1TIHA

Trypsin inhibitor (t1) from nicotiana alata
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
53
structure length
53
Chain Sequence
DRICTNCCAGTKGCKYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYGICPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a series of 6-kDa trypsin inhibitors isolated from the stigma of Nicotiana alata.
pubmed doi rcsb
molecule tags Proteinase inhibitor (trypsin)
molecule keywords TRYPSIN INHIBITOR T1
total genus 5
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1995-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1tihA00
1H0ZA 1TIHA 1UUCA 1TGSI 1SGRI 2KMRA 2NU4I 2WCYA 2JZMA 2NU2I 2LEOA 1Y1CA 1BUSA 1DS2I 1SGPI 2KMPA 1CT4I 2V53A 1YU6C 1N13A 2KMQA 1PJUA 2SGQI 1CHOI 2P6AC 1R0RI 1SGYI 4GI3C 1UVFA 1OVOA 1SGEI 3SGQI 1CGJI 1PPFI 3TJQA 1LR8A 2B0UC 1TBRR 2QQDA 1OMUA 2GKTI 2SGDI 2M5XA 2ERWA 1CT2I 1TURA 1IY5A 1PCEA 2NU1I 1HDLA 2SGFI 1Z7KB 1CE3A 1M8CA 3QTLD 1IW4A 1YTPA 1TBQR 2GKRI 1LR7A 1DS3I 1LR9A 4OVOA 1SGDI 1OYVI 2JXDA 1KMAA 1IY6A 1SGQI 1CSOI 1AN1I 1MT1A 2GKVA 1M8BA 5DAEA 2JYYA 2N52A 1BMOA 4SGBI 1CT0I 3SGBI 2SGEI 2ARPF 3SEKC 2NU0I 2F3CI 3B4VC 1Y1BA 1NUBA 2KCXA 1HJAI 1FYBA 2N71A 1CGII 2XRCA 2BUSA 2QQCA 4HGUA 2SGPI 2KMOA 1SGNI 1OMTA 1TUSA 1UVGA 5JHWC 1HPTA 3HH2C 2N17A 2NU3I 3OVOA 2OVOA
chains in the Genus database with same CATH superfamily
2ODDA 1FAQA 1H0ZA 1TIHA 3D00A 5EX0A 4UXHA 2YUUA 1WTJA 2QQ0A 1K7UA 1UUCA 3E59A 1TGSI 1Q9BA 7WGAA 1SGRI 4E1PA 2KMRA 2NU4I 2WCYA 2JZMA 2NU2I 2JA1A 2LEOA 5HI7A 1WGTA 3TOAA 2V1CC 1RFHA 3VDUA 9WGAA 2X3TA 1Z2IA 1Y1CA 3R5DA 5CCLA 1BUSA 2CWGA 1DS2I 3CXLA 2WGCA 1FARA 1SGPI 2KMPA 1CT4I 2V53A 2PQ8A 3R5AA 1VDDA 4UXJA 4MPIA 1YU6C 2CWFA 1N13A 2KMQA 1NXUA 3BJIA 2JW6A 3FC3A 1PJUA 1MJ9A 5E3PA 3UEYA 2SGQI 1CHOI 2K9HA 2P6AC 5EX3A 1R0RI 1SGYI 1P9ZA 2CJSC 2UZ3A 4L9MA 4GI3C 1PTRA 1OVOA 1ULNA 1UVFA 1SGEI 2DKVA 3OXGA 3SGQI 1XX6A 4B6DA 3QAHA 1CGJI 5HQ8A 2GIVA 3UGIA 1PPFI 4A24A 3TJQA 1LR8A 2B0UC 1V1IA 1TBRR 5E3RA 3GOXA 5FUWA 5CCMA 2QQDA 1OMUA 2GKTI 1MJAA 2J9RA 2ERWA 2M5XA 2SGDI 1CT2I 1TURA 2ORWA 2W0TA 3TO6A 1IY5A 1PCEA 2ELIA 2ORVA 2NU1I 2QPOA 2SGFI 1Z7KB 3TOBA 4DNCA 1CE3A 1HDLA 1M8CA 1K7VA 2LUYA 4AMLA 2CWHA 3QTLD 3OXLA 1IW4A 2ENNA 2OD1A 3OL0A 3TO9A 1YTPA 1TBQR 2UVOA 3FSYA 1PTQA 2GVIA 2GKRI 4E1RA 1KBFA 1LR7A 1S20A 1UHAA 3FSXA 1DS3I 2ROWA 1XA6A 2DIPA 1LR9A 4OVOA 1SGDI 1WKXA 1KBEA 1OYVI 2JXDA 2L7XA 1KMAA 2E73A 2OZUA 2VRWB 3R5CA 3R5BA 2J87A 3UOEA 1TOTA 1SGQI 2Y0MA 1CSOI 1AN1I 3PDNA 1MT1A 2GKVA 3RU0A 1M8BA 1WGCA 1TBNA 5DAEA 2JYYA 2N52A 1IY6A 2L8EA 1BMOA 2WVJA 3OXFA 2DB6A 3E2IA 4SGBI 2V1CA 1CT0I 3QWPA 2X52A 3UGDA 1X74A 3SGBI 2SGEI 1XBTA 2ARPF 3SEKC 3VDPA 4JCVE 2NU0I 2QQEA 4UXIA 4WP4A 2F3CI 3UGLA 1X4SA 3UEJA 1HEVA 1TBOA 2OU2A 3B4VC 1V1HA 1W4RA 2LB7A 1Y1BA 1NUBA 2E5RA 1HJAI 2KCXA 2N71A 1CGII 1FY7A 2FNFX 2XRCA 3MEKA 2B8TA 1R79A 2ENZA 2RIJA 1ULMA 5FUVA 3KY9A 2BUSA 3TO7A 1P9GA 2QQCA 4HGUA 1ULKA 2RC4A 5FUYA 2SGPI 5E3QA 2KMOA 1SGNI 1OMTA 5FUXA 1MJBA 1K7TA 5J8CA 1TUSA 1UVGA 4FKDA 5JHWC 1HPTA 2YQPA 1FYBA 3HH2C 1Y8FA 1W3SA 2N17A 3VE5A 2NU3I 5J8FA 3UFFA 3OVOA 2OVOA 1U5KA 2A20A 2N1AB
chains in the Genus database with same CATH topology
2ODDA 1FAQA 1H0ZA 1TIHA 5EX0A 4UXHA 2YUUA 2QQ0A 1UUCA 3E59A 1TGSI 1SGRI 4E1PA 2KMRA 2NU4I 2WCYA 2JZMA 2NU2I 2JA1A 2LEOA 5HI7A 3VDUA 2V1CC 1RFHA 5CCLA 1Y1CA 1BUSA 1DS2I 3CXLA 1FARA 1SGPI 2KMPA 1CT4I 2V53A 4UXJA 1VDDA 1YU6C 1N13A 2KMQA 3BJIA 2JW6A 3FC3A 1PJUA 3UEYA 2SGQI 1CHOI 2K9HA 2P6AC 5EX3A 1R0RI 1SGYI 2CJSC 2UZ3A 4L9MA 4GI3C 1PTRA 1OVOA 1UVFA 3OXGA 1SGEI 3SGQI 4B6DA 1XX6A 1CGJI 5HQ8A 3UGIA 1PPFI 4A24A 3TJQA 1LR8A 2B0UC 1V1IA 1TBRR 3GOXA 5FUWA 5CCMA 2QQDA 1OMUA 2GKTI 2J9RA 2M5XA 2ERWA 2SGDI 1CT2I 1TURA 2ORWA 2W0TA 1IY5A 1PCEA 2ELIA 2ORVA 2NU1I 2QPOA 2SGFI 1Z7KB 1CE3A 1HDLA 1M8CA 2LUYA 3QTLD 3OXLA 1IW4A 2ENNA 2OD1A 3OL0A 1YTPA 1TBQR 1PTQA 2GVIA 2GKRI 4E1RA 1KBFA 1LR7A 1DS3I 2ROWA 1XA6A 2DIPA 1LR9A 4OVOA 1SGDI 1KBEA 1OYVI 2JXDA 2L7XA 1KMAA 2E73A 2VRWB 1IY6A 2J87A 1TOTA 1SGQI 3RU0A 1CSOI 1AN1I 3PDNA 1MT1A 2GKVA 1M8BA 1TBNA 5DAEA 2JYYA 2N52A 2L8EA 1BMOA 2WVJA 3OXFA 2DB6A 3E2IA 4SGBI 2V1CA 1CT0I 3QWPA 3UGDA 1X74A 3SGBI 2SGEI 1XBTA 2ARPF 3SEKC 3VDPA 4JCVE 2NU0I 2QQEA 4UXIA 3UGLA 2F3CI 1X4SA 3UEJA 1TBOA 3B4VC 1V1HA 1W4RA 3D00A 2E5RA 1NUBA 1Y1BA 1HJAI 2KCXA 2N71A 1CGII 2FNFX 2XRCA 3MEKA 1FYBA 2B8TA 1R79A 2ENZA 5FUVA 3KY9A 2BUSA 2QQCA 4HGUA 5FUYA 2SGPI 2KMOA 1SGNI 1OMTA 5FUXA 1TUSA 1UVGA 4FKDA 5JHWC 1HPTA 2YQPA 3HH2C 1Y8FA 1W3SA 2N17A 3VE5A 2NU3I 3UFFA 3OVOA 2OVOA 1U5KA 2A20A 2N1AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0Z A;  1TIH A;  1UUC A;  1TGS I;  1SGR I;  2KMR A;  2NU4 I;  2WCY A;  2JZM A;  2NU2 I;  2LEO A;  1Y1C A;  1BUS A;  1DS2 I;  1SGP I;  2KMP A;  1CT4 I;  2V53 A;  1YU6 C;  1N13 A;  2KMQ A;  1PJU A;  2SGQ I;  1CHO I;  2P6A C;  1R0R I;  1SGY I;  4GI3 C;  1UVF A;  1OVO A;  1SGE I;  3SGQ I;  1CGJ I;  1PPF I;  3TJQ A;  1LR8 A;  2B0U C;  1TBR R;  2QQD A;  1OMU A;  2GKT I;  2SGD I;  2M5X A;  2ERW A;  1CT2 I;  1TUR A;  1IY5 A;  1PCE A;  2NU1 I;  1HDL A;  2SGF I;  1Z7K B;  1CE3 A;  1M8C A;  3QTL D;  1IW4 A;  1YTP A;  1TBQ R;  2GKR I;  1LR7 A;  1DS3 I;  1LR9 A;  4OVO A;  1SGD I;  1OYV I;  2JXD A;  1KMA A;  1IY6 A;  1SGQ I;  1CSO I;  1AN1 I;  1MT1 A;  2GKV A;  1M8B A;  5DAE A;  2JYY A;  2N52 A;  1BMO A;  4SGB I;  1CT0 I;  3SGB I;  2SGE I;  2ARP F;  3SEK C;  2NU0 I;  2F3C I;  3B4V C;  1Y1B A;  1NUB A;  2KCX A;  1HJA I;  1FYB A;  2N71 A;  1CGI I;  2XRC A;  2BUS A;  2QQC A;  4HGU A;  2SGP I;  2KMO A;  1SGN I;  1OMT A;  1TUS A;  1UVG A;  5JHW C;  1HPT A;  3HH2 C;  2N17 A;  2NU3 I;  3OVO A;  2OVO A; 
#chains in the Genus database with same CATH topology
 2ODD A;  1FAQ A;  1H0Z A;  1TIH A;  3D00 A;  5EX0 A;  4UXH A;  2YUU A;  1WTJ A;  2QQ0 A;  1K7U A;  1UUC A;  3E59 A;  1TGS I;  1Q9B A;  7WGA A;  1SGR I;  4E1P A;  2KMR A;  2NU4 I;  2WCY A;  2JZM A;  2NU2 I;  2JA1 A;  2LEO A;  5HI7 A;  1WGT A;  3TOA A;  2V1C C;  1RFH A;  3VDU A;  9WGA A;  2X3T A;  1Z2I A;  1Y1C A;  3R5D A;  5CCL A;  1BUS A;  2CWG A;  1DS2 I;  3CXL A;  2WGC A;  1FAR A;  1SGP I;  2KMP A;  1CT4 I;  2V53 A;  2PQ8 A;  3R5A A;  1VDD A;  4UXJ A;  4MPI A;  1YU6 C;  2CWF A;  1N13 A;  2KMQ A;  1NXU A;  3BJI A;  2JW6 A;  3FC3 A;  1PJU A;  1MJ9 A;  5E3P A;  3UEY A;  2SGQ I;  1CHO I;  2K9H A;  2P6A C;  5EX3 A;  1R0R I;  1SGY I;  1P9Z A;  2CJS C;  2UZ3 A;  4L9M A;  4GI3 C;  1PTR A;  1OVO A;  1ULN A;  1UVF A;  1SGE I;  2DKV A;  3OXG A;  3SGQ I;  1XX6 A;  4B6D A;  3QAH A;  1CGJ I;  5HQ8 A;  2GIV A;  3UGI A;  1PPF I;  4A24 A;  3TJQ A;  1LR8 A;  2B0U C;  1V1I A;  1TBR R;  5E3R A;  3GOX A;  5FUW A;  5CCM A;  2QQD A;  1OMU A;  2GKT I;  1MJA A;  2J9R A;  2ERW A;  2M5X A;  2SGD I;  1CT2 I;  1TUR A;  2ORW A;  2W0T A;  3TO6 A;  1IY5 A;  1PCE A;  2ELI A;  2ORV A;  2NU1 I;  2QPO A;  2SGF I;  1Z7K B;  3TOB A;  4DNC A;  1CE3 A;  1HDL A;  1M8C A;  1K7V A;  2LUY A;  4AML A;  2CWH A;  3QTL D;  3OXL A;  1IW4 A;  2ENN A;  2OD1 A;  3OL0 A;  3TO9 A;  1YTP A;  1TBQ R;  2UVO A;  3FSY A;  1PTQ A;  2GVI A;  2GKR I;  4E1R A;  1KBF A;  1LR7 A;  1S20 A;  1UHA A;  3FSX A;  1DS3 I;  2ROW A;  1XA6 A;  2DIP A;  1LR9 A;  4OVO A;  1SGD I;  1WKX A;  1KBE A;  1OYV I;  2JXD A;  2L7X A;  1KMA A;  2E73 A;  2OZU A;  2VRW B;  3R5C A;  3R5B A;  2J87 A;  3UOE A;  1TOT A;  1SGQ I;  2Y0M A;  1CSO I;  1AN1 I;  3PDN A;  1MT1 A;  2GKV A;  3RU0 A;  1M8B A;  1WGC A;  1TBN A;  5DAE A;  2JYY A;  2N52 A;  1IY6 A;  2L8E A;  1BMO A;  2WVJ A;  3OXF A;  2DB6 A;  3E2I A;  4SGB I;  2V1C A;  1CT0 I;  3QWP A;  2X52 A;  3UGD A;  1X74 A;  3SGB I;  2SGE I;  1XBT A;  2ARP F;  3SEK C;  3VDP A;  4JCV E;  2NU0 I;  2QQE A;  4UXI A;  4WP4 A;  2F3C I;  3UGL A;  1X4S A;  3UEJ A;  1HEV A;  1TBO A;  2OU2 A;  3B4V C;  1V1H A;  1W4R A;  2LB7 A;  1Y1B A;  1NUB A;  2E5R A;  1HJA I;  2KCX A;  2N71 A;  1CGI I;  1FY7 A;  2FNF X;  2XRC A;  3MEK A;  2B8T A;  1R79 A;  2ENZ A;  2RIJ A;  1ULM A;  5FUV A;  3KY9 A;  2BUS A;  3TO7 A;  1P9G A;  2QQC A;  4HGU A;  1ULK A;  2RC4 A;  5FUY A;  2SGP I;  5E3Q A;  2KMO A;  1SGN I;  1OMT A;  5FUX A;  1MJB A;  1K7T A;  5J8C A;  1TUS A;  1UVG A;  4FKD A;  5JHW C;  1HPT A;  2YQP A;  1FYB A;  3HH2 C;  1Y8F A;  1W3S A;  2N17 A;  3VE5 A;  2NU3 I;  5J8F A;  3UFF A;  3OVO A;  2OVO A;  1U5K A;  2A20 A;  2N1A B; 
#chains in the Genus database with same CATH homology
 2ODD A;  1FAQ A;  1H0Z A;  1TIH A;  5EX0 A;  4UXH A;  2YUU A;  2QQ0 A;  1UUC A;  3E59 A;  1TGS I;  1SGR I;  4E1P A;  2KMR A;  2NU4 I;  2WCY A;  2JZM A;  2NU2 I;  2JA1 A;  2LEO A;  5HI7 A;  3VDU A;  2V1C C;  1RFH A;  5CCL A;  1Y1C A;  1BUS A;  1DS2 I;  3CXL A;  1FAR A;  1SGP I;  2KMP A;  1CT4 I;  2V53 A;  4UXJ A;  1VDD A;  1YU6 C;  1N13 A;  2KMQ A;  3BJI A;  2JW6 A;  3FC3 A;  1PJU A;  3UEY A;  2SGQ I;  1CHO I;  2K9H A;  2P6A C;  5EX3 A;  1R0R I;  1SGY I;  2CJS C;  2UZ3 A;  4L9M A;  4GI3 C;  1PTR A;  1OVO A;  1UVF A;  3OXG A;  1SGE I;  3SGQ I;  4B6D A;  1XX6 A;  1CGJ I;  5HQ8 A;  3UGI A;  1PPF I;  4A24 A;  3TJQ A;  1LR8 A;  2B0U C;  1V1I A;  1TBR R;  3GOX A;  5FUW A;  5CCM A;  2QQD A;  1OMU A;  2GKT I;  2J9R A;  2M5X A;  2ERW A;  2SGD I;  1CT2 I;  1TUR A;  2ORW A;  2W0T A;  1IY5 A;  1PCE A;  2ELI A;  2ORV A;  2NU1 I;  2QPO A;  2SGF I;  1Z7K B;  1CE3 A;  1HDL A;  1M8C A;  2LUY A;  3QTL D;  3OXL A;  1IW4 A;  2ENN A;  2OD1 A;  3OL0 A;  1YTP A;  1TBQ R;  1PTQ A;  2GVI A;  2GKR I;  4E1R A;  1KBF A;  1LR7 A;  1DS3 I;  2ROW A;  1XA6 A;  2DIP A;  1LR9 A;  4OVO A;  1SGD I;  1KBE A;  1OYV I;  2JXD A;  2L7X A;  1KMA A;  2E73 A;  2VRW B;  1IY6 A;  2J87 A;  1TOT A;  1SGQ I;  3RU0 A;  1CSO I;  1AN1 I;  3PDN A;  1MT1 A;  2GKV A;  1M8B A;  1TBN A;  5DAE A;  2JYY A;  2N52 A;  2L8E A;  1BMO A;  2WVJ A;  3OXF A;  2DB6 A;  3E2I A;  4SGB I;  2V1C A;  1CT0 I;  3QWP A;  3UGD A;  1X74 A;  3SGB I;  2SGE I;  1XBT A;  2ARP F;  3SEK C;  3VDP A;  4JCV E;  2NU0 I;  2QQE A;  4UXI A;  3UGL A;  2F3C I;  1X4S A;  3UEJ A;  1TBO A;  3B4V C;  1V1H A;  1W4R A;  3D00 A;  2E5R A;  1NUB A;  1Y1B A;  1HJA I;  2KCX A;  2N71 A;  1CGI I;  2FNF X;  2XRC A;  3MEK A;  1FYB A;  2B8T A;  1R79 A;  2ENZ A;  5FUV A;  3KY9 A;  2BUS A;  2QQC A;  4HGU A;  5FUY A;  2SGP I;  2KMO A;  1SGN I;  1OMT A;  5FUX A;  1TUS A;  1UVG A;  4FKD A;  5JHW C;  1HPT A;  2YQP A;  3HH2 C;  1Y8F A;  1W3S A;  2N17 A;  3VE5 A;  2NU3 I;  3UFF A;  3OVO A;  2OVO A;  1U5K A;  2A20 A;  2N1A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...