1TIHA

Trypsin inhibitor (t1) from nicotiana alata
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN INHIBITOR T1
publication title Structures of a series of 6-kDa trypsin inhibitors isolated from the stigma of Nicotiana alata.
pubmed doi rcsb
molecule tags Proteinase inhibitor (trypsin)
total genus 5
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1995-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tihA00
1TBRR 1MT1A 2SGQI 1BMOA 1TIHA 1SGYI 1HPTA 2SGEI 1CT0I 3B4VC 1YU6C 1IW4A 2F3CI 1BUSA 4HGUA 4OVOA 2NU4I 2NU2I 2NU1I 2XRCA 1AN1I 1LR8A 4GI3C 2QQDA 2WCYA 2QQCA 2NU3I 1SGPI 2N52A 2NU0I 2KMOA 1SGEI 1NUBA 1SGDI 2ARPF 2SGFI 2N17A 1DS2I 1FYBA 2ERWA 1KMAA 1CHOI 1PPFI 1OMTA 1PJUA 1H0ZA 2B0UC 1DS3I 2KMPA 2BUSA 2SGPI 1UVGA 2OVOA 1M8BA 3OVOA 2KMRA 1TBQR 2KMQA 1IY5A 1UVFA 1TGSI 2JYYA 3QTLD 1IY6A 1LR7A 5JHWC 1SGNI 1CE3A 2LEOA 1CT2I 1SGQI 1OVOA 1Y1BA 2N71A 1CGJI 1UUCA 2P6AC 2SGDI 1SGRI 1CT4I 1TURA 2JXDA 1LR9A 3SEKC 3TJQA 1R0RI 1HJAI 5DAEA 2GKRI 2KCXA 1M8CA 1OYVI 3SGBI 2GKVA 1OMUA 1TUSA 2M5XA 1CGII 1HDLA 4SGBI 3HH2C 1YTPA 2JZMA 3SGQI 1Y1CA 2GKTI 1PCEA 1Z7KB 1N13A 2V53A 1CSOI
chains in the Genus database with same CATH superfamily
1TBRR 1WGCA 5EX0A 1MT1A 1ULMA 3BJIA 2WGCA 2J9RA 5FUVA 4WP4A 3VDUA 2SGQI 2UZ3A 1BMOA 3FSYA 1TIHA 1SGYI 1HPTA 2GVIA 2SGEI 1CT0I 3B4VC 1YU6C 7WGAA 1KBEA 2X3TA 2QQ0A 4DNCA 1IW4A 2F3CI 2QQEA 3UEYA 1TBOA 1BUSA 1W4RA 4FKDA 4L9MA 2FNFX 5J8CA 2CJSC 4HGUA 4OVOA 2NU4I 2NU2I 2B8TA 2NU1I 2XRCA 1AN1I 1LR8A 2JW6A 4GI3C 3UGIA 2QQDA 3UFFA 2ENZA 2QQCA 2WCYA 3QAHA 1Y8FA 1SGPI 2NU3I 2RC4A 1WGTA 2KMOA 2N52A 2NU0I 5FUYA 1SGEI 1NUBA 1SGDI 9WGAA 2CWHA 2ARPF 3TO9A 1ULNA 2SGFI 1V1HA 2DB6A 2N17A 1UHAA 3UGLA 3OXGA 4A24A 1FY7A 1XBTA 1DS2I 1PTRA 2GIVA 4E1RA 1KBFA 3RU0A 1FYBA 1U5KA 2ERWA 2ORVA 1CHOI 1KMAA 1PPFI 1K7TA 3R5DA 1OMTA 1WTJA 2V1CC 1PJUA 2L8EA 3CXLA 3MEKA 4MPIA 4UXJA 1RFHA 3TOAA 1P9GA 1VDDA 3FC3A 2OZUA 1H0ZA 2LUYA 1XA6A 1DS3I 2B0UC 2J87A 2KMPA 2BUSA 2RIJA 2SGPI 3R5CA 1UVGA 2OVOA 2A20A 2W0TA 1M8BA 3FSXA 1Q9BA 3OVOA 5HQ8A 2E5RA 1MJAA 2YQPA 2KMRA 1TBQR 3R5AA 2N1AB 2X52A 3UOEA 2KMQA 1IY5A 4UXHA 2CWGA 3OXFA 1UVFA 1MJBA 2QPOA 1NXUA 1TGSI 2JYYA 1HEVA 1X74A 2Y0MA 3QTLD 3TO7A 3UEJA 3KY9A 2DIPA 5E3QA 1IY6A 1MJ9A 1LR7A 2K9HA 3D00A 5JHWC 4E1PA 3E59A 1SGNI 2ENNA 3OL0A 4UXIA 4B6DA 5J8FA 1CE3A 3QWPA 1K7VA 2LEOA 1CT2I 1XX6A 1FAQA 1Z2IA 1SGQI 1WKXA 1OVOA 1Y1BA 2N71A 1CGJI 1UUCA 2P6AC 2SGDI 1FARA 1K7UA 1SGRI 1CT4I 1TURA 1ULKA 1V1IA 2JXDA 2PQ8A 1LR9A 2ROWA 3E2IA 5E3PA 3VDPA 2JA1A 4AMLA 5CCMA 2V1CA 2VRWB 3SEKC 3GOXA 2ODDA 3TJQA 1R0RI 3TO6A 3TOBA 1HJAI 2LB7A 3R5BA 3OXLA 2CWFA 5DAEA 2ORWA 2GKRI 2OD1A 1X4SA 2KCXA 2OU2A 2UVOA 1M8CA 5CCLA 1OYVI 3SGBI 2GKVA 1TOTA 5FUXA 1TBNA 1OMUA 3VE5A 3UGDA 2YUUA 1TUSA 1R79A 2L7XA 1PTQA 2WVJA 5FUWA 2M5XA 2ELIA 4JCVE 1CGII 1P9ZA 4SGBI 3HH2C 5HI7A 1HDLA 1YTPA 5E3RA 2JZMA 2DKVA 2E73A 1S20A 3PDNA 1Y1CA 3SGQI 2GKTI 1PCEA 1Z7KB 1N13A 2V53A 1CSOI 1W3SA 5EX3A
chains in the Genus database with same CATH topology
1TBRR 5EX0A 1MT1A 3BJIA 2J9RA 5FUVA 3VDUA 2SGQI 2UZ3A 1BMOA 1TIHA 1SGYI 1HPTA 2GVIA 2SGEI 1CT0I 3B4VC 1YU6C 1KBEA 2QQ0A 1IW4A 2F3CI 2QQEA 3UEYA 1TBOA 1BUSA 1W4RA 4FKDA 4L9MA 2FNFX 2CJSC 4HGUA 4OVOA 2NU4I 2NU2I 2B8TA 2NU1I 2XRCA 1AN1I 1LR8A 2JW6A 4GI3C 3UGIA 2QQDA 3UFFA 2ENZA 2QQCA 2WCYA 1Y8FA 1SGPI 2NU3I 2N52A 2KMOA 2NU0I 5FUYA 1SGEI 1NUBA 1SGDI 2ARPF 2SGFI 1V1HA 2DB6A 2N17A 3UGLA 3OXGA 4A24A 1XBTA 1DS2I 1PTRA 4E1RA 1KBFA 3RU0A 1FYBA 1U5KA 2ERWA 2ORVA 1CHOI 1KMAA 1PPFI 1OMTA 2V1CC 3MEKA 1PJUA 2L8EA 3CXLA 4UXJA 1RFHA 1VDDA 3FC3A 1H0ZA 2LUYA 1XA6A 1DS3I 2B0UC 2J87A 2KMPA 2BUSA 2SGPI 1UVGA 2OVOA 2A20A 2W0TA 1M8BA 3OVOA 5HQ8A 2E5RA 2KMRA 1TBQR 2N1AB 2KMQA 1IY5A 4UXHA 3OXFA 1UVFA 2QPOA 1TGSI 2JYYA 1X74A 3QTLD 3UEJA 3KY9A 2DIPA 1IY6A 1LR7A 2K9HA 3D00A 5JHWC 4E1PA 3E59A 1SGNI 2ENNA 3OL0A 4UXIA 4B6DA 1CE3A 3QWPA 2LEOA 1CT2I 1XX6A 1FAQA 1SGQI 1OVOA 1Y1BA 2N71A 1CGJI 1UUCA 2P6AC 2SGDI 1FARA 1SGRI 1V1IA 1CT4I 1TURA 2JXDA 2ROWA 2YQPA 1LR9A 3E2IA 3VDPA 5CCMA 2JA1A 2V1CA 2VRWB 3SEKC 3GOXA 2ODDA 3TJQA 1R0RI 1HJAI 3OXLA 5DAEA 2ORWA 2GKRI 2OD1A 1X4SA 2KCXA 1M8CA 5CCLA 1OYVI 3SGBI 2GKVA 1TOTA 5FUXA 1TBNA 1OMUA 3VE5A 3UGDA 2YUUA 1TUSA 1R79A 2L7XA 1PTQA 2WVJA 5FUWA 2M5XA 2ELIA 4JCVE 1CGII 5HI7A 4SGBI 3HH2C 1HDLA 1YTPA 2JZMA 2E73A 3PDNA 1Y1CA 3SGQI 2GKTI 1PCEA 1Z7KB 1N13A 2V53A 1CSOI 1W3SA 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TBR R;  1MT1 A;  2SGQ I;  1BMO A;  1TIH A;  1SGY I;  1HPT A;  2SGE I;  1CT0 I;  3B4V C;  1YU6 C;  1IW4 A;  2F3C I;  1BUS A;  4HGU A;  4OVO A;  2NU4 I;  2NU2 I;  2NU1 I;  2XRC A;  1AN1 I;  1LR8 A;  4GI3 C;  2QQD A;  2WCY A;  2QQC A;  2NU3 I;  1SGP I;  2N52 A;  2NU0 I;  2KMO A;  1SGE I;  1NUB A;  1SGD I;  2ARP F;  2SGF I;  2N17 A;  1DS2 I;  1FYB A;  2ERW A;  1KMA A;  1CHO I;  1PPF I;  1OMT A;  1PJU A;  1H0Z A;  2B0U C;  1DS3 I;  2KMP A;  2BUS A;  2SGP I;  1UVG A;  2OVO A;  1M8B A;  3OVO A;  2KMR A;  1TBQ R;  2KMQ A;  1IY5 A;  1UVF A;  1TGS I;  2JYY A;  3QTL D;  1IY6 A;  1LR7 A;  5JHW C;  1SGN I;  1CE3 A;  2LEO A;  1CT2 I;  1SGQ I;  1OVO A;  1Y1B A;  2N71 A;  1CGJ I;  1UUC A;  2P6A C;  2SGD I;  1SGR I;  1CT4 I;  1TUR A;  2JXD A;  1LR9 A;  3SEK C;  3TJQ A;  1R0R I;  1HJA I;  5DAE A;  2GKR I;  2KCX A;  1M8C A;  1OYV I;  3SGB I;  2GKV A;  1OMU A;  1TUS A;  2M5X A;  1CGI I;  1HDL A;  4SGB I;  3HH2 C;  1YTP A;  2JZM A;  3SGQ I;  1Y1C A;  2GKT I;  1PCE A;  1Z7K B;  1N13 A;  2V53 A;  1CSO I; 
#chains in the Genus database with same CATH topology
 1TBR R;  1WGC A;  5EX0 A;  1MT1 A;  1ULM A;  3BJI A;  2WGC A;  2J9R A;  5FUV A;  4WP4 A;  3VDU A;  2SGQ I;  2UZ3 A;  1BMO A;  3FSY A;  1TIH A;  1SGY I;  1HPT A;  2GVI A;  2SGE I;  1CT0 I;  3B4V C;  1YU6 C;  7WGA A;  1KBE A;  2X3T A;  2QQ0 A;  4DNC A;  1IW4 A;  2F3C I;  2QQE A;  3UEY A;  1TBO A;  1BUS A;  1W4R A;  4FKD A;  4L9M A;  2FNF X;  5J8C A;  2CJS C;  4HGU A;  4OVO A;  2NU4 I;  2NU2 I;  2B8T A;  2NU1 I;  2XRC A;  1AN1 I;  1LR8 A;  2JW6 A;  4GI3 C;  3UGI A;  2QQD A;  3UFF A;  2ENZ A;  2QQC A;  2WCY A;  3QAH A;  1Y8F A;  1SGP I;  2NU3 I;  2RC4 A;  1WGT A;  2KMO A;  2N52 A;  2NU0 I;  5FUY A;  1SGE I;  1NUB A;  1SGD I;  9WGA A;  2CWH A;  2ARP F;  3TO9 A;  1ULN A;  2SGF I;  1V1H A;  2DB6 A;  2N17 A;  1UHA A;  3UGL A;  3OXG A;  4A24 A;  1FY7 A;  1XBT A;  1DS2 I;  1PTR A;  2GIV A;  4E1R A;  1KBF A;  3RU0 A;  1FYB A;  1U5K A;  2ERW A;  2ORV A;  1CHO I;  1KMA A;  1PPF I;  1K7T A;  3R5D A;  1OMT A;  1WTJ A;  2V1C C;  1PJU A;  2L8E A;  3CXL A;  3MEK A;  4MPI A;  4UXJ A;  1RFH A;  3TOA A;  1P9G A;  1VDD A;  3FC3 A;  2OZU A;  1H0Z A;  2LUY A;  1XA6 A;  1DS3 I;  2B0U C;  2J87 A;  2KMP A;  2BUS A;  2RIJ A;  2SGP I;  3R5C A;  1UVG A;  2OVO A;  2A20 A;  2W0T A;  1M8B A;  3FSX A;  1Q9B A;  3OVO A;  5HQ8 A;  2E5R A;  1MJA A;  2YQP A;  2KMR A;  1TBQ R;  3R5A A;  2N1A B;  2X52 A;  3UOE A;  2KMQ A;  1IY5 A;  4UXH A;  2CWG A;  3OXF A;  1UVF A;  1MJB A;  2QPO A;  1NXU A;  1TGS I;  2JYY A;  1HEV A;  1X74 A;  2Y0M A;  3QTL D;  3TO7 A;  3UEJ A;  3KY9 A;  2DIP A;  5E3Q A;  1IY6 A;  1MJ9 A;  1LR7 A;  2K9H A;  3D00 A;  5JHW C;  4E1P A;  3E59 A;  1SGN I;  2ENN A;  3OL0 A;  4UXI A;  4B6D A;  5J8F A;  1CE3 A;  3QWP A;  1K7V A;  2LEO A;  1CT2 I;  1XX6 A;  1FAQ A;  1Z2I A;  1SGQ I;  1WKX A;  1OVO A;  1Y1B A;  2N71 A;  1CGJ I;  1UUC A;  2P6A C;  2SGD I;  1FAR A;  1K7U A;  1SGR I;  1CT4 I;  1TUR A;  1ULK A;  1V1I A;  2JXD A;  2PQ8 A;  1LR9 A;  2ROW A;  3E2I A;  5E3P A;  3VDP A;  2JA1 A;  4AML A;  5CCM A;  2V1C A;  2VRW B;  3SEK C;  3GOX A;  2ODD A;  3TJQ A;  1R0R I;  3TO6 A;  3TOB A;  1HJA I;  2LB7 A;  3R5B A;  3OXL A;  2CWF A;  5DAE A;  2ORW A;  2GKR I;  2OD1 A;  1X4S A;  2KCX A;  2OU2 A;  2UVO A;  1M8C A;  5CCL A;  1OYV I;  3SGB I;  2GKV A;  1TOT A;  5FUX A;  1TBN A;  1OMU A;  3VE5 A;  3UGD A;  2YUU A;  1TUS A;  1R79 A;  2L7X A;  1PTQ A;  2WVJ A;  5FUW A;  2M5X A;  2ELI A;  4JCV E;  1CGI I;  1P9Z A;  4SGB I;  3HH2 C;  5HI7 A;  1HDL A;  1YTP A;  5E3R A;  2JZM A;  2DKV A;  2E73 A;  1S20 A;  3PDN A;  1Y1C A;  3SGQ I;  2GKT I;  1PCE A;  1Z7K B;  1N13 A;  2V53 A;  1CSO I;  1W3S A;  5EX3 A; 
#chains in the Genus database with same CATH homology
 1TBR R;  5EX0 A;  1MT1 A;  3BJI A;  2J9R A;  5FUV A;  3VDU A;  2SGQ I;  2UZ3 A;  1BMO A;  1TIH A;  1SGY I;  1HPT A;  2GVI A;  2SGE I;  1CT0 I;  3B4V C;  1YU6 C;  1KBE A;  2QQ0 A;  1IW4 A;  2F3C I;  2QQE A;  3UEY A;  1TBO A;  1BUS A;  1W4R A;  4FKD A;  4L9M A;  2FNF X;  2CJS C;  4HGU A;  4OVO A;  2NU4 I;  2NU2 I;  2B8T A;  2NU1 I;  2XRC A;  1AN1 I;  1LR8 A;  2JW6 A;  4GI3 C;  3UGI A;  2QQD A;  3UFF A;  2ENZ A;  2QQC A;  2WCY A;  1Y8F A;  1SGP I;  2NU3 I;  2N52 A;  2KMO A;  2NU0 I;  5FUY A;  1SGE I;  1NUB A;  1SGD I;  2ARP F;  2SGF I;  1V1H A;  2DB6 A;  2N17 A;  3UGL A;  3OXG A;  4A24 A;  1XBT A;  1DS2 I;  1PTR A;  4E1R A;  1KBF A;  3RU0 A;  1FYB A;  1U5K A;  2ERW A;  2ORV A;  1CHO I;  1KMA A;  1PPF I;  1OMT A;  2V1C C;  3MEK A;  1PJU A;  2L8E A;  3CXL A;  4UXJ A;  1RFH A;  1VDD A;  3FC3 A;  1H0Z A;  2LUY A;  1XA6 A;  1DS3 I;  2B0U C;  2J87 A;  2KMP A;  2BUS A;  2SGP I;  1UVG A;  2OVO A;  2A20 A;  2W0T A;  1M8B A;  3OVO A;  5HQ8 A;  2E5R A;  2KMR A;  1TBQ R;  2N1A B;  2KMQ A;  1IY5 A;  4UXH A;  3OXF A;  1UVF A;  2QPO A;  1TGS I;  2JYY A;  1X74 A;  3QTL D;  3UEJ A;  3KY9 A;  2DIP A;  1IY6 A;  1LR7 A;  2K9H A;  3D00 A;  5JHW C;  4E1P A;  3E59 A;  1SGN I;  2ENN A;  3OL0 A;  4UXI A;  4B6D A;  1CE3 A;  3QWP A;  2LEO A;  1CT2 I;  1XX6 A;  1FAQ A;  1SGQ I;  1OVO A;  1Y1B A;  2N71 A;  1CGJ I;  1UUC A;  2P6A C;  2SGD I;  1FAR A;  1SGR I;  1V1I A;  1CT4 I;  1TUR A;  2JXD A;  2ROW A;  2YQP A;  1LR9 A;  3E2I A;  3VDP A;  5CCM A;  2JA1 A;  2V1C A;  2VRW B;  3SEK C;  3GOX A;  2ODD A;  3TJQ A;  1R0R I;  1HJA I;  3OXL A;  5DAE A;  2ORW A;  2GKR I;  2OD1 A;  1X4S A;  2KCX A;  1M8C A;  5CCL A;  1OYV I;  3SGB I;  2GKV A;  1TOT A;  5FUX A;  1TBN A;  1OMU A;  3VE5 A;  3UGD A;  2YUU A;  1TUS A;  1R79 A;  2L7X A;  1PTQ A;  2WVJ A;  5FUW A;  2M5X A;  2ELI A;  4JCV E;  1CGI I;  5HI7 A;  4SGB I;  3HH2 C;  1HDL A;  1YTP A;  2JZM A;  2E73 A;  3PDN A;  1Y1C A;  3SGQ I;  2GKT I;  1PCE A;  1Z7K B;  1N13 A;  2V53 A;  1CSO I;  1W3S A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...