNK e;  3QCP A;  1TK0 B;  4DVC A;  2JU5 A;  1GNE A;  2I9H A;  3ZL5 A;  5A4V A;  4J2F A;  1QFN A;  3H93 A;  5KEJ A;  4WF5 A;  2FY6 A;  2R6K A;  1TI1 A;  4OFT A;  2PPT A;  2BTO T;  1EEM A;  1U3I A;  2GTU A;  4G19 A;  2VIM A;  4BWS A;  3EUR A;  4POL A;  3A2X A;  5CAX A;  4V2L A;  4I97 A;  2H70 A;  5B8A A;  2F51 A;  2HXK A;  4WKW A;  1E6B A;  4TR4 A;  4POK A;  2DLX A;  1OVN A;  1K0D A;  3CRU A;  5F07 A;  4ZB6 A;  1ERW A;  2LJA A;  3LGC A;  4LMV A;  3M1G A;  3GKN A;  4GST A;  4XRD A;  3TKQ A;  3A3T A;  3FR3 A;  1GSD A;  4F03 A;  1KBN A;  5GAP D;  2A2S A;  1A24 A;  4ECJ A;  2B7K A;  2IMI A;  3IRA A;  1M9A A;  3K8N A;  4I5Q A;  3QR6 A;  1SKR B;  2HI7 A;  4K7O A;  5J9C A;  1SK1 A;  4WR4 A;  1NHO A;  3HZ8 A;  3QAV A;  5AIV A; 
#chains in the Genus database with same CATH topology
 1PKW A;  4HJM A;  3V1W A;  1GRX A;  4TRX A;  2QSI A;  1A0R P;  1G6W A;  2DJJ A;  2YP6 A;  5INY A;  1EWX A;  1MDJ A;  4X4J A;  1X5E A;  1DE2 A;  4IP6 A;  4MF7 A;  3TDG A;  2H6X A;  3TJF A;  4WET A;  3GN3 A;  3PGT A;  2C3Q A;  4K5R A;  3ZVJ D;  3L0H A;  3VLN A;  3FHK A;  4FH8 A;  1Z7P A;  2VCZ A;  2OJL A;  5JWR B;  3VWW A;  4NHZ A;  5HFI A;  1TI3 A;  1VRS D;  2EIQ A;  1OKT A;  2O85 A;  1SU9 A;  5KN3 A;  1SK2 A;  3C71 A;  1UA5 A;  1X5D A;  4ZXG A;  3QOU A;  2HLS A;  4KGI A;  1GP1 A;  2GZZ A;  3ZRD A;  2GST A;  3UVT A;  4GCI A;  4HJ2 A;  3DGQ A;  2XHF A;  3TJK A;  5G5E A;  3M3M A;  2HFD A;  1GSY A;  2YPM A;  1PN9 A;  4ILF A;  2MMN A;  1YY7 A;  1W89 A;  4IS0 A;  2H74 A;  5FHI A;  1MDK A;  4HZ2 A;  3FZ9 A;  4WF4 A;  1K3L A;  1HQO A;  3HVX A;  4JBB A;  1PL1 A;  2I81 A;  1EZK A;  1FAA A;  4MDC A;  3N9J A;  1OE8 A;  4GWR A;  4F2I A;  1ON4 A;  2YWM A;  4KW6 A;  4FQU A;  2LRN A;  1G7O A;  2WRT A;  4G0L A;  2GSQ A;  2MBS A;  2K9F A;  5FWG A;  2JSY A;  4MP4 A;  3ZIT A;  2A2R A;  3D21 A;  1CQG A;  3UMA A;  2F8A A;  3KJY A;  1W4V A;  3WGX A;  5CRE A;  2JSZ A;  4WXT A;  2VLT A;  4HU7 A;  4V2M A;  3ZYW A;  5GZZ B;  1OAZ A;  2GLR A;  2IFQ A;  3O6T A;  2G2Q A;  1QMV A;  1SEN A;  2G0F A;  4BWQ A;  4DEJ A;  2CA8 A;  2XPD A;  4ID0 A;  3FW2 A;  3H79 A;  4OFM A;  4G2E A;  4E8E A;  3HYP A;  1ACV A;  2VLU A;  1EGR A;  5ELG A;  1G7E A;  3KXO A;  1N2A A;  1SYR A;  1FHE A;  2AB6 A;  5HR3 A;  2H0I A;  4IQ1 A;  1ML6 A;  2VAF A;  3F8U A;  4NAX A;  5HR1 A;  3ME8 A;  1XOA A;  2DC5 A;  4ZL9 A;  2O89 A;  1TK8 B;  6GSU A;  2ES7 A;  3TB2 A;  2DIY A;  2P31 A;  3IK7 A;  3TRQ A;  1M2D A;  5F0G A;  5IPH A;  4MAB A;  4K7N A;  2C8U A;  4F9Z A;  4EC0 A;  3UBL A;  3UEM A;  1JZD A;  2V2G A;  4XIH A;  3DIE A;  1ZOF A;  1FO5 A;  2A2P A;  2O8V B;  4IVF A;  3ME7 A;  4EIP A;  3KTB A;  3ZFL A;  1OC8 A;  3CBU A;  1YDK A;  1WPI A;  1ERU A;  1V9W A;  1FG4 A;  1LU4 A;  3F4T A;  1DE1 A;  2PVO C;  3JCM L;  3UAP A;  4XCS A;  3MAK A;  4EO3 A;  1VF2 A;  2B1K A;  5EL8 A;  4CW9 A;  4PGT A;  3L4N A;  4MPG A;  1YKA A;  2AV4 A;  4TR0 A;  4ZB8 A;  2YWI A;  5EVO A;  4CDO A;  4BVX A;  3UVH A;  2HNL A;  1TRV A;  1XCC A;  4TR1 B;  1PN0 A;  1WWJ A;  3VPQ A;  2H76 A;  2HRF A;  1K0N A;  2VL2 C;  3GTU B;  4KDY A;  1RK4 A;  5IPG A;  1MD4 A;  3APS A;  3BCK A;  3G7J A;  2YWO A;  2ZCT A;  2JAD A;  3FKF A;  2QA2 A;  2LS5 A;  1GTI A;  3UOM A;  1DBY A;  4OCF A;  5IMD A;  2YJH A;  4JZQ A;  4N0Z A;  3US3 A;  5F05 A;  2H0G A;  4IKH A;  2VO4 A;  2DMM A;  3M0F A;  4JU5 A;  4HZ4 A;  5D93 A;  2VOC A;  5A5K A;  3HXS A;  1SK0 A;  2GSR A;  4L0U A;  2VM2 A;  1XPV A;  4H86 A;  2MMA A;  5JCW A;  1XW5 A;  2K18 A;  1R5A A;  3GUS A;  2OKA A;  4OWY A;  2CX4 A;  5IO2 A;  1T7P B;  4ECB A;  2PBJ A;  1X9W B;  5D96 A;  3FZ5 A;  1PD2 1;  3D6I A;  3RDW A;  3WD6 A;  1MEK A;  2VCT A;  5KN1 A;  1QK8 A;  3TUE A;  2EIR A;  1SD8 A;  2NBS A;  2HRN A;  5IIZ A;  1M3J A;  4XS6 A;  5E4W A;  1OYJ A;  2LST A;  1BED A;  4JED A;  5BMU A;  1THX A;  1GLQ A;  1A2J A;  4YQU A;  2FWG A;  4G0K A;  5F8B A;  1F2E A;  1K3O A;  4EDY A;  1ILO A;  4KA0 A;  2H01 A;  2KLX A;  3ZRE A;  2HT9 A;  3W8J A;  2HRA A;  5ECH B;  3ZMK A;  3CSI A;  1HNC A;  4K2X A;  5AIS A;  4N0V A;  1T1V A;  3F3Q A;  3HKR A;  4D73 B;  1TJD A;  1K0A A;  3BOA A;  5KN0 A;  3Q6O A;  5CO3 A;  4HQS A;  2GZY A;  4MZC A;  2OAD A;  1B4Q A;  1Y25 A;  2REM A;  4YQM A;  2HZE B;  2DJ0 A;  1ZYE A;  1BQ7 A;  4AJ6 A;  3KM6 A;  5IMC A;  2B5X A;  13GS A;  1F6M C;  5ID2 A;  5IMF A;  2GVP A;  3G9B A;  2HSM A;  1QQ2 A;  4EE0 A;  4BL7 B;  4ISD A;  5H5Q A;  4V2N A;  2BMX A;  3I9V 2;  2OBK A;  5ECQ B;  2H0H A;  3GST A;  3GH9 A;  1MTC A;  4Z2U A;  3UBK A;  1I5G A;  1AQX A;  1TP9 A;  2AJQ B;  2I4A A;  1OC9 B;  2CAI A;  1O8X A;  1LJR A;  5B7C A;  1O6J A;  3UAR A;  4EXJ A;  2YCD A;  5L71 A;  5J9B A;  1YF1 A;  6GSX A;  1J9B A;  1RQM A;  1IYH A;  4JE1 A;  4O5R A;  5D8I A;  3TRP A;  2HYX A;  4Z2R A;  4KB3 A;  5EY6 A;  3HVV A;  1K0C A;  1M0U A;  2HE3 A;  3DEX A;  4NMU A;  1JLW A;  3QDN A;  1F3A A;  1ZMA A;  4TXO A;  3IE3 A;  2YNX A;  17GS A;  3OR5 A;  6GSV A;  5G2Z A;  5ABR A;  4KCE A;  1FVJ A;  2RLI A;  3TOT A;  3BCI A;  2LNS A;  2FHE A;  2QKE A;  1Y6E A;  2X64 A;  3DXB A;  4AGS A;  5ECK B;  9GSS A;  3HJM A;  1TOF A;  2F3M A;  1QGV A;  2B3S A;  5DCH A;  2AHE A;  2X49 A;  3HVS A;  2R0G A;  3DVW A;  5ECS A;  3TKP A;  2VM1 A;  3ZFB A;  1G6Y A;  5B6M A;  2V1M A;  2YZU A;  5CRH A;  3F4R A;  1THO A;  2D2Z A;  2E0Q A;  1B9X C;  1ST9 A;  4ZL7 A;  2TRC P;  2KP1 A;  2O7K A;  2X4A A;  4Q5R A;  2RUF A;  2GQK A;  2LRC A;  3IOS A;  3LEF A;  1TK5 B;  1WRY A;  1UVZ A;  1ERV A;  5GSS A;  1N8J A;  3H4K A;  4K0G A;  2C0D A;  4AF2 A;  2L5O A;  3FYG A;  4ZIL A;  2KHP A;  22GS A;  8GSS A;  2H1D A;  1WOU A;  2C1Y A;  1RW1 A;  3NZN A;  1FOH A;  1F3B A;  2PWJ A;  4L0W A;  2UZ8 A;  3KMO A;  2QGV A;  2PMT A;  4PUF C;  5DQY A;  2H73 A;  2FCH A;  4EVM A;  1AW9 A;  3D4M A;  2L6C A;  4KDU A;  3UL3 A;  1Z6N A;  4KAE A;  3D22 A;  4RI6 A;  5G31 A;  3CTF A;  5HR2 A;  3QFB C;  1MD3 A;  1OC3 A;  4G10 A;  1T8E B;  1GSS A;  5J5N A;  1TRW A;  1M99 A;  1M2A A;  4ZBB A;  4PX1 A;  4TKY A;  3QAW A;  3A2W A;  2DKI A;  3C1S A;  5DAL B;  1R26 A;  3TKS C;  3KEB A;  2R0C A;  1Q4J A;  4I6X A;  4XTS A;  2QC7 A;  4KSM A;  1PMT A;  2DBC A;  1X9M B;  3LYK A;  16GS A;  1Z6M A;  5H5R A;  2JAC A;  2E2G A;  3GHA A;  4X43 A;  4DSS A;  3DKS A;  5CNW A;  1FVK A;  3G7I A;  3FZ4 A;  1PL2 A;  4JRR A;  3KZQ A;  2I3Y A;  4HDE A;  1H4O A;  3S9F A;  1O8W A;  2N5A A;  4MMM A;  4EDZ A;  2IJY A;  3E3E A;  2PU9 C;  1XW6 A;  2HSH A;  3KIJ A;  1O81 A;  3DVX A;  3QFA C;  3RBT A;  5DCG A;  1K3Y A;  4KDX A;  1TW9 A;  1XWK A;  4I8B A;  4PXO A;  3MYD A;  4HQZ A;  5C04 A;  3TGZ A;  1TXX A;  2VCV A;  1GSQ A;  1A0F A;  4MJA A;  3M9J A;  4LMW A;  1S3C A;  4I2U A;  4O7H A;  2ON7 A;  3O76 A;  1AUC A;  4TR3 A;  4POM A;  3MWH A;  3CXG A;  5DAK B;  1SKW B;  5B8B A;  3GL5 A;  1EP7 A;  6GSY A;  3CSJ A;  1XXU A;  1DUG A;  4O5U A;  5KOW A;  3N5O A;  2XPE A;  3IK9 A;  2VCX A;  1TRU A;  18GS A;  4XS4 A;  3LW9 A;  3VK9 A;  4MH2 A;  2VL2 A;  5J41 A;  2RM5 A;  4K1F A;  1QXH A;  2WS2 A;  4F0B A;  4GF0 A;  2I1U A;  2VD0 A;  12GS A;  3LQ7 A;  4L5O A;  2L59 A;  4MLY A;  3FY7 A;  4RQX A;  2FA4 A;  2K8S A;  3VWV A;  1XWB A;  2F8F A;  1A8L A;  4GQF A;  2CVD A;  1VF4 A;  3U6V A;  2FLS A;  1U88 A;  2CVK A;  4JR6 A;  4O92 A;  3TJB A;  3GNJ A;  3R2Q A;  3ISO A;  4MH3 A;  1GH2 A;  3L9V A;  2AUV A;  4L8E A;  3TOU A;  3UIW A;  4CY8 A;  1BYE A;  5G1L A;  4IHU A;  2MMO A;  4ECC A;  3GRX A;  3MIX A;  5CRG A;  1BX9 A;  2GT5 A;  1GUM A;  3WGE A;  3F9U A;  5BRT A;  1Z9H A;  3DRN A;  4MK3 A;  3HJO A;  3IAS 2;  4TW5 A;  3D5J A;  1TU7 A;  1FW1 A;  1ZGN A;  3P8W A;  4EL1 A;  1GSF A;  2H6Y A;  4MPF A;  1GTU A;  5J3R A;  4OMV A;  2RUE A;  1PGT A;  1ZCP A;  2FWE A;  2PN8 A;  1SJI A;  2R5G A;  1J0F A;  2IME A;  2VD1 A;  1KEB A;  3PR8 A;  4ZB9 A;  1PQN A;  4XHM A;  1WP0 A;  2CZ2 A;  3IA1 A;  2DJ1 A;  5AGY A;  3GFK A;  1XBS A;  1BJX A;  1PA3 A;  4TOP A;  5DQS A;  1Z3E A;  2C0G A;  4BVY A;  4LL4 B;  1XW9 A;  1JHB A;  4IBP A;  1E2Y A;  1YQ1 A;  3LFL A;  1XIY A;  1A2L A;  2WB9 A;  1FB6 A;  2YN1 A;  3IDV A;  5IOX A;  1ERT A;  2MBT A;  3RAZ A;  3CTG A;  4FYU A;  3FR9 A;  1NSW A;  3BD2 A;  5AIX A;  1O85 A;  1U3A A;  2DJ2 A;  2AAW A;  1B48 A;  2P0G A;  2MMZ A;  1B9Y C;  10GS A;  3GKM A;  1U87 A;  4WBJ A;  4V1A g;  1TTZ A;  2M46 A;  3CYN A;  4FYC A;  2AYT A;  3ERG A;  1Q98 A;  3ZLP A;  3L78 A;  3Q18 A;  3MNG A;  4KSO A;  4ZIJ A;  2YWN A;  2GQL A;  4TN8 A;  4MA9 A;  3ZVJ A;  2OE1 A;  2YV9 A;  2IMK A;  3GH6 A;  1A23 A;  1H75 A;  3WGD A;  3KCM A;  2B6M A;  2ZNM A;  6GSW A;  3F6F A;  3M8N A;  3IR4 A;  3U5R E;  4KF9 A;  4N30 A;  3APQ A;  3IHQ A;  4OO4 A;  1GUK A;  5A4W A;  2O87 A;  2H1A A;  2LKU A;  3HHV A;  3NOF A;  2B5Y A;  3TKR A;  1AIU A;  3EE2 A;  3HCZ A;  2GZP A;  2L6D A;  1M7T A;  3MDK A;  1I9D A;  2FWH A;  4J57 E;  1M9B A;  1TKD B;  1OE7 A;  2GSS A;  2LEG A;  3TRX A;  2IMD A;  2J9H A;  4NV5 A;  1X5C A;  2TRX A;  4LLR A;  3KP8 A;  1M2B A;  4KND A;  1OKD A;  5IO0 A;  2R0P A;  1K0M A;  2M80 A;  4Q5F A;  2VCW A;  5IMA A;  1V2A A;  2YAN A;  5E59 A;  1GSE A;  5AN1 A;  3E9J B;  5GST A;  3FRC A;  3SWL A;  1S3R A;  2L5L A;  4QL7 A;  1B8X A;  2IIY A;  2LV3 A;  3BBY A;  2WCI A;  2C4J A;  1GL8 A;  3GKX A;  5ECI B;  2DML A;  3L9S A;  4ICY A;  1JZW A;  4ACS A;  1J08 A;  4MF5 A;  4TVE A;  5B6N A;  2OE3 A;  4PUA A;  4BPY A;  3C8E A;  1O73 A;  5EPF A;  3QPM A;  2R3X A;  1ZL9 A;  1EEJ A;  2M72 A;  1WJK A;  3VWU A;  4Z7X A;  4LA1 A;  4MJB A;  4IN0 A;  4EIQ A;  3HDC A;  4IJI A;  3L9U A;  2WUL A;  2N5F A;  4V1A p;  3F4S A;  3IPZ A;  5IQY A;  2IFQ B;  4NXI A;  4ZBD A;  3F3R A;  1CQH A;  2XC2 A;  3MSZ A;  3TKS A;  3QMX A;  1XVQ A;  2VL3 A;  4MF6 A;  1HD2 A;  2LJK A;  3ED3 A;  2ZUP A;  4J56 E;  1V98 A;  3VI5 A;  4WEY A;  5HR0 A;  5KOX A;  4X1U A;  1UC7 A;  2HZF A;  3GSS A;  3LSZ A;  4EKZ A;  4HI7 A;  2CAQ A;  4YAV A;  1XG8 A;  2WJU A;  4PNF A;  1EV4 A;  4O32 A;  2DKH A;  1FOV A;  1T4Y A;  2WDU A;  2YOI A;  2KUC A;  2H75 A;  2GQM A;  3G7Y A;  2E2M A;  2OA7 A;  3GX0 A;  3HA9 A;  5JWO B;  2R4V A;  4PQI A;  1K0O A;  3GL3 A;  1WMJ A;  1S3D A;  3Q19 A;  4YKG A;  1XWG A;  4YH2 A;  1HYU A;  4ULX A;  2YJ7 A;  2FGX A;  1T3B A;  3RPN A;  3HD5 A;  1X9S B;  1YJ6 A;  1U6T A;  2IN3 A;  4TR1 A;  5JCG A;  2CQ9 A;  3FEU A;  3GTU A;  3FMW A;  1GTB A;  5DJM A;  1IYI A;  4K0N A;  4BA7 A;  1V40 A;  3F63 A;  3D4T A;  2H6Z A;  3EYT A;  2RII A;  5HFK A;  5JWQ B;  1NW2 A;  4PUR A;  3C1R A;  7GSS A;  2NTO A;  2R2J A;  2JZR A;  5D9X A;  3WYW A;  4X0X A;  5DVB A;  2FNO A;  1O7U A;  4FYB A;  3KH9 A;  4OCE A;  3CRT A;  4DSR A;  4GQC A;  2V41 A;  2KP2 A;  2HSY A;  3KP9 A;  2YV7 A;  5G30 A;  1XVW A;  4BVX B;  2CT6 A;  3I6A A;  4NHW A;  5IMZ A;  3EIN A;  3ZML A;  4KUN A;  3H1N A;  1AQV A;  4IGJ A;  3DYR A;  4NPB A;  4PQ1 A;  1ZYP A;  2HRK A;  1X0R A;  3WT2 A;  2NDO A;  2QA1 A;  3APO A;  2VUP A;  4F82 A;  2K6V A;  3W8S A;  4XRA A;  4ML6 A;  3IBH A;  3KMN A;  3TCO A;  1HNA A;  2B7J A;  2H72 A;  4IP1 A;  2DIZ A;  2EIO A;  2A4H A;  3RHC A;  1AC1 A;  3A2V A;  4YAP A;  4MNN A;  2L4C A;  3ZTL A;  1EOH A;  4XS1 A;  3GUR A;  2CVB A;  2H66 A;  3CSH A;  3W6G A;  1F37 A;  4NWY A;  2H19 A;  5IMV A;  3GIX A;  19GS A;  1JFU A;  5IOW A;  2X8H A;  3C7M A;  4WR5 A;  3EWL A;  4RUV A;  4NV2 A;  3TJG A;  4QL9 A;  3FR6 A;  4EUY A;  5KN2 A;  4I2T A;  3SBC A;  3UJ1 A;  1YZX A;  2X99 A;  1GWC A;  5ENU A;  1KTE A;  3HZ4 A;  1URM A;  5G1K A;  4D73 A;  1A8Y A;  1JZO A;  4WBR D;  4QQ7 A;  2X8G A;  5ECO B;  1KNG A;  2B5E A;  2HZE A;  3FK8 A;  4PQH A;  4K6X A;  3RHB A;  4P3Y B;  1YKC A;  3LYP A;  2CZ3 A;  1AXD A;  2GS3 A;  3J7Y b;  1NM3 A;  3HVN A;  3J7Y k;  4HS1 A;  4BL7 A;  2GGT A;  2VLV A;  3PH9 A;  1VF3 A;  1R7H A;  1DSB A;  3HJP A;  4O5Q A;  1SL2 B;  5CP1 A;  1B4P A;  2TIR A;  1QUW A;  2C0F A;  3DML A;  2OAC A;  3EC3 A;  2ALB A;  5CRD A;  1TDI A;  1PRX A;  5G5F A;  1OC9 A;  2E7P A;  3D0Z A;  3EU3 A;  3IXR A;  3VWX A;  4K9Z A;  3A5W A;  2IMF A;  1EP8 A;  1NHY A;  5FT3 A;  5ID2 B;  4ZL8 A;  1PFO A;  2NVL A;  3BJ5 A;  1EV9 A;  5ECP B;  2H1G A;  1ABA A;  5D9V A;  5IM9 A;  5ECN B;  1SL1 B;  2OBI A;  2IWT A;  4G0I A;  3DD3 A;  5ECL B;  1VGL A;  3CMI A;  5D9W A;  2F9S A;  1ZYQ B;  3EU4 A;  2C0E A;  1G0T A;  4ECI A;  4MZW A;  4L5L A;  2PVQ A;  1XOB A;  4HU9 A;  4MJC A;  2C3T A;  2N5B A;  4OO5 A;  3ZZX A;  1GTA A;  1R5P A;  2OE0 A;  4GLT A;  5A4U A;  3LWA A;  3A5I A;  2IL3 A;  1HNB A;  2L57 A;  2PUK C;  3RPP A;  4PNG A;  2Z9S A;  4POB A;  2JZS A;  2KOK A;  4FO5 A;  1M3I A;  3E0U A;  4EF0 A;  4TXO B;  3H8Q A;  3Q74 A;  1YF0 A;  3EMP A;  3GKK A;  3KTL A;  1GSU A;  1ZYN A;  4CY6 A;  2VL9 A;  3GMF A;  1AAZ A;  5GAN D;  3GYK A;  1PSQ A;  4BIK A;  2PER A;  5HQP A;  2H71 A;  2K8V A;  2WFC A;  4GSN A;  2R37 A;  5DBQ A;  1TRS A;  14GS A;  4KH7 A;  4DSQ A;  4KE3 A;  1PX7 A;  1GUL A;  3VUR A;  4PTS A;  1XWC A;  4MZB A;  4KCA A;  2FWF A;  4YKF A;  2L4Q A;  2P5Q A;  5CYY A;  2H30 A;  3VFI A;  4ML1 A;  3TJJ A;  2GT6 A;  4N10 A;  2V32 A;  3P90 A;  1SL0 B;  3PIN A;  1R4W A;  4YQV A;  3I43 A;  1XFL A;  5ELA A;  2CV4 A;  2LNT A;  3M9K A;  4GXZ A;  4Q5N A;  2C3N A;  4IQA A;  5COH A;  3P2A A;  2P5R A;  4FIW A;  3ZIV A;  4Q5Q A;  4GRF A;  5DJL A;  1SYX A;  3HY2 A;  2YZH A;  2ON5 A;  2XBI A;  11GS A;  5D9T A;  1A2M A;  1EOG A;  5DAL A;  2LQO A;  4K5S A;  3IV4 A;  4OD7 A;  4N11 A;  4K7I A;  4K8M A;  3F6D A;  2B1L A;  1SKS B;  1SJZ A;  2VCQ A;  4OFN A;  4E8H A;  4G9H A;  2MYG A;  3KGK A;  4JR4 A;  4ZBA A;  1VF1 A;  2XBQ A;  1XZO A;  2C80 A;  4MCU A;  5LCZ A;  4HEA 2;  4RQR A;  1BG5 A;  3O3T A;  2A4V A;  2DSA A;  2DJ3 A;  2EC4 A;  2JZT A;  1ZZY A;  2WGR A;  2MZC A;  1GNW A;  2PGT A;  1XWA A;  5JCU A;  3KD0 A;  2RM6 A;  4LL1 B;  4A5P A;  4HSC X;  20GS A;  2FUG 2;  2WZ9 A;  3IC4 A;  5DDL A;  2CX3 A;  3LXZ A;  4KX4 A;  1Z7R A;  2LUS A;  4F0C A;  6GST A;  3ERF A;  4IJ3 A;  3QAG A;  3C73 A;  4DSS B;  2NPB A;  4TXV A;  4GTU A;  2DJK A;  1S3A A;  1F9M A;  1JZR A;  3VI7 A;  3EVI A;  5HFG A;  1Z5Y E;  4HUA A;  5CRW A;  1PX6 A;  3ERW A;  5D73 A;  1PKZ A;  4GSS A;  4RI7 A;  1WE0 A;  4CHS A;  2H8L A;  1C72 A;  1TU8 A;  1USB A;  5DAK A;  3GA4 A;  3R3E A;  5C00 A;  5F06 A;  3VPT A;  2JL4 A;  2LQQ A;  1GLP A;  2BJX A;  1V57 A;  3DWV A;  3I69 A;  5H5S A;  3IAM 2;  2LRT A;  3IHG A;  3GX8 A;  1YEP A;  1K0B A;  3CQF A;  1T4Z A;  2H1B A;  2LJR A;  3AY8 A;  3QD9 A;  1GUH A;  3NIV A;  4MJE A;  1MDI A;  5J4U A;  2GDR A;  2LTK A;  5ECR B;  1FB0 A;  4K2D A;  3LXT A;  3KH7 A;  3F0I A;  3EMX A;  4AJ7 A;  3FZA A;  3EPT A;  4XS4 B;  1EGO A;  3GV1 A;  3LJR A;  1SJ6 A;  5LD0 A;  2IPA A;  3ZIJ A;  1JLV A;  4IEL A;  1SD9 A;  1BAY A;  3P7X A;  1V58 A;  4HOJ A;  1LBK A;  1YEX A;  4AJ8 A;  6GSS A;  1T00 A;  3LOR A;  1UN2 A;  4IW9 A;  3WT1 A;  2X8C A;  2J23 A;  2V6K A;  2V6O A;  2FD3 A;  3PPU A;  1WIK A;  3LG6 A;  5ECM B;  1AQW A;  3TKS E;  2FA8 A;  5LNK e;  3QCP A;  1TK0 B;  4DVC A;  2JU5 A;  1GNE A;  2I9H A;  3ZL5 A;  5A4V A;  4J2F A;  1QFN A;  3H93 A;  5KEJ A;  4WF5 A;  2FY6 A;  2R6K A;  1TI1 A;  4USS A;  4OFT A;  2PPT A;  2BTO T;  1EEM A;  1U3I A;  2GTU A;  4G19 A;  2VIM A;  4BWS A;  3EUR A;  4POL A;  3A2X A;  5CAX A;  4V2L A;  4I97 A;  2H70 A;  5B8A A;  2F51 A;  2HXK A;  4WKW A;  1E6B A;  4TR4 A;  4POK A;  2DLX A;  1OVN A;  1K0D A;  4Z2T A;  3CRU A;  5F07 A;  4ZB6 A;  1ERW A;  2LJA A;  3LGC A;  4LMV A;  3M1G A;  3GKN A;  4GST A;  4XRD A;  3TKQ A;  3A3T A;  3FR3 A;  1GSD A;  4F03 A;  1KBN A;  5GAP D;  2A2S A;  4BVY B;  1A24 A;  4ECJ A;  2B7K A;  2IMI A;  3IRA A;  1M9A A;  3K8N A;  4I5Q A;  3QR6 A;  1SKR B;  2HI7 A;  4K7O A;  5J9C A;  1SK1 A;  4WR4 A;  1NHO A;  3IC8 A;  3HZ8 A;  3QAV A;  5AIV A; 
#chains in the Genus database with same CATH homology
 1PKW A;  4HJM A;  3V1W A;  1GRX A;  4TRX A;  2QSI A;  1A0R P;  1G6W A;  2DJJ A;  2YP6 A;  5INY A;  1EWX A;  1MDJ A;  4X4J A;  1X5E A;  1DE2 A;  4IP6 A;  4MF7 A;  3TDG A;  2H6X A;  3TJF A;  4WET A;  3GN3 A;  3PGT A;  2C3Q A;  4K5R A;  3ZVJ D;  3L0H A;  3VLN A;  3FHK A;  4FH8 A;  1Z7P A;  2VCZ A;  2OJL A;  5JWR B;  3VWW A;  4NHZ A;  5HFI A;  1TI3 A;  1VRS D;  2EIQ A;  1OKT A;  2O85 A;  1SU9 A;  5KN3 A;  1SK2 A;  3C71 A;  1UA5 A;  1X5D A;  4ZXG A;  3QOU A;  2HLS A;  4KGI A;  1GP1 A;  2GZZ A;  3ZRD A;  2GST A;  3UVT A;  4GCI A;  4HJ2 A;  3DGQ A;  2XHF A;  3TJK A;  5G5E A;  3M3M A;  2HFD A;  1GSY A;  2YPM A;  1PN9 A;  4ILF A;  2MMN A;  1YY7 A;  1W89 A;  4IS0 A;  2H74 A;  5FHI A;  1MDK A;  4HZ2 A;  3FZ9 A;  4WF4 A;  1K3L A;  1HQO A;  3HVX A;  4JBB A;  1PL1 A;  2I81 A;  1EZK A;  1FAA A;  4MDC A;  3N9J A;  1OE8 A;  4GWR A;  4F2I A;  1ON4 A;  2YWM A;  4KW6 A;  4FQU A;  2LRN A;  1G7O A;  2WRT A;  4G0L A;  2GSQ A;  2MBS A;  2K9F A;  5FWG A;  2JSY A;  4MP4 A;  3ZIT A;  2A2R A;  3D21 A;  1CQG A;  3UMA A;  2F8A A;  3KJY A;  1W4V A;  3WGX A;  5CRE A;  2JSZ A;  4WXT A;  2VLT A;  4HU7 A;  4V2M A;  3ZYW A;  5GZZ B;  1OAZ A;  2GLR A;  2IFQ A;  3O6T A;  2G2Q A;  1QMV A;  1SEN A;  2G0F A;  4BWQ A;  4DEJ A;  2CA8 A;  2XPD A;  4ID0 A;  3FW2 A;  3H79 A;  4OFM A;  4G2E A;  4E8E A;  3HYP A;  1ACV A;  2VLU A;  1EGR A;  5ELG A;  1G7E A;  3KXO A;  1N2A A;  1SYR A;  1FHE A;  2AB6 A;  5HR3 A;  2H0I A;  4IQ1 A;  1ML6 A;  2VAF A;  3F8U A;  4NAX A;  5HR1 A;  3ME8 A;  1XOA A;  2DC5 A;  4ZL9 A;  2O89 A;  1TK8 B;  6GSU A;  2ES7 A;  3TB2 A;  2DIY A;  2P31 A;  3IK7 A;  3TRQ A;  1M2D A;  5F0G A;  5IPH A;  4MAB A;  4K7N A;  2C8U A;  4F9Z A;  4EC0 A;  3UBL A;  3UEM A;  1JZD A;  2V2G A;  4XIH A;  3DIE A;  1ZOF A;  1FO5 A;  2A2P A;  2O8V B;  4IVF A;  3ME7 A;  4EIP A;  3KTB A;  3ZFL A;  1OC8 A;  3CBU A;  1YDK A;  1WPI A;  1ERU A;  1V9W A;  1FG4 A;  1LU4 A;  3F4T A;  1DE1 A;  2PVO C;  3JCM L;  3UAP A;  4XCS A;  3MAK A;  4EO3 A;  1VF2 A;  2B1K A;  5EL8 A;  4CW9 A;  4PGT A;  3L4N A;  4MPG A;  1YKA A;  2AV4 A;  4TR0 A;  4ZB8 A;  2YWI A;  5EVO A;  4CDO A;  4BVX A;  3UVH A;  2HNL A;  1TRV A;  1XCC A;  4TR1 B;  1PN0 A;  1WWJ A;  3VPQ A;  2H76 A;  2HRF A;  1K0N A;  2VL2 C;  3GTU B;  4KDY A;  1RK4 A;  5IPG A;  1MD4 A;  3APS A;  3BCK A;  3G7J A;  2YWO A;  2ZCT A;  2JAD A;  3FKF A;  2QA2 A;  2LS5 A;  1GTI A;  3UOM A;  1DBY A;  4OCF A;  5IMD A;  2YJH A;  4JZQ A;  4N0Z A;  3US3 A;  5F05 A;  2H0G A;  4IKH A;  2VO4 A;  2DMM A;  3M0F A;  4JU5 A;  4HZ4 A;  5D93 A;  2VOC A;  5A5K A;  3HXS A;  1SK0 A;  2GSR A;  4L0U A;  2VM2 A;  1XPV A;  4H86 A;  2MMA A;  5JCW A;  1XW5 A;  2K18 A;  1R5A A;  3GUS A;  2OKA A;  4OWY A;  2CX4 A;  5IO2 A;  1T7P B;  4ECB A;  2PBJ A;  1X9W B;  5D96 A;  3FZ5 A;  1PD2 1;  3D6I A;  3RDW A;  3WD6 A;  1MEK A;  2VCT A;  5KN1 A;  1QK8 A;  3TUE A;  2EIR A;  1SD8 A;  2NBS A;  2HRN A;  5IIZ A;  4XS6 A;  5E4W A;  1OYJ A;  2LST A;  1BED A;  4JED A;  5BMU A;  1THX A;  1GLQ A;  1A2J A;  4YQU A;  2FWG A;  4G0K A;  5F8B A;  1F2E A;  1K3O A;  4EDY A;  1ILO A;  4KA0 A;  2H01 A;  2KLX A;  3ZRE A;  2HT9 A;  3W8J A;  2HRA A;  5ECH B;  3ZMK A;  3CSI A;  1HNC A;  4K2X A;  5AIS A;  4N0V A;  1T1V A;  3F3Q A;  3HKR A;  4D73 B;  1TJD A;  1K0A A;  3BOA A;  5KN0 A;  3Q6O A;  5CO3 A;  4HQS A;  2GZY A;  4MZC A;  2OAD A;  1B4Q A;  1Y25 A;  2REM A;  4YQM A;  2HZE B;  2DJ0 A;  1ZYE A;  1BQ7 A;  4AJ6 A;  3KM6 A;  5IMC A;  2B5X A;  13GS A;  1F6M C;  5ID2 A;  5IMF A;  2GVP A;  3G9B A;  2HSM A;  1QQ2 A;  4EE0 A;  4BL7 B;  4ISD A;  5H5Q A;  4V2N A;  2BMX A;  3I9V 2;  2OBK A;  5ECQ B;  2H0H A;  3GST A;  3GH9 A;  1MTC A;  4Z2U A;  3UBK A;  1I5G A;  1AQX A;  1TP9 A;  2AJQ B;  2I4A A;  1OC9 B;  2CAI A;  1O8X A;  1LJR A;  5B7C A;  1O6J A;  3UAR A;  4EXJ A;  2YCD A;  5L71 A;  5J9B A;  1YF1 A;  6GSX A;  1J9B A;  1RQM A;  1IYH A;  4JE1 A;  4O5R A;  5D8I A;  3TRP A;  2HYX A;  4Z2R A;  4KB3 A;  5EY6 A;  3HVV A;  1K0C A;  1M0U A;  2HE3 A;  3DEX A;  4NMU A;  1JLW A;  3QDN A;  1F3A A;  1ZMA A;  4TXO A;  3IE3 A;  2YNX A;  17GS A;  3OR5 A;  6GSV A;  5G2Z A;  5ABR A;  4KCE A;  1FVJ A;  2RLI A;  3TOT A;  3BCI A;  2LNS A;  2FHE A;  2QKE A;  1Y6E A;  2X64 A;  3DXB A;  4AGS A;  5ECK B;  9GSS A;  3HJM A;  1TOF A;  2F3M A;  1QGV A;  2B3S A;  5DCH A;  2AHE A;  2X49 A;  3HVS A;  2R0G A;  3DVW A;  5ECS A;  3TKP A;  2VM1 A;  3ZFB A;  1G6Y A;  5B6M A;  2V1M A;  2YZU A;  5CRH A;  3F4R A;  1THO A;  2D2Z A;  2E0Q A;  1B9X C;  1ST9 A;  4ZL7 A;  2TRC P;  2KP1 A;  2O7K A;  2X4A A;  4Q5R A;  2RUF A;  2GQK A;  2LRC A;  3IOS A;  3LEF A;  1TK5 B;  1WRY A;  1UVZ A;  1ERV A;  5GSS A;  1N8J A;  3H4K A;  4K0G A;  2C0D A;  4AF2 A;  2L5O A;  3FYG A;  4ZIL A;  2KHP A;  22GS A;  8GSS A;  2H1D A;  1WOU A;  2C1Y A;  1RW1 A;  3NZN A;  1FOH A;  1F3B A;  2PWJ A;  4L0W A;  2UZ8 A;  3KMO A;  2QGV A;  2PMT A;  4PUF C;  5DQY A;  2H73 A;  2FCH A;  4EVM A;  1AW9 A;  3D4M A;  2L6C A;  4KDU A;  3UL3 A;  1Z6N A;  4KAE A;  3D22 A;  4RI6 A;  5G31 A;  3CTF A;  5HR2 A;  3QFB C;  1MD3 A;  1OC3 A;  4G10 A;  1T8E B;  1GSS A;  5J5N A;  1TRW A;  1M99 A;  1M2A A;  4ZBB A;  4PX1 A;  4TKY A;  3QAW A;  3A2W A;  2DKI A;  3C1S A;  5DAL B;  1R26 A;  3TKS C;  3KEB A;  2R0C A;  1Q4J A;  4I6X A;  4XTS A;  2QC7 A;  4KSM A;  1PMT A;  2DBC A;  1X9M B;  3LYK A;  16GS A;  1Z6M A;  5H5R A;  2JAC A;  2E2G A;  3GHA A;  4X43 A;  4DSS A;  3DKS A;  5CNW A;  1FVK A;  3G7I A;  3FZ4 A;  1PL2 A;  4JRR A;  3KZQ A;  2I3Y A;  4HDE A;  1H4O A;  3S9F A;  1O8W A;  2N5A A;  4MMM A;  4EDZ A;  2IJY A;  3E3E A;  2PU9 C;  1XW6 A;  2HSH A;  3KIJ A;  1O81 A;  3DVX A;  3QFA C;  3RBT A;  5DCG A;  1K3Y A;  4KDX A;  1TW9 A;  1XWK A;  4I8B A;  4PXO A;  3MYD A;  4HQZ A;  5C04 A;  3TGZ A;  1TXX A;  2VCV A;  1GSQ A;  1A0F A;  4MJA A;  3M9J A;  4LMW A;  1S3C A;  4I2U A;  4O7H A;  2ON7 A;  3O76 A;  1AUC A;  4TR3 A;  4POM A;  3MWH A;  3CXG A;  5DAK B;  1SKW B;  5B8B A;  3GL5 A;  1EP7 A;  6GSY A;  3CSJ A;  1XXU A;  1DUG A;  4O5U A;  5KOW A;  3N5O A;  2XPE A;  3IK9 A;  2VCX A;  1TRU A;  18GS A;  4XS4 A;  3LW9 A;  3VK9 A;  4MH2 A;  2VL2 A;  5J41 A;  2RM5 A;  4K1F A;  1QXH A;  2WS2 A;  4F0B A;  4GF0 A;  2I1U A;  2VD0 A;  12GS A;  3LQ7 A;  4L5O A;  2L59 A;  4MLY A;  3FY7 A;  4RQX A;  2FA4 A;  2K8S A;  3VWV A;  1XWB A;  2F8F A;  1A8L A;  4GQF A;  2CVD A;  1VF4 A;  3U6V A;  2FLS A;  1U88 A;  2CVK A;  4JR6 A;  4O92 A;  3TJB A;  3GNJ A;  3R2Q A;  3ISO A;  4MH3 A;  1GH2 A;  3L9V A;  2AUV A;  4L8E A;  3TOU A;  3UIW A;  4CY8 A;  1BYE A;  5G1L A;  4IHU A;  2MMO A;  4ECC A;  3GRX A;  3MIX A;  5CRG A;  1BX9 A;  2GT5 A;  1GUM A;  3WGE A;  3F9U A;  5BRT A;  1Z9H A;  3DRN A;  4MK3 A;  3HJO A;  3IAS 2;  4TW5 A;  3D5J A;  1TU7 A;  1FW1 A;  1ZGN A;  3P8W A;  4EL1 A;  1GSF A;  2H6Y A;  4MPF A;  1GTU A;  5J3R A;  4OMV A;  2RUE A;  1PGT A;  1ZCP A;  2FWE A;  2PN8 A;  1SJI A;  2R5G A;  1J0F A;  2IME A;  2VD1 A;  1KEB A;  3PR8 A;  4ZB9 A;  1PQN A;  4XHM A;  1WP0 A;  2CZ2 A;  3IA1 A;  2DJ1 A;  5AGY A;  3GFK A;  1XBS A;  1BJX A;  1PA3 A;  4TOP A;  5DQS A;  1Z3E A;  2C0G A;  4BVY A;  4LL4 B;  1XW9 A;  1JHB A;  4IBP A;  1E2Y A;  1YQ1 A;  3LFL A;  1XIY A;  1A2L A;  2WB9 A;  1FB6 A;  2YN1 A;  3IDV A;  5IOX A;  1ERT A;  2MBT A;  3RAZ A;  3CTG A;  4FYU A;  3FR9 A;  1NSW A;  3BD2 A;  5AIX A;  1O85 A;  1U3A A;  2DJ2 A;  2AAW A;  1B48 A;  2P0G A;  2MMZ A;  1B9Y C;  10GS A;  3GKM A;  1U87 A;  4WBJ A;  4V1A g;  1TTZ A;  2M46 A;  3CYN A;  4FYC A;  2AYT A;  3ERG A;  1Q98 A;  3ZLP A;  3L78 A;  3Q18 A;  3MNG A;  4KSO A;  4ZIJ A;  2YWN A;  2GQL A;  4TN8 A;  4MA9 A;  3ZVJ A;  2OE1 A;  2YV9 A;  2IMK A;  3GH6 A;  1A23 A;  1H75 A;  3WGD A;  3KCM A;  2B6M A;  2ZNM A;  6GSW A;  3F6F A;  3M8N A;  3IR4 A;  3U5R E;  4KF9 A;  4N30 A;  3APQ A;  3IHQ A;  4OO4 A;  1GUK A;  5A4W A;  2O87 A;  2H1A A;  2LKU A;  3HHV A;  3NOF A;  2B5Y A;  3TKR A;  1AIU A;  3EE2 A;  3HCZ A;  2GZP A;  2L6D A;  1M7T A;  3MDK A;  1I9D A;  2FWH A;  4J57 E;  1M9B A;  1TKD B;  1OE7 A;  2GSS A;  2LEG A;  3TRX A;  2IMD A;  2J9H A;  4NV5 A;  1X5C A;  2TRX A;  4LLR A;  3KP8 A;  1M2B A;  4KND A;  1OKD A;  5IO0 A;  2R0P A;  1K0M A;  2M80 A;  4Q5F A;  2VCW A;  5IMA A;  1V2A A;  2YAN A;  5E59 A;  1GSE A;  5AN1 A;  3E9J B;  5GST A;  3FRC A;  3SWL A;  2L5L A;  4QL7 A;  1B8X A;  2IIY A;  2LV3 A;  3BBY A;  2WCI A;  2C4J A;  1GL8 A;  3GKX A;  5ECI B;  2DML A;  3L9S A;  4ICY A;  1JZW A;  4ACS A;  1J08 A;  4MF5 A;  4TVE A;  5B6N A;  2OE3 A;  4PUA A;  4BPY A;  3C8E A;  1O73 A;  5EPF A;  3QPM A;  2R3X A;  1ZL9 A;  1EEJ A;  2M72 A;  1WJK A;  3VWU A;  4Z7X A;  4LA1 A;  4MJB A;  4IN0 A;  4EIQ A;  3HDC A;  4IJI A;  3L9U A;  2WUL A;  2N5F A;  4V1A p;  3F4S A;  3IPZ A;  5IQY A;  2IFQ B;  4NXI A;  4ZBD A;  3F3R A;  1CQH A;  2XC2 A;  3MSZ A;  3TKS A;  3QMX A;  1XVQ A;  2VL3 A;  4MF6 A;  1HD2 A;  2LJK A;  3ED3 A;  2ZUP A;  4J56 E;  1V98 A;  3VI5 A;  4WEY A;  5HR0 A;  5KOX A;  4X1U A;  1UC7 A;  2HZF A;  3GSS A;  3LSZ A;  4EKZ A;  4HI7 A;  2CAQ A;  4YAV A;  2WJU A;  4PNF A;  1EV4 A;  4O32 A;  2DKH A;  1FOV A;  1T4Y A;  2WDU A;  2YOI A;  2KUC A;  2H75 A;  2GQM A;  3G7Y A;  2E2M A;  2OA7 A;  3GX0 A;  3HA9 A;  5JWO B;  2R4V A;  4PQI A;  1K0O A;  3GL3 A;  1WMJ A;  1S3D A;  3Q19 A;  4YKG A;  1XWG A;  4YH2 A;  1HYU A;  4ULX A;  2YJ7 A;  2FGX A;  1T3B A;  3RPN A;  3HD5 A;  1X9S B;  1YJ6 A;  1U6T A;  2IN3 A;  4TR1 A;  5JCG A;  2CQ9 A;  3FEU A;  3GTU A;  3FMW A;  1GTB A;  5DJM A;  1IYI A;  4K0N A;  4BA7 A;  1V40 A;  3F63 A;  3D4T A;  2H6Z A;  3EYT A;  2RII A;  5HFK A;  5JWQ B;  1NW2 A;  4PUR A;  3C1R A;  7GSS A;  2NTO A;  2R2J A;  2JZR A;  5D9X A;  3WYW A;  4X0X A;  5DVB A;  2FNO A;  1O7U A;  4FYB A;  3KH9 A;  4OCE A;  3CRT A;  4DSR A;  4GQC A;  2V41 A;  2KP2 A;  2HSY A;  3KP9 A;  2YV7 A;  5G30 A;  1XVW A;  4BVX B;  2CT6 A;  3I6A A;  4NHW A;  5IMZ A;  3EIN A;  3ZML A;  4KUN A;  3H1N A;  1AQV A;  4IGJ A;  3DYR A;  4NPB A;  4PQ1 A;  1ZYP A;  2HRK A;  1X0R A;  3WT2 A;  2NDO A;  2QA1 A;  3APO A;  2VUP A;  4F82 A;  2K6V A;  3W8S A;  4XRA A;  4ML6 A;  3IBH A;  3KMN A;  3TCO A;  1HNA A;  2B7J A;  2H72 A;  4IP1 A;  2DIZ A;  2EIO A;  2A4H A;  3RHC A;  1AC1 A;  3A2V A;  4YAP A;  4MNN A;  2L4C A;  3ZTL A;  1EOH A;  4XS1 A;  3GUR A;  2CVB A;  2H66 A;  3CSH A;  3W6G A;  1F37 A;  4NWY A;  2H19 A;  5IMV A;  3GIX A;  19GS A;  1JFU A;  5IOW A;  2X8H A;  3C7M A;  4WR5 A;  3EWL A;  4RUV A;  4NV2 A;  3TJG A;  4QL9 A;  3FR6 A;  4EUY A;  5KN2 A;  4I2T A;  3SBC A;  3UJ1 A;  1YZX A;  2X99 A;  1GWC A;  5ENU A;  1KTE A;  3HZ4 A;  1URM A;  5G1K A;  4D73 A;  1A8Y A;  1JZO A;  4WBR D;  4QQ7 A;  2X8G A;  5ECO B;  1KNG A;  2B5E A;  2HZE A;  3FK8 A;  4PQH A;  4K6X A;  3RHB A;  4P3Y B;  1YKC A;  3LYP A;  2CZ3 A;  1AXD A;  2GS3 A;  3J7Y b;  1NM3 A;  3J7Y k;  4HS1 A;  4BL7 A;  2GGT A;  2VLV A;  3PH9 A;  1VF3 A;  1R7H A;  1DSB A;  3HJP A;  4O5Q A;  1SL2 B;  5CP1 A;  1B4P A;  2TIR A;  1QUW A;  2C0F A;  3DML A;  2OAC A;  3EC3 A;  2ALB A;  5CRD A;  1TDI A;  1PRX A;  5G5F A;  1OC9 A;  2E7P A;  3D0Z A;  3EU3 A;  3IXR A;  3VWX A;  4K9Z A;  3A5W A;  2IMF A;  1EP8 A;  1NHY A;  5FT3 A;  5ID2 B;  4ZL8 A;  2NVL A;  3BJ5 A;  1EV9 A;  5ECP B;  2H1G A;  1ABA A;  5D9V A;  5IM9 A;  5ECN B;  1SL1 B;  2OBI A;  2IWT A;  4G0I A;  3DD3 A;  5ECL B;  1VGL A;  3CMI A;  5D9W A;  2F9S A;  1ZYQ B;  3EU4 A;  2C0E A;  1G0T A;  4ECI A;  4MZW A;  4L5L A;  2PVQ A;  1XOB A;  4HU9 A;  4MJC A;  2C3T A;  2N5B A;  4OO5 A;  3ZZX A;  1GTA A;  1R5P A;  2OE0 A;  4GLT A;  5A4U A;  3LWA A;  3A5I A;  2IL3 A;  1HNB A;  2L57 A;  2PUK C;  3RPP A;  4PNG A;  2Z9S A;  4POB A;  2JZS A;  2KOK A;  4FO5 A;  3E0U A;  4EF0 A;  4TXO B;  3H8Q A;  3Q74 A;  1YF0 A;  3EMP A;  3GKK A;  3KTL A;  1GSU A;  1ZYN A;  4CY6 A;  2VL9 A;  3GMF A;  1AAZ A;  5GAN D;  3GYK A;  1PSQ A;  2PER A;  5HQP A;  2H71 A;  2K8V A;  2WFC A;  4GSN A;  2R37 A;  5DBQ A;  1TRS A;  14GS A;  4KH7 A;  4DSQ A;  4KE3 A;  1PX7 A;  1GUL A;  3VUR A;  4PTS A;  1XWC A;  4MZB A;  4KCA A;  2FWF A;  4YKF A;  2L4Q A;  2P5Q A;  5CYY A;  2H30 A;  3VFI A;  4ML1 A;  3TJJ A;  2GT6 A;  4N10 A;  2V32 A;  3P90 A;  1SL0 B;  3PIN A;  1R4W A;  4YQV A;  3I43 A;  1XFL A;  5ELA A;  2CV4 A;  2LNT A;  3M9K A;  4GXZ A;  4Q5N A;  2C3N A;  4IQA A;  5COH A;  3P2A A;  2P5R A;  4FIW A;  3ZIV A;  4Q5Q A;  4GRF A;  5DJL A;  1SYX A;  3HY2 A;  2YZH A;  2ON5 A;  2XBI A;  11GS A;  5D9T A;  1A2M A;  1EOG A;  5DAL A;  2LQO A;  4K5S A;  3IV4 A;  4OD7 A;  4N11 A;  4K7I A;  4K8M A;  3F6D A;  2B1L A;  1SKS B;  1SJZ A;  2VCQ A;  4OFN A;  4E8H A;  4G9H A;  2MYG A;  3KGK A;  4JR4 A;  4ZBA A;  1VF1 A;  2XBQ A;  1XZO A;  2C80 A;  4MCU A;  5LCZ A;  4HEA 2;  4RQR A;  1BG5 A;  3O3T A;  2A4V A;  2DSA A;  2DJ3 A;  2EC4 A;  2JZT A;  1ZZY A;  2WGR A;  2MZC A;  1GNW A;  2PGT A;  1XWA A;  5JCU A;  3KD0 A;  2RM6 A;  4LL1 B;  4A5P A;  20GS A;  2FUG 2;  2WZ9 A;  3IC4 A;  5DDL A;  2CX3 A;  3LXZ A;  4KX4 A;  1Z7R A;  2LUS A;  4F0C A;  6GST A;  3ERF A;  4IJ3 A;  3QAG A;  3C73 A;  4DSS B;  2NPB A;  4TXV A;  4GTU A;  2DJK A;  1S3A A;  1F9M A;  1JZR A;  3VI7 A;  3EVI A;  5HFG A;  1Z5Y E;  4HUA A;  5CRW A;  1PX6 A;  3ERW A;  5D73 A;  1PKZ A;  4GSS A;  4RI7 A;  1WE0 A;  4CHS A;  2H8L A;  1C72 A;  1TU8 A;  1USB A;  5DAK A;  3GA4 A;  3R3E A;  5C00 A;  5F06 A;  3VPT A;  2JL4 A;  2LQQ A;  1GLP A;  2BJX A;  1V57 A;  3DWV A;  3I69 A;  5H5S A;  3IAM 2;  2LRT A;  3IHG A;  3GX8 A;  1YEP A;  1K0B A;  1T4Z A;  2H1B A;  2LJR A;  3AY8 A;  3QD9 A;  1GUH A;  3NIV A;  4MJE A;  1MDI A;  5J4U A;  2GDR A;  2LTK A;  5ECR B;  1FB0 A;  4K2D A;  3LXT A;  3KH7 A;  3F0I A;  3EMX A;  4AJ7 A;  3FZA A;  3EPT A;  4XS4 B;  1EGO A;  3GV1 A;  3LJR A;  1SJ6 A;  5LD0 A;  2IPA A;  3ZIJ A;  1JLV A;  4IEL A;  1SD9 A;  1BAY A;  3P7X A;  1V58 A;  4HOJ A;  1LBK A;  1YEX A;  4AJ8 A;  6GSS A;  1T00 A;  3LOR A;  1UN2 A;  4IW9 A;  3WT1 A;  2X8C A;  2J23 A;  2V6K A;  2V6O A;  2FD3 A;  3PPU A;  1WIK A;  3LG6 A;  5ECM B;  1AQW A;  3TKS E;  2FA8 A;  5LNK e;  3QCP A;  1TK0 B;  4DVC A;  2JU5 A;  1GNE A;  2I9H A;  3ZL5 A;  5A4V A;  4J2F A;  1QFN A;  3H93 A;  5KEJ A;  4WF5 A;  2FY6 A;  2R6K A;  1TI1 A;  4USS A;  4OFT A;  2PPT A;  2BTO T;  1EEM A;  1U3I A;  2GTU A;  4G19 A;  2VIM A;  4BWS A;  3EUR A;  4POL A;  3A2X A;  5CAX A;  4V2L A;  4I97 A;  2H70 A;  5B8A A;  2F51 A;  2HXK A;  4WKW A;  1E6B A;  4TR4 A;  4POK A;  2DLX A;  1OVN A;  1K0D A;  4Z2T A;  3CRU A;  5F07 A;  4ZB6 A;  1ERW A;  2LJA A;  3LGC A;  4LMV A;  3M1G A;  3GKN A;  4GST A;  4XRD A;  3TKQ A;  3A3T A;  3FR3 A;  1GSD A;  4F03 A;  1KBN A;  5GAP D;  2A2S A;  4BVY B;  1A24 A;  4ECJ A;  2B7K A;  2IMI A;  3IRA A;  1M9A A;  3K8N A;  4I5Q A;  3QR6 A;  1SKR B;  2HI7 A;  4K7O A;  5J9C A;  1SK1 A;  4WR4 A;  1NHO A;  3IC8 A;  3HZ8 A;  3QAV A;  5AIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...