1TIHA

Trypsin inhibitor (t1) from nicotiana alata
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
b'DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN INHIBITOR T1
publication title Structures of a series of 6-kDa trypsin inhibitors isolated from the stigma of Nicotiana alata.
pubmed doi rcsb
molecule tags Proteinase inhibitor (trypsin)
total genus 5
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1995-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tihA00
1FYBA 2KCXA 1KMAA 2WCYA 1TUSA 1CT4I 3TJQA 3OVOA 2M5XA 5DAEA 1IY6A 2NU2I 2GKRI 1TIHA 1CE3A 1CSOI 1IY5A 1SGDI 1PPFI 1SGYI 2GKVA 1CGII 2QQDA 1OMTA 1AN1I 2P6AC 2KMRA 1SGNI 1M8BA 2SGDI 2JYYA 2XRCA 1H0ZA 1CT0I 2B0UC 1HDLA 3SGQI 1Y1CA 1TBQR 2JZMA 1TURA 1IW4A 2N71A 3SEKC 1NUBA 2KMOA 2SGQI 1HJAI 2KMQA 2NU4I 2N17A 2LEOA 1SGRI 1TBRR 2BUSA 2NU3I 3QTLD 1BUSA 2V53A 2N52A 1N13A 1HPTA 1LR8A 1Y1BA 2ARPF 1TGSI 1PJUA 2F3CI 5JHWC 1M8CA 1UUCA 2SGEI 1SGEI 1MT1A 2QQCA 1CT2I 3B4VC 1CHOI 2NU0I 1OMUA 1R0RI 1OYVI 2SGFI 1SGPI 2ERWA 2KMPA 1Z7KB 1OVOA 4SGBI 2OVOA 1YU6C 4OVOA 3HH2C 3SGBI 2JXDA 1DS3I 4GI3C 1UVFA 1CGJI 1YTPA 1PCEA 1BMOA 2SGPI 1LR9A 1DS2I 2NU1I 1SGQI 4HGUA 2GKTI 1UVGA 1LR7A
chains in the Genus database with same CATH superfamily
2ENNA 1XA6A 3RU0A 1FYBA 4UXJA 5CCMA 2KCXA 1KMAA 2WCYA 1K7UA 1TUSA 1CT4I 4B6DA 3TJQA 3OVOA 2N1AB 2M5XA 5DAEA 1V1HA 2NU2I 2ORWA 3R5CA 2ORVA 2OD1A 4AMLA 1IY6A 2GKRI 1TIHA 1CE3A 1CSOI 3OL0A 4JCVE 4DNCA 1IY5A 2GVIA 2W0TA 4E1RA 1SGDI 2DKVA 1PPFI 1SGYI 2GKVA 2A20A 1CGII 4UXIA 1MJBA 2FNFX 2J87A 2QQDA 1OMTA 2ELIA 2YQPA 3FC3A 1AN1I 2RIJA 2P6AC 2LUYA 3VDPA 2OZUA 1HEVA 1V1IA 2KMRA 2QQ0A 1X4SA 3OXGA 2K9HA 1SGNI 1M8BA 5HI7A 4L9MA 3TO7A 5J8CA 2L8EA 2SGDI 2ROWA 2V1CC 2JYYA 3QWPA 3UOEA 1RFHA 2XRCA 1XX6A 1CT0I 1H0ZA 3BJIA 1P9GA 2B0UC 1XBTA 1U5KA 2WVJA 1HDLA 1MJAA 3SGQI 1Y1CA 3UGDA 1ULMA 2Y0MA 1TBQR 2JZMA 1WTJA 1TURA 2JW6A 1X74A 1IW4A 2N71A 4WP4A 1NUBA 3SEKC 3UEYA 2UZ3A 3UGIA 1WGTA 2KMOA 1S20A 1ULKA 2SGQI 1HJAI 3OXFA 9WGAA 2V1CA 2B8TA 2KMQA 2NU4I 2N17A 5FUVA 2QPOA 7WGAA 2LEOA 3KY9A 2X3TA 1SGRI 3OXLA 1TBRR 2BUSA 2NU3I 3QTLD 1BUSA 2V53A 5FUWA 2N52A 2X52A 2ODDA 3UEJA 1N13A 1HPTA 5E3RA 5E3QA 5FUYA 1NXUA 1FARA 1LR8A 1R79A 2L7XA 5E3PA 2E73A 5HQ8A 1Y1BA 2ARPF 3QAHA 1TGSI 2JA1A 1FY7A 1TOTA 3CXLA 2WGCA 2J9RA 2PQ8A 1PJUA 1W4RA 2F3CI 3D00A 5JHWC 4E1PA 1M8CA 1UUCA 2SGEI 1ULNA 2CWHA 3GOXA 2LB7A 3TOAA 1MJ9A 2YUUA 3R5AA 1SGEI 2CWGA 5CCLA 1MT1A 1UHAA 1PTQA 1Y8FA 1Z2IA 1FAQA 3TOBA 2OU2A 2QQCA 1CT2I 3TO9A 1TBNA 2E5RA 2ENZA 1VDDA 3VDUA 2DIPA 3B4VC 1CHOI 2NU0I 2QQEA 4UXHA 1OMUA 1R0RI 2VRWB 1K7VA 4MPIA 3UGLA 1TBOA 1WKXA 3TO6A 1OYVI 3R5BA 5EX3A 2SGFI 1SGPI 3FSYA 1W3SA 2ERWA 3PDNA 2KMPA 3E59A 1Z7KB 1OVOA 2DB6A 4SGBI 2OVOA 1YU6C 4OVOA 3HH2C 3SGBI 2JXDA 1DS3I 1K7TA 1P9ZA 1Q9BA 1WGCA 1UVFA 3R5DA 4GI3C 5FUXA 2CJSC 1CGJI 1YTPA 3VE5A 3UFFA 4A24A 2GIVA 1PCEA 1BMOA 2SGPI 1LR9A 1PTRA 3E2IA 1KBEA 1DS2I 4FKDA 2NU1I 1SGQI 5EX0A 2RC4A 5J8FA 1KBFA 2CWFA 4HGUA 2GKTI 2UVOA 1UVGA 3FSXA 1LR7A 3MEKA
chains in the Genus database with same CATH topology
2ENNA 1XA6A 3RU0A 1FYBA 4UXJA 5CCMA 2KCXA 1KMAA 2WCYA 1TUSA 1CT4I 4B6DA 3TJQA 3OVOA 2N1AB 2M5XA 5DAEA 1V1HA 2NU2I 2ORWA 1IY6A 2ORVA 2OD1A 2GKRI 1TIHA 1CE3A 1CSOI 3OL0A 4JCVE 1IY5A 2GVIA 2W0TA 4E1RA 1SGDI 1PPFI 1SGYI 2GKVA 2A20A 1CGII 4UXIA 2FNFX 2J87A 2YQPA 2QQDA 1OMTA 2ELIA 3FC3A 1AN1I 2P6AC 2LUYA 1V1IA 2KMRA 2QQ0A 1X4SA 3OXGA 2K9HA 1SGNI 1M8BA 5HI7A 4L9MA 2L8EA 2SGDI 2ROWA 2V1CC 2JYYA 3QWPA 1RFHA 2XRCA 1XX6A 1CT0I 1H0ZA 3BJIA 2B0UC 1XBTA 1U5KA 2WVJA 1HDLA 3SGQI 1Y1CA 3UGDA 1TBQR 2JZMA 1TURA 2JW6A 1X74A 1IW4A 2N71A 3SEKC 1NUBA 3UEYA 3UGIA 2UZ3A 3VDPA 5CCLA 2KMOA 2SGQI 3OXFA 1HJAI 2V1CA 2B8TA 2KMQA 2NU4I 2N17A 5FUVA 2QPOA 2LEOA 3KY9A 1SGRI 3OXLA 1TBRR 2BUSA 2NU3I 3QTLD 1BUSA 2V53A 5FUWA 2N52A 2ODDA 3UEJA 1N13A 1HPTA 5FUYA 1LR8A 1FARA 1R79A 2L7XA 2E73A 5HQ8A 1Y1BA 2ARPF 1TGSI 2JA1A 1TOTA 3CXLA 2J9RA 1PJUA 1W4RA 2F3CI 3D00A 5JHWC 4E1PA 1M8CA 1UUCA 2SGEI 3GOXA 2YUUA 1SGEI 1MT1A 1Y8FA 1PTQA 1FAQA 2QQCA 1CT2I 1TBNA 2E5RA 2ENZA 1VDDA 3VDUA 2DIPA 3B4VC 1CHOI 2NU0I 2QQEA 4UXHA 1OMUA 1R0RI 2VRWB 3UGLA 1TBOA 1OYVI 5EX3A 2SGFI 1SGPI 1W3SA 2ERWA 3PDNA 2KMPA 3E59A 1Z7KB 1OVOA 2DB6A 4SGBI 2OVOA 1YU6C 4OVOA 3HH2C 3SGBI 2JXDA 1DS3I 5FUXA 4GI3C 1UVFA 2CJSC 1CGJI 1YTPA 3VE5A 3UFFA 4A24A 1PCEA 1BMOA 2SGPI 1LR9A 1PTRA 3E2IA 1KBEA 1DS2I 4FKDA 2NU1I 1SGQI 5EX0A 1KBFA 4HGUA 2GKTI 1UVGA 1LR7A 3MEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYB A;  2KCX A;  1KMA A;  2WCY A;  1TUS A;  1CT4 I;  3TJQ A;  3OVO A;  2M5X A;  5DAE A;  1IY6 A;  2NU2 I;  2GKR I;  1TIH A;  1CE3 A;  1CSO I;  1IY5 A;  1SGD I;  1PPF I;  1SGY I;  2GKV A;  1CGI I;  2QQD A;  1OMT A;  1AN1 I;  2P6A C;  2KMR A;  1SGN I;  1M8B A;  2SGD I;  2JYY A;  2XRC A;  1H0Z A;  1CT0 I;  2B0U C;  1HDL A;  3SGQ I;  1Y1C A;  1TBQ R;  2JZM A;  1TUR A;  1IW4 A;  2N71 A;  3SEK C;  1NUB A;  2KMO A;  2SGQ I;  1HJA I;  2KMQ A;  2NU4 I;  2N17 A;  2LEO A;  1SGR I;  1TBR R;  2BUS A;  2NU3 I;  3QTL D;  1BUS A;  2V53 A;  2N52 A;  1N13 A;  1HPT A;  1LR8 A;  1Y1B A;  2ARP F;  1TGS I;  1PJU A;  2F3C I;  5JHW C;  1M8C A;  1UUC A;  2SGE I;  1SGE I;  1MT1 A;  2QQC A;  1CT2 I;  3B4V C;  1CHO I;  2NU0 I;  1OMU A;  1R0R I;  1OYV I;  2SGF I;  1SGP I;  2ERW A;  2KMP A;  1Z7K B;  1OVO A;  4SGB I;  2OVO A;  1YU6 C;  4OVO A;  3HH2 C;  3SGB I;  2JXD A;  1DS3 I;  4GI3 C;  1UVF A;  1CGJ I;  1YTP A;  1PCE A;  1BMO A;  2SGP I;  1LR9 A;  1DS2 I;  2NU1 I;  1SGQ I;  4HGU A;  2GKT I;  1UVG A;  1LR7 A; 
#chains in the Genus database with same CATH topology
 2ENN A;  1XA6 A;  3RU0 A;  1FYB A;  4UXJ A;  5CCM A;  2KCX A;  1KMA A;  2WCY A;  1K7U A;  1TUS A;  1CT4 I;  4B6D A;  3TJQ A;  3OVO A;  2N1A B;  2M5X A;  5DAE A;  1V1H A;  2NU2 I;  2ORW A;  3R5C A;  2ORV A;  2OD1 A;  4AML A;  1IY6 A;  2GKR I;  1TIH A;  1CE3 A;  1CSO I;  3OL0 A;  4JCV E;  4DNC A;  1IY5 A;  2GVI A;  2W0T A;  4E1R A;  1SGD I;  2DKV A;  1PPF I;  1SGY I;  2GKV A;  2A20 A;  1CGI I;  4UXI A;  1MJB A;  2FNF X;  2J87 A;  2QQD A;  1OMT A;  2ELI A;  2YQP A;  3FC3 A;  1AN1 I;  2RIJ A;  2P6A C;  2LUY A;  3VDP A;  2OZU A;  1HEV A;  1V1I A;  2KMR A;  2QQ0 A;  1X4S A;  3OXG A;  2K9H A;  1SGN I;  1M8B A;  5HI7 A;  4L9M A;  3TO7 A;  5J8C A;  2L8E A;  2SGD I;  2ROW A;  2V1C C;  2JYY A;  3QWP A;  3UOE A;  1RFH A;  2XRC A;  1XX6 A;  1CT0 I;  1H0Z A;  3BJI A;  1P9G A;  2B0U C;  1XBT A;  1U5K A;  2WVJ A;  1HDL A;  1MJA A;  3SGQ I;  1Y1C A;  3UGD A;  1ULM A;  2Y0M A;  1TBQ R;  2JZM A;  1WTJ A;  1TUR A;  2JW6 A;  1X74 A;  1IW4 A;  2N71 A;  4WP4 A;  1NUB A;  3SEK C;  3UEY A;  2UZ3 A;  3UGI A;  1WGT A;  2KMO A;  1S20 A;  1ULK A;  2SGQ I;  1HJA I;  3OXF A;  9WGA A;  2V1C A;  2B8T A;  2KMQ A;  2NU4 I;  2N17 A;  5FUV A;  2QPO A;  7WGA A;  2LEO A;  3KY9 A;  2X3T A;  1SGR I;  3OXL A;  1TBR R;  2BUS A;  2NU3 I;  3QTL D;  1BUS A;  2V53 A;  5FUW A;  2N52 A;  2X52 A;  2ODD A;  3UEJ A;  1N13 A;  1HPT A;  5E3R A;  5E3Q A;  5FUY A;  1NXU A;  1FAR A;  1LR8 A;  1R79 A;  2L7X A;  5E3P A;  2E73 A;  5HQ8 A;  1Y1B A;  2ARP F;  3QAH A;  1TGS I;  2JA1 A;  1FY7 A;  1TOT A;  3CXL A;  2WGC A;  2J9R A;  2PQ8 A;  1PJU A;  1W4R A;  2F3C I;  3D00 A;  5JHW C;  4E1P A;  1M8C A;  1UUC A;  2SGE I;  1ULN A;  2CWH A;  3GOX A;  2LB7 A;  3TOA A;  1MJ9 A;  2YUU A;  3R5A A;  1SGE I;  2CWG A;  5CCL A;  1MT1 A;  1UHA A;  1PTQ A;  1Y8F A;  1Z2I A;  1FAQ A;  3TOB A;  2OU2 A;  2QQC A;  1CT2 I;  3TO9 A;  1TBN A;  2E5R A;  2ENZ A;  1VDD A;  3VDU A;  2DIP A;  3B4V C;  1CHO I;  2NU0 I;  2QQE A;  4UXH A;  1OMU A;  1R0R I;  2VRW B;  1K7V A;  4MPI A;  3UGL A;  1TBO A;  1WKX A;  3TO6 A;  1OYV I;  3R5B A;  5EX3 A;  2SGF I;  1SGP I;  3FSY A;  1W3S A;  2ERW A;  3PDN A;  2KMP A;  3E59 A;  1Z7K B;  1OVO A;  2DB6 A;  4SGB I;  2OVO A;  1YU6 C;  4OVO A;  3HH2 C;  3SGB I;  2JXD A;  1DS3 I;  1K7T A;  1P9Z A;  1Q9B A;  1WGC A;  1UVF A;  3R5D A;  4GI3 C;  5FUX A;  2CJS C;  1CGJ I;  1YTP A;  3VE5 A;  3UFF A;  4A24 A;  2GIV A;  1PCE A;  1BMO A;  2SGP I;  1LR9 A;  1PTR A;  3E2I A;  1KBE A;  1DS2 I;  4FKD A;  2NU1 I;  1SGQ I;  5EX0 A;  2RC4 A;  5J8F A;  1KBF A;  2CWF A;  4HGU A;  2GKT I;  2UVO A;  1UVG A;  3FSX A;  1LR7 A;  3MEK A; 
#chains in the Genus database with same CATH homology
 2ENN A;  1XA6 A;  3RU0 A;  1FYB A;  4UXJ A;  5CCM A;  2KCX A;  1KMA A;  2WCY A;  1TUS A;  1CT4 I;  4B6D A;  3TJQ A;  3OVO A;  2N1A B;  2M5X A;  5DAE A;  1V1H A;  2NU2 I;  2ORW A;  1IY6 A;  2ORV A;  2OD1 A;  2GKR I;  1TIH A;  1CE3 A;  1CSO I;  3OL0 A;  4JCV E;  1IY5 A;  2GVI A;  2W0T A;  4E1R A;  1SGD I;  1PPF I;  1SGY I;  2GKV A;  2A20 A;  1CGI I;  4UXI A;  2FNF X;  2J87 A;  2YQP A;  2QQD A;  1OMT A;  2ELI A;  3FC3 A;  1AN1 I;  2P6A C;  2LUY A;  1V1I A;  2KMR A;  2QQ0 A;  1X4S A;  3OXG A;  2K9H A;  1SGN I;  1M8B A;  5HI7 A;  4L9M A;  2L8E A;  2SGD I;  2ROW A;  2V1C C;  2JYY A;  3QWP A;  1RFH A;  2XRC A;  1XX6 A;  1CT0 I;  1H0Z A;  3BJI A;  2B0U C;  1XBT A;  1U5K A;  2WVJ A;  1HDL A;  3SGQ I;  1Y1C A;  3UGD A;  1TBQ R;  2JZM A;  1TUR A;  2JW6 A;  1X74 A;  1IW4 A;  2N71 A;  3SEK C;  1NUB A;  3UEY A;  3UGI A;  2UZ3 A;  3VDP A;  5CCL A;  2KMO A;  2SGQ I;  3OXF A;  1HJA I;  2V1C A;  2B8T A;  2KMQ A;  2NU4 I;  2N17 A;  5FUV A;  2QPO A;  2LEO A;  3KY9 A;  1SGR I;  3OXL A;  1TBR R;  2BUS A;  2NU3 I;  3QTL D;  1BUS A;  2V53 A;  5FUW A;  2N52 A;  2ODD A;  3UEJ A;  1N13 A;  1HPT A;  5FUY A;  1LR8 A;  1FAR A;  1R79 A;  2L7X A;  2E73 A;  5HQ8 A;  1Y1B A;  2ARP F;  1TGS I;  2JA1 A;  1TOT A;  3CXL A;  2J9R A;  1PJU A;  1W4R A;  2F3C I;  3D00 A;  5JHW C;  4E1P A;  1M8C A;  1UUC A;  2SGE I;  3GOX A;  2YUU A;  1SGE I;  1MT1 A;  1Y8F A;  1PTQ A;  1FAQ A;  2QQC A;  1CT2 I;  1TBN A;  2E5R A;  2ENZ A;  1VDD A;  3VDU A;  2DIP A;  3B4V C;  1CHO I;  2NU0 I;  2QQE A;  4UXH A;  1OMU A;  1R0R I;  2VRW B;  3UGL A;  1TBO A;  1OYV I;  5EX3 A;  2SGF I;  1SGP I;  1W3S A;  2ERW A;  3PDN A;  2KMP A;  3E59 A;  1Z7K B;  1OVO A;  2DB6 A;  4SGB I;  2OVO A;  1YU6 C;  4OVO A;  3HH2 C;  3SGB I;  2JXD A;  1DS3 I;  5FUX A;  4GI3 C;  1UVF A;  2CJS C;  1CGJ I;  1YTP A;  3VE5 A;  3UFF A;  4A24 A;  1PCE A;  1BMO A;  2SGP I;  1LR9 A;  1PTR A;  3E2I A;  1KBE A;  1DS2 I;  4FKD A;  2NU1 I;  1SGQ I;  5EX0 A;  1KBF A;  4HGU A;  2GKT I;  1UVG A;  1LR7 A;  3MEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...