1TI1A

Crystal structure of a mutant dsba
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
186
structure length
186
Chain Sequence
YEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Intriguing conformation changes associated with the trans/cis isomerization of a prolyl residue in the active site of the DsbA C33A mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 63
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ti1A00
3PH9A 4PURA 4IN0A 5ELAA 3W8JA 2VUPA 1TI1A 1GUMA 1OKTA 2YANA 4MJBA 4TR1B 2KLXA 1T1VA 5IMAA 1TU7A 4K7IA 3DRNA 1MD3A 1EOHA 2WFCA 1XOBA 1R5AA 1A0FA 1QFNA 4K9ZA 3IOSA 2IN3A 2LUSA 2AAWA 1G7OA 1JZWA 4J57E 1ZYQB 4KAEA 1O81A 1XZOA 3N9JA 4I97A 2VCZA 4KSMA 5IM9A 3VWUA 5H5QA 3H79A 3F6DA 5ECPB 1ZOFA 3UBKA 1BQ7A 2D2ZA 4ZL8A 3GYKA 2K8VA 2HXKA 4PXOA 5GAND 1BYEA 2YJHA 3H4KA 2CX3A 3O6TA 4IKHA 1W89A 4IBPA 4BWSA 1K0AA 3MSZA 3L4NA 5D9VA 2HYXA 5ECKB 3CYNA 4ZBDA 1K3OA 2XC2A 1O85A 1MDIA 1WE0A 2LQOA 3TCOA 1A2MA 2YV7A 3QAVA 3VFIA 2R37A 4N30A 3DVWA 4ISDA 4NV2A 2V1MA 4POLA 5J3RA 3GTUA 4K7OA 4XRAA 5IO2A 4P3YB 1ERVA 3ZREA 4F0BA 2ZUPA 1GSEA 1EEMA 1OVNA 3HZ4A 2FCHA 2E0QA 4KCAA 4V1Ap 1X9SB 3F4SA 1ERTA 2L5OA 4PQ1A 2BJXA 1ERWA 11GSA 2IMKA 3TJKA 2O87A 2RM6A 2R5GA 3FRCA 1I5GA 3CBUA 1PKZA 1H4OA 2FNOA 3TGZA 1OC8A 5CP1A 3GV1A 2VLTA 2B5YA 3DWVA 5J9BA 3ZLPA 1EGOA 3A2WA 3FR9A 4MZCA 2AUVA 3RHCA 2K9FA 2IL3A 1Q98A 2E7PA 1SD9A 2HRFA 4HJMA 1M99A 5G30A 5ECQB 8GSSA 5D9XA 2AYTA 2ZNMA 1SL2B 1S3AA 5COHA 3WGEA 2GS3A 5LNKe 4XRDA 5EL8A 2KP2A 1TRVA 2XPDA 4KDXA 5GAPD 1TU8A 4GXZA 2LQQA 2WRTA 3GKXA 4ZB6A 2XBQA 3CTGA 4YQUA 2KP1A 5B6NA 4ECJA 2MZCA 1WWJA 2H1BA 3KIJA 2G2QA 2JADA 18GSA 4F2IA 1TW9A 4MABA 4KNDA 5HR2A 1HNAA 2R2JA 1GUKA 4BVYA 2H73A 2LJKA 2H30A 4J2FA 3DVXA 1Z6NA 13GSA 2CVBA 2LKUA 3DD3A 4X1UA 4V1Ag 1XW6A 5IMVA 1XWCA 2OA7A 3GUSA 5L71A 1ERUA 1SJIA 3TB2A 4FYUA 1XVQA 2K18A 2WS2A 4DSSA 3D4TA 2KOKA 4MH3A 2YZHA 1ZL9A 4TXOB 4WBRD 4WF5A 4ZB9A 2GGTA 1U87A 6GSTA 2VL9A 3QAWA 1IYIA 3FY7A 4TXVA 4PNFA 4QL7A 2H6ZA 3HDCA 1XWKA 3WYWA 5KN2A 1G7EA 1QGVA 3VI7A 2YCDA 1R5PA 2PBJA 3P7XA 2MBTA 4Q5RA 2PPTA 1O8WA 5J9CA 2NBSA 4POMA 1GUHA 4MCUA 3KXOA 2FHEA 2O7KA 3EU4A 3G7IA 4WKWA 5DVBA 4KE3A 4EC0A 7GSSA 4FIWA 3UOMA 5IOWA 3UEMA 3L78A 5FHIA 2H76A 1X0RA 2DMLA 1PGTA 1J9BA 1EZKA 1FVKA 1BJXA 2HFDA 3HJMA 1Y25A 3GRXA 5F0GA 4HEA2 3GTUB 1KNGA 1Z6MA 2M46A 1EP7A 2B5EA 1FOVA 2F8AA 3ZITA 4ML6A 2N5FA 2WDUA 2X8HA 2H19A 2I81A 1A2JA 3M3MA 4YQVA 4RQRA 2ZCTA 1PL2A 1F3BA 3K8NA 2K6VA 5HFGA 5A4VA 2I9HA 2FY6A 4WR5A 1SU9A 2C80A 3TJFA 3P2AA 2CZ3A 5B6MA 2IMDA 4HU7A 4O5RA 5CRGA 1Z9HA 3R2QA 3CTFA 1M9BA 4IJIA 3CRTA 1YQ1A 5DQYA 1SK2A 3H8QA 4O32A 2VM2A 3DGQA 3IBHA 3H1NA 3IA1A 5JCWA 1J0FA 1VF2A 2GT6A 4MJCA 3AY8A 1ZYEA 1TI3A 2QKEA 3FZAA 5HR1A 4KUNA 4OFTA 2R3XA 4IP6A 4EDYA 3TOUA 2YZUA 3VK9A 1EEJA 17GSA 9GSSA 6GSVA 5DQSA 2MMNA 1YY7A 2FA4A 3KM6A 2VCVA 3ME7A 4YQMA 2IMIA 5ECLB 2PMTA 3GL3A 2H72A 3FR3A 5E4WA 3EURA 1PX6A 4F0CA 4XS1A 3A2XA 5D73A 3ZRDA 2DSAA 1URMA 5GZZB 1TRUA 2I4AA 2L6CA 4KGIA 1ZZYA 3GX8A 1WP0A 2GZYA 4G9HA 4V2NA 4X43A 1OE8A 1RK4A 3ISOA 4EF0A 4IGJA 3I9V2 2WB9A 1ON4A 3EMPA 3HXSA 1FO5A 1OC9B 1A8YA 2H8LA 3O76A 4POKA 2CX4A 1Z3EA 3CSHA 4ILFA 1TKDB 1MD4A 5IIZA 5ENUA 4GRFA 2H6YA 1XPVA 1O8XA 1O73A 2XBIA 1LU4A 3TKPA 3EC3A 2FWFA 3GNJA 1XVWA 1YF0A 4XS4A 4Q5QA 4V2LA 4Z7XA 2FUG2 2R6KA 5F06A 1GP1A 1JFUA 2YWMA 1Q4JA 2LTKA 1ZMAA 4WEYA 2GTUA 4TW5A 1F6MC 4CW9A 1MDKA 5CO3A 5KN1A 2H0IA 4E8EA 2DJ1A 1G6YA 1N2AA 1SENA 2YP6A 3L9VA 3UBLA 1GSDA 1WPIA 2I3YA 2VCWA 3RHBA 3FHKA 3ERWA 5DJMA 1GSYA 3KZQA 1K3LA 2HZEA 4PNGA 2PU9C 2RLIA 1WMJA 2K8SA 4BVXA 3DYRA 1BG5A 4TN8A 5FWGA 1TRSA 2F8FA 3BOAA 1VF1A 2B3SA 1U6TA 4N10A 2VL3A 3TUEA 4IW9A 4GSSA 3F4RA 2EIOA 3TKRA 1DSBA 3D6IA 5IMCA 3QDNA 4OO5A 4OD7A 4PQHA 1UC7A 4EE0A 5J4UA 2AHEA 2L59A 3LFLA 2PVQA 4TKYA 5ECMB 3OR5A 3EU3A 2L4CA 2PERA 1XW5A 6GSYA 2RUEA 2CT6A 5CRDA 4IQ1A 5HFIA 2YJ7A 3UL3A 1RQMA 1XWBA 1GNWA 4MPGA 4OO4A 4IJ3A 4YAVA 1KTEA 2O8VB 1NM3A 4IQAA 1B4PA 4DVCA 3FZ5A 4HQZA 6GSXA 2OADA 1GULA 2OJLA 2YWOA 4MDCA 5EPFA 1HQOA 1MTCA 3VURA 1G0TA 4IELA 3GMFA 3W8SA 2GZPA 4KX4A 4LMVA 4ZILA 5B8AA 4GF0A 3IXRA 5G2ZA 4CHSA 3ED3A 2GDRA 1AUCA 1DUGA 4QQ7A 4D73B 5GSSA 3A2VA 4PX1A 2VD0A 4JBBA 1GTBA 3F63A 1EV9A 2IMEA 1PL1A 4N0VA 1O7UA 2C8UA 5DAKB 2REMA 5HQPA 3VLNA 4L0WA 1PX7A 3EVIA 2GT5A 4GCIA 2YPMA 1TJDA 2ES7A 2A4VA 3IK9A 2OBKA 3UAPA 3HVSA 3UVTA 2VCTA 1ZGNA 4G10A 1B48A 3PINA 1GTUA 1ZCPA 4HUAA 5D9WA 4HZ4A 5C00A 3IE3A 3GKKA 1QMVA 5IOXA 4EO3A 4ULXA 3FZ9A 4OFMA 2PGTA 2CAIA 5JCGA 2IJYA 2X8CA 3GSSA 1JLWA 1WRYA 5AGYA 1A0RP 4XS4B 2YWIA 2QGVA 1GTIA 3G7YA 5D93A 3BCIA 3TKQA 2IFQA 3ZZXA 2V6KA 1KEBA 4MH2A 1FAAA 2JZRA 4G2EA 2XHFA 5INYA 1PSQA 1HYUA 2JSZA 4EL1A 5DALB 4PGTA 1IYHA 22GSA 3S9FA 1V40A 1GH2A 2KUCA 2WZ9A 1B9YC 16GSA 1R7HA 4DSQA 1OC3A 4HOJA 4RQXA 1BAYA 1ILOA 2C3NA 2RUFA 3EWLA 1S3DA 1M9AA 1YKCA 1Z7PA 3C1SA 2YNXA 3TJGA 2VIMA 4BA7A 3M1GA 3F6FA 3KGKA 2C3TA 3IRAA 4MJEA 2CA8A 2YOIA 3QCPA 4YAPA 1SYXA 3BBYA 1B8XA 1XFLA 2L6DA 4FYBA 3NIVA 1FG4A 5ECHB 1X9WB 5DJLA 1A8LA 3CXGA 2TRXA 1NSWA 4BL7A 3LSZA 3U6VA 1AQXA 2DJ0A 5HR0A 4EUYA 3TKSE 5H5RA 3IV4A 2TIRA 3E0UA 2H66A 1M7TA 5B8BA 1PQNA 3LXTA 4G19A 3Q6OA 3D0ZA 4I2UA 2EIRA 2NDOA 3DEXA 2G0FA 2N5BA 4HDEA 1MEKA 3DKSA 1GSQA 1TDIA 2H1GA 2GSSA 3F9UA 3HKRA 4Q5FA 2AJQB 2C0EA 3WD6A 2IWTA 1U3IA 2GQLA 1T7PB 2H74A 3E3EA 3ZVJD 2OBIA 5JCUA 3A3TA 3J7Yk 3ZIJA 2LJRA 1ML6A 1ACVA 1X5EA 3D4MA 5AIVA 5CAXA 3D5JA 1ABAA 1QXHA 2X8GA 2A2RA 1FW1A 5ECIB 3GN3A 1T4ZA 5A5KA 3C7MA 4ZBAA 1GLPA 5JWOB 1TTZA 2PUKC 5D9TA 3TRXA 4NXIA 2X99A 4ZXGA 2MMOA 1OAZA 3MWHA 4F9ZA 2IMFA 5JWQB 2JL4A 2EC4A 4DEJA 3WT1A 4N0ZA 1YEPA 1FVJA 2H1DA 2B7JA 3MAKA 1TRWA 1THXA 1V98A 4ECCA 10GSA 4JZQA 2YN1A 4L5OA 4TR1A 1EGRA 5IPHA 1QQ2A 2F9SA 2AV4A 2GSRA 2AB6A 3ZVJA 3ERGA 2B7KA 2P31A 1O6JA 4XTSA 2V41A 1F3AA 3QOUA 1T4YA 2P5QA 2LRNA 2GSTA 1T00A 2VL2C 4K7NA 1NHOA 2C0FA 4WF4A 1SK0A 3KEBA 2N5AA 1BEDA 4MP4A 4HJ2A 4MA9A 1XW9A 3LXZA 4ZBBA 1K0OA 1A23A 5CRHA 1XOAA 12GSA 4L0UA 5G1KA 4HU9A 1VF4A 1WOUA 3DIEA 5IMZA 4LMWA 4NHZA 4I6XA 3HJPA 1R26A 3HYPA 2L4QA 1AC1A 1HNBA 4ML1A 5H5SA 2GLRA 2M80A 1W4VA 1X5DA 5JWRB 1KBNA 5CNWA 2PN8A 1M2DA 4OWYA 1I9DA 2NPBA 4LA1A 5HFKA 3QR6A 2H0GA 4GQCA 3KH7A 2ALBA 1TP9A 5F05A 1F9MA 1PN9A 1NHYA 5ELGA 2H1AA 4E8HA 3ZYWA 2FWGA 2CZ2A 5D96A 5G5EA 2NVLA 1PRXA 4DSSB 4EXJA 2F3MA 3VWVA 3GURA 4JU5A 4GQFA 2OACA 1AQWA 1DE1A 3UJ1A 1JZDA 2DMMA 3RDWA 3QFBC 2IIYA 4GWRA 3VPQA 5DBQA 2FD3A 3GH6A 2LV3A 4DSRA 4JEDA 4KW6A 1E2YA 4JRRA 5ECNB 4MPFA 2FWEA 1OKDA 4QL9A 3HVVA 1OYJA 1TK8B 4YH2A 2VLVA 4XS6A 5CRWA 3L9UA 4AJ7A 2M72A 1R4WA 2JZSA 2DJ3A 1FHEA 2FA8A 1K0CA 2DJKA 1S3CA 3RBTA 1PKWA 3BCKA 1LJRA 2NTOA 1V58A 3KTLA 5J5NA 4OCFA 1B4QA 1SJZA 3GIXA 3ZFBA 4MJAA 2GZZA 5DCGA 3IR4A 1T3BA 1YZXA 3GFKA 3HHVA 3I69A 2HSHA 5D8IA 2VD1A 2E2GA 4WR4A 3EE2A 3IK7A 1SL1B 1A2LA 3FK8A 1SK1A 3BD2A 5AN1A 4JE1A 1EP8A 3KH9A 1BX9A 5A4UA 5EY6A 1C72A 2A2SA 4GSNA 4O7HA 1GSFA 4BWQA 3P8WA 1UN2A 4PQIA 1TOFA 1WJKA 3QAGA 2DIZA 4TVEA 3ZTLA 3APSA 1T8EB 3HZ8A 4TXOA 4MMMA 3QD9A 3GKMA 1SYRA 1OE7A 1HD2A 3P90A 4GSTA 3SWLA 3GSTA 4KDYA 5HR3A 2C0GA 3EYTA 3HVXA 3NZNA 2V2GA 1B9XC 5F8BA 2IPAA 1Y6EA 2OE3A 3F8UA 3FEUA 3W6GA 3HA9A 4WXTA 4IVFA 4OCEA 3EINA 5C04A 2VCXA 3M0FA 3TJJA 3TRQA 1K0DA 2DLXA 3VI5A 4PUFC 3FKFA 3IDVA 4OMVA 3N5OA 1K3YA 2J23A 4K2DA 1V9WA 3KP8A 5A4WA 2DIYA 4K0NA 3WGDA 1G6WA 1EV4A 2B1LA 3H93A 4F82A 1XWGA 4LLRA 2QSIA 3TJBA 3SBCA 2HSYA 1N8JA 4BPYA 1AIUA 3V1WA 2CAQA 3KP9A 2DC5A 3LGCA 4HZ2A 6GSWA 4MZBA 4H86A 3UVHA 5ABRA 2PWJA 1M0UA 2J9HA 3LQ7A 3US3A 2LRTA 2L5LA 1H75A 3IAM2 1TK0B 4HQSA 2CV4A 2VM1A 4FYCA 5LD0A 2RM5A 3ME8A 4NAXA 3VWXA 4TRXA 2QC7A 1AW9A 1SJ6A 1GWCA 4HI7A 3L9SA 3GA4A 3QMXA 2GVPA 1M2BA 2OKAA 3FYGA 5KEJA 5EVOA 4IHUA 4K6XA 1FB6A 3F4TA 2C4JA 4MLYA 1QUWA 2O89A 3G7JA 3EMXA 4AGSA 1A24A 4AJ6A 4EVMA 2VAFA 3ERFA 1EWXA 3QPMA 3G9BA 2LS5A 3GKNA 3C1RA 2P0GA 5AISA 1FB0A 2WJUA 2LNTA 1VRSD 3BJ5A 1Z7RA 3D21A 1SKWB 1AAZA 4RUVA 1MDJA 4NV5A 2OE1A 4HS1A 2FWHA 3E9JB 3LORA 3KCMA 3TKSC 3KMOA 2FGXA 1GL8A 1XCCA 2HZEB 4IS0A 1EOGA 1X9MB 4KDUA 1YKAA 5ECSA 3TKSA 1WIKA 3APQA 2PVOC 3JCML 2V6OA 1SL0B 4KH7A 1RW1A 4KCEA 5CREA 19GSA 2MMZA 2XPEA 4ZB8A 1K0NA 4K1FA 2LJAA 1USBA 2WCIA 5J41A 5G31A 3WGXA 2OE0A 1OC9A 3Q18A 4MF7A 1AQVA 3I6AA 1UA5A 2H75A 2MBSA 2JSYA 3M9KA 3F0IA 2H70A 14GSA 4TR3A 4ZL9A 4XIHA 3RPPA 3MDKA 3FW2A 5ID2A 4JR6A 3Q19A 2WULA 2YWNA 4KB3A 2LEGA 2X64A 3Q74A 2I1UA 2H0HA 2LSTA 3CMIA 2HNLA 5KN3A 5B7CA 5E59A 5ECOB 1V2AA 1HNCA 5GSTA 2VCQA 5KN0A 4MF5A 3ZMLA 3CSIA 2ON5A 1PMTA 2L57A 1CQHA 4ID0A 2WGRA 4LL1B 4XHMA 1PA3A 1GLQA 2VO4A 3KD0A 4NWYA 2R4VA 1K0BA 3FR6A 1AXDA 5IMDA 3CRUA 4KA0A 3RAZA 2C0DA 2H6XA 1SKSB 1YJ6A 4L8EA 2GSQA 1E6BA 2GQKA 2F51A 3M8NA 3LYKA 3C8EA 20GSA 2JU5A 1TXXA 3GX0A 3LEFA 2MMAA 4KSOA 3A5WA 4MZWA 3LG6A 1XXUA 5F07A 3C71A 1YEXA 6GSUA 1YDKA 3GH9A 4EDZA 3WT2A 1VGLA 4RI6A 3IHQA 2FLSA 2CQ9A 1U3AA 4PUAA 2HT9A 4K0GA 2GQMA 3TOTA 4WETA 4L5LA 3HY2A 3ZL5A 5LCZA 4ZL7A 4LL4B 3HCZA 3UIWA 4I8BA 3IC4A 5FT3A 1JZRA 3DMLA 1GSUA 4AJ8A 1GNEA 1CQGA 1K0MA 4ZIJA 3GHAA 2VL2A 4N11A 2O85A 3MNGA 1THOA 1U88A 6GSSA 5IPGA 3GL5A 2IFQB 4RI7A 4NMUA 2KHPA 4O92A 3O3TA 4NPBA 1DE2A 1V57A 3F3QA 2B5XA 1XWAA 4CDOA 4ECIA 4NHWA 3KTBA 2JACA 4D73A 2VOCA 3VPTA 4GLTA 3TDGA 3PR8A 4MF6A 2DJ2A 3UMAA 1JHBA 3TRPA 2BMXA 4WBJA 3F3RA 1XBSA 5DAKA 4TOPA 5CYYA 4ECBA 1YF1A 3DXBA 5DDLA 4F03A 1VF3A 4I2TA 3U5RE 5G1LA 2CVDA 3APOA 2TRCP 1F37A 1GSSA 4FH8A 2LNSA 1J08A 3ZFLA 4POBA 3LJRA 2YV9A 3RPNA 3QFAC 3UARA 1SD8A 3IPZA 1PD21 2DJJA 2ON7A 2JZTA 4J56E 2MYGA 1SKRB 1XIYA 5AIXA 5ID2B 4V2MA 2CVKA 4GTUA 4I5QA 4XCSA 2V32A 3PGTA 1QK8A 5IMFA 4K8MA 2HRNA 4JR4A 2HLSA 1UVZA 2LRCA 3KJYA 5G5FA 2C3QA 1X5CA 3KMNA 5IO0A 4TR4A 2HE3A 1ST9A 1M2AA 4IP1A 3HD5A 2C1YA 3M9JA 2EIQA 1Z5YE 3NOFA 2HI7A 3IAS2 3FZ4A 4ACSA 1GTAA 2HZFA 3D22A 4AF2A 5IQYA 3VWWA 3CSJA 4EKZA 1JZOA 5DALA 4MK3A 2P5RA 2BTOT 1LBKA 4TR0A 2B1KA 4Q5NA 1JLVA 2VLUA 4OFNA 4X0XA 3I43A 2Z9SA 3ZMKA 5DCHA 3HJOA 2DBCA 3L0HA 2H01A 5ECRB 2RIIA 1DBYA 3ZIVA 1TK5B 4FO5A 3LYPA 2H71A 1F2EA 1NW2A 3J7Yb 3LWAA 2E2MA 1GRXA 3C73A 2B6MA
chains in the Genus database with same CATH superfamily
3PH9A 4PURA 4IN0A 5ELAA 1ZYNA 3W8JA 2VUPA 1TI1A 1GUMA 1OKTA 2YANA 4MJBA 4TR1B 2KLXA 1T1VA 5IMAA 1TU7A 4K7IA 3DRNA 1MD3A 1EOHA 2WFCA 1XOBA 1R5AA 1A0FA 1QFNA 4K9ZA 3IOSA 2IN3A 2LUSA 2AAWA 1G7OA 1JZWA 4J57E 1ZYQB 4KAEA 1O81A 1XZOA 3N9JA 4I97A 2VCZA 4KSMA 5IM9A 3VWUA 5H5QA 3H79A 3F6DA 5ECPB 1ZOFA 3UBKA 1BQ7A 2D2ZA 4ZL8A 3GYKA 2K8VA 2HXKA 4PXOA 5GAND 1BYEA 2YJHA 3H4KA 2CX3A 3O6TA 4IKHA 4PTSA 1W89A 4IBPA 4BWSA 1K0AA 3MSZA 3L4NA 5D9VA 2HYXA 5ECKB 3CYNA 4ZBDA 1K3OA 2XC2A 1O85A 1MDIA 1WE0A 2LQOA 3TCOA 1A2MA 2YV7A 3QAVA 3VFIA 2R37A 4N30A 2R0CA 3DVWA 4ISDA 4NV2A 2V1MA 4POLA 5J3RA 3GTUA 4K7OA 4XRAA 5IO2A 4P3YB 1ERVA 3ZREA 4F0BA 2ZUPA 1GSEA 1EEMA 1OVNA 3HZ4A 2FCHA 2E0QA 4KCAA 4V1Ap 1X9SB 3F4SA 1ERTA 2L5OA 4PQ1A 2BJXA 1ERWA 11GSA 2IMKA 3TJKA 2O87A 2RM6A 2R5GA 3FRCA 1I5GA 3CBUA 1PKZA 1H4OA 2FNOA 3TGZA 1OC8A 4X4JA 5CP1A 3GV1A 2VLTA 2B5YA 3DWVA 5J9BA 3ZLPA 1EGOA 3A2WA 3FR9A 4MZCA 2AUVA 3RHCA 2K9FA 2IL3A 1Q98A 2E7PA 1SD9A 2HRFA 4HJMA 1M99A 5G30A 5ECQB 8GSSA 5D9XA 2AYTA 2ZNMA 1SL2B 1S3AA 5COHA 3WGEA 2GS3A 5LNKe 4XRDA 5EL8A 2KP2A 1TRVA 2XPDA 4KDXA 5GAPD 1TU8A 4GXZA 2LQQA 2WRTA 3GKXA 4ZB6A 2XBQA 3CTGA 4YQUA 2KP1A 5B6NA 4ECJA 2MZCA 1WWJA 2H1BA 3KIJA 2G2QA 2JADA 18GSA 4F2IA 1TW9A 4MABA 4KNDA 5HR2A 1HNAA 2R2JA 1GUKA 4BVYA 2H73A 2LJKA 2H30A 4J2FA 3DVXA 1Z6NA 13GSA 2CVBA 2LKUA 3DD3A 4X1UA 4V1Ag 1XW6A 5IMVA 1XWCA 2OA7A 3GUSA 3LW9A 5L71A 1ERUA 1SJIA 3TB2A 4FYUA 1XVQA 5KOXA 2K18A 2WS2A 4DSSA 3D4TA 2KOKA 4MH3A 2YZHA 1ZL9A 4TXOB 4WBRD 4WF5A 4ZB9A 2GGTA 1U87A 6GSTA 2VL9A 3EPTA 3QAWA 1IYIA 3FY7A 4TXVA 4PNFA 4QL7A 2H6ZA 3HDCA 1XWKA 3WYWA 5KN2A 1G7EA 1QGVA 3VI7A 2YCDA 1R5PA 2PBJA 3P7XA 2MBTA 4Q5RA 2PPTA 1O8WA 5J9CA 2NBSA 4POMA 1GUHA 4MCUA 3KXOA 2FHEA 2O7KA 3EU4A 3G7IA 4WKWA 5DVBA 4KE3A 4EC0A 7GSSA 4FIWA 3UOMA 5IOWA 3UEMA 3L78A 5FHIA 2H76A 1X0RA 2DMLA 1PGTA 1J9BA 1EZKA 1FVKA 1BJXA 2HFDA 3HJMA 1Y25A 3GRXA 5F0GA 4HEA2 3GTUB 1KNGA 1Z6MA 2HSMA 2M46A 3R3EA 1EP7A 2B5EA 1FOVA 2F8AA 3ZITA 4ML6A 2N5FA 2WDUA 2X8HA 2H19A 2I81A 1A2JA 3M3MA 4YQVA 4RQRA 2ZCTA 1PL2A 1F3BA 3K8NA 2K6VA 4G0LA 5HFGA 5A4VA 4USSA 2I9HA 2FY6A 4WR5A 1SU9A 2C80A 3TJFA 3P2AA 4O5UA 2CZ3A 5B6MA 2IMDA 4HU7A 4O5RA 5CRGA 1Z9HA 3R2QA 3CTFA 1M9BA 4IJIA 3CRTA 1YQ1A 5DQYA 1SK2A 3H8QA 4O32A 2VM2A 2R0GA 3DGQA 3IBHA 3H1NA 3IA1A 5BRTA 4Z2RA 5JCWA 1J0FA 1VF2A 2GT6A 4MJCA 3AY8A 1ZYEA 1TI3A 2QKEA 3FZAA 5HR1A 4KUNA 4OFTA 2R3XA 4IP6A 4EDYA 3TOUA 2YZUA 3VK9A 1EEJA 17GSA 9GSSA 6GSVA 5DQSA 2MMNA 1YY7A 2FA4A 3KM6A 2VCVA 3ME7A 4YQMA 2IMIA 5ECLB 2PMTA 3GL3A 2H72A 3FR3A 5E4WA 3EURA 1PX6A 4F0CA 4XS1A 3A2XA 5D73A 3ZRDA 2DSAA 1URMA 5GZZB 1TRUA 2I4AA 2L6CA 4KGIA 1ZZYA 3GX8A 1WP0A 2GZYA 4G9HA 4V2NA 4X43A 1OE8A 1RK4A 3ISOA 4EF0A 4IGJA 3I9V2 2WB9A 1ON4A 3EMPA 3HXSA 1FO5A 1OC9B 1A8YA 2H8LA 3O76A 4POKA 2CX4A 1Z3EA 3CSHA 2A4HA 4ILFA 4A5PA 1TKDB 1MD4A 5IIZA 5ENUA 4GRFA 2H6YA 1XPVA 1O8XA 1O73A 2XBIA 1LU4A 3TKPA 3EC3A 2FWFA 3GNJA 1XVWA 1YF0A 4XS4A 4Q5QA 1XG8A 4V2LA 4Z7XA 2FUG2 2R6KA 5F06A 1GP1A 4ICYA 1JFUA 2YWMA 1Q4JA 2LTKA 1ZMAA 4WEYA 2GTUA 4TW5A 1F6MC 4CW9A 1MDKA 5CO3A 5KN1A 2H0IA 4E8EA 2DJ1A 1G6YA 1N2AA 1SENA 2YP6A 3L9VA 3UBLA 1GSDA 1WPIA 2I3YA 2VCWA 3RHBA 3FHKA 3ERWA 5DJMA 1GSYA 3KZQA 1K3LA 2HZEA 4PNGA 2PU9C 2RLIA 1WMJA 2K8SA 4BVXA 3DYRA 1BG5A 4TN8A 5FWGA 1TRSA 2F8FA 3BOAA 5BMUA 1VF1A 2B3SA 1U6TA 4N10A 2VL3A 3TUEA 4IW9A 4GSSA 3F4RA 2EIOA 3TKRA 1DSBA 3D6IA 5IMCA 3QDNA 4OO5A 4OD7A 4PQHA 1UC7A 4EE0A 5J4UA 2AHEA 2L59A 3LFLA 2PVQA 4TKYA 5ECMB 3OR5A 3EU3A 4YKGA 2L4CA 2PERA 1XW5A 6GSYA 2RUEA 2CT6A 5CRDA 4IQ1A 5HFIA 2YJ7A 3UL3A 1RQMA 4K5RA 1XWBA 1GNWA 4MPGA 4OO4A 4IJ3A 4YAVA 1KTEA 2O8VB 1NM3A 4IQAA 1B4PA 4DVCA 3FZ5A 4HQZA 6GSXA 2OADA 1GULA 2OJLA 2YWOA 4MDCA 5EPFA 1HQOA 1MTCA 3VURA 1G0TA 4IELA 3GMFA 3W8SA 2GZPA 4KX4A 4FQUA 4LMVA 4ZILA 5B8AA 4GF0A 3IXRA 5G2ZA 4CHSA 3ED3A 2GDRA 1AUCA 1DUGA 4QQ7A 4D73B 5GSSA 3A2VA 4PX1A 2VD0A 4JBBA 1GTBA 3F63A 1EV9A 2IMEA 1PL1A 4N0VA 1O7UA 2C8UA 5DAKB 2REMA 5HQPA 3VLNA 3FMWA 4L0WA 1PX7A 3EVIA 2GT5A 4GCIA 2YPMA 1TJDA 2ES7A 2A4VA 3IK9A 2OBKA 3UAPA 3HVSA 3UVTA 2VCTA 1ZGNA 4G10A 1B48A 3PINA 1GTUA 1ZCPA 4HUAA 5D9WA 4HZ4A 5C00A 3IE3A 3GKKA 1PFOA 1QMVA 5IOXA 4EO3A 4ULXA 3FZ9A 4OFMA 2PGTA 4K5SA 2CAIA 5JCGA 2IJYA 2X8CA 3GSSA 1JLWA 1WRYA 5AGYA 1A0RP 4XS4B 2YWIA 2QGVA 1GTIA 3G7YA 5D93A 3BCIA 3TKQA 2IFQA 4MNNA 3ZZXA 2V6KA 1KEBA 4MH2A 1FAAA 2JZRA 4G2EA 2XHFA 5INYA 1PSQA 1HYUA 2JSZA 4EL1A 5DALB 4PGTA 1IYHA 22GSA 3S9FA 1V40A 1GH2A 2KUCA 2WZ9A 4CY6A 1B9YC 16GSA 1R7HA 4DSQA 1OC3A 4HOJA 4RQXA 1BAYA 1ILOA 2C3NA 2RUFA 3EWLA 1S3DA 1M9AA 1YKCA 1Z7PA 3C1SA 2YNXA 3TJGA 2VIMA 4BA7A 2DKIA 3F6FA 3M1GA 3KGKA 2C3TA 3IRAA 4MJEA 2CA8A 2YOIA 3QCPA 4YAPA 1SYXA 3BBYA 1B8XA 1XFLA 2L6DA 4FYBA 3NIVA 1FG4A 5ECHB 1X9WB 5DJLA 1A8LA 3CXGA 2TRXA 1NSWA 4BL7A 3LSZA 3U6VA 1AQXA 2DJ0A 5HR0A 4EUYA 3TKSE 1ZYPA 5H5RA 3IV4A 2TIRA 3E0UA 2H66A 1M7TA 5B8BA 1PQNA 3LXTA 4G19A 3Q6OA 3D0ZA 4I2UA 2EIRA 2NDOA 3DEXA 2G0FA 2N5BA 4HDEA 1MEKA 3DKSA 3CQFA 1GSQA 1TDIA 2H1GA 2GSSA 3F9UA 3HKRA 4Q5FA 2AJQB 2C0EA 3WD6A 2IWTA 1U3IA 2GQLA 1T7PB 2H74A 3E3EA 3ZVJD 2OBIA 5JCUA 3A3TA 3J7Yk 3ZIJA 2LJRA 1ML6A 1ACVA 1X5EA 3D4MA 5AIVA 5CAXA 3D5JA 1ABAA 1QXHA 2X8GA 2A2RA 1FW1A 5ECIB 3GN3A 1T4ZA 5A5KA 2HRAA 3C7MA 4ZBAA 1GLPA 5JWOB 1TTZA 2PUKC 5D9TA 3TRXA 4NXIA 2X99A 4K2XA 4ZXGA 4BIKA 2MMOA 1OAZA 3MWHA 4F9ZA 2IMFA 5JWQB 2R0PA 2JL4A 2EC4A 4DEJA 3WT1A 4N0ZA 1YEPA 1FVJA 1M3IA 2H1DA 2B7JA 3MAKA 1TRWA 1THXA 1V98A 4ECCA 10GSA 4JZQA 2YN1A 4L5OA 4TR1A 1EGRA 5IPHA 1QQ2A 2F9SA 2AV4A 2GSRA 2AB6A 3ZVJA 3ERGA 2B7KA 2P31A 1O6JA 4XTSA 2V41A 1F3AA 3QOUA 1T4YA 2P5QA 2LRNA 2GSTA 1T00A 2VL2C 4K7NA 1NHOA 2C0FA 4WF4A 1SK0A 3KEBA 2N5AA 1BEDA 4MP4A 4HJ2A 4MA9A 1XW9A 3LXZA 4ZBBA 1K0OA 1A23A 5CRHA 1XOAA 12GSA 4L0UA 5G1KA 4HU9A 1VF4A 1WOUA 3DIEA 5IMZA 4LMWA 4NHZA 1S3RA 4I6XA 3HJPA 1R26A 3HYPA 2L4QA 1AC1A 1HNBA 4ML1A 5H5SA 2GLRA 2M80A 1W4VA 1X5DA 5JWRB 1KBNA 5CNWA 2PN8A 1M2DA 4OWYA 2DKHA 1I9DA 2NPBA 4LA1A 5HFKA 3QR6A 2H0GA 4YKFA 4GQCA 4BVYB 3KH7A 2ALBA 1TP9A 5F05A 1F9MA 1PN9A 1NHYA 5ELGA 2H1AA 4E8HA 3ZYWA 2FWGA 2CZ2A 5D96A 5G5EA 2NVLA 1PRXA 4DSSB 4EXJA 2F3MA 3VWVA 3GURA 4JU5A 4GQFA 2OACA 1AQWA 1DE1A 2UZ8A 3UJ1A 1JZDA 4Z2UA 2DMMA 3RDWA 3QFBC 2IIYA 4GWRA 3VPQA 5DBQA 2FD3A 3GH6A 2LV3A 4DSRA 4JEDA 4CY8A 3PPUA 4KW6A 1E2YA 4JRRA 5ECNB 4MPFA 2FWEA 1OKDA 4QL9A 3HVVA 1OYJA 1TK8B 4YH2A 2VLVA 4XS6A 5CRWA 3L9UA 4AJ7A 2M72A 1R4WA 2JZSA 2DJ3A 1FHEA 2FA8A 1K0CA 2DJKA 1S3CA 3RBTA 1PKWA 3MYDA 3BCKA 1LJRA 1M3JA 2X4AA 2NTOA 1V58A 3KTLA 5J5NA 4OCFA 1B4QA 1SJZA 3GIXA 3ZFBA 4MJAA 2GZZA 5DCGA 3IR4A 1T3BA 1YZXA 3GFKA 3HHVA 3I69A 2HSHA 5D8IA 2VD1A 2E2GA 4WR4A 4G0IA 3EE2A 3IK7A 1SL1B 1A2LA 3FK8A 1SK1A 3BD2A 5AN1A 4JE1A 1EP8A 3KH9A 1BX9A 5A4UA 5EY6A 1C72A 2A2SA 4GSNA 4O7HA 1GSFA 4BWQA 3P8WA 1UN2A 2A2PA 4PQIA 1TOFA 1WJKA 3QAGA 2DIZA 4TVEA 3ZTLA 3APSA 1T8EB 3HZ8A 4TXOA 4MMMA 3QD9A 3GKMA 1SYRA 1OE7A 1HD2A 3P90A 4GSTA 3SWLA 3GSTA 4KDYA 5HR3A 2C0GA 3EYTA 3HVXA 3NZNA 2V2GA 1B9XC 5F8BA 2IPAA 1Y6EA 2OE3A 3F8UA 3FEUA 3W6GA 3HA9A 4WXTA 4IVFA 4OCEA 3EINA 5C04A 2VCXA 3M0FA 3TJJA 3TRQA 1K0DA 2DLXA 3VI5A 4PUFC 3FKFA 3IDVA 4OMVA 3N5OA 1K3YA 2J23A 4K2DA 1V9WA 3KP8A 5A4WA 2DIYA 4HSCX 4K0NA 3WGDA 1G6WA 1EV4A 2B1LA 3H93A 4F82A 1XWGA 4LLRA 2QSIA 3TJBA 3SBCA 2HSYA 1N8JA 2X49A 4BPYA 1AIUA 3V1WA 2CAQA 3KP9A 2DC5A 3LGCA 4HZ2A 6GSWA 4MZBA 4H86A 3UVHA 5ABRA 2PWJA 1M0UA 2J9HA 3LQ7A 3US3A 2LRTA 2QA2A 2L5LA 1H75A 3IAM2 1TK0B 4HQSA 2CV4A 2VM1A 3A5IA 4FYCA 5LD0A 2RM5A 3ME8A 4NAXA 3VWXA 4TRXA 2QC7A 1AW9A 1SJ6A 1GWCA 4HI7A 3L9SA 3GA4A 3QMXA 2GVPA 1M2BA 2OKAA 3FYGA 5KEJA 3IC8A 5EVOA 4IHUA 4K6XA 1FB6A 3F4TA 2C4JA 4MLYA 1QUWA 2O89A 3G7JA 3EMXA 4AGSA 1A24A 4AJ6A 4EIQA 4EVMA 2VAFA 3ERFA 1EWXA 3QPMA 3G9BA 2LS5A 3GKNA 3C1RA 2P0GA 5AISA 1FB0A 2WJUA 2LNTA 1VRSD 3BJ5A 1Z7RA 1FOHA 3D21A 1SKWB 1AAZA 4RUVA 1MDJA 4NV5A 2OE1A 4HS1A 2FWHA 4EIPA 3E9JB 3LORA 3KCMA 3TKSC 3KMOA 2FGXA 1GL8A 1XCCA 2HZEB 4IS0A 1EOGA 1X9MB 4KDUA 4BVXB 1YKAA 5ECSA 3TKSA 1WIKA 3APQA 2PVOC 3JCML 4O5QA 2V6OA 1SL0B 4KH7A 1RW1A 4KCEA 5CREA 19GSA 2MMZA 2XPEA 4ZB8A 1K0NA 4K1FA 2LJAA 1USBA 2WCIA 5J41A 5G31A 3WGXA 2OE0A 1OC9A 3Q18A 4MF7A 1AQVA 3I6AA 1UA5A 2H75A 2MBSA 2JSYA 3M9KA 3F0IA 2H70A 14GSA 4TR3A 4ZL9A 4XIHA 3RPPA 3MDKA 3FW2A 5ID2A 4JR6A 3Q19A 2WULA 2YWNA 4KB3A 2LEGA 2X64A 3Q74A 2I1UA 2H0HA 2LSTA 3CMIA 2HNLA 5KN3A 5B7CA 5E59A 5ECOB 1V2AA 1HNCA 5GSTA 2VCQA 5KN0A 4MF5A 3ZMLA 3CSIA 2ON5A 1PMTA 2L57A 1CQHA 4ID0A 2WGRA 4LL1B 4XHMA 1PA3A 1GLQA 2VO4A 3KD0A 4NWYA 2R4VA 1K0BA 3FR6A 1AXDA 5IMDA 3CRUA 4KA0A 3RAZA 2C0DA 2H6XA 1SKSB 1YJ6A 4KF9A 4L8EA 2GSQA 1E6BA 2GQKA 2F51A 3M8NA 3LYKA 4Z2TA 3C8EA 20GSA 2JU5A 5KOWA 1TXXA 3GX0A 3LEFA 2MMAA 4G0KA 4KSOA 3A5WA 4MZWA 3LG6A 1XXUA 5F07A 3C71A 1YEXA 6GSUA 1YDKA 3GH9A 4EDZA 3WT2A 1VGLA 4RI6A 3IHQA 2FLSA 2CQ9A 1U3AA 4PUAA 2HT9A 4K0GA 2GQMA 3TOTA 4WETA 4L5LA 3HY2A 3ZL5A 5LCZA 4ZL7A 4LL4B 3HCZA 3UIWA 4I8BA 3IC4A 5FT3A 1JZRA 3DMLA 1GSUA 4AJ8A 3IHGA 1GNEA 1CQGA 1K0MA 4ZIJA 3GHAA 2VL2A 4N11A 2O85A 3MNGA 1THOA 1U88A 6GSSA 5IPGA 3GL5A 2IFQB 4RI7A 4NMUA 2KHPA 4O92A 3O3TA 4NPBA 1DE2A 1V57A 3F3QA 2B5XA 1XWAA 4CDOA 4ECIA 4NHWA 3KTBA 2JACA 4D73A 2VOCA 2QA1A 3VPTA 4GLTA 3TDGA 3PR8A 2HRKA 4MF6A 2DJ2A 3UMAA 1JHBA 3TRPA 2BMXA 4WBJA 3F3RA 1XBSA 5DAKA 4TOPA 5CYYA 4ECBA 1YF1A 3DXBA 5DDLA 4F03A 1VF3A 4I2TA 3U5RE 5G1LA 2CVDA 3APOA 2TRCP 1F37A 1GSSA 4FH8A 2LNSA 1J08A 3ZFLA 4POBA 3LJRA 4BL7B 2YV9A 3HVNA 3RPNA 3QFAC 3UARA 1SD8A 3IPZA 1PD21 2DJJA 2ON7A 2JZTA 4J56E 2MYGA 1SKRB 1XIYA 5AIXA 5ID2B 4V2MA 2CVKA 4GTUA 4I5QA 4XCSA 2V32A 3PGTA 1QK8A 5IMFA 4K8MA 2HRNA 4JR4A 2HLSA 1UVZA 2LRCA 3KJYA 1PN0A 5G5FA 2C3QA 1X5CA 3KMNA 5IO0A 4TR4A 2HE3A 1ST9A 1M2AA 4IP1A 3HD5A 2C1YA 3M9JA 2EIQA 1Z5YE 3NOFA 2HI7A 3IAS2 3FZ4A 4ACSA 1GTAA 2HZFA 3D22A 4AF2A 5IQYA 3VWWA 3CSJA 4EKZA 1JZOA 5DALA 4MK3A 2P5RA 2BTOT 1LBKA 4TR0A 2B1KA 4Q5NA 1JLVA 2VLUA 4OFNA 4X0XA 3I43A 2Z9SA 3ZMKA 5DCHA 3HJOA 2DBCA 3L0HA 3MIXA 2H01A 5ECRB 2RIIA 1DBYA 3ZIVA 1TK5B 4FO5A 3LYPA 2H71A 1F2EA 1NW2A 3J7Yb 3LWAA 2E2MA 1GRXA 3C73A 2B6MA
chains in the Genus database with same CATH topology
3PH9A 4PURA 4IN0A 5ELAA 1ZYNA 3W8JA 2VUPA 1TI1A 1GUMA 1OKTA 2YANA 4MJBA 4TR1B 2KLXA 1T1VA 5IMAA 1TU7A 4K7IA 3DRNA 1MD3A 1EOHA 2WFCA 1XOBA 1R5AA 1A0FA 1QFNA 4K9ZA 3IOSA 2IN3A 2LUSA 2AAWA 1G7OA 1JZWA 4J57E 1ZYQB 4KAEA 1O81A 1XZOA 3N9JA 4I97A 2VCZA 4KSMA 5IM9A 3VWUA 5H5QA 3H79A 3F6DA 5ECPB 1ZOFA 3UBKA 1BQ7A 2D2ZA 4ZL8A 3GYKA 2K8VA 2HXKA 4PXOA 5GAND 1BYEA 2YJHA 3H4KA 2CX3A 3O6TA 4IKHA 4PTSA 1W89A 4IBPA 4BWSA 1K0AA 3MSZA 3L4NA 5D9VA 2HYXA 5ECKB 3CYNA 4ZBDA 1K3OA 2XC2A 1O85A 1MDIA 1WE0A 2LQOA 3TCOA 1A2MA 2YV7A 3QAVA 3VFIA 2R37A 4N30A 2R0CA 3DVWA 4ISDA 4NV2A 2V1MA 4POLA 5J3RA 3GTUA 4K7OA 4XRAA 5IO2A 4P3YB 1ERVA 3ZREA 4F0BA 2ZUPA 1GSEA 1EEMA 1OVNA 3HZ4A 2FCHA 2E0QA 4KCAA 4V1Ap 1X9SB 3F4SA 1ERTA 2L5OA 4PQ1A 2BJXA 1ERWA 11GSA 2IMKA 3TJKA 2O87A 2RM6A 2R5GA 3FRCA 1I5GA 3CBUA 1PKZA 1H4OA 2FNOA 3TGZA 1OC8A 4X4JA 5CP1A 3GV1A 2VLTA 2B5YA 3DWVA 5J9BA 3ZLPA 1EGOA 3A2WA 3FR9A 4MZCA 2AUVA 3RHCA 2K9FA 2IL3A 1Q98A 2E7PA 1SD9A 2HRFA 4HJMA 1M99A 5G30A 5ECQB 8GSSA 5D9XA 2AYTA 2ZNMA 1SL2B 1S3AA 5COHA 3WGEA 2GS3A 5LNKe 4XRDA 5EL8A 2KP2A 1TRVA 2XPDA 4KDXA 5GAPD 1TU8A 4GXZA 2LQQA 2WRTA 3GKXA 4ZB6A 2XBQA 3CTGA 4YQUA 2KP1A 5B6NA 4ECJA 2MZCA 1WWJA 2H1BA 3KIJA 2G2QA 2JADA 18GSA 4F2IA 1TW9A 4MABA 4KNDA 5HR2A 1HNAA 2R2JA 1GUKA 4BVYA 2H73A 2LJKA 2H30A 4J2FA 3DVXA 1Z6NA 13GSA 2CVBA 2LKUA 3DD3A 4X1UA 4V1Ag 1XW6A 5IMVA 1XWCA 2OA7A 3GUSA 3LW9A 5L71A 1ERUA 1SJIA 3TB2A 4FYUA 1XVQA 5KOXA 2K18A 2WS2A 4DSSA 3D4TA 2KOKA 4MH3A 2YZHA 1ZL9A 4TXOB 4WBRD 4WF5A 4ZB9A 2GGTA 1U87A 6GSTA 2VL9A 3EPTA 3QAWA 1IYIA 3FY7A 4TXVA 4PNFA 4QL7A 2H6ZA 3HDCA 1XWKA 3WYWA 5KN2A 1G7EA 1QGVA 3VI7A 2YCDA 1R5PA 2PBJA 3P7XA 2MBTA 4Q5RA 2PPTA 1O8WA 5J9CA 2NBSA 4POMA 1GUHA 4MCUA 3KXOA 2FHEA 2O7KA 3EU4A 3G7IA 4WKWA 5DVBA 4KE3A 4EC0A 7GSSA 4FIWA 3UOMA 5IOWA 3UEMA 3L78A 5FHIA 2H76A 1X0RA 2DMLA 1PGTA 1J9BA 1EZKA 1FVKA 1BJXA 2HFDA 3HJMA 1Y25A 3GRXA 5F0GA 4HEA2 3GTUB 1KNGA 1Z6MA 2HSMA 2M46A 3R3EA 1EP7A 2B5EA 1FOVA 2F8AA 3ZITA 4ML6A 2N5FA 2WDUA 2X8HA 2H19A 2I81A 1A2JA 3M3MA 4YQVA 4RQRA 2ZCTA 1PL2A 1F3BA 3K8NA 2K6VA 4G0LA 5HFGA 5A4VA 4USSA 2I9HA 2FY6A 4WR5A 1SU9A 2C80A 3TJFA 3P2AA 4O5UA 2CZ3A 5B6MA 2IMDA 4HU7A 4O5RA 5CRGA 1Z9HA 3R2QA 3CTFA 1M9BA 4IJIA 3CRTA 1YQ1A 5DQYA 1SK2A 3H8QA 4O32A 2VM2A 2R0GA 3DGQA 3IBHA 3H1NA 3IA1A 5BRTA 4Z2RA 5JCWA 1J0FA 1VF2A 2GT6A 4MJCA 3AY8A 1ZYEA 1TI3A 2QKEA 3FZAA 5HR1A 4KUNA 4OFTA 2R3XA 4IP6A 4EDYA 3TOUA 2YZUA 3VK9A 1EEJA 17GSA 9GSSA 6GSVA 5DQSA 2MMNA 1YY7A 2FA4A 3KM6A 2VCVA 3ME7A 4YQMA 2IMIA 5ECLB 2PMTA 3GL3A 2H72A 3FR3A 5E4WA 3EURA 1PX6A 4F0CA 4XS1A 3A2XA 5D73A 3ZRDA 2DSAA 1URMA 5GZZB 1TRUA 2I4AA 2L6CA 4KGIA 1ZZYA 3GX8A 1WP0A 2GZYA 4G9HA 4V2NA 4X43A 1OE8A 1RK4A 3ISOA 4EF0A 4IGJA 3I9V2 2WB9A 1ON4A 3EMPA 3HXSA 1FO5A 1OC9B 1A8YA 2H8LA 3O76A 4POKA 2CX4A 1Z3EA 3CSHA 2A4HA 4ILFA 4A5PA 1TKDB 1MD4A 5IIZA 5ENUA 4GRFA 2H6YA 1XPVA 1O8XA 1O73A 2XBIA 1LU4A 3TKPA 3EC3A 2FWFA 3GNJA 1XVWA 1YF0A 4XS4A 4Q5QA 4V2LA 4Z7XA 2FUG2 2R6KA 5F06A 1GP1A 4ICYA 1JFUA 2YWMA 1Q4JA 2LTKA 1ZMAA 4WEYA 2GTUA 4TW5A 1F6MC 4CW9A 1MDKA 5CO3A 5KN1A 2H0IA 4E8EA 2DJ1A 1G6YA 1N2AA 1SENA 2YP6A 3L9VA 3UBLA 1GSDA 1WPIA 2I3YA 2VCWA 3RHBA 3FHKA 3ERWA 5DJMA 1GSYA 3KZQA 1K3LA 2HZEA 4PNGA 2PU9C 2RLIA 1WMJA 2K8SA 4BVXA 3DYRA 1BG5A 4TN8A 5FWGA 1TRSA 2F8FA 3BOAA 5BMUA 1VF1A 2B3SA 1U6TA 4N10A 2VL3A 3TUEA 4IW9A 4GSSA 3F4RA 2EIOA 3TKRA 1DSBA 3D6IA 5IMCA 3QDNA 4OO5A 4OD7A 4PQHA 1UC7A 4EE0A 5J4UA 2AHEA 2L59A 3LFLA 2PVQA 4TKYA 5ECMB 3OR5A 3EU3A 4YKGA 2L4CA 2PERA 1XW5A 6GSYA 2RUEA 2CT6A 5CRDA 4IQ1A 5HFIA 2YJ7A 3UL3A 1RQMA 4K5RA 1XWBA 1GNWA 4MPGA 4OO4A 4IJ3A 4YAVA 1KTEA 2O8VB 1NM3A 4IQAA 1B4PA 4DVCA 3FZ5A 4HQZA 6GSXA 2OADA 1GULA 2OJLA 2YWOA 4MDCA 5EPFA 1HQOA 1MTCA 3VURA 1G0TA 4IELA 3GMFA 3W8SA 2GZPA 4KX4A 4FQUA 4LMVA 4ZILA 5B8AA 4GF0A 3IXRA 5G2ZA 4CHSA 3ED3A 2GDRA 1AUCA 1DUGA 4QQ7A 4D73B 5GSSA 3A2VA 4PX1A 2VD0A 4JBBA 1GTBA 3F63A 1EV9A 2IMEA 1PL1A 4N0VA 1O7UA 2C8UA 5DAKB 2REMA 5HQPA 3VLNA 3FMWA 4L0WA 1PX7A 3EVIA 2GT5A 4GCIA 2YPMA 1TJDA 2ES7A 2A4VA 3IK9A 2OBKA 3UAPA 3HVSA 3UVTA 2VCTA 1ZGNA 4G10A 1B48A 3PINA 1GTUA 1ZCPA 4HUAA 5D9WA 4HZ4A 5C00A 3IE3A 3GKKA 1QMVA 5IOXA 4EO3A 4ULXA 3FZ9A 4OFMA 2PGTA 4K5SA 2CAIA 5JCGA 2IJYA 2X8CA 3GSSA 1JLWA 1WRYA 5AGYA 1A0RP 4XS4B 2YWIA 2QGVA 1GTIA 3G7YA 5D93A 3BCIA 3TKQA 2IFQA 4MNNA 3ZZXA 2V6KA 1KEBA 4MH2A 1FAAA 2JZRA 4G2EA 2XHFA 5INYA 1PSQA 1HYUA 2JSZA 4EL1A 5DALB 4PGTA 1IYHA 22GSA 3S9FA 1V40A 1GH2A 2KUCA 2WZ9A 4CY6A 1B9YC 16GSA 1R7HA 4DSQA 1OC3A 4HOJA 4RQXA 1BAYA 1ILOA 2C3NA 2RUFA 3EWLA 1S3DA 1M9AA 1YKCA 1Z7PA 3C1SA 2YNXA 3TJGA 2VIMA 4BA7A 2DKIA 3F6FA 3M1GA 3KGKA 2C3TA 3IRAA 4MJEA 2CA8A 2YOIA 3QCPA 4YAPA 1SYXA 3BBYA 1B8XA 1XFLA 2L6DA 4FYBA 3NIVA 1FG4A 5ECHB 1X9WB 5DJLA 1A8LA 3CXGA 2TRXA 1NSWA 4BL7A 3LSZA 3U6VA 1AQXA 2DJ0A 5HR0A 4EUYA 3TKSE 1ZYPA 5H5RA 3IV4A 2TIRA 3E0UA 2H66A 1M7TA 5B8BA 1PQNA 3LXTA 4G19A 3Q6OA 3D0ZA 4I2UA 2EIRA 2NDOA 3DEXA 2G0FA 2N5BA 4HDEA 1MEKA 3DKSA 1GSQA 1TDIA 2H1GA 2GSSA 3F9UA 3HKRA 4Q5FA 2AJQB 2C0EA 3WD6A 2IWTA 1U3IA 2GQLA 1T7PB 2H74A 3E3EA 3ZVJD 2OBIA 5JCUA 3A3TA 3J7Yk 3ZIJA 2LJRA 1ML6A 1ACVA 1X5EA 3D4MA 5AIVA 5CAXA 3D5JA 1ABAA 1QXHA 2X8GA 2A2RA 1FW1A 5ECIB 3GN3A 1T4ZA 5A5KA 2HRAA 3C7MA 4ZBAA 1GLPA 5JWOB 1TTZA 2PUKC 5D9TA 3TRXA 4NXIA 2X99A 4K2XA 4ZXGA 2MMOA 1OAZA 3MWHA 4F9ZA 2IMFA 5JWQB 2R0PA 2JL4A 2EC4A 4DEJA 3WT1A 4N0ZA 1YEPA 1FVJA 2H1DA 2B7JA 3MAKA 1TRWA 1THXA 1V98A 4ECCA 10GSA 4JZQA 2YN1A 4L5OA 4TR1A 1EGRA 5IPHA 1QQ2A 2F9SA 2AV4A 2GSRA 2AB6A 3ZVJA 3ERGA 2B7KA 2P31A 1O6JA 4XTSA 2V41A 1F3AA 3QOUA 1T4YA 2P5QA 2LRNA 2GSTA 1T00A 2VL2C 4K7NA 1NHOA 2C0FA 4WF4A 1SK0A 3KEBA 2N5AA 1BEDA 4MP4A 4HJ2A 4MA9A 1XW9A 3LXZA 4ZBBA 1K0OA 1A23A 5CRHA 1XOAA 12GSA 4L0UA 5G1KA 4HU9A 1VF4A 1WOUA 3DIEA 5IMZA 4LMWA 4NHZA 4I6XA 3HJPA 1R26A 3HYPA 2L4QA 1AC1A 1HNBA 4ML1A 5H5SA 2GLRA 2M80A 1W4VA 1X5DA 5JWRB 1KBNA 5CNWA 2PN8A 1M2DA 4OWYA 2DKHA 1I9DA 2NPBA 4LA1A 5HFKA 3QR6A 2H0GA 4YKFA 4GQCA 4BVYB 3KH7A 2ALBA 1TP9A 5F05A 1F9MA 1PN9A 1NHYA 5ELGA 2H1AA 4E8HA 3ZYWA 2FWGA 2CZ2A 5D96A 5G5EA 2NVLA 1PRXA 4DSSB 4EXJA 2F3MA 3VWVA 3GURA 4JU5A 4GQFA 2OACA 1AQWA 1DE1A 2UZ8A 3UJ1A 1JZDA 4Z2UA 2DMMA 3RDWA 3QFBC 2IIYA 4GWRA 3VPQA 5DBQA 2FD3A 3GH6A 2LV3A 4DSRA 4JEDA 4CY8A 3PPUA 4KW6A 1E2YA 4JRRA 5ECNB 4MPFA 2FWEA 1OKDA 4QL9A 3HVVA 1OYJA 1TK8B 4YH2A 2VLVA 4XS6A 5CRWA 3L9UA 4AJ7A 2M72A 1R4WA 2JZSA 2DJ3A 1FHEA 2FA8A 1K0CA 2DJKA 1S3CA 3RBTA 1PKWA 3MYDA 3BCKA 1LJRA 2X4AA 2NTOA 1V58A 3KTLA 5J5NA 4OCFA 1B4QA 1SJZA 3GIXA 3ZFBA 4MJAA 2GZZA 5DCGA 3IR4A 1T3BA 1YZXA 3GFKA 3HHVA 3I69A 2HSHA 5D8IA 2VD1A 2E2GA 4WR4A 4G0IA 3EE2A 3IK7A 1SL1B 1A2LA 3FK8A 1SK1A 3BD2A 5AN1A 4JE1A 1EP8A 3KH9A 1BX9A 5A4UA 5EY6A 1C72A 2A2SA 4GSNA 4O7HA 1GSFA 4BWQA 3P8WA 1UN2A 2A2PA 4PQIA 1TOFA 1WJKA 3QAGA 2DIZA 4TVEA 3ZTLA 3APSA 1T8EB 3HZ8A 4TXOA 4MMMA 3QD9A 3GKMA 1SYRA 1OE7A 1HD2A 3P90A 4GSTA 3SWLA 3GSTA 4KDYA 5HR3A 2C0GA 3EYTA 3HVXA 3NZNA 2V2GA 1B9XC 5F8BA 2IPAA 1Y6EA 2OE3A 3F8UA 3FEUA 3W6GA 3HA9A 4WXTA 4IVFA 4OCEA 3EINA 5C04A 2VCXA 3M0FA 3TJJA 3TRQA 1K0DA 2DLXA 3VI5A 4PUFC 3FKFA 3IDVA 4OMVA 3N5OA 1K3YA 2J23A 4K2DA 1V9WA 3KP8A 5A4WA 2DIYA 4K0NA 3WGDA 1G6WA 1EV4A 2B1LA 3H93A 4F82A 1XWGA 4LLRA 2QSIA 3TJBA 3SBCA 2HSYA 1N8JA 2X49A 4BPYA 1AIUA 3V1WA 2CAQA 3KP9A 2DC5A 3LGCA 4HZ2A 6GSWA 4MZBA 4H86A 3UVHA 5ABRA 2PWJA 1M0UA 2J9HA 3LQ7A 3US3A 2LRTA 2QA2A 2L5LA 1H75A 3IAM2 1TK0B 4HQSA 2CV4A 2VM1A 3A5IA 4FYCA 5LD0A 2RM5A 3ME8A 4NAXA 3VWXA 4TRXA 2QC7A 1AW9A 1SJ6A 1GWCA 4HI7A 3L9SA 3GA4A 3QMXA 2GVPA 1M2BA 2OKAA 3FYGA 5KEJA 3IC8A 5EVOA 4IHUA 4K6XA 1FB6A 3F4TA 2C4JA 4MLYA 1QUWA 2O89A 3G7JA 3EMXA 4AGSA 1A24A 4AJ6A 4EIQA 4EVMA 2VAFA 3ERFA 1EWXA 3QPMA 3G9BA 2LS5A 3GKNA 3C1RA 2P0GA 5AISA 1FB0A 2WJUA 2LNTA 1VRSD 3BJ5A 1Z7RA 1FOHA 3D21A 1SKWB 1AAZA 4RUVA 1MDJA 4NV5A 2OE1A 4HS1A 2FWHA 4EIPA 3E9JB 3LORA 3KCMA 3TKSC 3KMOA 2FGXA 1GL8A 1XCCA 2HZEB 4IS0A 1EOGA 1X9MB 4KDUA 4BVXB 1YKAA 5ECSA 3TKSA 1WIKA 3APQA 2PVOC 3JCML 4O5QA 2V6OA 1SL0B 4KH7A 1RW1A 4KCEA 5CREA 19GSA 2MMZA 2XPEA 4ZB8A 1K0NA 4K1FA 2LJAA 1USBA 2WCIA 5J41A 5G31A 3WGXA 2OE0A 1OC9A 3Q18A 4MF7A 1AQVA 3I6AA 1UA5A 2H75A 2MBSA 2JSYA 3M9KA 3F0IA 2H70A 14GSA 4TR3A 4ZL9A 4XIHA 3RPPA 3MDKA 3FW2A 5ID2A 4JR6A 3Q19A 2WULA 2YWNA 4KB3A 2LEGA 2X64A 3Q74A 2I1UA 2H0HA 2LSTA 3CMIA 2HNLA 5KN3A 5B7CA 5E59A 5ECOB 1V2AA 1HNCA 5GSTA 2VCQA 5KN0A 4MF5A 3ZMLA 3CSIA 2ON5A 1PMTA 2L57A 1CQHA 4ID0A 2WGRA 4LL1B 4XHMA 1PA3A 1GLQA 2VO4A 3KD0A 4NWYA 2R4VA 1K0BA 3FR6A 1AXDA 5IMDA 3CRUA 4KA0A 3RAZA 2C0DA 2H6XA 1SKSB 1YJ6A 4KF9A 4L8EA 2GSQA 1E6BA 2GQKA 2F51A 3M8NA 3LYKA 4Z2TA 3C8EA 20GSA 2JU5A 5KOWA 1TXXA 3GX0A 3LEFA 2MMAA 4G0KA 4KSOA 3A5WA 4MZWA 3LG6A 1XXUA 5F07A 3C71A 1YEXA 6GSUA 1YDKA 3GH9A 4EDZA 3WT2A 1VGLA 4RI6A 3IHQA 2FLSA 2CQ9A 1U3AA 4PUAA 2HT9A 4K0GA 2GQMA 3TOTA 4WETA 4L5LA 3HY2A 3ZL5A 5LCZA 4ZL7A 4LL4B 3HCZA 3UIWA 4I8BA 3IC4A 5FT3A 1JZRA 3DMLA 1GSUA 4AJ8A 3IHGA 1GNEA 1CQGA 1K0MA 4ZIJA 3GHAA 2VL2A 4N11A 2O85A 3MNGA 1THOA 1U88A 6GSSA 5IPGA 3GL5A 2IFQB 4RI7A 4NMUA 2KHPA 4O92A 3O3TA 4NPBA 1DE2A 1V57A 3F3QA 2B5XA 1XWAA 4CDOA 4ECIA 4NHWA 3KTBA 2JACA 4D73A 2VOCA 2QA1A 3VPTA 4GLTA 3TDGA 3PR8A 2HRKA 4MF6A 2DJ2A 3UMAA 1JHBA 3TRPA 2BMXA 4WBJA 3F3RA 1XBSA 5DAKA 4TOPA 5CYYA 4ECBA 1YF1A 3DXBA 5DDLA 4F03A 1VF3A 4I2TA 3U5RE 5G1LA 2CVDA 3APOA 2TRCP 1F37A 1GSSA 4FH8A 2LNSA 1J08A 3ZFLA 4POBA 3LJRA 4BL7B 2YV9A 3RPNA 3QFAC 3UARA 1SD8A 3IPZA 1PD21 2DJJA 2ON7A 2JZTA 4J56E 2MYGA 1SKRB 1XIYA 5AIXA 5ID2B 4V2MA 2CVKA 4GTUA 4I5QA 4XCSA 2V32A 3PGTA 1QK8A 5IMFA 4K8MA 2HRNA 4JR4A 2HLSA 1UVZA 2LRCA 3KJYA 1PN0A 5G5FA 2C3QA 1X5CA 3KMNA 5IO0A 4TR4A 2HE3A 1ST9A 1M2AA 4IP1A 3HD5A 2C1YA 3M9JA 2EIQA 1Z5YE 3NOFA 2HI7A 3IAS2 3FZ4A 4ACSA 1GTAA 2HZFA 3D22A 4AF2A 5IQYA 3VWWA 3CSJA 4EKZA 1JZOA 5DALA 4MK3A 2P5RA 2BTOT 1LBKA 4TR0A 2B1KA 4Q5NA 1JLVA 2VLUA 4OFNA 4X0XA 3I43A 2Z9SA 3ZMKA 5DCHA 3HJOA 2DBCA 3L0HA 3MIXA 2H01A 5ECRB 2RIIA 1DBYA 3ZIVA 1TK5B 4FO5A 3LYPA 2H71A 1F2EA 1NW2A 3J7Yb 3LWAA 2E2MA 1GRXA 3C73A 2B6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PH9 A;  4PUR A;  4IN0 A;  5ELA A;  3W8J A;  2VUP A;  1TI1 A;  1GUM A;  1OKT A;  2YAN A;  4MJB A;  4TR1 B;  2KLX A;  1T1V A;  5IMA A;  1TU7 A;  4K7I A;  3DRN A;  1MD3 A;  1EOH A;  2WFC A;  1XOB A;  1R5A A;  1A0F A;  1QFN A;  4K9Z A;  3IOS A;  2IN3 A;  2LUS A;  2AAW A;  1G7O A;  1JZW A;  4J57 E;  1ZYQ B;  4KAE A;  1O81 A;  1XZO A;  3N9J A;  4I97 A;  2VCZ A;  4KSM A;  5IM9 A;  3VWU A;  5H5Q A;  3H79 A;  3F6D A;  5ECP B;  1ZOF A;  3UBK A;  1BQ7 A;  2D2Z A;  4ZL8 A;  3GYK A;  2K8V A;  2HXK A;  4PXO A;  5GAN D;  1BYE A;  2YJH A;  3H4K A;  2CX3 A;  3O6T A;  4IKH A;  1W89 A;  4IBP A;  4BWS A;  1K0A A;  3MSZ A;  3L4N A;  5D9V A;  2HYX A;  5ECK B;  3CYN A;  4ZBD A;  1K3O A;  2XC2 A;  1O85 A;  1MDI A;  1WE0 A;  2LQO A;  3TCO A;  1A2M A;  2YV7 A;  3QAV A;  3VFI A;  2R37 A;  4N30 A;  3DVW A;  4ISD A;  4NV2 A;  2V1M A;  4POL A;  5J3R A;  3GTU A;  4K7O A;  4XRA A;  5IO2 A;  4P3Y B;  1ERV A;  3ZRE A;  4F0B A;  2ZUP A;  1GSE A;  1EEM A;  1OVN A;  3HZ4 A;  2FCH A;  2E0Q A;  4KCA A;  4V1A p;  1X9S B;  3F4S A;  1ERT A;  2L5O A;  4PQ1 A;  2BJX A;  1ERW A;  11GS A;  2IMK A;  3TJK A;  2O87 A;  2RM6 A;  2R5G A;  3FRC A;  1I5G A;  3CBU A;  1PKZ A;  1H4O A;  2FNO A;  3TGZ A;  1OC8 A;  5CP1 A;  3GV1 A;  2VLT A;  2B5Y A;  3DWV A;  5J9B A;  3ZLP A;  1EGO A;  3A2W A;  3FR9 A;  4MZC A;  2AUV A;  3RHC A;  2K9F A;  2IL3 A;  1Q98 A;  2E7P A;  1SD9 A;  2HRF A;  4HJM A;  1M99 A;  5G30 A;  5ECQ B;  8GSS A;  5D9X A;  2AYT A;  2ZNM A;  1SL2 B;  1S3A A;  5COH A;  3WGE A;  2GS3 A;  5LNK e;  4XRD A;  5EL8 A;  2KP2 A;  1TRV A;  2XPD A;  4KDX A;  5GAP D;  1TU8 A;  4GXZ A;  2LQQ A;  2WRT A;  3GKX A;  4ZB6 A;  2XBQ A;  3CTG A;  4YQU A;  2KP1 A;  5B6N A;  4ECJ A;  2MZC A;  1WWJ A;  2H1B A;  3KIJ A;  2G2Q A;  2JAD A;  18GS A;  4F2I A;  1TW9 A;  4MAB A;  4KND A;  5HR2 A;  1HNA A;  2R2J A;  1GUK A;  4BVY A;  2H73 A;  2LJK A;  2H30 A;  4J2F A;  3DVX A;  1Z6N A;  13GS A;  2CVB A;  2LKU A;  3DD3 A;  4X1U A;  4V1A g;  1XW6 A;  5IMV A;  1XWC A;  2OA7 A;  3GUS A;  5L71 A;  1ERU A;  1SJI A;  3TB2 A;  4FYU A;  1XVQ A;  2K18 A;  2WS2 A;  4DSS A;  3D4T A;  2KOK A;  4MH3 A;  2YZH A;  1ZL9 A;  4TXO B;  4WBR D;  4WF5 A;  4ZB9 A;  2GGT A;  1U87 A;  6GST A;  2VL9 A;  3QAW A;  1IYI A;  3FY7 A;  4TXV A;  4PNF A;  4QL7 A;  2H6Z A;  3HDC A;  1XWK A;  3WYW A;  5KN2 A;  1G7E A;  1QGV A;  3VI7 A;  2YCD A;  1R5P A;  2PBJ A;  3P7X A;  2MBT A;  4Q5R A;  2PPT A;  1O8W A;  5J9C A;  2NBS A;  4POM A;  1GUH A;  4MCU A;  3KXO A;  2FHE A;  2O7K A;  3EU4 A;  3G7I A;  4WKW A;  5DVB A;  4KE3 A;  4EC0 A;  7GSS A;  4FIW A;  3UOM A;  5IOW A;  3UEM A;  3L78 A;  5FHI A;  2H76 A;  1X0R A;  2DML A;  1PGT A;  1J9B A;  1EZK A;  1FVK A;  1BJX A;  2HFD A;  3HJM A;  1Y25 A;  3GRX A;  5F0G A;  4HEA 2;  3GTU B;  1KNG A;  1Z6M A;  2M46 A;  1EP7 A;  2B5E A;  1FOV A;  2F8A A;  3ZIT A;  4ML6 A;  2N5F A;  2WDU A;  2X8H A;  2H19 A;  2I81 A;  1A2J A;  3M3M A;  4YQV A;  4RQR A;  2ZCT A;  1PL2 A;  1F3B A;  3K8N A;  2K6V A;  5HFG A;  5A4V A;  2I9H A;  2FY6 A;  4WR5 A;  1SU9 A;  2C80 A;  3TJF A;  3P2A A;  2CZ3 A;  5B6M A;  2IMD A;  4HU7 A;  4O5R A;  5CRG A;  1Z9H A;  3R2Q A;  3CTF A;  1M9B A;  4IJI A;  3CRT A;  1YQ1 A;  5DQY A;  1SK2 A;  3H8Q A;  4O32 A;  2VM2 A;  3DGQ A;  3IBH A;  3H1N A;  3IA1 A;  5JCW A;  1J0F A;  1VF2 A;  2GT6 A;  4MJC A;  3AY8 A;  1ZYE A;  1TI3 A;  2QKE A;  3FZA A;  5HR1 A;  4KUN A;  4OFT A;  2R3X A;  4IP6 A;  4EDY A;  3TOU A;  2YZU A;  3VK9 A;  1EEJ A;  17GS A;  9GSS A;  6GSV A;  5DQS A;  2MMN A;  1YY7 A;  2FA4 A;  3KM6 A;  2VCV A;  3ME7 A;  4YQM A;  2IMI A;  5ECL B;  2PMT A;  3GL3 A;  2H72 A;  3FR3 A;  5E4W A;  3EUR A;  1PX6 A;  4F0C A;  4XS1 A;  3A2X A;  5D73 A;  3ZRD A;  2DSA A;  1URM A;  5GZZ B;  1TRU A;  2I4A A;  2L6C A;  4KGI A;  1ZZY A;  3GX8 A;  1WP0 A;  2GZY A;  4G9H A;  4V2N A;  4X43 A;  1OE8 A;  1RK4 A;  3ISO A;  4EF0 A;  4IGJ A;  3I9V 2;  2WB9 A;  1ON4 A;  3EMP A;  3HXS A;  1FO5 A;  1OC9 B;  1A8Y A;  2H8L A;  3O76 A;  4POK A;  2CX4 A;  1Z3E A;  3CSH A;  4ILF A;  1TKD B;  1MD4 A;  5IIZ A;  5ENU A;  4GRF A;  2H6Y A;  1XPV A;  1O8X A;  1O73 A;  2XBI A;  1LU4 A;  3TKP A;  3EC3 A;  2FWF A;  3GNJ A;  1XVW A;  1YF0 A;  4XS4 A;  4Q5Q A;  4V2L A;  4Z7X A;  2FUG 2;  2R6K A;  5F06 A;  1GP1 A;  1JFU A;  2YWM A;  1Q4J A;  2LTK A;  1ZMA A;  4WEY A;  2GTU A;  4TW5 A;  1F6M C;  4CW9 A;  1MDK A;  5CO3 A;  5KN1 A;  2H0I A;  4E8E A;  2DJ1 A;  1G6Y A;  1N2A A;  1SEN A;  2YP6 A;  3L9V A;  3UBL A;  1GSD A;  1WPI A;  2I3Y A;  2VCW A;  3RHB A;  3FHK A;  3ERW A;  5DJM A;  1GSY A;  3KZQ A;  1K3L A;  2HZE A;  4PNG A;  2PU9 C;  2RLI A;  1WMJ A;  2K8S A;  4BVX A;  3DYR A;  1BG5 A;  4TN8 A;  5FWG A;  1TRS A;  2F8F A;  3BOA A;  1VF1 A;  2B3S A;  1U6T A;  4N10 A;  2VL3 A;  3TUE A;  4IW9 A;  4GSS A;  3F4R A;  2EIO A;  3TKR A;  1DSB A;  3D6I A;  5IMC A;  3QDN A;  4OO5 A;  4OD7 A;  4PQH A;  1UC7 A;  4EE0 A;  5J4U A;  2AHE A;  2L59 A;  3LFL A;  2PVQ A;  4TKY A;  5ECM B;  3OR5 A;  3EU3 A;  2L4C A;  2PER A;  1XW5 A;  6GSY A;  2RUE A;  2CT6 A;  5CRD A;  4IQ1 A;  5HFI A;  2YJ7 A;  3UL3 A;  1RQM A;  1XWB A;  1GNW A;  4MPG A;  4OO4 A;  4IJ3 A;  4YAV A;  1KTE A;  2O8V B;  1NM3 A;  4IQA A;  1B4P A;  4DVC A;  3FZ5 A;  4HQZ A;  6GSX A;  2OAD A;  1GUL A;  2OJL A;  2YWO A;  4MDC A;  5EPF A;  1HQO A;  1MTC A;  3VUR A;  1G0T A;  4IEL A;  3GMF A;  3W8S A;  2GZP A;  4KX4 A;  4LMV A;  4ZIL A;  5B8A A;  4GF0 A;  3IXR A;  5G2Z A;  4CHS A;  3ED3 A;  2GDR A;  1AUC A;  1DUG A;  4QQ7 A;  4D73 B;  5GSS A;  3A2V A;  4PX1 A;  2VD0 A;  4JBB A;  1GTB A;  3F63 A;  1EV9 A;  2IME A;  1PL1 A;  4N0V A;  1O7U A;  2C8U A;  5DAK B;  2REM A;  5HQP A;  3VLN A;  4L0W A;  1PX7 A;  3EVI A;  2GT5 A;  4GCI A;  2YPM A;  1TJD A;  2ES7 A;  2A4V A;  3IK9 A;  2OBK A;  3UAP A;  3HVS A;  3UVT A;  2VCT A;  1ZGN A;  4G10 A;  1B48 A;  3PIN A;  1GTU A;  1ZCP A;  4HUA A;  5D9W A;  4HZ4 A;  5C00 A;  3IE3 A;  3GKK A;  1QMV A;  5IOX A;  4EO3 A;  4ULX A;  3FZ9 A;  4OFM A;  2PGT A;  2CAI A;  5JCG A;  2IJY A;  2X8C A;  3GSS A;  1JLW A;  1WRY A;  5AGY A;  1A0R P;  4XS4 B;  2YWI A;  2QGV A;  1GTI A;  3G7Y A;  5D93 A;  3BCI A;  3TKQ A;  2IFQ A;  3ZZX A;  2V6K A;  1KEB A;  4MH2 A;  1FAA A;  2JZR A;  4G2E A;  2XHF A;  5INY A;  1PSQ A;  1HYU A;  2JSZ A;  4EL1 A;  5DAL B;  4PGT A;  1IYH A;  22GS A;  3S9F A;  1V40 A;  1GH2 A;  2KUC A;  2WZ9 A;  1B9Y C;  16GS A;  1R7H A;  4DSQ A;  1OC3 A;  4HOJ A;  4RQX A;  1BAY A;  1ILO A;  2C3N A;  2RUF A;  3EWL A;  1S3D A;  1M9A A;  1YKC A;  1Z7P A;  3C1S A;  2YNX A;  3TJG A;  2VIM A;  4BA7 A;  3M1G A;  3F6F A;  3KGK A;  2C3T A;  3IRA A;  4MJE A;  2CA8 A;  2YOI A;  3QCP A;  4YAP A;  1SYX A;  3BBY A;  1B8X A;  1XFL A;  2L6D A;  4FYB A;  3NIV A;  1FG4 A;  5ECH B;  1X9W B;  5DJL A;  1A8L A;  3CXG A;  2TRX A;  1NSW A;  4BL7 A;  3LSZ A;  3U6V A;  1AQX A;  2DJ0 A;  5HR0 A;  4EUY A;  3TKS E;  5H5R A;  3IV4 A;  2TIR A;  3E0U A;  2H66 A;  1M7T A;  5B8B A;  1PQN A;  3LXT A;  4G19 A;  3Q6O A;  3D0Z A;  4I2U A;  2EIR A;  2NDO A;  3DEX A;  2G0F A;  2N5B A;  4HDE A;  1MEK A;  3DKS A;  1GSQ A;  1TDI A;  2H1G A;  2GSS A;  3F9U A;  3HKR A;  4Q5F A;  2AJQ B;  2C0E A;  3WD6 A;  2IWT A;  1U3I A;  2GQL A;  1T7P B;  2H74 A;  3E3E A;  3ZVJ D;  2OBI A;  5JCU A;  3A3T A;  3J7Y k;  3ZIJ A;  2LJR A;  1ML6 A;  1ACV A;  1X5E A;  3D4M A;  5AIV A;  5CAX A;  3D5J A;  1ABA A;  1QXH A;  2X8G A;  2A2R A;  1FW1 A;  5ECI B;  3GN3 A;  1T4Z A;  5A5K A;  3C7M A;  4ZBA A;  1GLP A;  5JWO B;  1TTZ A;  2PUK C;  5D9T A;  3TRX A;  4NXI A;  2X99 A;  4ZXG A;  2MMO A;  1OAZ A;  3MWH A;  4F9Z A;  2IMF A;  5JWQ B;  2JL4 A;  2EC4 A;  4DEJ A;  3WT1 A;  4N0Z A;  1YEP A;  1FVJ A;  2H1D A;  2B7J A;  3MAK A;  1TRW A;  1THX A;  1V98 A;  4ECC A;  10GS A;  4JZQ A;  2YN1 A;  4L5O A;  4TR1 A;  1EGR A;  5IPH A;  1QQ2 A;  2F9S A;  2AV4 A;  2GSR A;  2AB6 A;  3ZVJ A;  3ERG A;  2B7K A;  2P31 A;  1O6J A;  4XTS A;  2V41 A;  1F3A A;  3QOU A;  1T4Y A;  2P5Q A;  2LRN A;  2GST A;  1T00 A;  2VL2 C;  4K7N A;  1NHO A;  2C0F A;  4WF4 A;  1SK0 A;  3KEB A;  2N5A A;  1BED A;  4MP4 A;  4HJ2 A;  4MA9 A;  1XW9 A;  3LXZ A;  4ZBB A;  1K0O A;  1A23 A;  5CRH A;  1XOA A;  12GS A;  4L0U A;  5G1K A;  4HU9 A;  1VF4 A;  1WOU A;  3DIE A;  5IMZ A;  4LMW A;  4NHZ A;  4I6X A;  3HJP A;  1R26 A;  3HYP A;  2L4Q A;  1AC1 A;  1HNB A;  4ML1 A;  5H5S A;  2GLR A;  2M80 A;  1W4V A;  1X5D A;  5JWR B;  1KBN A;  5CNW A;  2PN8 A;  1M2D A;  4OWY A;  1I9D A;  2NPB A;  4LA1 A;  5HFK A;  3QR6 A;  2H0G A;  4GQC A;  3KH7 A;  2ALB A;  1TP9 A;  5F05 A;  1F9M A;  1PN9 A;  1NHY A;  5ELG A;  2H1A A;  4E8H A;  3ZYW A;  2FWG A;  2CZ2 A;  5D96 A;  5G5E A;  2NVL A;  1PRX A;  4DSS B;  4EXJ A;  2F3M A;  3VWV A;  3GUR A;  4JU5 A;  4GQF A;  2OAC A;  1AQW A;  1DE1 A;  3UJ1 A;  1JZD A;  2DMM A;  3RDW A;  3QFB C;  2IIY A;  4GWR A;  3VPQ A;  5DBQ A;  2FD3 A;  3GH6 A;  2LV3 A;  4DSR A;  4JED A;  4KW6 A;  1E2Y A;  4JRR A;  5ECN B;  4MPF A;  2FWE A;  1OKD A;  4QL9 A;  3HVV A;  1OYJ A;  1TK8 B;  4YH2 A;  2VLV A;  4XS6 A;  5CRW A;  3L9U A;  4AJ7 A;  2M72 A;  1R4W A;  2JZS A;  2DJ3 A;  1FHE A;  2FA8 A;  1K0C A;  2DJK A;  1S3C A;  3RBT A;  1PKW A;  3BCK A;  1LJR A;  2NTO A;  1V58 A;  3KTL A;  5J5N A;  4OCF A;  1B4Q A;  1SJZ A;  3GIX A;  3ZFB A;  4MJA A;  2GZZ A;  5DCG A;  3IR4 A;  1T3B A;  1YZX A;  3GFK A;  3HHV A;  3I69 A;  2HSH A;  5D8I A;  2VD1 A;  2E2G A;  4WR4 A;  3EE2 A;  3IK7 A;  1SL1 B;  1A2L A;  3FK8 A;  1SK1 A;  3BD2 A;  5AN1 A;  4JE1 A;  1EP8 A;  3KH9 A;  1BX9 A;  5A4U A;  5EY6 A;  1C72 A;  2A2S A;  4GSN A;  4O7H A;  1GSF A;  4BWQ A;  3P8W A;  1UN2 A;  4PQI A;  1TOF A;  1WJK A;  3QAG A;  2DIZ A;  4TVE A;  3ZTL A;  3APS A;  1T8E B;  3HZ8 A;  4TXO A;  4MMM A;  3QD9 A;  3GKM A;  1SYR A;  1OE7 A;  1HD2 A;  3P90 A;  4GST A;  3SWL A;  3GST A;  4KDY A;  5HR3 A;  2C0G A;  3EYT A;  3HVX A;  3NZN A;  2V2G A;  1B9X C;  5F8B A;  2IPA A;  1Y6E A;  2OE3 A;  3F8U A;  3FEU A;  3W6G A;  3HA9 A;  4WXT A;  4IVF A;  4OCE A;  3EIN A;  5C04 A;  2VCX A;  3M0F A;  3TJJ A;  3TRQ A;  1K0D A;  2DLX A;  3VI5 A;  4PUF C;  3FKF A;  3IDV A;  4OMV A;  3N5O A;  1K3Y A;  2J23 A;  4K2D A;  1V9W A;  3KP8 A;  5A4W A;  2DIY A;  4K0N A;  3WGD A;  1G6W A;  1EV4 A;  2B1L A;  3H93 A;  4F82 A;  1XWG A;  4LLR A;  2QSI A;  3TJB A;  3SBC A;  2HSY A;  1N8J A;  4BPY A;  1AIU A;  3V1W A;  2CAQ A;  3KP9 A;  2DC5 A;  3LGC A;  4HZ2 A;  6GSW A;  4MZB A;  4H86 A;  3UVH A;  5ABR A;  2PWJ A;  1M0U A;  2J9H A;  3LQ7 A;  3US3 A;  2LRT A;  2L5L A;  1H75 A;  3IAM 2;  1TK0 B;  4HQS A;  2CV4 A;  2VM1 A;  4FYC A;  5LD0 A;  2RM5 A;  3ME8 A;  4NAX A;  3VWX A;  4TRX A;  2QC7 A;  1AW9 A;  1SJ6 A;  1GWC A;  4HI7 A;  3L9S A;  3GA4 A;  3QMX A;  2GVP A;  1M2B A;  2OKA A;  3FYG A;  5KEJ A;  5EVO A;  4IHU A;  4K6X A;  1FB6 A;  3F4T A;  2C4J A;  4MLY A;  1QUW A;  2O89 A;  3G7J A;  3EMX A;  4AGS A;  1A24 A;  4AJ6 A;  4EVM A;  2VAF A;  3ERF A;  1EWX A;  3QPM A;  3G9B A;  2LS5 A;  3GKN A;  3C1R A;  2P0G A;  5AIS A;  1FB0 A;  2WJU A;  2LNT A;  1VRS D;  3BJ5 A;  1Z7R A;  3D21 A;  1SKW B;  1AAZ A;  4RUV A;  1MDJ A;  4NV5 A;  2OE1 A;  4HS1 A;  2FWH A;  3E9J B;  3LOR A;  3KCM A;  3TKS C;  3KMO A;  2FGX A;  1GL8 A;  1XCC A;  2HZE B;  4IS0 A;  1EOG A;  1X9M B;  4KDU A;  1YKA A;  5ECS A;  3TKS A;  1WIK A;  3APQ A;  2PVO C;  3JCM L;  2V6O A;  1SL0 B;  4KH7 A;  1RW1 A;  4KCE A;  5CRE A;  19GS A;  2MMZ A;  2XPE A;  4ZB8 A;  1K0N A;  4K1F A;  2LJA A;  1USB A;  2WCI A;  5J41 A;  5G31 A;  3WGX A;  2OE0 A;  1OC9 A;  3Q18 A;  4MF7 A;  1AQV A;  3I6A A;  1UA5 A;  2H75 A;  2MBS A;  2JSY A;  3M9K A;  3F0I A;  2H70 A;  14GS A;  4TR3 A;  4ZL9 A;  4XIH A;  3RPP A;  3MDK A;  3FW2 A;  5ID2 A;  4JR6 A;  3Q19 A;  2WUL A;  2YWN A;  4KB3 A;  2LEG A;  2X64 A;  3Q74 A;  2I1U A;  2H0H A;  2LST A;  3CMI A;  2HNL A;  5KN3 A;  5B7C A;  5E59 A;  5ECO B;  1V2A A;  1HNC A;  5GST A;  2VCQ A;  5KN0 A;  4MF5 A;  3ZML A;  3CSI A;  2ON5 A;  1PMT A;  2L57 A;  1CQH A;  4ID0 A;  2WGR A;  4LL1 B;  4XHM A;  1PA3 A;  1GLQ A;  2VO4 A;  3KD0 A;  4NWY A;  2R4V A;  1K0B A;  3FR6 A;  1AXD A;  5IMD A;  3CRU A;  4KA0 A;  3RAZ A;  2C0D A;  2H6X A;  1SKS B;  1YJ6 A;  4L8E A;  2GSQ A;  1E6B A;  2GQK A;  2F51 A;  3M8N A;  3LYK A;  3C8E A;  20GS A;  2JU5 A;  1TXX A;  3GX0 A;  3LEF A;  2MMA A;  4KSO A;  3A5W A;  4MZW A;  3LG6 A;  1XXU A;  5F07 A;  3C71 A;  1YEX A;  6GSU A;  1YDK A;  3GH9 A;  4EDZ A;  3WT2 A;  1VGL A;  4RI6 A;  3IHQ A;  2FLS A;  2CQ9 A;  1U3A A;  4PUA A;  2HT9 A;  4K0G A;  2GQM A;  3TOT A;  4WET A;  4L5L A;  3HY2 A;  3ZL5 A;  5LCZ A;  4ZL7 A;  4LL4 B;  3HCZ A;  3UIW A;  4I8B A;  3IC4 A;  5FT3 A;  1JZR A;  3DML A;  1GSU A;  4AJ8 A;  1GNE A;  1CQG A;  1K0M A;  4ZIJ A;  3GHA A;  2VL2 A;  4N11 A;  2O85 A;  3MNG A;  1THO A;  1U88 A;  6GSS A;  5IPG A;  3GL5 A;  2IFQ B;  4RI7 A;  4NMU A;  2KHP A;  4O92 A;  3O3T A;  4NPB A;  1DE2 A;  1V57 A;  3F3Q A;  2B5X A;  1XWA A;  4CDO A;  4ECI A;  4NHW A;  3KTB A;  2JAC A;  4D73 A;  2VOC A;  3VPT A;  4GLT A;  3TDG A;  3PR8 A;  4MF6 A;  2DJ2 A;  3UMA A;  1JHB A;  3TRP A;  2BMX A;  4WBJ A;  3F3R A;  1XBS A;  5DAK A;  4TOP A;  5CYY A;  4ECB A;  1YF1 A;  3DXB A;  5DDL A;  4F03 A;  1VF3 A;  4I2T A;  3U5R E;  5G1L A;  2CVD A;  3APO A;  2TRC P;  1F37 A;  1GSS A;  4FH8 A;  2LNS A;  1J08 A;  3ZFL A;  4POB A;  3LJR A;  2YV9 A;  3RPN A;  3QFA C;  3UAR A;  1SD8 A;  3IPZ A;  1PD2 1;  2DJJ A;  2ON7 A;  2JZT A;  4J56 E;  2MYG A;  1SKR B;  1XIY A;  5AIX A;  5ID2 B;  4V2M A;  2CVK A;  4GTU A;  4I5Q A;  4XCS A;  2V32 A;  3PGT A;  1QK8 A;  5IMF A;  4K8M A;  2HRN A;  4JR4 A;  2HLS A;  1UVZ A;  2LRC A;  3KJY A;  5G5F A;  2C3Q A;  1X5C A;  3KMN A;  5IO0 A;  4TR4 A;  2HE3 A;  1ST9 A;  1M2A A;  4IP1 A;  3HD5 A;  2C1Y A;  3M9J A;  2EIQ A;  1Z5Y E;  3NOF A;  2HI7 A;  3IAS 2;  3FZ4 A;  4ACS A;  1GTA A;  2HZF A;  3D22 A;  4AF2 A;  5IQY A;  3VWW A;  3CSJ A;  4EKZ A;  1JZO A;  5DAL A;  4MK3 A;  2P5R A;  2BTO T;  1LBK A;  4TR0 A;  2B1K A;  4Q5N A;  1JLV A;  2VLU A;  4OFN A;  4X0X A;  3I43 A;  2Z9S A;  3ZMK A;  5DCH A;  3HJO A;  2DBC A;  3L0H A;  2H01 A;  5ECR B;  2RII A;  1DBY A;  3ZIV A;  1TK5 B;  4FO5 A;  3LYP A;  2H71 A;  1F2E A;  1NW2 A;  3J7Y b;  3LWA A;  2E2M A;  1GRX A;  3C73 A;  2B6M A; 
#chains in the Genus database with same CATH topology
 3PH9 A;  4PUR A;  4IN0 A;  5ELA A;  1ZYN A;  3W8J A;  2VUP A;  1TI1 A;  1GUM A;  1OKT A;  2YAN A;  4MJB A;  4TR1 B;  2KLX A;  1T1V A;  5IMA A;  1TU7 A;  4K7I A;  3DRN A;  1MD3 A;  1EOH A;  2WFC A;  1XOB A;  1R5A A;  1A0F A;  1QFN A;  4K9Z A;  3IOS A;  2IN3 A;  2LUS A;  2AAW A;  1G7O A;  1JZW A;  4J57 E;  1ZYQ B;  4KAE A;  1O81 A;  1XZO A;  3N9J A;  4I97 A;  2VCZ A;  4KSM A;  5IM9 A;  3VWU A;  5H5Q A;  3H79 A;  3F6D A;  5ECP B;  1ZOF A;  3UBK A;  1BQ7 A;  2D2Z A;  4ZL8 A;  3GYK A;  2K8V A;  2HXK A;  4PXO A;  5GAN D;  1BYE A;  2YJH A;  3H4K A;  2CX3 A;  3O6T A;  4IKH A;  4PTS A;  1W89 A;  4IBP A;  4BWS A;  1K0A A;  3MSZ A;  3L4N A;  5D9V A;  2HYX A;  5ECK B;  3CYN A;  4ZBD A;  1K3O A;  2XC2 A;  1O85 A;  1MDI A;  1WE0 A;  2LQO A;  3TCO A;  1A2M A;  2YV7 A;  3QAV A;  3VFI A;  2R37 A;  4N30 A;  2R0C A;  3DVW A;  4ISD A;  4NV2 A;  2V1M A;  4POL A;  5J3R A;  3GTU A;  4K7O A;  4XRA A;  5IO2 A;  4P3Y B;  1ERV A;  3ZRE A;  4F0B A;  2ZUP A;  1GSE A;  1EEM A;  1OVN A;  3HZ4 A;  2FCH A;  2E0Q A;  4KCA A;  4V1A p;  1X9S B;  3F4S A;  1ERT A;  2L5O A;  4PQ1 A;  2BJX A;  1ERW A;  11GS A;  2IMK A;  3TJK A;  2O87 A;  2RM6 A;  2R5G A;  3FRC A;  1I5G A;  3CBU A;  1PKZ A;  1H4O A;  2FNO A;  3TGZ A;  1OC8 A;  4X4J A;  5CP1 A;  3GV1 A;  2VLT A;  2B5Y A;  3DWV A;  5J9B A;  3ZLP A;  1EGO A;  3A2W A;  3FR9 A;  4MZC A;  2AUV A;  3RHC A;  2K9F A;  2IL3 A;  1Q98 A;  2E7P A;  1SD9 A;  2HRF A;  4HJM A;  1M99 A;  5G30 A;  5ECQ B;  8GSS A;  5D9X A;  2AYT A;  2ZNM A;  1SL2 B;  1S3A A;  5COH A;  3WGE A;  2GS3 A;  5LNK e;  4XRD A;  5EL8 A;  2KP2 A;  1TRV A;  2XPD A;  4KDX A;  5GAP D;  1TU8 A;  4GXZ A;  2LQQ A;  2WRT A;  3GKX A;  4ZB6 A;  2XBQ A;  3CTG A;  4YQU A;  2KP1 A;  5B6N A;  4ECJ A;  2MZC A;  1WWJ A;  2H1B A;  3KIJ A;  2G2Q A;  2JAD A;  18GS A;  4F2I A;  1TW9 A;  4MAB A;  4KND A;  5HR2 A;  1HNA A;  2R2J A;  1GUK A;  4BVY A;  2H73 A;  2LJK A;  2H30 A;  4J2F A;  3DVX A;  1Z6N A;  13GS A;  2CVB A;  2LKU A;  3DD3 A;  4X1U A;  4V1A g;  1XW6 A;  5IMV A;  1XWC A;  2OA7 A;  3GUS A;  3LW9 A;  5L71 A;  1ERU A;  1SJI A;  3TB2 A;  4FYU A;  1XVQ A;  5KOX A;  2K18 A;  2WS2 A;  4DSS A;  3D4T A;  2KOK A;  4MH3 A;  2YZH A;  1ZL9 A;  4TXO B;  4WBR D;  4WF5 A;  4ZB9 A;  2GGT A;  1U87 A;  6GST A;  2VL9 A;  3EPT A;  3QAW A;  1IYI A;  3FY7 A;  4TXV A;  4PNF A;  4QL7 A;  2H6Z A;  3HDC A;  1XWK A;  3WYW A;  5KN2 A;  1G7E A;  1QGV A;  3VI7 A;  2YCD A;  1R5P A;  2PBJ A;  3P7X A;  2MBT A;  4Q5R A;  2PPT A;  1O8W A;  5J9C A;  2NBS A;  4POM A;  1GUH A;  4MCU A;  3KXO A;  2FHE A;  2O7K A;  3EU4 A;  3G7I A;  4WKW A;  5DVB A;  4KE3 A;  4EC0 A;  7GSS A;  4FIW A;  3UOM A;  5IOW A;  3UEM A;  3L78 A;  5FHI A;  2H76 A;  1X0R A;  2DML A;  1PGT A;  1J9B A;  1EZK A;  1FVK A;  1BJX A;  2HFD A;  3HJM A;  1Y25 A;  3GRX A;  5F0G A;  4HEA 2;  3GTU B;  1KNG A;  1Z6M A;  2HSM A;  2M46 A;  3R3E A;  1EP7 A;  2B5E A;  1FOV A;  2F8A A;  3ZIT A;  4ML6 A;  2N5F A;  2WDU A;  2X8H A;  2H19 A;  2I81 A;  1A2J A;  3M3M A;  4YQV A;  4RQR A;  2ZCT A;  1PL2 A;  1F3B A;  3K8N A;  2K6V A;  4G0L A;  5HFG A;  5A4V A;  4USS A;  2I9H A;  2FY6 A;  4WR5 A;  1SU9 A;  2C80 A;  3TJF A;  3P2A A;  4O5U A;  2CZ3 A;  5B6M A;  2IMD A;  4HU7 A;  4O5R A;  5CRG A;  1Z9H A;  3R2Q A;  3CTF A;  1M9B A;  4IJI A;  3CRT A;  1YQ1 A;  5DQY A;  1SK2 A;  3H8Q A;  4O32 A;  2VM2 A;  2R0G A;  3DGQ A;  3IBH A;  3H1N A;  3IA1 A;  5BRT A;  4Z2R A;  5JCW A;  1J0F A;  1VF2 A;  2GT6 A;  4MJC A;  3AY8 A;  1ZYE A;  1TI3 A;  2QKE A;  3FZA A;  5HR1 A;  4KUN A;  4OFT A;  2R3X A;  4IP6 A;  4EDY A;  3TOU A;  2YZU A;  3VK9 A;  1EEJ A;  17GS A;  9GSS A;  6GSV A;  5DQS A;  2MMN A;  1YY7 A;  2FA4 A;  3KM6 A;  2VCV A;  3ME7 A;  4YQM A;  2IMI A;  5ECL B;  2PMT A;  3GL3 A;  2H72 A;  3FR3 A;  5E4W A;  3EUR A;  1PX6 A;  4F0C A;  4XS1 A;  3A2X A;  5D73 A;  3ZRD A;  2DSA A;  1URM A;  5GZZ B;  1TRU A;  2I4A A;  2L6C A;  4KGI A;  1ZZY A;  3GX8 A;  1WP0 A;  2GZY A;  4G9H A;  4V2N A;  4X43 A;  1OE8 A;  1RK4 A;  3ISO A;  4EF0 A;  4IGJ A;  3I9V 2;  2WB9 A;  1ON4 A;  3EMP A;  3HXS A;  1FO5 A;  1OC9 B;  1A8Y A;  2H8L A;  3O76 A;  4POK A;  2CX4 A;  1Z3E A;  3CSH A;  2A4H A;  4ILF A;  4A5P A;  1TKD B;  1MD4 A;  5IIZ A;  5ENU A;  4GRF A;  2H6Y A;  1XPV A;  1O8X A;  1O73 A;  2XBI A;  1LU4 A;  3TKP A;  3EC3 A;  2FWF A;  3GNJ A;  1XVW A;  1YF0 A;  4XS4 A;  4Q5Q A;  1XG8 A;  4V2L A;  4Z7X A;  2FUG 2;  2R6K A;  5F06 A;  1GP1 A;  4ICY A;  1JFU A;  2YWM A;  1Q4J A;  2LTK A;  1ZMA A;  4WEY A;  2GTU A;  4TW5 A;  1F6M C;  4CW9 A;  1MDK A;  5CO3 A;  5KN1 A;  2H0I A;  4E8E A;  2DJ1 A;  1G6Y A;  1N2A A;  1SEN A;  2YP6 A;  3L9V A;  3UBL A;  1GSD A;  1WPI A;  2I3Y A;  2VCW A;  3RHB A;  3FHK A;  3ERW A;  5DJM A;  1GSY A;  3KZQ A;  1K3L A;  2HZE A;  4PNG A;  2PU9 C;  2RLI A;  1WMJ A;  2K8S A;  4BVX A;  3DYR A;  1BG5 A;  4TN8 A;  5FWG A;  1TRS A;  2F8F A;  3BOA A;  5BMU A;  1VF1 A;  2B3S A;  1U6T A;  4N10 A;  2VL3 A;  3TUE A;  4IW9 A;  4GSS A;  3F4R A;  2EIO A;  3TKR A;  1DSB A;  3D6I A;  5IMC A;  3QDN A;  4OO5 A;  4OD7 A;  4PQH A;  1UC7 A;  4EE0 A;  5J4U A;  2AHE A;  2L59 A;  3LFL A;  2PVQ A;  4TKY A;  5ECM B;  3OR5 A;  3EU3 A;  4YKG A;  2L4C A;  2PER A;  1XW5 A;  6GSY A;  2RUE A;  2CT6 A;  5CRD A;  4IQ1 A;  5HFI A;  2YJ7 A;  3UL3 A;  1RQM A;  4K5R A;  1XWB A;  1GNW A;  4MPG A;  4OO4 A;  4IJ3 A;  4YAV A;  1KTE A;  2O8V B;  1NM3 A;  4IQA A;  1B4P A;  4DVC A;  3FZ5 A;  4HQZ A;  6GSX A;  2OAD A;  1GUL A;  2OJL A;  2YWO A;  4MDC A;  5EPF A;  1HQO A;  1MTC A;  3VUR A;  1G0T A;  4IEL A;  3GMF A;  3W8S A;  2GZP A;  4KX4 A;  4FQU A;  4LMV A;  4ZIL A;  5B8A A;  4GF0 A;  3IXR A;  5G2Z A;  4CHS A;  3ED3 A;  2GDR A;  1AUC A;  1DUG A;  4QQ7 A;  4D73 B;  5GSS A;  3A2V A;  4PX1 A;  2VD0 A;  4JBB A;  1GTB A;  3F63 A;  1EV9 A;  2IME A;  1PL1 A;  4N0V A;  1O7U A;  2C8U A;  5DAK B;  2REM A;  5HQP A;  3VLN A;  3FMW A;  4L0W A;  1PX7 A;  3EVI A;  2GT5 A;  4GCI A;  2YPM A;  1TJD A;  2ES7 A;  2A4V A;  3IK9 A;  2OBK A;  3UAP A;  3HVS A;  3UVT A;  2VCT A;  1ZGN A;  4G10 A;  1B48 A;  3PIN A;  1GTU A;  1ZCP A;  4HUA A;  5D9W A;  4HZ4 A;  5C00 A;  3IE3 A;  3GKK A;  1PFO A;  1QMV A;  5IOX A;  4EO3 A;  4ULX A;  3FZ9 A;  4OFM A;  2PGT A;  4K5S A;  2CAI A;  5JCG A;  2IJY A;  2X8C A;  3GSS A;  1JLW A;  1WRY A;  5AGY A;  1A0R P;  4XS4 B;  2YWI A;  2QGV A;  1GTI A;  3G7Y A;  5D93 A;  3BCI A;  3TKQ A;  2IFQ A;  4MNN A;  3ZZX A;  2V6K A;  1KEB A;  4MH2 A;  1FAA A;  2JZR A;  4G2E A;  2XHF A;  5INY A;  1PSQ A;  1HYU A;  2JSZ A;  4EL1 A;  5DAL B;  4PGT A;  1IYH A;  22GS A;  3S9F A;  1V40 A;  1GH2 A;  2KUC A;  2WZ9 A;  4CY6 A;  1B9Y C;  16GS A;  1R7H A;  4DSQ A;  1OC3 A;  4HOJ A;  4RQX A;  1BAY A;  1ILO A;  2C3N A;  2RUF A;  3EWL A;  1S3D A;  1M9A A;  1YKC A;  1Z7P A;  3C1S A;  2YNX A;  3TJG A;  2VIM A;  4BA7 A;  2DKI A;  3F6F A;  3M1G A;  3KGK A;  2C3T A;  3IRA A;  4MJE A;  2CA8 A;  2YOI A;  3QCP A;  4YAP A;  1SYX A;  3BBY A;  1B8X A;  1XFL A;  2L6D A;  4FYB A;  3NIV A;  1FG4 A;  5ECH B;  1X9W B;  5DJL A;  1A8L A;  3CXG A;  2TRX A;  1NSW A;  4BL7 A;  3LSZ A;  3U6V A;  1AQX A;  2DJ0 A;  5HR0 A;  4EUY A;  3TKS E;  1ZYP A;  5H5R A;  3IV4 A;  2TIR A;  3E0U A;  2H66 A;  1M7T A;  5B8B A;  1PQN A;  3LXT A;  4G19 A;  3Q6O A;  3D0Z A;  4I2U A;  2EIR A;  2NDO A;  3DEX A;  2G0F A;  2N5B A;  4HDE A;  1MEK A;  3DKS A;  3CQF A;  1GSQ A;  1TDI A;  2H1G A;  2GSS A;  3F9U A;  3HKR A;  4Q5F A;  2AJQ B;  2C0E A;  3WD6 A;  2IWT A;  1U3I A;  2GQL A;  1T7P B;  2H74 A;  3E3E A;  3ZVJ D;  2OBI A;  5JCU A;  3A3T A;  3J7Y k;  3ZIJ A;  2LJR A;  1ML6 A;  1ACV A;  1X5E A;  3D4M A;  5AIV A;  5CAX A;  3D5J A;  1ABA A;  1QXH A;  2X8G A;  2A2R A;  1FW1 A;  5ECI B;  3GN3 A;  1T4Z A;  5A5K A;  2HRA A;  3C7M A;  4ZBA A;  1GLP A;  5JWO B;  1TTZ A;  2PUK C;  5D9T A;  3TRX A;  4NXI A;  2X99 A;  4K2X A;  4ZXG A;  4BIK A;  2MMO A;  1OAZ A;  3MWH A;  4F9Z A;  2IMF A;  5JWQ B;  2R0P A;  2JL4 A;  2EC4 A;  4DEJ A;  3WT1 A;  4N0Z A;  1YEP A;  1FVJ A;  1M3I A;  2H1D A;  2B7J A;  3MAK A;  1TRW A;  1THX A;  1V98 A;  4ECC A;  10GS A;  4JZQ A;  2YN1 A;  4L5O A;  4TR1 A;  1EGR A;  5IPH A;  1QQ2 A;  2F9S A;  2AV4 A;  2GSR A;  2AB6 A;  3ZVJ A;  3ERG A;  2B7K A;  2P31 A;  1O6J A;  4XTS A;  2V41 A;  1F3A A;  3QOU A;  1T4Y A;  2P5Q A;  2LRN A;  2GST A;  1T00 A;  2VL2 C;  4K7N A;  1NHO A;  2C0F A;  4WF4 A;  1SK0 A;  3KEB A;  2N5A A;  1BED A;  4MP4 A;  4HJ2 A;  4MA9 A;  1XW9 A;  3LXZ A;  4ZBB A;  1K0O A;  1A23 A;  5CRH A;  1XOA A;  12GS A;  4L0U A;  5G1K A;  4HU9 A;  1VF4 A;  1WOU A;  3DIE A;  5IMZ A;  4LMW A;  4NHZ A;  1S3R A;  4I6X A;  3HJP A;  1R26 A;  3HYP A;  2L4Q A;  1AC1 A;  1HNB A;  4ML1 A;  5H5S A;  2GLR A;  2M80 A;  1W4V A;  1X5D A;  5JWR B;  1KBN A;  5CNW A;  2PN8 A;  1M2D A;  4OWY A;  2DKH A;  1I9D A;  2NPB A;  4LA1 A;  5HFK A;  3QR6 A;  2H0G A;  4YKF A;  4GQC A;  4BVY B;  3KH7 A;  2ALB A;  1TP9 A;  5F05 A;  1F9M A;  1PN9 A;  1NHY A;  5ELG A;  2H1A A;  4E8H A;  3ZYW A;  2FWG A;  2CZ2 A;  5D96 A;  5G5E A;  2NVL A;  1PRX A;  4DSS B;  4EXJ A;  2F3M A;  3VWV A;  3GUR A;  4JU5 A;  4GQF A;  2OAC A;  1AQW A;  1DE1 A;  2UZ8 A;  3UJ1 A;  1JZD A;  4Z2U A;  2DMM A;  3RDW A;  3QFB C;  2IIY A;  4GWR A;  3VPQ A;  5DBQ A;  2FD3 A;  3GH6 A;  2LV3 A;  4DSR A;  4JED A;  4CY8 A;  3PPU A;  4KW6 A;  1E2Y A;  4JRR A;  5ECN B;  4MPF A;  2FWE A;  1OKD A;  4QL9 A;  3HVV A;  1OYJ A;  1TK8 B;  4YH2 A;  2VLV A;  4XS6 A;  5CRW A;  3L9U A;  4AJ7 A;  2M72 A;  1R4W A;  2JZS A;  2DJ3 A;  1FHE A;  2FA8 A;  1K0C A;  2DJK A;  1S3C A;  3RBT A;  1PKW A;  3MYD A;  3BCK A;  1LJR A;  1M3J A;  2X4A A;  2NTO A;  1V58 A;  3KTL A;  5J5N A;  4OCF A;  1B4Q A;  1SJZ A;  3GIX A;  3ZFB A;  4MJA A;  2GZZ A;  5DCG A;  3IR4 A;  1T3B A;  1YZX A;  3GFK A;  3HHV A;  3I69 A;  2HSH A;  5D8I A;  2VD1 A;  2E2G A;  4WR4 A;  4G0I A;  3EE2 A;  3IK7 A;  1SL1 B;  1A2L A;  3FK8 A;  1SK1 A;  3BD2 A;  5AN1 A;  4JE1 A;  1EP8 A;  3KH9 A;  1BX9 A;  5A4U A;  5EY6 A;  1C72 A;  2A2S A;  4GSN A;  4O7H A;  1GSF A;  4BWQ A;  3P8W A;  1UN2 A;  2A2P A;  4PQI A;  1TOF A;  1WJK A;  3QAG A;  2DIZ A;  4TVE A;  3ZTL A;  3APS A;  1T8E B;  3HZ8 A;  4TXO A;  4MMM A;  3QD9 A;  3GKM A;  1SYR A;  1OE7 A;  1HD2 A;  3P90 A;  4GST A;  3SWL A;  3GST A;  4KDY A;  5HR3 A;  2C0G A;  3EYT A;  3HVX A;  3NZN A;  2V2G A;  1B9X C;  5F8B A;  2IPA A;  1Y6E A;  2OE3 A;  3F8U A;  3FEU A;  3W6G A;  3HA9 A;  4WXT A;  4IVF A;  4OCE A;  3EIN A;  5C04 A;  2VCX A;  3M0F A;  3TJJ A;  3TRQ A;  1K0D A;  2DLX A;  3VI5 A;  4PUF C;  3FKF A;  3IDV A;  4OMV A;  3N5O A;  1K3Y A;  2J23 A;  4K2D A;  1V9W A;  3KP8 A;  5A4W A;  2DIY A;  4HSC X;  4K0N A;  3WGD A;  1G6W A;  1EV4 A;  2B1L A;  3H93 A;  4F82 A;  1XWG A;  4LLR A;  2QSI A;  3TJB A;  3SBC A;  2HSY A;  1N8J A;  2X49 A;  4BPY A;  1AIU A;  3V1W A;  2CAQ A;  3KP9 A;  2DC5 A;  3LGC A;  4HZ2 A;  6GSW A;  4MZB A;  4H86 A;  3UVH A;  5ABR A;  2PWJ A;  1M0U A;  2J9H A;  3LQ7 A;  3US3 A;  2LRT A;  2QA2 A;  2L5L A;  1H75 A;  3IAM 2;  1TK0 B;  4HQS A;  2CV4 A;  2VM1 A;  3A5I A;  4FYC A;  5LD0 A;  2RM5 A;  3ME8 A;  4NAX A;  3VWX A;  4TRX A;  2QC7 A;  1AW9 A;  1SJ6 A;  1GWC A;  4HI7 A;  3L9S A;  3GA4 A;  3QMX A;  2GVP A;  1M2B A;  2OKA A;  3FYG A;  5KEJ A;  3IC8 A;  5EVO A;  4IHU A;  4K6X A;  1FB6 A;  3F4T A;  2C4J A;  4MLY A;  1QUW A;  2O89 A;  3G7J A;  3EMX A;  4AGS A;  1A24 A;  4AJ6 A;  4EIQ A;  4EVM A;  2VAF A;  3ERF A;  1EWX A;  3QPM A;  3G9B A;  2LS5 A;  3GKN A;  3C1R A;  2P0G A;  5AIS A;  1FB0 A;  2WJU A;  2LNT A;  1VRS D;  3BJ5 A;  1Z7R A;  1FOH A;  3D21 A;  1SKW B;  1AAZ A;  4RUV A;  1MDJ A;  4NV5 A;  2OE1 A;  4HS1 A;  2FWH A;  4EIP A;  3E9J B;  3LOR A;  3KCM A;  3TKS C;  3KMO A;  2FGX A;  1GL8 A;  1XCC A;  2HZE B;  4IS0 A;  1EOG A;  1X9M B;  4KDU A;  4BVX B;  1YKA A;  5ECS A;  3TKS A;  1WIK A;  3APQ A;  2PVO C;  3JCM L;  4O5Q A;  2V6O A;  1SL0 B;  4KH7 A;  1RW1 A;  4KCE A;  5CRE A;  19GS A;  2MMZ A;  2XPE A;  4ZB8 A;  1K0N A;  4K1F A;  2LJA A;  1USB A;  2WCI A;  5J41 A;  5G31 A;  3WGX A;  2OE0 A;  1OC9 A;  3Q18 A;  4MF7 A;  1AQV A;  3I6A A;  1UA5 A;  2H75 A;  2MBS A;  2JSY A;  3M9K A;  3F0I A;  2H70 A;  14GS A;  4TR3 A;  4ZL9 A;  4XIH A;  3RPP A;  3MDK A;  3FW2 A;  5ID2 A;  4JR6 A;  3Q19 A;  2WUL A;  2YWN A;  4KB3 A;  2LEG A;  2X64 A;  3Q74 A;  2I1U A;  2H0H A;  2LST A;  3CMI A;  2HNL A;  5KN3 A;  5B7C A;  5E59 A;  5ECO B;  1V2A A;  1HNC A;  5GST A;  2VCQ A;  5KN0 A;  4MF5 A;  3ZML A;  3CSI A;  2ON5 A;  1PMT A;  2L57 A;  1CQH A;  4ID0 A;  2WGR A;  4LL1 B;  4XHM A;  1PA3 A;  1GLQ A;  2VO4 A;  3KD0 A;  4NWY A;  2R4V A;  1K0B A;  3FR6 A;  1AXD A;  5IMD A;  3CRU A;  4KA0 A;  3RAZ A;  2C0D A;  2H6X A;  1SKS B;  1YJ6 A;  4KF9 A;  4L8E A;  2GSQ A;  1E6B A;  2GQK A;  2F51 A;  3M8N A;  3LYK A;  4Z2T A;  3C8E A;  20GS A;  2JU5 A;  5KOW A;  1TXX A;  3GX0 A;  3LEF A;  2MMA A;  4G0K A;  4KSO A;  3A5W A;  4MZW A;  3LG6 A;  1XXU A;  5F07 A;  3C71 A;  1YEX A;  6GSU A;  1YDK A;  3GH9 A;  4EDZ A;  3WT2 A;  1VGL A;  4RI6 A;  3IHQ A;  2FLS A;  2CQ9 A;  1U3A A;  4PUA A;  2HT9 A;  4K0G A;  2GQM A;  3TOT A;  4WET A;  4L5L A;  3HY2 A;  3ZL5 A;  5LCZ A;  4ZL7 A;  4LL4 B;  3HCZ A;  3UIW A;  4I8B A;  3IC4 A;  5FT3 A;  1JZR A;  3DML A;  1GSU A;  4AJ8 A;  3IHG A;  1GNE A;  1CQG A;  1K0M A;  4ZIJ A;  3GHA A;  2VL2 A;  4N11 A;  2O85 A;  3MNG A;  1THO A;  1U88 A;  6GSS A;  5IPG A;  3GL5 A;  2IFQ B;  4RI7 A;  4NMU A;  2KHP A;  4O92 A;  3O3T A;  4NPB A;  1DE2 A;  1V57 A;  3F3Q A;  2B5X A;  1XWA A;  4CDO A;  4ECI A;  4NHW A;  3KTB A;  2JAC A;  4D73 A;  2VOC A;  2QA1 A;  3VPT A;  4GLT A;  3TDG A;  3PR8 A;  2HRK A;  4MF6 A;  2DJ2 A;  3UMA A;  1JHB A;  3TRP A;  2BMX A;  4WBJ A;  3F3R A;  1XBS A;  5DAK A;  4TOP A;  5CYY A;  4ECB A;  1YF1 A;  3DXB A;  5DDL A;  4F03 A;  1VF3 A;  4I2T A;  3U5R E;  5G1L A;  2CVD A;  3APO A;  2TRC P;  1F37 A;  1GSS A;  4FH8 A;  2LNS A;  1J08 A;  3ZFL A;  4POB A;  3LJR A;  4BL7 B;  2YV9 A;  3HVN A;  3RPN A;  3QFA C;  3UAR A;  1SD8 A;  3IPZ A;  1PD2 1;  2DJJ A;  2ON7 A;  2JZT A;  4J56 E;  2MYG A;  1SKR B;  1XIY A;  5AIX A;  5ID2 B;  4V2M A;  2CVK A;  4GTU A;  4I5Q A;  4XCS A;  2V32 A;  3PGT A;  1QK8 A;  5IMF A;  4K8M A;  2HRN A;  4JR4 A;  2HLS A;  1UVZ A;  2LRC A;  3KJY A;  1PN0 A;  5G5F A;  2C3Q A;  1X5C A;  3KMN A;  5IO0 A;  4TR4 A;  2HE3 A;  1ST9 A;  1M2A A;  4IP1 A;  3HD5 A;  2C1Y A;  3M9J A;  2EIQ A;  1Z5Y E;  3NOF A;  2HI7 A;  3IAS 2;  3FZ4 A;  4ACS A;  1GTA A;  2HZF A;  3D22 A;  4AF2 A;  5IQY A;  3VWW A;  3CSJ A;  4EKZ A;  1JZO A;  5DAL A;  4MK3 A;  2P5R A;  2BTO T;  1LBK A;  4TR0 A;  2B1K A;  4Q5N A;  1JLV A;  2VLU A;  4OFN A;  4X0X A;  3I43 A;  2Z9S A;  3ZMK A;  5DCH A;  3HJO A;  2DBC A;  3L0H A;  3MIX A;  2H01 A;  5ECR B;  2RII A;  1DBY A;  3ZIV A;  1TK5 B;  4FO5 A;  3LYP A;  2H71 A;  1F2E A;  1NW2 A;  3J7Y b;  3LWA A;  2E2M A;  1GRX A;  3C73 A;  2B6M A; 
#chains in the Genus database with same CATH homology
 3PH9 A;  4PUR A;  4IN0 A;  5ELA A;  1ZYN A;  3W8J A;  2VUP A;  1TI1 A;  1GUM A;  1OKT A;  2YAN A;  4MJB A;  4TR1 B;  2KLX A;  1T1V A;  5IMA A;  1TU7 A;  4K7I A;  3DRN A;  1MD3 A;  1EOH A;  2WFC A;  1XOB A;  1R5A A;  1A0F A;  1QFN A;  4K9Z A;  3IOS A;  2IN3 A;  2LUS A;  2AAW A;  1G7O A;  1JZW A;  4J57 E;  1ZYQ B;  4KAE A;  1O81 A;  1XZO A;  3N9J A;  4I97 A;  2VCZ A;  4KSM A;  5IM9 A;  3VWU A;  5H5Q A;  3H79 A;  3F6D A;  5ECP B;  1ZOF A;  3UBK A;  1BQ7 A;  2D2Z A;  4ZL8 A;  3GYK A;  2K8V A;  2HXK A;  4PXO A;  5GAN D;  1BYE A;  2YJH A;  3H4K A;  2CX3 A;  3O6T A;  4IKH A;  4PTS A;  1W89 A;  4IBP A;  4BWS A;  1K0A A;  3MSZ A;  3L4N A;  5D9V A;  2HYX A;  5ECK B;  3CYN A;  4ZBD A;  1K3O A;  2XC2 A;  1O85 A;  1MDI A;  1WE0 A;  2LQO A;  3TCO A;  1A2M A;  2YV7 A;  3QAV A;  3VFI A;  2R37 A;  4N30 A;  2R0C A;  3DVW A;  4ISD A;  4NV2 A;  2V1M A;  4POL A;  5J3R A;  3GTU A;  4K7O A;  4XRA A;  5IO2 A;  4P3Y B;  1ERV A;  3ZRE A;  4F0B A;  2ZUP A;  1GSE A;  1EEM A;  1OVN A;  3HZ4 A;  2FCH A;  2E0Q A;  4KCA A;  4V1A p;  1X9S B;  3F4S A;  1ERT A;  2L5O A;  4PQ1 A;  2BJX A;  1ERW A;  11GS A;  2IMK A;  3TJK A;  2O87 A;  2RM6 A;  2R5G A;  3FRC A;  1I5G A;  3CBU A;  1PKZ A;  1H4O A;  2FNO A;  3TGZ A;  1OC8 A;  4X4J A;  5CP1 A;  3GV1 A;  2VLT A;  2B5Y A;  3DWV A;  5J9B A;  3ZLP A;  1EGO A;  3A2W A;  3FR9 A;  4MZC A;  2AUV A;  3RHC A;  2K9F A;  2IL3 A;  1Q98 A;  2E7P A;  1SD9 A;  2HRF A;  4HJM A;  1M99 A;  5G30 A;  5ECQ B;  8GSS A;  5D9X A;  2AYT A;  2ZNM A;  1SL2 B;  1S3A A;  5COH A;  3WGE A;  2GS3 A;  5LNK e;  4XRD A;  5EL8 A;  2KP2 A;  1TRV A;  2XPD A;  4KDX A;  5GAP D;  1TU8 A;  4GXZ A;  2LQQ A;  2WRT A;  3GKX A;  4ZB6 A;  2XBQ A;  3CTG A;  4YQU A;  2KP1 A;  5B6N A;  4ECJ A;  2MZC A;  1WWJ A;  2H1B A;  3KIJ A;  2G2Q A;  2JAD A;  18GS A;  4F2I A;  1TW9 A;  4MAB A;  4KND A;  5HR2 A;  1HNA A;  2R2J A;  1GUK A;  4BVY A;  2H73 A;  2LJK A;  2H30 A;  4J2F A;  3DVX A;  1Z6N A;  13GS A;  2CVB A;  2LKU A;  3DD3 A;  4X1U A;  4V1A g;  1XW6 A;  5IMV A;  1XWC A;  2OA7 A;  3GUS A;  3LW9 A;  5L71 A;  1ERU A;  1SJI A;  3TB2 A;  4FYU A;  1XVQ A;  5KOX A;  2K18 A;  2WS2 A;  4DSS A;  3D4T A;  2KOK A;  4MH3 A;  2YZH A;  1ZL9 A;  4TXO B;  4WBR D;  4WF5 A;  4ZB9 A;  2GGT A;  1U87 A;  6GST A;  2VL9 A;  3EPT A;  3QAW A;  1IYI A;  3FY7 A;  4TXV A;  4PNF A;  4QL7 A;  2H6Z A;  3HDC A;  1XWK A;  3WYW A;  5KN2 A;  1G7E A;  1QGV A;  3VI7 A;  2YCD A;  1R5P A;  2PBJ A;  3P7X A;  2MBT A;  4Q5R A;  2PPT A;  1O8W A;  5J9C A;  2NBS A;  4POM A;  1GUH A;  4MCU A;  3KXO A;  2FHE A;  2O7K A;  3EU4 A;  3G7I A;  4WKW A;  5DVB A;  4KE3 A;  4EC0 A;  7GSS A;  4FIW A;  3UOM A;  5IOW A;  3UEM A;  3L78 A;  5FHI A;  2H76 A;  1X0R A;  2DML A;  1PGT A;  1J9B A;  1EZK A;  1FVK A;  1BJX A;  2HFD A;  3HJM A;  1Y25 A;  3GRX A;  5F0G A;  4HEA 2;  3GTU B;  1KNG A;  1Z6M A;  2HSM A;  2M46 A;  3R3E A;  1EP7 A;  2B5E A;  1FOV A;  2F8A A;  3ZIT A;  4ML6 A;  2N5F A;  2WDU A;  2X8H A;  2H19 A;  2I81 A;  1A2J A;  3M3M A;  4YQV A;  4RQR A;  2ZCT A;  1PL2 A;  1F3B A;  3K8N A;  2K6V A;  4G0L A;  5HFG A;  5A4V A;  4USS A;  2I9H A;  2FY6 A;  4WR5 A;  1SU9 A;  2C80 A;  3TJF A;  3P2A A;  4O5U A;  2CZ3 A;  5B6M A;  2IMD A;  4HU7 A;  4O5R A;  5CRG A;  1Z9H A;  3R2Q A;  3CTF A;  1M9B A;  4IJI A;  3CRT A;  1YQ1 A;  5DQY A;  1SK2 A;  3H8Q A;  4O32 A;  2VM2 A;  2R0G A;  3DGQ A;  3IBH A;  3H1N A;  3IA1 A;  5BRT A;  4Z2R A;  5JCW A;  1J0F A;  1VF2 A;  2GT6 A;  4MJC A;  3AY8 A;  1ZYE A;  1TI3 A;  2QKE A;  3FZA A;  5HR1 A;  4KUN A;  4OFT A;  2R3X A;  4IP6 A;  4EDY A;  3TOU A;  2YZU A;  3VK9 A;  1EEJ A;  17GS A;  9GSS A;  6GSV A;  5DQS A;  2MMN A;  1YY7 A;  2FA4 A;  3KM6 A;  2VCV A;  3ME7 A;  4YQM A;  2IMI A;  5ECL B;  2PMT A;  3GL3 A;  2H72 A;  3FR3 A;  5E4W A;  3EUR A;  1PX6 A;  4F0C A;  4XS1 A;  3A2X A;  5D73 A;  3ZRD A;  2DSA A;  1URM A;  5GZZ B;  1TRU A;  2I4A A;  2L6C A;  4KGI A;  1ZZY A;  3GX8 A;  1WP0 A;  2GZY A;  4G9H A;  4V2N A;  4X43 A;  1OE8 A;  1RK4 A;  3ISO A;  4EF0 A;  4IGJ A;  3I9V 2;  2WB9 A;  1ON4 A;  3EMP A;  3HXS A;  1FO5 A;  1OC9 B;  1A8Y A;  2H8L A;  3O76 A;  4POK A;  2CX4 A;  1Z3E A;  3CSH A;  2A4H A;  4ILF A;  4A5P A;  1TKD B;  1MD4 A;  5IIZ A;  5ENU A;  4GRF A;  2H6Y A;  1XPV A;  1O8X A;  1O73 A;  2XBI A;  1LU4 A;  3TKP A;  3EC3 A;  2FWF A;  3GNJ A;  1XVW A;  1YF0 A;  4XS4 A;  4Q5Q A;  4V2L A;  4Z7X A;  2FUG 2;  2R6K A;  5F06 A;  1GP1 A;  4ICY A;  1JFU A;  2YWM A;  1Q4J A;  2LTK A;  1ZMA A;  4WEY A;  2GTU A;  4TW5 A;  1F6M C;  4CW9 A;  1MDK A;  5CO3 A;  5KN1 A;  2H0I A;  4E8E A;  2DJ1 A;  1G6Y A;  1N2A A;  1SEN A;  2YP6 A;  3L9V A;  3UBL A;  1GSD A;  1WPI A;  2I3Y A;  2VCW A;  3RHB A;  3FHK A;  3ERW A;  5DJM A;  1GSY A;  3KZQ A;  1K3L A;  2HZE A;  4PNG A;  2PU9 C;  2RLI A;  1WMJ A;  2K8S A;  4BVX A;  3DYR A;  1BG5 A;  4TN8 A;  5FWG A;  1TRS A;  2F8F A;  3BOA A;  5BMU A;  1VF1 A;  2B3S A;  1U6T A;  4N10 A;  2VL3 A;  3TUE A;  4IW9 A;  4GSS A;  3F4R A;  2EIO A;  3TKR A;  1DSB A;  3D6I A;  5IMC A;  3QDN A;  4OO5 A;  4OD7 A;  4PQH A;  1UC7 A;  4EE0 A;  5J4U A;  2AHE A;  2L59 A;  3LFL A;  2PVQ A;  4TKY A;  5ECM B;  3OR5 A;  3EU3 A;  4YKG A;  2L4C A;  2PER A;  1XW5 A;  6GSY A;  2RUE A;  2CT6 A;  5CRD A;  4IQ1 A;  5HFI A;  2YJ7 A;  3UL3 A;  1RQM A;  4K5R A;  1XWB A;  1GNW A;  4MPG A;  4OO4 A;  4IJ3 A;  4YAV A;  1KTE A;  2O8V B;  1NM3 A;  4IQA A;  1B4P A;  4DVC A;  3FZ5 A;  4HQZ A;  6GSX A;  2OAD A;  1GUL A;  2OJL A;  2YWO A;  4MDC A;  5EPF A;  1HQO A;  1MTC A;  3VUR A;  1G0T A;  4IEL A;  3GMF A;  3W8S A;  2GZP A;  4KX4 A;  4FQU A;  4LMV A;  4ZIL A;  5B8A A;  4GF0 A;  3IXR A;  5G2Z A;  4CHS A;  3ED3 A;  2GDR A;  1AUC A;  1DUG A;  4QQ7 A;  4D73 B;  5GSS A;  3A2V A;  4PX1 A;  2VD0 A;  4JBB A;  1GTB A;  3F63 A;  1EV9 A;  2IME A;  1PL1 A;  4N0V A;  1O7U A;  2C8U A;  5DAK B;  2REM A;  5HQP A;  3VLN A;  3FMW A;  4L0W A;  1PX7 A;  3EVI A;  2GT5 A;  4GCI A;  2YPM A;  1TJD A;  2ES7 A;  2A4V A;  3IK9 A;  2OBK A;  3UAP A;  3HVS A;  3UVT A;  2VCT A;  1ZGN A;  4G10 A;  1B48 A;  3PIN A;  1GTU A;  1ZCP A;  4HUA A;  5D9W A;  4HZ4 A;  5C00 A;  3IE3 A;  3GKK A;  1QMV A;  5IOX A;  4EO3 A;  4ULX A;  3FZ9 A;  4OFM A;  2PGT A;  4K5S A;  2CAI A;  5JCG A;  2IJY A;  2X8C A;  3GSS A;  1JLW A;  1WRY A;  5AGY A;  1A0R P;  4XS4 B;  2YWI A;  2QGV A;  1GTI A;  3G7Y A;  5D93 A;  3BCI A;  3TKQ A;  2IFQ A;  4MNN A;  3ZZX A;  2V6K A;  1KEB A;  4MH2 A;  1FAA A;  2JZR A;  4G2E A;  2XHF A;  5INY A;  1PSQ A;  1HYU A;  2JSZ A;  4EL1 A;  5DAL B;  4PGT A;  1IYH A;  22GS A;  3S9F A;  1V40 A;  1GH2 A;  2KUC A;  2WZ9 A;  4CY6 A;  1B9Y C;  16GS A;  1R7H A;  4DSQ A;  1OC3 A;  4HOJ A;  4RQX A;  1BAY A;  1ILO A;  2C3N A;  2RUF A;  3EWL A;  1S3D A;  1M9A A;  1YKC A;  1Z7P A;  3C1S A;  2YNX A;  3TJG A;  2VIM A;  4BA7 A;  2DKI A;  3F6F A;  3M1G A;  3KGK A;  2C3T A;  3IRA A;  4MJE A;  2CA8 A;  2YOI A;  3QCP A;  4YAP A;  1SYX A;  3BBY A;  1B8X A;  1XFL A;  2L6D A;  4FYB A;  3NIV A;  1FG4 A;  5ECH B;  1X9W B;  5DJL A;  1A8L A;  3CXG A;  2TRX A;  1NSW A;  4BL7 A;  3LSZ A;  3U6V A;  1AQX A;  2DJ0 A;  5HR0 A;  4EUY A;  3TKS E;  1ZYP A;  5H5R A;  3IV4 A;  2TIR A;  3E0U A;  2H66 A;  1M7T A;  5B8B A;  1PQN A;  3LXT A;  4G19 A;  3Q6O A;  3D0Z A;  4I2U A;  2EIR A;  2NDO A;  3DEX A;  2G0F A;  2N5B A;  4HDE A;  1MEK A;  3DKS A;  1GSQ A;  1TDI A;  2H1G A;  2GSS A;  3F9U A;  3HKR A;  4Q5F A;  2AJQ B;  2C0E A;  3WD6 A;  2IWT A;  1U3I A;  2GQL A;  1T7P B;  2H74 A;  3E3E A;  3ZVJ D;  2OBI A;  5JCU A;  3A3T A;  3J7Y k;  3ZIJ A;  2LJR A;  1ML6 A;  1ACV A;  1X5E A;  3D4M A;  5AIV A;  5CAX A;  3D5J A;  1ABA A;  1QXH A;  2X8G A;  2A2R A;  1FW1 A;  5ECI B;  3GN3 A;  1T4Z A;  5A5K A;  2HRA A;  3C7M A;  4ZBA A;  1GLP A;  5JWO B;  1TTZ A;  2PUK C;  5D9T A;  3TRX A;  4NXI A;  2X99 A;  4K2X A;  4ZXG A;  2MMO A;  1OAZ A;  3MWH A;  4F9Z A;  2IMF A;  5JWQ B;  2R0P A;  2JL4 A;  2EC4 A;  4DEJ A;  3WT1 A;  4N0Z A;  1YEP A;  1FVJ A;  2H1D A;  2B7J A;  3MAK A;  1TRW A;  1THX A;  1V98 A;  4ECC A;  10GS A;  4JZQ A;  2YN1 A;  4L5O A;  4TR1 A;  1EGR A;  5IPH A;  1QQ2 A;  2F9S A;  2AV4 A;  2GSR A;  2AB6 A;  3ZVJ A;  3ERG A;  2B7K A;  2P31 A;  1O6J A;  4XTS A;  2V41 A;  1F3A A;  3QOU A;  1T4Y A;  2P5Q A;  2LRN A;  2GST A;  1T00 A;  2VL2 C;  4K7N A;  1NHO A;  2C0F A;  4WF4 A;  1SK0 A;  3KEB A;  2N5A A;  1BED A;  4MP4 A;  4HJ2 A;  4MA9 A;  1XW9 A;  3LXZ A;  4ZBB A;  1K0O A;  1A23 A;  5CRH A;  1XOA A;  12GS A;  4L0U A;  5G1K A;  4HU9 A;  1VF4 A;  1WOU A;  3DIE A;  5IMZ A;  4LMW A;  4NHZ A;  4I6X A;  3HJP A;  1R26 A;  3HYP A;  2L4Q A;  1AC1 A;  1HNB A;  4ML1 A;  5H5S A;  2GLR A;  2M80 A;  1W4V A;  1X5D A;  5JWR B;  1KBN A;  5CNW A;  2PN8 A;  1M2D A;  4OWY A;  2DKH A;  1I9D A;  2NPB A;  4LA1 A;  5HFK A;  3QR6 A;  2H0G A;  4YKF A;  4GQC A;  4BVY B;  3KH7 A;  2ALB A;  1TP9 A;  5F05 A;  1F9M A;  1PN9 A;  1NHY A;  5ELG A;  2H1A A;  4E8H A;  3ZYW A;  2FWG A;  2CZ2 A;  5D96 A;  5G5E A;  2NVL A;  1PRX A;  4DSS B;  4EXJ A;  2F3M A;  3VWV A;  3GUR A;  4JU5 A;  4GQF A;  2OAC A;  1AQW A;  1DE1 A;  2UZ8 A;  3UJ1 A;  1JZD A;  4Z2U A;  2DMM A;  3RDW A;  3QFB C;  2IIY A;  4GWR A;  3VPQ A;  5DBQ A;  2FD3 A;  3GH6 A;  2LV3 A;  4DSR A;  4JED A;  4CY8 A;  3PPU A;  4KW6 A;  1E2Y A;  4JRR A;  5ECN B;  4MPF A;  2FWE A;  1OKD A;  4QL9 A;  3HVV A;  1OYJ A;  1TK8 B;  4YH2 A;  2VLV A;  4XS6 A;  5CRW A;  3L9U A;  4AJ7 A;  2M72 A;  1R4W A;  2JZS A;  2DJ3 A;  1FHE A;  2FA8 A;  1K0C A;  2DJK A;  1S3C A;  3RBT A;  1PKW A;  3MYD A;  3BCK A;  1LJR A;  2X4A A;  2NTO A;  1V58 A;  3KTL A;  5J5N A;  4OCF A;  1B4Q A;  1SJZ A;  3GIX A;  3ZFB A;  4MJA A;  2GZZ A;  5DCG A;  3IR4 A;  1T3B A;  1YZX A;  3GFK A;  3HHV A;  3I69 A;  2HSH A;  5D8I A;  2VD1 A;  2E2G A;  4WR4 A;  4G0I A;  3EE2 A;  3IK7 A;  1SL1 B;  1A2L A;  3FK8 A;  1SK1 A;  3BD2 A;  5AN1 A;  4JE1 A;  1EP8 A;  3KH9 A;  1BX9 A;  5A4U A;  5EY6 A;  1C72 A;  2A2S A;  4GSN A;  4O7H A;  1GSF A;  4BWQ A;  3P8W A;  1UN2 A;  2A2P A;  4PQI A;  1TOF A;  1WJK A;  3QAG A;  2DIZ A;  4TVE A;  3ZTL A;  3APS A;  1T8E B;  3HZ8 A;  4TXO A;  4MMM A;  3QD9 A;  3GKM A;  1SYR A;  1OE7 A;  1HD2 A;  3P90 A;  4GST A;  3SWL A;  3GST A;  4KDY A;  5HR3 A;  2C0G A;  3EYT A;  3HVX A;  3NZN A;  2V2G A;  1B9X C;  5F8B A;  2IPA A;  1Y6E A;  2OE3 A;  3F8U A;  3FEU A;  3W6G A;  3HA9 A;  4WXT A;  4IVF A;  4OCE A;  3EIN A;  5C04 A;  2VCX A;  3M0F A;  3TJJ A;  3TRQ A;  1K0D A;  2DLX A;  3VI5 A;  4PUF C;  3FKF A;  3IDV A;  4OMV A;  3N5O A;  1K3Y A;  2J23 A;  4K2D A;  1V9W A;  3KP8 A;  5A4W A;  2DIY A;  4K0N A;  3WGD A;  1G6W A;  1EV4 A;  2B1L A;  3H93 A;  4F82 A;  1XWG A;  4LLR A;  2QSI A;  3TJB A;  3SBC A;  2HSY A;  1N8J A;  2X49 A;  4BPY A;  1AIU A;  3V1W A;  2CAQ A;  3KP9 A;  2DC5 A;  3LGC A;  4HZ2 A;  6GSW A;  4MZB A;  4H86 A;  3UVH A;  5ABR A;  2PWJ A;  1M0U A;  2J9H A;  3LQ7 A;  3US3 A;  2LRT A;  2QA2 A;  2L5L A;  1H75 A;  3IAM 2;  1TK0 B;  4HQS A;  2CV4 A;  2VM1 A;  3A5I A;  4FYC A;  5LD0 A;  2RM5 A;  3ME8 A;  4NAX A;  3VWX A;  4TRX A;  2QC7 A;  1AW9 A;  1SJ6 A;  1GWC A;  4HI7 A;  3L9S A;  3GA4 A;  3QMX A;  2GVP A;  1M2B A;  2OKA A;  3FYG A;  5KEJ A;  3IC8 A;  5EVO A;  4IHU A;  4K6X A;  1FB6 A;  3F4T A;  2C4J A;  4MLY A;  1QUW A;  2O89 A;  3G7J A;  3EMX A;  4AGS A;  1A24 A;  4AJ6 A;  4EIQ A;  4EVM A;  2VAF A;  3ERF A;  1EWX A;  3QPM A;  3G9B A;  2LS5 A;  3GKN A;  3C1R A;  2P0G A;  5AIS A;  1FB0 A;  2WJU A;  2LNT A;  1VRS D;  3BJ5 A;  1Z7R A;  1FOH A;  3D21 A;  1SKW B;  1AAZ A;  4RUV A;  1MDJ A;  4NV5 A;  2OE1 A;  4HS1 A;  2FWH A;  4EIP A;  3E9J B;  3LOR A;  3KCM A;  3TKS C;  3KMO A;  2FGX A;  1GL8 A;  1XCC A;  2HZE B;  4IS0 A;  1EOG A;  1X9M B;  4KDU A;  4BVX B;  1YKA A;  5ECS A;  3TKS A;  1WIK A;  3APQ A;  2PVO C;  3JCM L;  4O5Q A;  2V6O A;  1SL0 B;  4KH7 A;  1RW1 A;  4KCE A;  5CRE A;  19GS A;  2MMZ A;  2XPE A;  4ZB8 A;  1K0N A;  4K1F A;  2LJA A;  1USB A;  2WCI A;  5J41 A;  5G31 A;  3WGX A;  2OE0 A;  1OC9 A;  3Q18 A;  4MF7 A;  1AQV A;  3I6A A;  1UA5 A;  2H75 A;  2MBS A;  2JSY A;  3M9K A;  3F0I A;  2H70 A;  14GS A;  4TR3 A;  4ZL9 A;  4XIH A;  3RPP A;  3MDK A;  3FW2 A;  5ID2 A;  4JR6 A;  3Q19 A;  2WUL A;  2YWN A;  4KB3 A;  2LEG A;  2X64 A;  3Q74 A;  2I1U A;  2H0H A;  2LST A;  3CMI A;  2HNL A;  5KN3 A;  5B7C A;  5E59 A;  5ECO B;  1V2A A;  1HNC A;  5GST A;  2VCQ A;  5KN0 A;  4MF5 A;  3ZML A;  3CSI A;  2ON5 A;  1PMT A;  2L57 A;  1CQH A;  4ID0 A;  2WGR A;  4LL1 B;  4XHM A;  1PA3 A;  1GLQ A;  2VO4 A;  3KD0 A;  4NWY A;  2R4V A;  1K0B A;  3FR6 A;  1AXD A;  5IMD A;  3CRU A;  4KA0 A;  3RAZ A;  2C0D A;  2H6X A;  1SKS B;  1YJ6 A;  4KF9 A;  4L8E A;  2GSQ A;  1E6B A;  2GQK A;  2F51 A;  3M8N A;  3LYK A;  4Z2T A;  3C8E A;  20GS A;  2JU5 A;  5KOW A;  1TXX A;  3GX0 A;  3LEF A;  2MMA A;  4G0K A;  4KSO A;  3A5W A;  4MZW A;  3LG6 A;  1XXU A;  5F07 A;  3C71 A;  1YEX A;  6GSU A;  1YDK A;  3GH9 A;  4EDZ A;  3WT2 A;  1VGL A;  4RI6 A;  3IHQ A;  2FLS A;  2CQ9 A;  1U3A A;  4PUA A;  2HT9 A;  4K0G A;  2GQM A;  3TOT A;  4WET A;  4L5L A;  3HY2 A;  3ZL5 A;  5LCZ A;  4ZL7 A;  4LL4 B;  3HCZ A;  3UIW A;  4I8B A;  3IC4 A;  5FT3 A;  1JZR A;  3DML A;  1GSU A;  4AJ8 A;  3IHG A;  1GNE A;  1CQG A;  1K0M A;  4ZIJ A;  3GHA A;  2VL2 A;  4N11 A;  2O85 A;  3MNG A;  1THO A;  1U88 A;  6GSS A;  5IPG A;  3GL5 A;  2IFQ B;  4RI7 A;  4NMU A;  2KHP A;  4O92 A;  3O3T A;  4NPB A;  1DE2 A;  1V57 A;  3F3Q A;  2B5X A;  1XWA A;  4CDO A;  4ECI A;  4NHW A;  3KTB A;  2JAC A;  4D73 A;  2VOC A;  2QA1 A;  3VPT A;  4GLT A;  3TDG A;  3PR8 A;  2HRK A;  4MF6 A;  2DJ2 A;  3UMA A;  1JHB A;  3TRP A;  2BMX A;  4WBJ A;  3F3R A;  1XBS A;  5DAK A;  4TOP A;  5CYY A;  4ECB A;  1YF1 A;  3DXB A;  5DDL A;  4F03 A;  1VF3 A;  4I2T A;  3U5R E;  5G1L A;  2CVD A;  3APO A;  2TRC P;  1F37 A;  1GSS A;  4FH8 A;  2LNS A;  1J08 A;  3ZFL A;  4POB A;  3LJR A;  4BL7 B;  2YV9 A;  3RPN A;  3QFA C;  3UAR A;  1SD8 A;  3IPZ A;  1PD2 1;  2DJJ A;  2ON7 A;  2JZT A;  4J56 E;  2MYG A;  1SKR B;  1XIY A;  5AIX A;  5ID2 B;  4V2M A;  2CVK A;  4GTU A;  4I5Q A;  4XCS A;  2V32 A;  3PGT A;  1QK8 A;  5IMF A;  4K8M A;  2HRN A;  4JR4 A;  2HLS A;  1UVZ A;  2LRC A;  3KJY A;  1PN0 A;  5G5F A;  2C3Q A;  1X5C A;  3KMN A;  5IO0 A;  4TR4 A;  2HE3 A;  1ST9 A;  1M2A A;  4IP1 A;  3HD5 A;  2C1Y A;  3M9J A;  2EIQ A;  1Z5Y E;  3NOF A;  2HI7 A;  3IAS 2;  3FZ4 A;  4ACS A;  1GTA A;  2HZF A;  3D22 A;  4AF2 A;  5IQY A;  3VWW A;  3CSJ A;  4EKZ A;  1JZO A;  5DAL A;  4MK3 A;  2P5R A;  2BTO T;  1LBK A;  4TR0 A;  2B1K A;  4Q5N A;  1JLV A;  2VLU A;  4OFN A;  4X0X A;  3I43 A;  2Z9S A;  3ZMK A;  5DCH A;  3HJO A;  2DBC A;  3L0H A;  3MIX A;  2H01 A;  5ECR B;  2RII A;  1DBY A;  3ZIV A;  1TK5 B;  4FO5 A;  3LYP A;  2H71 A;  1F2E A;  1NW2 A;  3J7Y b;  3LWA A;  2E2M A;  1GRX A;  3C73 A;  2B6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...