1TIEA

Crystal structure of a kunitz-type trypsin inhibitor from erythrina caffra seeds
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
166
Chain Sequence
VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTGEETCPLTVVQSPNELSDGKPIRIESRLRSAFIPDDDKVRIGFAYAPKCAPSPWWTVVEGLSVKLSEDESTQFDYPFKFEQVSDQLHSYKLLYCEGKHEKCASIGINRDQKGYRRLVVTEDYPLTVVLKKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Kunitz-type trypsin inhibitor from Erythrina caffra seeds.
pubmed doi rcsb
molecule keywords ERYTHRINA TRYPSIN INHIBITOR
molecule tags Proteinase inhibitor (trypsin)
source organism Erythrina caffra
total genus 26
structure length 166
sequence length 170
ec nomenclature
pdb deposition date 1991-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1tieA00
2DREA 4A7YA 2K8RA 4LO1C 5EC5A 2Z48A 3O4BA 3MALA 4X38A 3AJ6A 4GAIA 5E24E 1G9DA 3O4CA 4IY9A 4J2YA 1IT0A 2GO2A 3O4AA 5F8YA 2WRYA 1FGAA 4Q9GA 3BRFA 1RMLA 1TOOA 3A23A 3TC2A 2KH2A 5DUYA 5BQUA 2NZ9A 3ZC8A 1FQ9A 1V6WA 3N7MA 1CE7B 2F2FA 3NBDA 4QD2B 4I4XA 2ESUA 3CA4A 3CRGA 3VSFA 2VUAA 2ERMA 4JPZA 4H04A 3CA3A 1PC8B 2RQ9A 3P6JA 2Y9XE 4IQPA 4OW4A 1IHKA 4I2SA 4I4OA 1M16A 2AXMA 2D23A 1E0OA 3FJAA 1TTUA 3RTIB 1G82A 1IILA 5G00A 3Q7XA 1JQZA 3FJDA 4KC3A 5JMCA 1AVXB 1VCLA 3N7KA 4FGFA 3PHZA 3NBNA 2YUGA 5BP5C 3AKIA 3AJ5A 1MD6A 3BA5A 1ISWA 2NYYA 21BIA 1FWUA 1NUNA 4XFSA 3I2XA 5DSSB 2DS0A 3CA6A 5F8WA 1NZKA 4I8MA 5DVHA 3VT1A 1DZDA 4XFUA 1YBIA 1TWEA 2FFVA 3CA0A 4YOLA 3RSJA 1IOBA 1SR4A 3BAQA 3IAGC 2KKIA 4QBCA 4IZXA 3BX1C 2UUSA 3RTJB 3BA7A 3FFZA 4I4PA 1FWVA 1A8DA 3CU1B 4GOVA 4QD2C 1BFBA 4OUJA 1S0FA 3UD7A 2VXTI 3UD9A 2Q9XA 3H6RA 3LTQA 1BFGA 3CRIA 4P0LA 1IJTA 1N4KA 4FVVA 4LO2C 1W3FA 1Q04A 2NVHA 2DRYA 3A07A 2D44A 4G9NA 3CA5A 1JTCA 1WBCA 1HCDA 2AFGA 2NTDA 3S8KA 5BOWA 4ZGRB 1Q1UA 4X37A 1DQOA 4OWJA 4Z9WB 1J0SA 3P6IA 1DLLA 3W9TA 1DFQA 2LIQA 1S0CA 4L4HA 1AVWB 2IHOA 3ZX7A 2NP0A 1ONKB 2NM1A 4I1EA 3WMVA 5BXRA 1HWNB 2ZQOA 3ILAA 2WBCA 3FJIA 4P0JA 3AH2A 3I2AA 4QKSA 2K4AB 5BQUC 1HCEA 4H9WA 3HBWA 1AFCA 4F34A 31BIA 3CRHA 1R8NA 3VWCA 3BAUA 1WD3A 4G6MA 4I4VA 4IONA 3BAOA 3D7WB 1RZOB 2MLLB 3P53A 4PC4A 1DJSB 1K5UA 1DQGA 3OJMA 4EKXB 1D0HA 1G9CA 3A22A 1W3GA 1JLYA 2AAIB 1S0LA 1BASA 5EHAA 3Q7WA 1TFMB 4TLPA 1PZZA 5B2HA 1XYFA 4A7ZA 4J23B 3BA4A 4GOYA 1CVSA 1IRAX 1XG6A 1KNMA 3VUOA 4R6UB 2QN4A 3AKFA 3VT0A 3WA1A 4JKQA 5BXSA 3FJBA 1S0EA 1T9FA 4CJMA 3BRDA 3HALA 3FJFA 4KEKA 3WO4A 2FGFA 1SR4C 4I96A 2D1ZA 3IM7A 5I1BA 3FJ9A 1V6UA 2BEAA 2M49A 4I4UA 3N0KA 4D0ZA 4KEJA 4ZFWB 2F8XC 4AN6A 4ZLBB 4ENDA 1G9BA 3FJJA 4OWKA 1YYNA 2XOAA 2E4MA 1HKNA 5JLVA 3SNVA 1AF9A 1RY7A 3UD8A 3WINA 1EYLA 1S0DA 3OGFA 3ZXGA 4ISRA 3QR5A 1EV2A 3VT2A 1TP0A 4GAFA 1I1EA 1ISYA 2ZR1B 3N7JA 2RG9B 2VSAA 5HPZA 3H6SE 1R8OA 3V0BB 1AXMA 1HWPB 3JUTA 3PG0A 4A7KA 4LO3A 4KBBA 3O4OA 2D43A 2FO1A 2HWMA 3S8JA 3BTAA 4GP0A 4LO0A 3FUQA 3AZVA 2Y9GA 4LO7B 5DZUA 3N7LA 3FUOA 5GAQA 2MC2A 1JY0A 2RSTA 3AKHA 3UJ4A 4JQ0A 4EFRA 3ZXDA 4P0KA 1II4A 4ZBVB 5FZYA 4KEIA 4I1BA 1YF8B 4JAWA 4ZKTB 1W3AA 1TWMA 1DFCA 3PMEA 1YXWA 3CQAA 4XFTA 3R4UA 3WMUA 4D0TA 3BADA 3HMYA 4I7IA 1UPSA 3FJCA 3O5WB 4QALA 1ISZA 2QYIB 2ET2A 2F2FC 4ZFYB 1DIWA 5FNXA 4GP3A 5F90A 4X39A 4EB2B 7I1BA 3B9UA 4QO3A 1BFCA 3O49A 3FJKA 1L2HA 1TIEA 1ABRB 3O4DA 3FGMA 4II0A 1Z2VA 3BRGC 1T4QA 2LIEA 2VLCA 3HOMA 3I29B 3MPPG 5BXTA 1V6VA 1JT3A 1XZZA 3T8SA 3CA1A 9ILBA 4I4YA 3F62B 1QQKA 3R4SA 4DCKC 1RG8A 3CAHA 2IWTB 3AKGA 3OJVA 1HWOB 4LO7C 1Q03A 2K43A 4DEPA 4IZEA 2Q3NB 1JT5A 3VEQA 1BLAA 2E4MC 4G1RA 2DRZA 1QXMA 1AVAC 4OEGA 1BA7A 1K5VA 3F1RA 4I37A 3WINC 2VSEA 4ZA3B 3OGGA 3V0BA 5BVPI 1DZCA 4ZFUB 4I6IA 4Z8SB 3VSZA 3AZWA 3Q7YA 3C9ZA 4JKXB 3NJ5A 3IM5A 4L4IA 4X3AA 3FJ8A 1I1BA 4LO1A 1JT4A 3O3QA 3V0AA 3IM6A 2D24A 2P39A 3AH4A 3WO3A 1M2TB 2VU9A 5D61A 3AH1A 4USPA 1S0GA 1ISXA 4LO3C 2I1BA 1FN0A 4F83A 1XHBA 4I0YA 1PUMB 2ZQNA 3H6QA 4LO0C 2D7RA 3OBTA 1FMZA 1PWAA 4QKRA 1WBAA 3EF2A 2Y9WC 5FZZA 4IY8A 5F8SA 6I1BA 4ISQA 2X2TA 1P63A 2GZBA 2J3PA 3RMYA 1OQLB 1G9AA 4QC4A 41BIA 1IRPA 1JT7A 1ISVA 4Q91A 3JRRA 1BLDA 1ITBA 5EG6C 2BFHA 1GGPB 3OBRA 3IIRA 5D62A 4JRAA 4Q9PA 5BP5A 1S0BA 2AQZA 3BB2A 2Y9FA 4D8HA 3OJ2A 4WBCA 1PUUB 3E8LC 4ZOTA 3V0AB 3V79C 8I1BA 3POKA 2KI4A 2P23A 1Z0HA 4OEEA 1FV3A 1Z4SA 3KMVA 4OEFA 4J2XA 1BARA 2HW9A 2KLLA 3FJHA 3NBCA 4G9MA 4I4QA 1EVTA 4J2SA 4EEEB 4J2KA 3BAGA 2D20A 4JP0A 4XKIA 3QYDA 2HZ9A 1AVUA 3FJEA 4HJJA 1EPWA 4QBVA 3BAHA 5BXPA 4HR6C 1YTOA 4USOA 2MIBA 1FV2A 2R9KB 4IHZA 1MC9A 4I3NA 1V6XA 2D7IA 4I4RA 2KI6B 3K1XA 5FNWA 5D63A 3UDAA 3WO2A 2FFUA 3HN1A 2X2SA 2VXRA 1SZ6B 4I4SA 4OWLA 1BFFA 2HWAA 3BAVA 4LO2A 4IYBA 5FZUA 3LLPA 3PUBA 4P6AA 1JLXA 3UJ0A 4HA2A 1ILR1 2FDBM 4AN7B 3HSMA 4G6JA 4EFQA 1F31A 3A21A 4LO8B 3NBEA 4EFPA 3ZC9A 2BEBA 1WD4A 1HIBA 3O44A 2D22A 2L5XA 1HWMB 3RMXA 4DENA 2Z49A 3H6RB 1QQLA 1FMMS
chains in the Genus database with same CATH superfamily
2DREA 4A7YA 2K8RA 4LO1C 4MZFB 5EC5A 2Z48A 3O4BA 3MALA 4X38A 3AJ6A 4GAIA 5E24E 1G9DA 3O4CA 4IY9A 4J2YA 1IT0A 2GO2A 3O4AA 5F8YA 2WRYA 1FGAA 4Q9GA 3BRFA 1RMLA 1TOOA 3A23A 3TC2A 2KH2A 5DUYA 5BQUA 2NZ9A 3ZC8A 1FQ9A 1V6WA 3N7MA 1CE7B 2F2FA 3NBDA 4QD2B 4I4XA 2ESUA 3CA4A 3CRGA 3VSFA 2VUAA 2ERMA 4JPZA 4H04A 3CA3A 1PC8B 2RQ9A 3P6JA 2Y9XE 4IQPA 4OW4A 1IHKA 4I2SA 4I4OA 1M16A 2AXMA 2D23A 1E0OA 3FJAA 1TTUA 3RTIB 1G82A 1IILA 5G00A 3Q7XA 1JQZA 3FJDA 4KC3A 5JMCA 1AVXB 1VCLA 3N7KA 4FGFA 3PHZA 3NBNA 2YUGA 5BP5C 3AKIA 3AJ5A 1MD6A 3BA5A 1ISWA 2NYYA 21BIA 1FWUA 1NUNA 4XFSA 3I2XA 5DSSB 2DS0A 3CA6A 5F8WA 1NZKA 4I8MA 5DVHA 3VT1A 1DZDA 4XFUA 1YBIA 1TWEA 2FFVA 3CA0A 4YOLA 3RSJA 1IOBA 1SR4A 3BAQA 3IAGC 2KKIA 2NS2A 4QBCA 4IZXA 3BX1C 2UUSA 3RTJB 3BA7A 3FFZA 4I4PA 1FWVA 1A8DA 3CU1B 4GOVA 4QD2C 1BFBA 4OUJA 1S0FA 3UD7A 2VXTI 3UD9A 2Q9XA 3H6RA 3LTQA 1BFGA 3CRIA 4P0LA 1IJTA 1N4KA 4FVVA 4LO2C 1W3FA 1Q04A 2NVHA 2DRYA 3A07A 2D44A 4G9NA 3CA5A 1JTCA 1WBCA 1HCDA 2AFGA 2NTDA 3S8KA 5BOWA 4ZGRB 1Q1UA 4X37A 1DQOA 4OWJA 4Z9WB 1J0SA 3P6IA 1DLLA 3W9TA 1DFQA 2LIQA 1S0CA 4L4HA 1AVWB 2IHOA 3ZX7A 2NP0A 1ONKB 2NM1A 4I1EA 3WMVA 5BXRA 1HWNB 2ZQOA 3ILAA 2WBCA 3FJIA 4P0JA 3AH2A 3I2AA 4QKSA 2K4AB 5BQUC 1HCEA 4H9WA 3HBWA 1AFCA 4F34A 31BIA 3CRHA 1R8NA 3VWCA 3BAUA 1WD3A 4G6MA 4I4VA 4IONA 3BAOA 3D7WB 1RZOB 2MLLB 3P53A 4PC4A 1DJSB 1K5UA 1DQGA 3OJMA 4EKXB 1D0HA 1G9CA 3A22A 1W3GA 1JLYA 2AAIB 1S0LA 1BASA 5EHAA 3Q7WA 1TFMB 4TLPA 1PZZA 5B2HA 1XYFA 4A7ZA 4J23B 3BA4A 4GOYA 1CVSA 1IRAX 1XG6A 1KNMA 3VUOA 4R6UB 2QN4A 3AKFA 3VT0A 3WA1A 4MZGB 4JKQA 5BXSA 3FJBA 1S0EA 1T9FA 4CJMA 3BRDA 3HALA 3FJFA 4KEKA 3WO4A 2FGFA 1SR4C 4I96A 2D1ZA 3IM7A 5I1BA 3FJ9A 1V6UA 2BEAA 2M49A 4I4UA 3N0KA 4D0ZA 4KEJA 4ZFWB 2F8XC 4AN6A 4ZLBB 4ENDA 1G9BA 3FJJA 4OWKA 1YYNA 2XOAA 2E4MA 1HKNA 5JLVA 3SNVA 1AF9A 1RY7A 3UD8A 3WINA 1EYLA 1S0DA 3OGFA 3ZXGA 4ISRA 3QR5A 1EV2A 3VT2A 1TP0A 4GAFA 1I1EA 1ISYA 2ZR1B 3N7JA 2RG9B 2VSAA 5HPZA 3H6SE 1R8OA 3V0BB 1AXMA 1HWPB 3JUTA 3PG0A 4A7KA 4LO3A 4KBBA 3O4OA 2D43A 2FO1A 2HWMA 3S8JA 3BTAA 4GP0A 4LO0A 3FUQA 3AZVA 2Y9GA 4LO7B 5DZUA 3N7LA 3FUOA 5GAQA 2MC2A 1JY0A 2RSTA 3AKHA 3UJ4A 4JQ0A 4EFRA 3ZXDA 4P0KA 1II4A 4ZBVB 5FZYA 4KEIA 4I1BA 1YF8B 4JAWA 4ZKTB 1W3AA 1TWMA 1DFCA 3PMEA 1YXWA 3CQAA 4XFTA 3R4UA 3WMUA 4D0TA 3BADA 3HMYA 4I7IA 1UPSA 3FJCA 3O5WB 4QALA 1ISZA 2QYIB 2ET2A 2F2FC 4ZFYB 1DIWA 5FNXA 4GP3A 5F90A 4X39A 4EB2B 7I1BA 3B9UA 4QO3A 1BFCA 3O49A 3FJKA 1L2HA 1TIEA 1ABRB 3O4DA 3FGMA 4II0A 1Z2VA 3BRGC 1T4QA 2LIEA 2VLCA 3HOMA 3I29B 3MPPG 5BXTA 1V6VA 1JT3A 1XZZA 3T8SA 3CA1A 9ILBA 4I4YA 3F62B 1QQKA 3R4SA 4DCKC 1RG8A 3CAHA 2IWTB 3AKGA 3OJVA 1HWOB 4LO7C 1Q03A 2K43A 4DEPA 4IZEA 2Q3NB 1JT5A 3VEQA 1BLAA 2E4MC 4G1RA 2DRZA 1QXMA 1AVAC 4OEGA 1BA7A 1K5VA 3F1RA 4I37A 3WINC 2VSEA 4ZA3B 3OGGA 3V0BA 5BVPI 1DZCA 4ZFUB 4I6IA 4Z8SB 3VSZA 3AZWA 3Q7YA 3C9ZA 4JKXB 3NJ5A 3IM5A 4L4IA 4UY4A 4X3AA 3FJ8A 1I1BA 4LO1A 1JT4A 3O3QA 3V0AA 3IM6A 2D24A 2P39A 3AH4A 3WO3A 1M2TB 2VU9A 5D61A 3AH1A 4USPA 1S0GA 1ISXA 4LO3C 2I1BA 1FN0A 4F83A 1XHBA 4I0YA 1PUMB 2ZQNA 3H6QA 4LO0C 2D7RA 3OBTA 1FMZA 1PWAA 4QKRA 1WBAA 3EF2A 2Y9WC 5FZZA 4IY8A 5F8SA 6I1BA 4ISQA 2X2TA 1P63A 2GZBA 2J3PA 3RMYA 1OQLB 1G9AA 4QC4A 41BIA 1IRPA 1JT7A 1ISVA 4Q91A 3JRRA 1BLDA 1ITBA 5EG6C 2BFHA 1GGPB 3OBRA 3IIRA 5D62A 4JRAA 4Q9PA 5BP5A 1S0BA 2AQZA 3BB2A 2Y9FA 4D8HA 3OJ2A 4WBCA 1PUUB 3E8LC 4ZOTA 3V0AB 3V79C 8I1BA 3POKA 2KI4A 2P23A 1Z0HA 4OEEA 1FV3A 1Z4SA 3KMVA 4OEFA 4J2XA 1BARA 2HW9A 2KLLA 3FJHA 3NBCA 4G9MA 4I4QA 1EVTA 4J2SA 4EEEB 4J2KA 3BAGA 2D20A 4JP0A 4XKIA 3QYDA 2HZ9A 1AVUA 3FJEA 4HJJA 1EPWA 4QBVA 3BAHA 5BXPA 4HR6C 1YTOA 4USOA 2MIBA 1FV2A 2R9KB 4MZHA 4IHZA 1MC9A 4I3NA 1V6XA 2D7IA 4H75A 4I4RA 2KI6B 3K1XA 5FNWA 5D63A 3UDAA 3WO2A 2FFUA 3HN1A 2X2SA 2VXRA 1SZ6B 4I4SA 4OWLA 1BFFA 2HWAA 3BAVA 4LO2A 4IYBA 5FZUA 3LLPA 3PUBA 4P6AA 1JLXA 3UJ0A 4HA2A 1ILR1 2FDBM 4AN7B 3HSMA 4G6JA 4EFQA 1F31A 3A21A 4LO8B 3NBEA 4EFPA 3ZC9A 2BEBA 1WD4A 1HIBA 3O44A 2D22A 2L5XA 1HWMB 3RMXA 4DENA 2Z49A 3H6RB 1QQLA 1FMMS
chains in the Genus database with same CATH topology
2DREA 4A7YA 2K8RA 4LO1C 4MZFB 5EC5A 2Z48A 3O4BA 3MALA 4X38A 3AJ6A 4GAIA 5E24E 1G9DA 3O4CA 4IY9A 4J2YA 1IT0A 2GO2A 3O4AA 5F8YA 2WRYA 1FGAA 4Q9GA 3BRFA 1RMLA 1TOOA 3A23A 3TC2A 2KH2A 5DUYA 5BQUA 2NZ9A 3ZC8A 1FQ9A 1V6WA 3N7MA 1CE7B 2F2FA 3NBDA 4QD2B 4I4XA 2ESUA 3CA4A 3CRGA 3VSFA 2VUAA 2ERMA 4JPZA 4H04A 3CA3A 1PC8B 2RQ9A 3P6JA 2Y9XE 4IQPA 4OW4A 1IHKA 4I2SA 4I4OA 1M16A 2AXMA 2D23A 1E0OA 3FJAA 1TTUA 3RTIB 1G82A 1IILA 5G00A 3Q7XA 1JQZA 3FJDA 4KC3A 5JMCA 1AVXB 1VCLA 3N7KA 4FGFA 3PHZA 3NBNA 2YUGA 5BP5C 3AKIA 3AJ5A 1MD6A 3BA5A 1ISWA 2NYYA 21BIA 1FWUA 1NUNA 4XFSA 3I2XA 5DSSB 2DS0A 3CA6A 5F8WA 1NZKA 4I8MA 5DVHA 3VT1A 1DZDA 4XFUA 1YBIA 1TWEA 2FFVA 3CA0A 4YOLA 3RSJA 1IOBA 1SR4A 3BAQA 3IAGC 2KKIA 2NS2A 4QBCA 4IZXA 3BX1C 2UUSA 3RTJB 3BA7A 3FFZA 4I4PA 1FWVA 1A8DA 3CU1B 4GOVA 4QD2C 1BFBA 4OUJA 1S0FA 3UD7A 2VXTI 3UD9A 2Q9XA 3H6RA 3LTQA 1BFGA 3CRIA 4P0LA 1IJTA 1N4KA 4FVVA 4LO2C 1W3FA 1Q04A 2NVHA 2DRYA 3A07A 2D44A 4G9NA 3CA5A 1JTCA 1WBCA 1HCDA 2AFGA 2NTDA 3S8KA 5BOWA 4ZGRB 1Q1UA 4X37A 1DQOA 4OWJA 4Z9WB 1J0SA 3P6IA 1DLLA 3W9TA 1DFQA 2LIQA 1S0CA 4L4HA 1AVWB 2IHOA 3ZX7A 2NP0A 1ONKB 2NM1A 4I1EA 3WMVA 5BXRA 1HWNB 2ZQOA 3ILAA 2WBCA 3FJIA 4P0JA 3AH2A 3I2AA 4QKSA 2K4AB 5BQUC 1HCEA 4H9WA 3HBWA 1AFCA 4F34A 31BIA 3CRHA 1R8NA 3VWCA 3BAUA 1WD3A 4G6MA 4I4VA 4IONA 3BAOA 3D7WB 1RZOB 2MLLB 3P53A 4PC4A 1DJSB 1K5UA 1DQGA 3OJMA 4EKXB 1D0HA 1G9CA 3A22A 1W3GA 1JLYA 2AAIB 1S0LA 1BASA 5EHAA 3Q7WA 1TFMB 4TLPA 1PZZA 5B2HA 1XYFA 4A7ZA 4J23B 3BA4A 4GOYA 1CVSA 1IRAX 1XG6A 1KNMA 3VUOA 4R6UB 2QN4A 3AKFA 3VT0A 3WA1A 4MZGB 4JKQA 5BXSA 3FJBA 1S0EA 1T9FA 4CJMA 3BRDA 3HALA 3FJFA 4KEKA 3WO4A 2FGFA 1SR4C 4I96A 2D1ZA 3IM7A 5I1BA 3FJ9A 1V6UA 2BEAA 2M49A 4I4UA 3N0KA 4D0ZA 4KEJA 4ZFWB 2F8XC 4AN6A 4ZLBB 4ENDA 1G9BA 3FJJA 4OWKA 1YYNA 2XOAA 2E4MA 1HKNA 5JLVA 3SNVA 1AF9A 1RY7A 3UD8A 3WINA 1EYLA 1S0DA 3OGFA 3ZXGA 4ISRA 3QR5A 1EV2A 3VT2A 1TP0A 4GAFA 1I1EA 1ISYA 2ZR1B 3N7JA 2RG9B 2VSAA 5HPZA 3H6SE 1R8OA 3V0BB 1AXMA 1HWPB 3JUTA 3PG0A 4A7KA 4LO3A 4KBBA 3O4OA 2D43A 2FO1A 2HWMA 3S8JA 3BTAA 4GP0A 4LO0A 3FUQA 3AZVA 2Y9GA 4LO7B 5DZUA 3N7LA 3FUOA 5GAQA 2MC2A 1JY0A 2RSTA 3AKHA 3UJ4A 4JQ0A 4EFRA 3ZXDA 4P0KA 1II4A 4ZBVB 5FZYA 4KEIA 4I1BA 1YF8B 4JAWA 4ZKTB 1W3AA 1TWMA 1DFCA 3PMEA 1YXWA 3CQAA 4XFTA 3R4UA 3WMUA 4D0TA 3BADA 3HMYA 4I7IA 1UPSA 3FJCA 3O5WB 4QALA 1ISZA 2QYIB 2ET2A 2F2FC 4ZFYB 1DIWA 5FNXA 4GP3A 5F90A 4X39A 4EB2B 7I1BA 3B9UA 4QO3A 1BFCA 3O49A 3FJKA 1L2HA 1TIEA 1ABRB 3O4DA 3FGMA 4II0A 1Z2VA 3BRGC 1T4QA 2LIEA 2VLCA 3HOMA 3I29B 3MPPG 5BXTA 1V6VA 1JT3A 1XZZA 3T8SA 3CA1A 9ILBA 4I4YA 3F62B 1QQKA 3R4SA 4DCKC 1RG8A 3CAHA 2IWTB 3AKGA 3OJVA 1HWOB 4LO7C 1Q03A 2K43A 4DEPA 4IZEA 2Q3NB 1JT5A 3VEQA 1BLAA 2E4MC 4G1RA 2DRZA 1QXMA 1AVAC 4OEGA 1BA7A 1K5VA 3F1RA 4I37A 3WINC 2VSEA 4ZA3B 3OGGA 3V0BA 5BVPI 1DZCA 4ZFUB 4I6IA 4Z8SB 3VSZA 3AZWA 3Q7YA 3C9ZA 4JKXB 3NJ5A 3IM5A 4L4IA 4UY4A 4X3AA 3FJ8A 1I1BA 4LO1A 1JT4A 3O3QA 3V0AA 3IM6A 2D24A 2P39A 3AH4A 3WO3A 1M2TB 2VU9A 5D61A 3AH1A 4USPA 1S0GA 1ISXA 4LO3C 2I1BA 1FN0A 4F83A 1XHBA 4I0YA 1PUMB 2ZQNA 3H6QA 4LO0C 2D7RA 3OBTA 1FMZA 1PWAA 4QKRA 1WBAA 3EF2A 2Y9WC 5FZZA 4IY8A 5F8SA 6I1BA 4ISQA 2X2TA 1P63A 2GZBA 2J3PA 3RMYA 1OQLB 1G9AA 4QC4A 41BIA 1IRPA 1JT7A 1ISVA 4Q91A 3JRRA 1BLDA 1ITBA 5EG6C 2BFHA 1GGPB 3OBRA 3IIRA 5D62A 4JRAA 4Q9PA 5BP5A 1S0BA 2AQZA 3BB2A 2Y9FA 4D8HA 3OJ2A 4WBCA 1PUUB 3E8LC 4ZOTA 3V0AB 3V79C 8I1BA 3POKA 2KI4A 2P23A 1Z0HA 4OEEA 1FV3A 1Z4SA 3KMVA 4OEFA 4J2XA 1BARA 2HW9A 2KLLA 3FJHA 3NBCA 4G9MA 4I4QA 1EVTA 4J2SA 4EEEB 4J2KA 3BAGA 2D20A 4JP0A 4XKIA 3QYDA 2HZ9A 1AVUA 3FJEA 4HJJA 1EPWA 4QBVA 3BAHA 5BXPA 4HR6C 1YTOA 4USOA 2MIBA 1FV2A 2R9KB 4MZHA 4IHZA 1MC9A 4I3NA 1V6XA 2D7IA 4H75A 4I4RA 2KI6B 3K1XA 5FNWA 5D63A 3UDAA 3WO2A 2FFUA 3HN1A 2X2SA 2VXRA 1SZ6B 4I4SA 4OWLA 1BFFA 2HWAA 3BAVA 4LO2A 4IYBA 5FZUA 3LLPA 3PUBA 4P6AA 1JLXA 3UJ0A 4HA2A 1ILR1 2FDBM 4AN7B 3HSMA 4G6JA 4EFQA 1F31A 3A21A 4LO8B 3NBEA 4EFPA 3ZC9A 2BEBA 1WD4A 1HIBA 3O44A 2D22A 2L5XA 1HWMB 3RMXA 4DENA 2Z49A 3H6RB 1QQLA 1FMMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRE A;  4A7Y A;  2K8R A;  4LO1 C;  5EC5 A;  2Z48 A;  3O4B A;  3MAL A;  4X38 A;  3AJ6 A;  4GAI A;  5E24 E;  1G9D A;  3O4C A;  4IY9 A;  4J2Y A;  1IT0 A;  2GO2 A;  3O4A A;  5F8Y A;  2WRY A;  1FGA A;  4Q9G A;  3BRF A;  1RML A;  1TOO A;  3A23 A;  3TC2 A;  2KH2 A;  5DUY A;  5BQU A;  2NZ9 A;  3ZC8 A;  1FQ9 A;  1V6W A;  3N7M A;  1CE7 B;  2F2F A;  3NBD A;  4QD2 B;  4I4X A;  2ESU A;  3CA4 A;  3CRG A;  3VSF A;  2VUA A;  2ERM A;  4JPZ A;  4H04 A;  3CA3 A;  1PC8 B;  2RQ9 A;  3P6J A;  2Y9X E;  4IQP A;  4OW4 A;  1IHK A;  4I2S A;  4I4O A;  1M16 A;  2AXM A;  2D23 A;  1E0O A;  3FJA A;  1TTU A;  3RTI B;  1G82 A;  1IIL A;  5G00 A;  3Q7X A;  1JQZ A;  3FJD A;  4KC3 A;  5JMC A;  1AVX B;  1VCL A;  3N7K A;  4FGF A;  3PHZ A;  3NBN A;  2YUG A;  5BP5 C;  3AKI A;  3AJ5 A;  1MD6 A;  3BA5 A;  1ISW A;  2NYY A;  21BI A;  1FWU A;  1NUN A;  4XFS A;  3I2X A;  5DSS B;  2DS0 A;  3CA6 A;  5F8W A;  1NZK A;  4I8M A;  5DVH A;  3VT1 A;  1DZD A;  4XFU A;  1YBI A;  1TWE A;  2FFV A;  3CA0 A;  4YOL A;  3RSJ A;  1IOB A;  1SR4 A;  3BAQ A;  3IAG C;  2KKI A;  4QBC A;  4IZX A;  3BX1 C;  2UUS A;  3RTJ B;  3BA7 A;  3FFZ A;  4I4P A;  1FWV A;  1A8D A;  3CU1 B;  4GOV A;  4QD2 C;  1BFB A;  4OUJ A;  1S0F A;  3UD7 A;  2VXT I;  3UD9 A;  2Q9X A;  3H6R A;  3LTQ A;  1BFG A;  3CRI A;  4P0L A;  1IJT A;  1N4K A;  4FVV A;  4LO2 C;  1W3F A;  1Q04 A;  2NVH A;  2DRY A;  3A07 A;  2D44 A;  4G9N A;  3CA5 A;  1JTC A;  1WBC A;  1HCD A;  2AFG A;  2NTD A;  3S8K A;  5BOW A;  4ZGR B;  1Q1U A;  4X37 A;  1DQO A;  4OWJ A;  4Z9W B;  1J0S A;  3P6I A;  1DLL A;  3W9T A;  1DFQ A;  2LIQ A;  1S0C A;  4L4H A;  1AVW B;  2IHO A;  3ZX7 A;  2NP0 A;  1ONK B;  2NM1 A;  4I1E A;  3WMV A;  5BXR A;  1HWN B;  2ZQO A;  3ILA A;  2WBC A;  3FJI A;  4P0J A;  3AH2 A;  3I2A A;  4QKS A;  2K4A B;  5BQU C;  1HCE A;  4H9W A;  3HBW A;  1AFC A;  4F34 A;  31BI A;  3CRH A;  1R8N A;  3VWC A;  3BAU A;  1WD3 A;  4G6M A;  4I4V A;  4ION A;  3BAO A;  3D7W B;  1RZO B;  2MLL B;  3P53 A;  4PC4 A;  1DJS B;  1K5U A;  1DQG A;  3OJM A;  4EKX B;  1D0H A;  1G9C A;  3A22 A;  1W3G A;  1JLY A;  2AAI B;  1S0L A;  1BAS A;  5EHA A;  3Q7W A;  1TFM B;  4TLP A;  1PZZ A;  5B2H A;  1XYF A;  4A7Z A;  4J23 B;  3BA4 A;  4GOY A;  1CVS A;  1IRA X;  1XG6 A;  1KNM A;  3VUO A;  4R6U B;  2QN4 A;  3AKF A;  3VT0 A;  3WA1 A;  4JKQ A;  5BXS A;  3FJB A;  1S0E A;  1T9F A;  4CJM A;  3BRD A;  3HAL A;  3FJF A;  4KEK A;  3WO4 A;  2FGF A;  1SR4 C;  4I96 A;  2D1Z A;  3IM7 A;  5I1B A;  3FJ9 A;  1V6U A;  2BEA A;  2M49 A;  4I4U A;  3N0K A;  4D0Z A;  4KEJ A;  4ZFW B;  2F8X C;  4AN6 A;  4ZLB B;  4END A;  1G9B A;  3FJJ A;  4OWK A;  1YYN A;  2XOA A;  2E4M A;  1HKN A;  5JLV A;  3SNV A;  1AF9 A;  1RY7 A;  3UD8 A;  3WIN A;  1EYL A;  1S0D A;  3OGF A;  3ZXG A;  4ISR A;  3QR5 A;  1EV2 A;  3VT2 A;  1TP0 A;  4GAF A;  1I1E A;  1ISY A;  2ZR1 B;  3N7J A;  2RG9 B;  2VSA A;  5HPZ A;  3H6S E;  1R8O A;  3V0B B;  1AXM A;  1HWP B;  3JUT A;  3PG0 A;  4A7K A;  4LO3 A;  4KBB A;  3O4O A;  2D43 A;  2FO1 A;  2HWM A;  3S8J A;  3BTA A;  4GP0 A;  4LO0 A;  3FUQ A;  3AZV A;  2Y9G A;  4LO7 B;  5DZU A;  3N7L A;  3FUO A;  5GAQ A;  2MC2 A;  1JY0 A;  2RST A;  3AKH A;  3UJ4 A;  4JQ0 A;  4EFR A;  3ZXD A;  4P0K A;  1II4 A;  4ZBV B;  5FZY A;  4KEI A;  4I1B A;  1YF8 B;  4JAW A;  4ZKT B;  1W3A A;  1TWM A;  1DFC A;  3PME A;  1YXW A;  3CQA A;  4XFT A;  3R4U A;  3WMU A;  4D0T A;  3BAD A;  3HMY A;  4I7I A;  1UPS A;  3FJC A;  3O5W B;  4QAL A;  1ISZ A;  2QYI B;  2ET2 A;  2F2F C;  4ZFY B;  1DIW A;  5FNX A;  4GP3 A;  5F90 A;  4X39 A;  4EB2 B;  7I1B A;  3B9U A;  4QO3 A;  1BFC A;  3O49 A;  3FJK A;  1L2H A;  1TIE A;  1ABR B;  3O4D A;  3FGM A;  4II0 A;  1Z2V A;  3BRG C;  1T4Q A;  2LIE A;  2VLC A;  3HOM A;  3I29 B;  3MPP G;  5BXT A;  1V6V A;  1JT3 A;  1XZZ A;  3T8S A;  3CA1 A;  9ILB A;  4I4Y A;  3F62 B;  1QQK A;  3R4S A;  4DCK C;  1RG8 A;  3CAH A;  2IWT B;  3AKG A;  3OJV A;  1HWO B;  4LO7 C;  1Q03 A;  2K43 A;  4DEP A;  4IZE A;  2Q3N B;  1JT5 A;  3VEQ A;  1BLA A;  2E4M C;  4G1R A;  2DRZ A;  1QXM A;  1AVA C;  4OEG A;  1BA7 A;  1K5V A;  3F1R A;  4I37 A;  3WIN C;  2VSE A;  4ZA3 B;  3OGG A;  3V0B A;  5BVP I;  1DZC A;  4ZFU B;  4I6I A;  4Z8S B;  3VSZ A;  3AZW A;  3Q7Y A;  3C9Z A;  4JKX B;  3NJ5 A;  3IM5 A;  4L4I A;  4X3A A;  3FJ8 A;  1I1B A;  4LO1 A;  1JT4 A;  3O3Q A;  3V0A A;  3IM6 A;  2D24 A;  2P39 A;  3AH4 A;  3WO3 A;  1M2T B;  2VU9 A;  5D61 A;  3AH1 A;  4USP A;  1S0G A;  1ISX A;  4LO3 C;  2I1B A;  1FN0 A;  4F83 A;  1XHB A;  4I0Y A;  1PUM B;  2ZQN A;  3H6Q A;  4LO0 C;  2D7R A;  3OBT A;  1FMZ A;  1PWA A;  4QKR A;  1WBA A;  3EF2 A;  2Y9W C;  5FZZ A;  4IY8 A;  5F8S A;  6I1B A;  4ISQ A;  2X2T A;  1P63 A;  2GZB A;  2J3P A;  3RMY A;  1OQL B;  1G9A A;  4QC4 A;  41BI A;  1IRP A;  1JT7 A;  1ISV A;  4Q91 A;  3JRR A;  1BLD A;  1ITB A;  5EG6 C;  2BFH A;  1GGP B;  3OBR A;  3IIR A;  5D62 A;  4JRA A;  4Q9P A;  5BP5 A;  1S0B A;  2AQZ A;  3BB2 A;  2Y9F A;  4D8H A;  3OJ2 A;  4WBC A;  1PUU B;  3E8L C;  4ZOT A;  3V0A B;  3V79 C;  8I1B A;  3POK A;  2KI4 A;  2P23 A;  1Z0H A;  4OEE A;  1FV3 A;  1Z4S A;  3KMV A;  4OEF A;  4J2X A;  1BAR A;  2HW9 A;  2KLL A;  3FJH A;  3NBC A;  4G9M A;  4I4Q A;  1EVT A;  4J2S A;  4EEE B;  4J2K A;  3BAG A;  2D20 A;  4JP0 A;  4XKI A;  3QYD A;  2HZ9 A;  1AVU A;  3FJE A;  4HJJ A;  1EPW A;  4QBV A;  3BAH A;  5BXP A;  4HR6 C;  1YTO A;  4USO A;  2MIB A;  1FV2 A;  2R9K B;  4IHZ A;  1MC9 A;  4I3N A;  1V6X A;  2D7I A;  4I4R A;  2KI6 B;  3K1X A;  5FNW A;  5D63 A;  3UDA A;  3WO2 A;  2FFU A;  3HN1 A;  2X2S A;  2VXR A;  1SZ6 B;  4I4S A;  4OWL A;  1BFF A;  2HWA A;  3BAV A;  4LO2 A;  4IYB A;  5FZU A;  3LLP A;  3PUB A;  4P6A A;  1JLX A;  3UJ0 A;  4HA2 A;  1ILR 1;  2FDB M;  4AN7 B;  3HSM A;  4G6J A;  4EFQ A;  1F31 A;  3A21 A;  4LO8 B;  3NBE A;  4EFP A;  3ZC9 A;  2BEB A;  1WD4 A;  1HIB A;  3O44 A;  2D22 A;  2L5X A;  1HWM B;  3RMX A;  4DEN A;  2Z49 A;  3H6R B;  1QQL A;  1FMM S; 
#chains in the Genus database with same CATH topology
 2DRE A;  4A7Y A;  2K8R A;  4LO1 C;  4MZF B;  5EC5 A;  2Z48 A;  3O4B A;  3MAL A;  4X38 A;  3AJ6 A;  4GAI A;  5E24 E;  1G9D A;  3O4C A;  4IY9 A;  4J2Y A;  1IT0 A;  2GO2 A;  3O4A A;  5F8Y A;  2WRY A;  1FGA A;  4Q9G A;  3BRF A;  1RML A;  1TOO A;  3A23 A;  3TC2 A;  2KH2 A;  5DUY A;  5BQU A;  2NZ9 A;  3ZC8 A;  1FQ9 A;  1V6W A;  3N7M A;  1CE7 B;  2F2F A;  3NBD A;  4QD2 B;  4I4X A;  2ESU A;  3CA4 A;  3CRG A;  3VSF A;  2VUA A;  2ERM A;  4JPZ A;  4H04 A;  3CA3 A;  1PC8 B;  2RQ9 A;  3P6J A;  2Y9X E;  4IQP A;  4OW4 A;  1IHK A;  4I2S A;  4I4O A;  1M16 A;  2AXM A;  2D23 A;  1E0O A;  3FJA A;  1TTU A;  3RTI B;  1G82 A;  1IIL A;  5G00 A;  3Q7X A;  1JQZ A;  3FJD A;  4KC3 A;  5JMC A;  1AVX B;  1VCL A;  3N7K A;  4FGF A;  3PHZ A;  3NBN A;  2YUG A;  5BP5 C;  3AKI A;  3AJ5 A;  1MD6 A;  3BA5 A;  1ISW A;  2NYY A;  21BI A;  1FWU A;  1NUN A;  4XFS A;  3I2X A;  5DSS B;  2DS0 A;  3CA6 A;  5F8W A;  1NZK A;  4I8M A;  5DVH A;  3VT1 A;  1DZD A;  4XFU A;  1YBI A;  1TWE A;  2FFV A;  3CA0 A;  4YOL A;  3RSJ A;  1IOB A;  1SR4 A;  3BAQ A;  3IAG C;  2KKI A;  2NS2 A;  4QBC A;  4IZX A;  3BX1 C;  2UUS A;  3RTJ B;  3BA7 A;  3FFZ A;  4I4P A;  1FWV A;  1A8D A;  3CU1 B;  4GOV A;  4QD2 C;  1BFB A;  4OUJ A;  1S0F A;  3UD7 A;  2VXT I;  3UD9 A;  2Q9X A;  3H6R A;  3LTQ A;  1BFG A;  3CRI A;  4P0L A;  1IJT A;  1N4K A;  4FVV A;  4LO2 C;  1W3F A;  1Q04 A;  2NVH A;  2DRY A;  3A07 A;  2D44 A;  4G9N A;  3CA5 A;  1JTC A;  1WBC A;  1HCD A;  2AFG A;  2NTD A;  3S8K A;  5BOW A;  4ZGR B;  1Q1U A;  4X37 A;  1DQO A;  4OWJ A;  4Z9W B;  1J0S A;  3P6I A;  1DLL A;  3W9T A;  1DFQ A;  2LIQ A;  1S0C A;  4L4H A;  1AVW B;  2IHO A;  3ZX7 A;  2NP0 A;  1ONK B;  2NM1 A;  4I1E A;  3WMV A;  5BXR A;  1HWN B;  2ZQO A;  3ILA A;  2WBC A;  3FJI A;  4P0J A;  3AH2 A;  3I2A A;  4QKS A;  2K4A B;  5BQU C;  1HCE A;  4H9W A;  3HBW A;  1AFC A;  4F34 A;  31BI A;  3CRH A;  1R8N A;  3VWC A;  3BAU A;  1WD3 A;  4G6M A;  4I4V A;  4ION A;  3BAO A;  3D7W B;  1RZO B;  2MLL B;  3P53 A;  4PC4 A;  1DJS B;  1K5U A;  1DQG A;  3OJM A;  4EKX B;  1D0H A;  1G9C A;  3A22 A;  1W3G A;  1JLY A;  2AAI B;  1S0L A;  1BAS A;  5EHA A;  3Q7W A;  1TFM B;  4TLP A;  1PZZ A;  5B2H A;  1XYF A;  4A7Z A;  4J23 B;  3BA4 A;  4GOY A;  1CVS A;  1IRA X;  1XG6 A;  1KNM A;  3VUO A;  4R6U B;  2QN4 A;  3AKF A;  3VT0 A;  3WA1 A;  4MZG B;  4JKQ A;  5BXS A;  3FJB A;  1S0E A;  1T9F A;  4CJM A;  3BRD A;  3HAL A;  3FJF A;  4KEK A;  3WO4 A;  2FGF A;  1SR4 C;  4I96 A;  2D1Z A;  3IM7 A;  5I1B A;  3FJ9 A;  1V6U A;  2BEA A;  2M49 A;  4I4U A;  3N0K A;  4D0Z A;  4KEJ A;  4ZFW B;  2F8X C;  4AN6 A;  4ZLB B;  4END A;  1G9B A;  3FJJ A;  4OWK A;  1YYN A;  2XOA A;  2E4M A;  1HKN A;  5JLV A;  3SNV A;  1AF9 A;  1RY7 A;  3UD8 A;  3WIN A;  1EYL A;  1S0D A;  3OGF A;  3ZXG A;  4ISR A;  3QR5 A;  1EV2 A;  3VT2 A;  1TP0 A;  4GAF A;  1I1E A;  1ISY A;  2ZR1 B;  3N7J A;  2RG9 B;  2VSA A;  5HPZ A;  3H6S E;  1R8O A;  3V0B B;  1AXM A;  1HWP B;  3JUT A;  3PG0 A;  4A7K A;  4LO3 A;  4KBB A;  3O4O A;  2D43 A;  2FO1 A;  2HWM A;  3S8J A;  3BTA A;  4GP0 A;  4LO0 A;  3FUQ A;  3AZV A;  2Y9G A;  4LO7 B;  5DZU A;  3N7L A;  3FUO A;  5GAQ A;  2MC2 A;  1JY0 A;  2RST A;  3AKH A;  3UJ4 A;  4JQ0 A;  4EFR A;  3ZXD A;  4P0K A;  1II4 A;  4ZBV B;  5FZY A;  4KEI A;  4I1B A;  1YF8 B;  4JAW A;  4ZKT B;  1W3A A;  1TWM A;  1DFC A;  3PME A;  1YXW A;  3CQA A;  4XFT A;  3R4U A;  3WMU A;  4D0T A;  3BAD A;  3HMY A;  4I7I A;  1UPS A;  3FJC A;  3O5W B;  4QAL A;  1ISZ A;  2QYI B;  2ET2 A;  2F2F C;  4ZFY B;  1DIW A;  5FNX A;  4GP3 A;  5F90 A;  4X39 A;  4EB2 B;  7I1B A;  3B9U A;  4QO3 A;  1BFC A;  3O49 A;  3FJK A;  1L2H A;  1TIE A;  1ABR B;  3O4D A;  3FGM A;  4II0 A;  1Z2V A;  3BRG C;  1T4Q A;  2LIE A;  2VLC A;  3HOM A;  3I29 B;  3MPP G;  5BXT A;  1V6V A;  1JT3 A;  1XZZ A;  3T8S A;  3CA1 A;  9ILB A;  4I4Y A;  3F62 B;  1QQK A;  3R4S A;  4DCK C;  1RG8 A;  3CAH A;  2IWT B;  3AKG A;  3OJV A;  1HWO B;  4LO7 C;  1Q03 A;  2K43 A;  4DEP A;  4IZE A;  2Q3N B;  1JT5 A;  3VEQ A;  1BLA A;  2E4M C;  4G1R A;  2DRZ A;  1QXM A;  1AVA C;  4OEG A;  1BA7 A;  1K5V A;  3F1R A;  4I37 A;  3WIN C;  2VSE A;  4ZA3 B;  3OGG A;  3V0B A;  5BVP I;  1DZC A;  4ZFU B;  4I6I A;  4Z8S B;  3VSZ A;  3AZW A;  3Q7Y A;  3C9Z A;  4JKX B;  3NJ5 A;  3IM5 A;  4L4I A;  4UY4 A;  4X3A A;  3FJ8 A;  1I1B A;  4LO1 A;  1JT4 A;  3O3Q A;  3V0A A;  3IM6 A;  2D24 A;  2P39 A;  3AH4 A;  3WO3 A;  1M2T B;  2VU9 A;  5D61 A;  3AH1 A;  4USP A;  1S0G A;  1ISX A;  4LO3 C;  2I1B A;  1FN0 A;  4F83 A;  1XHB A;  4I0Y A;  1PUM B;  2ZQN A;  3H6Q A;  4LO0 C;  2D7R A;  3OBT A;  1FMZ A;  1PWA A;  4QKR A;  1WBA A;  3EF2 A;  2Y9W C;  5FZZ A;  4IY8 A;  5F8S A;  6I1B A;  4ISQ A;  2X2T A;  1P63 A;  2GZB A;  2J3P A;  3RMY A;  1OQL B;  1G9A A;  4QC4 A;  41BI A;  1IRP A;  1JT7 A;  1ISV A;  4Q91 A;  3JRR A;  1BLD A;  1ITB A;  5EG6 C;  2BFH A;  1GGP B;  3OBR A;  3IIR A;  5D62 A;  4JRA A;  4Q9P A;  5BP5 A;  1S0B A;  2AQZ A;  3BB2 A;  2Y9F A;  4D8H A;  3OJ2 A;  4WBC A;  1PUU B;  3E8L C;  4ZOT A;  3V0A B;  3V79 C;  8I1B A;  3POK A;  2KI4 A;  2P23 A;  1Z0H A;  4OEE A;  1FV3 A;  1Z4S A;  3KMV A;  4OEF A;  4J2X A;  1BAR A;  2HW9 A;  2KLL A;  3FJH A;  3NBC A;  4G9M A;  4I4Q A;  1EVT A;  4J2S A;  4EEE B;  4J2K A;  3BAG A;  2D20 A;  4JP0 A;  4XKI A;  3QYD A;  2HZ9 A;  1AVU A;  3FJE A;  4HJJ A;  1EPW A;  4QBV A;  3BAH A;  5BXP A;  4HR6 C;  1YTO A;  4USO A;  2MIB A;  1FV2 A;  2R9K B;  4MZH A;  4IHZ A;  1MC9 A;  4I3N A;  1V6X A;  2D7I A;  4H75 A;  4I4R A;  2KI6 B;  3K1X A;  5FNW A;  5D63 A;  3UDA A;  3WO2 A;  2FFU A;  3HN1 A;  2X2S A;  2VXR A;  1SZ6 B;  4I4S A;  4OWL A;  1BFF A;  2HWA A;  3BAV A;  4LO2 A;  4IYB A;  5FZU A;  3LLP A;  3PUB A;  4P6A A;  1JLX A;  3UJ0 A;  4HA2 A;  1ILR 1;  2FDB M;  4AN7 B;  3HSM A;  4G6J A;  4EFQ A;  1F31 A;  3A21 A;  4LO8 B;  3NBE A;  4EFP A;  3ZC9 A;  2BEB A;  1WD4 A;  1HIB A;  3O44 A;  2D22 A;  2L5X A;  1HWM B;  3RMX A;  4DEN A;  2Z49 A;  3H6R B;  1QQL A;  1FMM S; 
#chains in the Genus database with same CATH homology
 2DRE A;  4A7Y A;  2K8R A;  4LO1 C;  4MZF B;  5EC5 A;  2Z48 A;  3O4B A;  3MAL A;  4X38 A;  3AJ6 A;  4GAI A;  5E24 E;  1G9D A;  3O4C A;  4IY9 A;  4J2Y A;  1IT0 A;  2GO2 A;  3O4A A;  5F8Y A;  2WRY A;  1FGA A;  4Q9G A;  3BRF A;  1RML A;  1TOO A;  3A23 A;  3TC2 A;  2KH2 A;  5DUY A;  5BQU A;  2NZ9 A;  3ZC8 A;  1FQ9 A;  1V6W A;  3N7M A;  1CE7 B;  2F2F A;  3NBD A;  4QD2 B;  4I4X A;  2ESU A;  3CA4 A;  3CRG A;  3VSF A;  2VUA A;  2ERM A;  4JPZ A;  4H04 A;  3CA3 A;  1PC8 B;  2RQ9 A;  3P6J A;  2Y9X E;  4IQP A;  4OW4 A;  1IHK A;  4I2S A;  4I4O A;  1M16 A;  2AXM A;  2D23 A;  1E0O A;  3FJA A;  1TTU A;  3RTI B;  1G82 A;  1IIL A;  5G00 A;  3Q7X A;  1JQZ A;  3FJD A;  4KC3 A;  5JMC A;  1AVX B;  1VCL A;  3N7K A;  4FGF A;  3PHZ A;  3NBN A;  2YUG A;  5BP5 C;  3AKI A;  3AJ5 A;  1MD6 A;  3BA5 A;  1ISW A;  2NYY A;  21BI A;  1FWU A;  1NUN A;  4XFS A;  3I2X A;  5DSS B;  2DS0 A;  3CA6 A;  5F8W A;  1NZK A;  4I8M A;  5DVH A;  3VT1 A;  1DZD A;  4XFU A;  1YBI A;  1TWE A;  2FFV A;  3CA0 A;  4YOL A;  3RSJ A;  1IOB A;  1SR4 A;  3BAQ A;  3IAG C;  2KKI A;  2NS2 A;  4QBC A;  4IZX A;  3BX1 C;  2UUS A;  3RTJ B;  3BA7 A;  3FFZ A;  4I4P A;  1FWV A;  1A8D A;  3CU1 B;  4GOV A;  4QD2 C;  1BFB A;  4OUJ A;  1S0F A;  3UD7 A;  2VXT I;  3UD9 A;  2Q9X A;  3H6R A;  3LTQ A;  1BFG A;  3CRI A;  4P0L A;  1IJT A;  1N4K A;  4FVV A;  4LO2 C;  1W3F A;  1Q04 A;  2NVH A;  2DRY A;  3A07 A;  2D44 A;  4G9N A;  3CA5 A;  1JTC A;  1WBC A;  1HCD A;  2AFG A;  2NTD A;  3S8K A;  5BOW A;  4ZGR B;  1Q1U A;  4X37 A;  1DQO A;  4OWJ A;  4Z9W B;  1J0S A;  3P6I A;  1DLL A;  3W9T A;  1DFQ A;  2LIQ A;  1S0C A;  4L4H A;  1AVW B;  2IHO A;  3ZX7 A;  2NP0 A;  1ONK B;  2NM1 A;  4I1E A;  3WMV A;  5BXR A;  1HWN B;  2ZQO A;  3ILA A;  2WBC A;  3FJI A;  4P0J A;  3AH2 A;  3I2A A;  4QKS A;  2K4A B;  5BQU C;  1HCE A;  4H9W A;  3HBW A;  1AFC A;  4F34 A;  31BI A;  3CRH A;  1R8N A;  3VWC A;  3BAU A;  1WD3 A;  4G6M A;  4I4V A;  4ION A;  3BAO A;  3D7W B;  1RZO B;  2MLL B;  3P53 A;  4PC4 A;  1DJS B;  1K5U A;  1DQG A;  3OJM A;  4EKX B;  1D0H A;  1G9C A;  3A22 A;  1W3G A;  1JLY A;  2AAI B;  1S0L A;  1BAS A;  5EHA A;  3Q7W A;  1TFM B;  4TLP A;  1PZZ A;  5B2H A;  1XYF A;  4A7Z A;  4J23 B;  3BA4 A;  4GOY A;  1CVS A;  1IRA X;  1XG6 A;  1KNM A;  3VUO A;  4R6U B;  2QN4 A;  3AKF A;  3VT0 A;  3WA1 A;  4MZG B;  4JKQ A;  5BXS A;  3FJB A;  1S0E A;  1T9F A;  4CJM A;  3BRD A;  3HAL A;  3FJF A;  4KEK A;  3WO4 A;  2FGF A;  1SR4 C;  4I96 A;  2D1Z A;  3IM7 A;  5I1B A;  3FJ9 A;  1V6U A;  2BEA A;  2M49 A;  4I4U A;  3N0K A;  4D0Z A;  4KEJ A;  4ZFW B;  2F8X C;  4AN6 A;  4ZLB B;  4END A;  1G9B A;  3FJJ A;  4OWK A;  1YYN A;  2XOA A;  2E4M A;  1HKN A;  5JLV A;  3SNV A;  1AF9 A;  1RY7 A;  3UD8 A;  3WIN A;  1EYL A;  1S0D A;  3OGF A;  3ZXG A;  4ISR A;  3QR5 A;  1EV2 A;  3VT2 A;  1TP0 A;  4GAF A;  1I1E A;  1ISY A;  2ZR1 B;  3N7J A;  2RG9 B;  2VSA A;  5HPZ A;  3H6S E;  1R8O A;  3V0B B;  1AXM A;  1HWP B;  3JUT A;  3PG0 A;  4A7K A;  4LO3 A;  4KBB A;  3O4O A;  2D43 A;  2FO1 A;  2HWM A;  3S8J A;  3BTA A;  4GP0 A;  4LO0 A;  3FUQ A;  3AZV A;  2Y9G A;  4LO7 B;  5DZU A;  3N7L A;  3FUO A;  5GAQ A;  2MC2 A;  1JY0 A;  2RST A;  3AKH A;  3UJ4 A;  4JQ0 A;  4EFR A;  3ZXD A;  4P0K A;  1II4 A;  4ZBV B;  5FZY A;  4KEI A;  4I1B A;  1YF8 B;  4JAW A;  4ZKT B;  1W3A A;  1TWM A;  1DFC A;  3PME A;  1YXW A;  3CQA A;  4XFT A;  3R4U A;  3WMU A;  4D0T A;  3BAD A;  3HMY A;  4I7I A;  1UPS A;  3FJC A;  3O5W B;  4QAL A;  1ISZ A;  2QYI B;  2ET2 A;  2F2F C;  4ZFY B;  1DIW A;  5FNX A;  4GP3 A;  5F90 A;  4X39 A;  4EB2 B;  7I1B A;  3B9U A;  4QO3 A;  1BFC A;  3O49 A;  3FJK A;  1L2H A;  1TIE A;  1ABR B;  3O4D A;  3FGM A;  4II0 A;  1Z2V A;  3BRG C;  1T4Q A;  2LIE A;  2VLC A;  3HOM A;  3I29 B;  3MPP G;  5BXT A;  1V6V A;  1JT3 A;  1XZZ A;  3T8S A;  3CA1 A;  9ILB A;  4I4Y A;  3F62 B;  1QQK A;  3R4S A;  4DCK C;  1RG8 A;  3CAH A;  2IWT B;  3AKG A;  3OJV A;  1HWO B;  4LO7 C;  1Q03 A;  2K43 A;  4DEP A;  4IZE A;  2Q3N B;  1JT5 A;  3VEQ A;  1BLA A;  2E4M C;  4G1R A;  2DRZ A;  1QXM A;  1AVA C;  4OEG A;  1BA7 A;  1K5V A;  3F1R A;  4I37 A;  3WIN C;  2VSE A;  4ZA3 B;  3OGG A;  3V0B A;  5BVP I;  1DZC A;  4ZFU B;  4I6I A;  4Z8S B;  3VSZ A;  3AZW A;  3Q7Y A;  3C9Z A;  4JKX B;  3NJ5 A;  3IM5 A;  4L4I A;  4UY4 A;  4X3A A;  3FJ8 A;  1I1B A;  4LO1 A;  1JT4 A;  3O3Q A;  3V0A A;  3IM6 A;  2D24 A;  2P39 A;  3AH4 A;  3WO3 A;  1M2T B;  2VU9 A;  5D61 A;  3AH1 A;  4USP A;  1S0G A;  1ISX A;  4LO3 C;  2I1B A;  1FN0 A;  4F83 A;  1XHB A;  4I0Y A;  1PUM B;  2ZQN A;  3H6Q A;  4LO0 C;  2D7R A;  3OBT A;  1FMZ A;  1PWA A;  4QKR A;  1WBA A;  3EF2 A;  2Y9W C;  5FZZ A;  4IY8 A;  5F8S A;  6I1B A;  4ISQ A;  2X2T A;  1P63 A;  2GZB A;  2J3P A;  3RMY A;  1OQL B;  1G9A A;  4QC4 A;  41BI A;  1IRP A;  1JT7 A;  1ISV A;  4Q91 A;  3JRR A;  1BLD A;  1ITB A;  5EG6 C;  2BFH A;  1GGP B;  3OBR A;  3IIR A;  5D62 A;  4JRA A;  4Q9P A;  5BP5 A;  1S0B A;  2AQZ A;  3BB2 A;  2Y9F A;  4D8H A;  3OJ2 A;  4WBC A;  1PUU B;  3E8L C;  4ZOT A;  3V0A B;  3V79 C;  8I1B A;  3POK A;  2KI4 A;  2P23 A;  1Z0H A;  4OEE A;  1FV3 A;  1Z4S A;  3KMV A;  4OEF A;  4J2X A;  1BAR A;  2HW9 A;  2KLL A;  3FJH A;  3NBC A;  4G9M A;  4I4Q A;  1EVT A;  4J2S A;  4EEE B;  4J2K A;  3BAG A;  2D20 A;  4JP0 A;  4XKI A;  3QYD A;  2HZ9 A;  1AVU A;  3FJE A;  4HJJ A;  1EPW A;  4QBV A;  3BAH A;  5BXP A;  4HR6 C;  1YTO A;  4USO A;  2MIB A;  1FV2 A;  2R9K B;  4MZH A;  4IHZ A;  1MC9 A;  4I3N A;  1V6X A;  2D7I A;  4H75 A;  4I4R A;  2KI6 B;  3K1X A;  5FNW A;  5D63 A;  3UDA A;  3WO2 A;  2FFU A;  3HN1 A;  2X2S A;  2VXR A;  1SZ6 B;  4I4S A;  4OWL A;  1BFF A;  2HWA A;  3BAV A;  4LO2 A;  4IYB A;  5FZU A;  3LLP A;  3PUB A;  4P6A A;  1JLX A;  3UJ0 A;  4HA2 A;  1ILR 1;  2FDB M;  4AN7 B;  3HSM A;  4G6J A;  4EFQ A;  1F31 A;  3A21 A;  4LO8 B;  3NBE A;  4EFP A;  3ZC9 A;  2BEB A;  1WD4 A;  1HIB A;  3O44 A;  2D22 A;  2L5X A;  1HWM B;  3RMX A;  4DEN A;  2Z49 A;  3H6R B;  1QQL A;  1FMM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...