1TIJA

3d domain-swapped human cystatin c with amyloid-like intermolecular beta-sheets
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
PRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D domain-swapped human cystatin C with amyloidlike intermolecular beta-sheets.
pubmed doi rcsb
molecule keywords Cystatin C
molecule tags Hydrolase inhibitor
source organism Homo sapiens
total genus 16
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tijA00
1N5PA 4N6V0 4N6LA 3PXMA 4N6MA 1TIJA 1IV9A 1IV7A 1ROAA 1R4CA 1NB5I 1STFI 3MWZA 1GD3A 4N6TA 1N9JA 3KSED 3UL6A 3PS8A 3KFQC 1FA3A 2BO9B 1CEWI 2W9QA 1LXEA 3PYJA 4IT7A 1EQKA 1KWIA 4CCVA 1MOLA 4LZIA 3Q2PA 1MNLA 4ZM8A 3QRDA 3SVAA 1A90A 1WNHA 3LH4A 1CYVA 2OCTA 3IMAB 1FUWA 4N6UA 3L0RA 5EQLA 1RN7A 5ELJA 1NB3I 5A0OB 4N6OB 1N5HA 3NX0A 4EYCA 5LC6A 5ELUA 1M9GA 2KXGA 1DVDA 4N6NB 3S67A 1DVCA 1YVBI 1G96A 1GD4A 1PFPA 3UL5A 3GAXA 4TX4A 1CYUA 2W9PA 1A67A 2CH9A 2O9UX 5LC7A 3K9MC
chains in the Genus database with same CATH superfamily
2BHMA 1ZGXA 2LYXA 3WA3A 2B24B 2CFLA 4EW5A 1BNRA 2XGLA 3SYUA 3X41A 4N6LA 4EV5A 3CC43 3MSOA 1GMQA 1TUHA 5CK6A 1BSDA 1BRJA 1T2IA 4HJLB 1W6GA 2GBXB 3CCU3 2CHCA 2XFSA 1S5AA 2Z76A 3BNCA 4J9AA 1KD14 3CXC2 2W0QA 1IQ8A 1WTHA 5AEUB 1NU3A 2OWPA 3GZBA 2P05A 1I2EA 3B7CA 3H3HA 1YGWA 3EN1B 3LTBA 3O8YA 2O3OA 2XSOB 1LVNA 3NUVA 4FCZA 4X2OA 3RNTA 4BL3A 4R80A 1FGQA 3D3LA 3SOYA 3FKAA 4I5QA 1PU4A 3S29A 5IG0A 1ZS7A 9RNTA 1RN4A 1UCIA 4HM0B 3ALAA 1IQYA 2QIYA 4MMXB 1DE3A 1RGKA 2JQ5A 2BU4A 2IY2A 1C7HA 3OWSA 2OOVA 1E97A 1FGTA 3B8LA 3UL6A 4FMDA 3PS8A 1BIRA 1K41A 1MWRA 2BO9B 4RBNA 3WDGB 1CEWI 5CXOA 4O02B 3I0YA 3CC73 3T8UA 2CX1A 2F99A 3GWRA 1JRQA 1GS3A 1QMAA 3NQYA 3EBYA 5STDA 5AI1A 4IT7A 1EQKA 1JN5A 4WFOA 1KWIA 1YHQ3 1S723 3AGNA 5IW9A 3MPHA 1TFKA 3CCE3 5M1AA 1RGHA 2AAEA 1M1K4 1YIJ3 2OTJ3 1GY5A 3G16A 5FGOA 1SIHA 1US1A 3DMCA 3WMDA 6GSPA 3SVAA 1NDOB 1IDPA 1TRQA 2C11A 5EVHA 3D4AA 4XDWA 5M18A 2K0MA 3EB8A 4WYKB 1K8A4 1LOVA 2A15A 2OCTA 4AEQA 2AADA 2FGTA 1UI8A 1FUTA 4JRFA 1BUJA 1FUWA 3BB9A 1B21A 4XBXA 1KC84 4N6UA 1BRNL 4L8PA 1BVIA 1B20A 4AKZA 2P09A 5TGNA 2F98A 2SBLA 4LGQA 2HMOB 3FSDA 1K28A 3KCHA 4OVMA 2CG1A 5A0OB 2M7OA 3IPTA 3KKGA 5AIIA 1D6YA 3F8XA 3BLZA 2CK3H 1W01A 4GSPA 1FGMA 3LMLA 1W2ZA 1QVG2 5ELUA 1M9GA 3NBBA 2KXGA 1A2PA 1DVDA 1ZO2A 1G0TA 2L4VA 2D42A 1RGFA 2PNCA 3STDA 3NM2A 1X1WA 1LOYA 4HYZA 3MG2A 3T0UA 1TP6A 1JB2A 1FUSA 1G96A 2W2CA 1Z1SA 5M19A 3F7XA 2Q07A 1B3SA 3BNDA 2IMJA 3MYTA 2XF3A 3PZWA 1NWWA 1UUGB 1BNEA 3GRDA 4MEIA 4TX4A 4AKYA 3SEDA 4GL6A 3TDGA 2QEX3 2B1XB 1MWSA 3WR2A 3FCSB 1ISKA 2YFLB 2Z6BA 1VQP3 5BVBA 2XRXB 4LSOA 1O7PB 2D1WA 1W7CA 2CH9A 2H0IA 3DGMA 4FCJA 1RN1A 1RNBA 4KZ1A 4HM1B 1OCVA 1RJOA 3HIIA 1JJ22 1A2KA 4XBTA 2WGOA 3MG1A 3UNLA 1O7NB 2OTL3 1CQSA 5HOHA 2QGUA 3DXOA 5DRVA 4HM2B 1TIJA 4N6MA 5HGRA 1VQ63 1GOYA 4HAAA 2CKFB 5RNTA 3CME3 4U13A 5G2GA 3V98A 1K9M4 2YFJB 4WYKA 1ROAA 4LEHA 3SX1A 5IG3A 1YJN3 1N9EA 1R4CA 2ZHXB 1DYUA 1R4YA 4R4KA 1B2MA 2E2UA 1WQLB 1RGEA 3RGRA 3VF1A 1IQXA 5IENA 1STDA 1STFI 2CC3A 3MWZA 2ZA4A 1BNIA 1U8CB 2F5MA 1JNQA 1FW7A 2K54A 1TFOA 3LTCA 2UUGC 1GD3A 1I0XA 1JZDA 2XSHB 2HMJB 1BU4A 3CC23 1Q824 3EJVA 4NREA 2HMKB 5IF6A 2CWTA 3Q3FA 4IPBA 5JBSA 5EEOA 3KZTA 3KFQC 3DGNA 7GSPA 1FA3A 3I563 2W9QA 1RHLA 3D9RA 3ZG0A 1OHPA 1YIT3 1BRGA 1CH0A 1RCKA 2Z77A 1JB5A 3BIRA 4H3UA 1GYBA 4HZ9B 4BIRA 1V58A 3NHXA 3AGOA 4HKVB 4L8OA 1VQ73 4J5KA 1MGRA 3LZAA 1TRPA 4LZIA 3ZFZA 3SLUA 1RGGA 2KF3A 3KIIA 1X1UA 1I3FA 1OGXA 1QAKA 2OQEC 3PGBA 3Q2PA 1AY7A 2UX0A 3X42A 1I3IA 2F4YA 1IU7A 1WNHA 2CIUA 2IYJA 3LH4A 3CPW2 1Q814 3JUOA 2UGIA 3NV0A 4BTYA 2L1SA 3OV4A 4KFDA 1BUQA 2GXFA 1TJDA 2W56B 3AHWA 7STDA 1VQN3 3PCSA 3MKIA 1RLSA 1RDSA 2Z7AA 1QVF2 3HIGA 1LNIA 1IK3A 3EF8A 1BNGA 3HX8A 5JPUA 4HVNA 5KP4A 4XBYA 4OUQA 3MHEA 4K1UA 1O7MB 1OH0A 2CWUA 2CX0A 1ULJB 4KT3B 1HZ1A 5IEOA 2RCDA 1IT7A 1I0VA 1UUWB 4N3VA 6RNTA 1VQQA 1TU5A 3FG4A 2GEXA 1FGRA 3CCV3 1X1XA 2RBIA 5LC6A 3UJMA 1VQ43 4R1KA 1J2BA 1HYFA 3A5EA 5AIGA 1UCKA 4H61A 4N6NB 2I9WA 6STDA 1GMPA 3ER7A 3F40A 2RSXA 3M8CA 3AMOB 3AHSA 4K1VA 1DVCA 1YVBI 2HMNB 1O7WB 3UB1A 3WOEB 1PFPA 3GZYB 1JKGB 1MGWA 3A76A 3GZXB 4HM8B 4STDA 1TTOA 5D83A 4BL2A 3GSPA 1IVXA 1A2VA 2H0GA 5I97A 4R9LA 1AVKA 1BGSA 3JUMA 4FCMA 5IG4A 1UCJA 1GMRA 3EX9A 2QA43 3LXUX 3K63A 2RNTA 2O9UX 4XDVA 1W6CA 1SIIA 1BRIA 1GOUA 3T8NA 1N5PA 4EV2A 4N6V0 4WWUC 1FGOA 3BNEA 3DGLA 2IA7A 3PXMA 1LOWA 4LMIA 3N9HA 3F8HA 1W00A 3BNBA 1FZUA 2KF6A 3OWUA 1SJWA 1G02A 1U5OA 3Q90A 2XGNA 4ORLA 4RNTA 3CCR3 2CFDA 3KSPA 4FR9A 1IV7A 1K734 3S5CA 1UGIA 2WOHA 1BOXA 3DGOA 3SXXA 1OF5B 2W56A 3NBJA 1IVVA 3LYGA 5AYSC 1EEJA 1Y4KA 1ROVA 3NV0B 7RNTA 1EUIC 2WOFA 1QAFA 3G4S3 1V74A 3E99A 1JZOA 1HU9A 2GU1A 1LQMB 3EBTA 3S27A 8CHOA 3RDEA 1JBSA 1BRHA 1EKMA 2F56A 4MJDA 4N6TA 1N9JA 3KSED 2ZDJA 1W6YA 2GU3A 4EC6A 3JUPA 4NHFA 3G0KA 3WOFB 4EXRA 1VQM3 1FYSA 4EBGA 1DMMA 3FF2A 5G1KA 1YJ93 1BRSA 3PYJA 1ASKA 4LYLB 3F7SA 2BMRB 4BTXA 3AMOA 4KFEA 1NJI4 1JBTA 2CG0A 2CFKA 2KF4A 4CCVA 3FF0A 5CF2A 3H51A 4RNZA 1Q40B 1JKGA 1LNHA 1BAOA 5CLKA 1VQ53 3OWYA 3QK9A 1NO3A 1BNJA 1MNLA 1SQWA 1N8QA 3DUKA 3EC9A 3RGAA 4O2HA 1NNVA 1RGAA 2BIRA 2FXTA 3QRDA 3CD63 1B2SA 2J8XB 3D5GA 3DGYA 3LT9A 4J8TA 1CYVA 1RRLA 1W02A 3ROBA 1Q9EA 1B2XA 1BNFA 4KFFA 3PCRA 5BIRA 1RNTA 2YFIB 4G1MB 1I8VA 1RCLA 1UW1A 3J7Yd 2E2VA 3HZPA 3JUNA 3WHOA 3L0RA 3N8BA 1RN7A 1B27A 1LQGC 4OK0A 3URPA 1UGHI 4HM3B 5ELJA 1PYLA 1M1XB 5KP1A 1VQ93 4RNYA 3EHCA 5AEWB 1WMNA 2MF7A 1VQL3 1RTUA 4N6OB 4DKIA 1N5HA 3FG1A 1I2GA 3DY5A 3KE7A 2BNGA 2GBWB 4EYCA 3CCQ3 2YX9A 1AV4A 1WMPA 1OF5A 4GHOA 2CFGA 3WA2X 3EE1A 2KRTA 1JB4A 3G8ZA 1DETA 2E2TA 1MWUA 1Q42A 2HOHA 2Y73A 3JUQA 2OOVC 3NQZA 1RMSA 2ZL8A 1VQ83 1BSAA 3D79A 1T5YA 1YNVX 3U97A 1C54A 4NPBA 3CCJ3 1AR0A 4MMZB 1WMOA 1L5GB 3GAXA 2LQVA 2WO0A 5D81A 3LOYA 5IEPA 3NXJA 2CFWA 4JF8A 2BMOB 3DM8A 1OHSA 2P0MA 1Q7HA 1D6ZA 4O3VA 1UUVB 2F5WA 3CCS3 3OX9A 1A67A 1Q7Y4 2IUJA 3V92A 1VZZA 4O8SA 1IVWA 3FH1A 5LC7A 2KF5A 3K9MC 2OQEA 5FW5A 3X40A 1RSNA 4FMBA 1SARA 2RGQA 5GSPA 1Q40A 2K3DA 1IT8A 3LT8A 1M904 3K5TA 1LOXA 2MC8A 3B4PA 1UDII 1GOVA 1IV9A 3ECFA 3U1WA 1BANA 1AVLA 3DZLA 2RFRA 3S28A 3V99A 3N54B 1NB5I 5AIHA 3G6E3 1DMQA 3FLJA 1N8R4 1UI7A 3K0ZA 5KP3A 1E3VA 3F9SA 1I2FA 3BU4A 3LTAA 2FNQA 1IYYA 5DREA 4FMCA 2C4BA 1SPUA 1JV2B 2XR8B 3F14A 3EQQB 4HOHA 3X3ZA 1D6UA 2Y74A 3D5IA 1T2HA 4XB5A 2R4IA 1Q864 1BNSA 4BU4A 4ILFA 3CCL3 1GY7A 1T3BA 1IVUA 1RRHA 1W4NA 4HM5B 3WODG 8RNTA 1E3RA 1KSIA 2XFTA 1RKYA 3FZWA 1YVSA 3HK4A 1LXEA 1HKXA 1PY3A 3CPOA 4KVHA 3DH2A 3HI7A 4CJNA 1UCLA 2ML6A 3CMA3 2ML5A 1BRKA 4RZMA 5IG5A 1GSPA 3CU3A 2F86B 4WP5A 4K90B 1MOLA 1F8NA 1X1YA 3OW22 4MMYB 4CPKA 2W03A 3CCM3 4L7KA 4K61A 3MG3A 4ZM8A 4HZBB 2P38A 1A90A 1RGCA 1RGLA 4J5GA 5IERA 1QALA 1BSCA 1BSBA 1I70A 1O7HB 2CW9A 1OHOA 2BT3A 4WHAA 4I4KA 1O7GB 1MWTA 1V57A 3K7CA 3B4OA 3CNMA 3IMAB 4HBRA 4IIAA 2GEYA 3SOAA 1GY6A 4BTWA 3VGNA 1OGZA 2CWVA 2STDA 4Q53A 1DMNA 5EQLA 4PEJA 5AYRB 1NB3I 1W5ZA 1B2ZA 1ULIB 3G713 2R41A 1EG9B 2IUKA 2KCDA 4HM4B 1QJGA 3GZRA 3NX0A 3NM7A 2V1LA 3CNXA 1KQS2 2KAAA 4QWTA 3EN8A 4R9KA 3X3XA 1OACA 3IJEB 1JBRA 1OUNA 3Q1CA 3FGYA 1VQO3 2JDIH 2INXA 3JVCA 2W6JH 3HOHA 3OXAA 3S67A 2XH9A 1JN5B 4HM6B 1EA2A 5G1LA 5BU4A 5CF1A 1YI23 1AQZA 2W04A 1YJW3 3ZG5A 3VSYA 1GD4A 4GB5A 1LRAA 1BSEA 5AIFA 2GSPA 2HMMB 3UL5A 4XM4A 4CDLA 2HMLB 2BMQB 2H0HA 3NBRA 5BXQA 1VQK3 2XEPA 1W2B2 2PZVA 3KN4A 5D82A 1CYUA 4HM7B 4X2HA 3LTDA 2C10A 2WGQA 2W9PA 3I553 3X3YA 2P0XA 1OPYA 3FG3A 4FMAA 5JPPA 1B2UA 1ZX2A 2SARA 1YGEA
chains in the Genus database with same CATH topology
2BHMA 2LYXA 3WA3A 2B24B 2CFLA 2XGLA 3X41A 4EV5A 4N6LA 3CC43 3MSOA 1TUHA 5CK6A 4HJLB 1W6GA 2GBXB 3CCU3 2CHCA 2XFSA 1S5AA 2Z76A 3BNCA 4J9AA 1KD14 3CXC2 2W0QA 1IQ8A 1WTHA 5AEUB 1NU3A 2OWPA 3GZBA 2P05A 3B7CA 3H3HA 3O8YA 3EN1B 3LTBA 4X2OA 2O3OA 2XSOB 1LVNA 3NUVA 4FCZA 4R80A 1FGQA 3D3LA 3SOYA 3FKAA 1PU4A 3S29A 5IG0A 4HM0B 3ALAA 1IQYA 2QIYA 4MMXB 2JQ5A 1C7HA 3OWSA 2OOVA 1E97A 1FGTA 3B8LA 3UL6A 4FMDA 3PS8A 1K41A 2BO9B 4RBNA 3WDGB 1CEWI 5CXOA 4O02B 3I0YA 3CC73 3T8UA 3GWRA 2F99A 1JRQA 1GS3A 1QMAA 3NQYA 3EBYA 5STDA 5AI1A 4IT7A 1EQKA 1JN5A 4WFOA 1KWIA 1YHQ3 1S723 5IW9A 3MPHA 1TFKA 3CCE3 1M1K4 1YIJ3 2OTJ3 1GY5A 3G16A 5FGOA 1SIHA 1US1A 3DMCA 3WMDA 3SVAA 1NDOB 1IDPA 2C11A 5EVHA 4XDWA 2K0MA 3EB8A 4WYKB 1K8A4 2A15A 2OCTA 4AEQA 2FGTA 1UI8A 4JRFA 1FUWA 3BB9A 4XBXA 1KC84 4N6UA 4L8PA 4AKZA 2P09A 5TGNA 2F98A 2SBLA 4LGQA 2HMOB 3FSDA 1K28A 4OVMA 2CG1A 5A0OB 2M7OA 3IPTA 3KKGA 5AIIA 1D6YA 3F8XA 3BLZA 2CK3H 1W01A 1FGMA 3LMLA 1W2ZA 1QVG2 5ELUA 1M9GA 3NBBA 2KXGA 1DVDA 1ZO2A 2L4VA 2D42A 2PNCA 3STDA 3NM2A 4HYZA 3MG2A 3T0UA 1TP6A 1JB2A 1G96A 2W2CA 1Z1SA 3F7XA 2Q07A 3MYTA 3BNDA 2IMJA 3PZWA 2XF3A 4MEIA 1NWWA 4TX4A 4AKYA 3GRDA 3CD63 3SEDA 4GL6A 3TDGA 2QEX3 2B1XB 3FCSB 1ISKA 2YFLB 2Z6BA 1VQP3 5BVBA 2XRXB 4LSOA 1O7PB 2D1WA 1W7CA 2CH9A 3DGMA 4FCJA 4KZ1A 4HM1B 1OCVA 1RJOA 3HIIA 1JJ22 1A2KA 4XBTA 2WGOA 3MG1A 3UNLA 1O7NB 2OTL3 1CQSA 2QGUA 3DXOA 5DRVA 4HM2B 1TIJA 4N6MA 5HGRA 1VQ63 2CKFB 3CME3 4U13A 5G2GA 3V98A 2YFJB 4WYKA 1ROAA 4LEHA 3SX1A 5IG3A 1YJN3 1N9EA 1R4CA 1DYUA 4R4KA 2E2UA 1WQLB 3RGRA 3VF1A 1IQXA 5IENA 1STDA 1STFI 2CC3A 3MWZA 1U8CB 1JNQA 2K54A 1TFOA 3LTCA 1GD3A 2XSHB 3CC23 1Q824 2HMJB 3EJVA 4NREA 2HMKB 5IF6A 2CWTA 4IPBA 5JBSA 5EEOA 3KZTA 3KFQC 3DGNA 1FA3A 3I563 2W9QA 3D9RA 1OHPA 1YIT3 2Z77A 4H3UA 1JB5A 1GYBA 4HZ9B 3NHXA 1VQ73 4HKVB 4L8OA 3LZAA 4LZIA 3SLUA 3KIIA 3Q2PA 1OGXA 2OQEC 1QAKA 3PGBA 3X42A 1K9M4 2UX0A 1IU7A 1WNHA 2CIUA 3LH4A 3CPW2 1Q814 3JUOA 3NV0A 4BTYA 3OV4A 4KFDA 1BUQA 2GXFA 2W56B 7STDA 1VQN3 3PCSA 3MKIA 2Z7AA 1QVF2 3HIGA 1IK3A 3EF8A 3HX8A 5JPUA 4HVNA 5KP4A 4XBYA 4OUQA 3MHEA 4K1UA 1O7MB 1OH0A 2CWUA 1ULJB 5IEOA 2RCDA 1IT7A 1UUWB 4N3VA 1TU5A 3FG4A 2GEXA 1FGRA 3CCV3 5LC6A 3UJMA 1VQ43 4R1KA 1J2BA 5AIGA 4H61A 4N6NB 2I9WA 6STDA 3ER7A 3F40A 2RSXA 3M8CA 3AMOB 4K1VA 1DVCA 1YVBI 2HMNB 1O7WB 3UB1A 3WOEB 1PFPA 3GZYB 1JKGB 3A76A 3GZXB 4HM8B 4STDA 5D83A 1IVXA 1A2VA 5I97A 4R9LA 1AVKA 3JUMA 4FCMA 5IG4A 3EX9A 2QA43 3LXUX 3K63A 2O9UX 4XDVA 1W6CA 1SIIA 3T8NA 1N5PA 4EV2A 4N6V0 4WWUC 1FGOA 3BNEA 3DGLA 2IA7A 3PXMA 4LMIA 3N9HA 3F8HA 1W00A 3BNBA 3OWUA 1SJWA 1U5OA 3Q90A 2XGNA 4ORLA 3CCR3 1K734 2CFDA 3KSPA 4FR9A 1IV7A 3S5CA 2WOHA 3DGOA 3SXXA 1OF5B 2W56A 3NBJA 1IVVA 3LYGA 5AYSC 1Y4KA 1ROVA 3NV0B 2WOFA 1QAFA 3G4S3 1V74A 3E99A 2GU1A 1HU9A 3EBTA 8CHOA 3S27A 3RDEA 1EKMA 4MJDA 4N6TA 1N9JA 3KSED 2ZDJA 1W6YA 2GU3A 4EC6A 3JUPA 4NHFA 3G0KA 3WOFB 4EXRA 1VQM3 4EBGA 1DMMA 3FF2A 1YJ93 3PYJA 1ASKA 3F7SA 2BMRB 4BTXA 3AMOA 4KFEA 1NJI4 2CG0A 2CFKA 4CCVA 3FF0A 5CF2A 3H51A 4RNZA 1Q40B 1JKGA 1LNHA 5CLKA 1VQ53 3OWYA 3QK9A 1NO3A 1MNLA 3RGAA 1SQWA 1N8QA 3DUKA 3EC9A 4O2HA 3QRDA 2FXTA 3LT9A 4J8TA 1CYVA 1RRLA 1W02A 3ROBA 4KFFA 3PCRA 2YFIB 3J7Yd 4G1MB 1UW1A 2E2VA 3HZPA 3JUNA 3L0RA 3N8BA 1RN7A 4OK0A 5ELJA 4HM3B 1M1XB 5KP1A 1VQ93 4RNYA 3EHCA 5AEWB 1WMNA 2MF7A 1VQL3 4N6OB 1N5HA 3FG1A 3DY5A 3KE7A 2BNGA 2GBWB 4EYCA 3CCQ3 2YX9A 1AV4A 1WMPA 1OF5A 3WA2X 2CFGA 3EE1A 2KRTA 1JB4A 3G8ZA 2E2TA 1Q42A 2Y73A 3JUQA 2OOVC 3NQZA 2ZL8A 1VQ83 1T5YA 3U97A 3CCJ3 1AR0A 4MMZB 1WMOA 1L5GB 3GAXA 2LQVA 2WO0A 5D81A 3LOYA 5IEPA 3NXJA 2CFWA 4JF8A 2BMOB 3DM8A 1OHSA 2P0MA 1D6ZA 4O3VA 1UUVB 3CCS3 3OX9A 1A67A 1Q7Y4 2IUJA 3V92A 1VZZA 4O8SA 1IVWA 3FH1A 5LC7A 2OQEA 3K9MC 3X40A 5FW5A 4FMBA 2RGQA 1Q40A 1IT8A 3LT8A 1M904 3K5TA 1LOXA 2MC8A 3B4PA 1IV9A 3ECFA 3U1WA 1AVLA 3DZLA 2RFRA 3S28A 3V99A 3N54B 1NB5I 5AIHA 3G6E3 1DMQA 3FLJA 1N8R4 1UI7A 3K0ZA 5KP3A 1E3VA 3F9SA 3LTAA 2FNQA 5DREA 4FMCA 1SPUA 1JV2B 2XR8B 3F14A 3EQQB 3X3ZA 1D6UA 2Y74A 4XB5A 2R4IA 1Q864 3CCL3 1GY7A 3WODG 1IVUA 1RRHA 1W4NA 4HM5B 1E3RA 1KSIA 2XFTA 1RKYA 3FZWA 3HK4A 1LXEA 1HKXA 3CPOA 4KVHA 3HI7A 2ML6A 3CMA3 2ML5A 4RZMA 5IG5A 3CU3A 2F86B 4WP5A 4K90B 1MOLA 1F8NA 3OW22 4MMYB 2W03A 3CCM3 4L7KA 4K61A 3MG3A 4ZM8A 4HZBB 2P38A 1A90A 5IERA 1QALA 1O7HB 2CW9A 1OHOA 2BT3A 4WHAA 4I4KA 1O7GB 3K7CA 3B4OA 3CNMA 3IMAB 4HBRA 4IIAA 2GEYA 3SOAA 1GY6A 4BTWA 3VGNA 1OGZA 2CWVA 2STDA 4Q53A 1DMNA 5EQLA 4PEJA 5AYRB 1NB3I 1W5ZA 1ULIB 3G713 1EG9B 2IUKA 2KCDA 4HM4B 1QJGA 3GZRA 3NX0A 3NM7A 2V1LA 3CNXA 1KQS2 4QWTA 3EN8A 4R9KA 3X3XA 1OACA 3IJEB 1OUNA 3Q1CA 3FGYA 1VQO3 2JDIH 2INXA 3JVCA 2W6JH 3S67A 3OXAA 2XH9A 1JN5B 4HM6B 1EA2A 5CF1A 1YI23 1YJW3 2W04A 3VSYA 1GD4A 4GB5A 5AIFA 2HMMB 3UL5A 4XM4A 4CDLA 2HMLB 2BMQB 3NBRA 1VQK3 5BXQA 1W2B2 2XEPA 2PZVA 3KN4A 5D82A 1CYUA 4HM7B 4X2HA 3LTDA 2C10A 2WGQA 2W9PA 3I553 3X3YA 2P0XA 1OPYA 3FG3A 4FMAA 5JPPA 1ZX2A 1YGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5P A;  4N6V 0;  4N6L A;  3PXM A;  4N6M A;  1TIJ A;  1IV9 A;  1IV7 A;  1ROA A;  1R4C A;  1NB5 I;  1STF I;  3MWZ A;  1GD3 A;  4N6T A;  1N9J A;  3KSE D;  3UL6 A;  3PS8 A;  3KFQ C;  1FA3 A;  2BO9 B;  1CEW I;  2W9Q A;  1LXE A;  3PYJ A;  4IT7 A;  1EQK A;  1KWI A;  4CCV A;  1MOL A;  4LZI A;  3Q2P A;  1MNL A;  4ZM8 A;  3QRD A;  3SVA A;  1A90 A;  1WNH A;  3LH4 A;  1CYV A;  2OCT A;  3IMA B;  1FUW A;  4N6U A;  3L0R A;  5EQL A;  1RN7 A;  5ELJ A;  1NB3 I;  5A0O B;  4N6O B;  1N5H A;  3NX0 A;  4EYC A;  5LC6 A;  5ELU A;  1M9G A;  2KXG A;  1DVD A;  4N6N B;  3S67 A;  1DVC A;  1YVB I;  1G96 A;  1GD4 A;  1PFP A;  3UL5 A;  3GAX A;  4TX4 A;  1CYU A;  2W9P A;  1A67 A;  2CH9 A;  2O9U X;  5LC7 A;  3K9M C; 
#chains in the Genus database with same CATH topology
 2BHM A;  1ZGX A;  2LYX A;  3WA3 A;  2B24 B;  2CFL A;  4EW5 A;  1BNR A;  2XGL A;  3SYU A;  3X41 A;  4N6L A;  4EV5 A;  3CC4 3;  3MSO A;  1GMQ A;  1TUH A;  5CK6 A;  1BSD A;  1BRJ A;  1T2I A;  4HJL B;  1W6G A;  2GBX B;  3CCU 3;  2CHC A;  2XFS A;  1S5A A;  2Z76 A;  3BNC A;  4J9A A;  1KD1 4;  3CXC 2;  2W0Q A;  1IQ8 A;  1WTH A;  5AEU B;  1NU3 A;  2OWP A;  3GZB A;  2P05 A;  1I2E A;  3B7C A;  3H3H A;  1YGW A;  3EN1 B;  3LTB A;  3O8Y A;  2O3O A;  2XSO B;  1LVN A;  3NUV A;  4FCZ A;  4X2O A;  3RNT A;  4BL3 A;  4R80 A;  1FGQ A;  3D3L A;  3SOY A;  3FKA A;  4I5Q A;  1PU4 A;  3S29 A;  5IG0 A;  1ZS7 A;  9RNT A;  1RN4 A;  1UCI A;  4HM0 B;  3ALA A;  1IQY A;  2QIY A;  4MMX B;  1DE3 A;  1RGK A;  2JQ5 A;  2BU4 A;  2IY2 A;  1C7H A;  3OWS A;  2OOV A;  1E97 A;  1FGT A;  3B8L A;  3UL6 A;  4FMD A;  3PS8 A;  1BIR A;  1K41 A;  1MWR A;  2BO9 B;  4RBN A;  3WDG B;  1CEW I;  5CXO A;  4O02 B;  3I0Y A;  3CC7 3;  3T8U A;  2CX1 A;  2F99 A;  3GWR A;  1JRQ A;  1GS3 A;  1QMA A;  3NQY A;  3EBY A;  5STD A;  5AI1 A;  4IT7 A;  1EQK A;  1JN5 A;  4WFO A;  1KWI A;  1YHQ 3;  1S72 3;  3AGN A;  5IW9 A;  3MPH A;  1TFK A;  3CCE 3;  5M1A A;  1RGH A;  2AAE A;  1M1K 4;  1YIJ 3;  2OTJ 3;  1GY5 A;  3G16 A;  5FGO A;  1SIH A;  1US1 A;  3DMC A;  3WMD A;  6GSP A;  3SVA A;  1NDO B;  1IDP A;  1TRQ A;  2C11 A;  5EVH A;  3D4A A;  4XDW A;  5M18 A;  2K0M A;  3EB8 A;  4WYK B;  1K8A 4;  1LOV A;  2A15 A;  2OCT A;  4AEQ A;  2AAD A;  2FGT A;  1UI8 A;  1FUT A;  4JRF A;  1BUJ A;  1FUW A;  3BB9 A;  1B21 A;  4XBX A;  1KC8 4;  4N6U A;  1BRN L;  4L8P A;  1BVI A;  1B20 A;  4AKZ A;  2P09 A;  5TGN A;  2F98 A;  2SBL A;  4LGQ A;  2HMO B;  3FSD A;  1K28 A;  3KCH A;  4OVM A;  2CG1 A;  5A0O B;  2M7O A;  3IPT A;  3KKG A;  5AII A;  1D6Y A;  3F8X A;  3BLZ A;  2CK3 H;  1W01 A;  4GSP A;  1FGM A;  3LML A;  1W2Z A;  1QVG 2;  5ELU A;  1M9G A;  3NBB A;  2KXG A;  1A2P A;  1DVD A;  1ZO2 A;  1G0T A;  2L4V A;  2D42 A;  1RGF A;  2PNC A;  3STD A;  3NM2 A;  1X1W A;  1LOY A;  4HYZ A;  3MG2 A;  3T0U A;  1TP6 A;  1JB2 A;  1FUS A;  1G96 A;  2W2C A;  1Z1S A;  5M19 A;  3F7X A;  2Q07 A;  1B3S A;  3BND A;  2IMJ A;  3MYT A;  2XF3 A;  3PZW A;  1NWW A;  1UUG B;  1BNE A;  3GRD A;  4MEI A;  4TX4 A;  4AKY A;  3SED A;  4GL6 A;  3TDG A;  2QEX 3;  2B1X B;  1MWS A;  3WR2 A;  3FCS B;  1ISK A;  2YFL B;  2Z6B A;  1VQP 3;  5BVB A;  2XRX B;  4LSO A;  1O7P B;  2D1W A;  1W7C A;  2CH9 A;  2H0I A;  3DGM A;  4FCJ A;  1RN1 A;  1RNB A;  4KZ1 A;  4HM1 B;  1OCV A;  1RJO A;  3HII A;  1JJ2 2;  1A2K A;  4XBT A;  2WGO A;  3MG1 A;  3UNL A;  1O7N B;  2OTL 3;  1CQS A;  5HOH A;  2QGU A;  3DXO A;  5DRV A;  4HM2 B;  1TIJ A;  4N6M A;  5HGR A;  1VQ6 3;  1GOY A;  4HAA A;  2CKF B;  5RNT A;  3CME 3;  4U13 A;  5G2G A;  3V98 A;  1K9M 4;  2YFJ B;  4WYK A;  1ROA A;  4LEH A;  3SX1 A;  5IG3 A;  1YJN 3;  1N9E A;  1R4C A;  2ZHX B;  1DYU A;  1R4Y A;  4R4K A;  1B2M A;  2E2U A;  1WQL B;  1RGE A;  3RGR A;  3VF1 A;  1IQX A;  5IEN A;  1STD A;  1STF I;  2CC3 A;  3MWZ A;  2ZA4 A;  1BNI A;  1U8C B;  2F5M A;  1JNQ A;  1FW7 A;  2K54 A;  1TFO A;  3LTC A;  2UUG C;  1GD3 A;  1I0X A;  1JZD A;  2XSH B;  2HMJ B;  1BU4 A;  3CC2 3;  1Q82 4;  3EJV A;  4NRE A;  2HMK B;  5IF6 A;  2CWT A;  3Q3F A;  4IPB A;  5JBS A;  5EEO A;  3KZT A;  3KFQ C;  3DGN A;  7GSP A;  1FA3 A;  3I56 3;  2W9Q A;  1RHL A;  3D9R A;  3ZG0 A;  1OHP A;  1YIT 3;  1BRG A;  1CH0 A;  1RCK A;  2Z77 A;  1JB5 A;  3BIR A;  4H3U A;  1GYB A;  4HZ9 B;  4BIR A;  1V58 A;  3NHX A;  3AGO A;  4HKV B;  4L8O A;  1VQ7 3;  4J5K A;  1MGR A;  3LZA A;  1TRP A;  4LZI A;  3ZFZ A;  3SLU A;  1RGG A;  2KF3 A;  3KII A;  1X1U A;  1I3F A;  1OGX A;  1QAK A;  2OQE C;  3PGB A;  3Q2P A;  1AY7 A;  2UX0 A;  3X42 A;  1I3I A;  2F4Y A;  1IU7 A;  1WNH A;  2CIU A;  2IYJ A;  3LH4 A;  3CPW 2;  1Q81 4;  3JUO A;  2UGI A;  3NV0 A;  4BTY A;  2L1S A;  3OV4 A;  4KFD A;  1BUQ A;  2GXF A;  1TJD A;  2W56 B;  3AHW A;  7STD A;  1VQN 3;  3PCS A;  3MKI A;  1RLS A;  1RDS A;  2Z7A A;  1QVF 2;  3HIG A;  1LNI A;  1IK3 A;  3EF8 A;  1BNG A;  3HX8 A;  5JPU A;  4HVN A;  5KP4 A;  4XBY A;  4OUQ A;  3MHE A;  4K1U A;  1O7M B;  1OH0 A;  2CWU A;  2CX0 A;  1ULJ B;  4KT3 B;  1HZ1 A;  5IEO A;  2RCD A;  1IT7 A;  1I0V A;  1UUW B;  4N3V A;  6RNT A;  1VQQ A;  1TU5 A;  3FG4 A;  2GEX A;  1FGR A;  3CCV 3;  1X1X A;  2RBI A;  5LC6 A;  3UJM A;  1VQ4 3;  4R1K A;  1J2B A;  1HYF A;  3A5E A;  5AIG A;  1UCK A;  4H61 A;  4N6N B;  2I9W A;  6STD A;  1GMP A;  3ER7 A;  3F40 A;  2RSX A;  3M8C A;  3AMO B;  3AHS A;  4K1V A;  1DVC A;  1YVB I;  2HMN B;  1O7W B;  3UB1 A;  3WOE B;  1PFP A;  3GZY B;  1JKG B;  1MGW A;  3A76 A;  3GZX B;  4HM8 B;  4STD A;  1TTO A;  5D83 A;  4BL2 A;  3GSP A;  1IVX A;  1A2V A;  2H0G A;  5I97 A;  4R9L A;  1AVK A;  1BGS A;  3JUM A;  4FCM A;  5IG4 A;  1UCJ A;  1GMR A;  3EX9 A;  2QA4 3;  3LXU X;  3K63 A;  2RNT A;  2O9U X;  4XDV A;  1W6C A;  1SII A;  1BRI A;  1GOU A;  3T8N A;  1N5P A;  4EV2 A;  4N6V 0;  4WWU C;  1FGO A;  3BNE A;  3DGL A;  2IA7 A;  3PXM A;  1LOW A;  4LMI A;  3N9H A;  3F8H A;  1W00 A;  3BNB A;  1FZU A;  2KF6 A;  3OWU A;  1SJW A;  1G02 A;  1U5O A;  3Q90 A;  2XGN A;  4ORL A;  4RNT A;  3CCR 3;  2CFD A;  3KSP A;  4FR9 A;  1IV7 A;  1K73 4;  3S5C A;  1UGI A;  2WOH A;  1BOX A;  3DGO A;  3SXX A;  1OF5 B;  2W56 A;  3NBJ A;  1IVV A;  3LYG A;  5AYS C;  1EEJ A;  1Y4K A;  1ROV A;  3NV0 B;  7RNT A;  1EUI C;  2WOF A;  1QAF A;  3G4S 3;  1V74 A;  3E99 A;  1JZO A;  1HU9 A;  2GU1 A;  1LQM B;  3EBT A;  3S27 A;  8CHO A;  3RDE A;  1JBS A;  1BRH A;  1EKM A;  2F56 A;  4MJD A;  4N6T A;  1N9J A;  3KSE D;  2ZDJ A;  1W6Y A;  2GU3 A;  4EC6 A;  3JUP A;  4NHF A;  3G0K A;  3WOF B;  4EXR A;  1VQM 3;  1FYS A;  4EBG A;  1DMM A;  3FF2 A;  5G1K A;  1YJ9 3;  1BRS A;  3PYJ A;  1ASK A;  4LYL B;  3F7S A;  2BMR B;  4BTX A;  3AMO A;  4KFE A;  1NJI 4;  1JBT A;  2CG0 A;  2CFK A;  2KF4 A;  4CCV A;  3FF0 A;  5CF2 A;  3H51 A;  4RNZ A;  1Q40 B;  1JKG A;  1LNH A;  1BAO A;  5CLK A;  1VQ5 3;  3OWY A;  3QK9 A;  1NO3 A;  1BNJ A;  1MNL A;  1SQW A;  1N8Q A;  3DUK A;  3EC9 A;  3RGA A;  4O2H A;  1NNV A;  1RGA A;  2BIR A;  2FXT A;  3QRD A;  3CD6 3;  1B2S A;  2J8X B;  3D5G A;  3DGY A;  3LT9 A;  4J8T A;  1CYV A;  1RRL A;  1W02 A;  3ROB A;  1Q9E A;  1B2X A;  1BNF A;  4KFF A;  3PCR A;  5BIR A;  1RNT A;  2YFI B;  4G1M B;  1I8V A;  1RCL A;  1UW1 A;  3J7Y d;  2E2V A;  3HZP A;  3JUN A;  3WHO A;  3L0R A;  3N8B A;  1RN7 A;  1B27 A;  1LQG C;  4OK0 A;  3URP A;  1UGH I;  4HM3 B;  5ELJ A;  1PYL A;  1M1X B;  5KP1 A;  1VQ9 3;  4RNY A;  3EHC A;  5AEW B;  1WMN A;  2MF7 A;  1VQL 3;  1RTU A;  4N6O B;  4DKI A;  1N5H A;  3FG1 A;  1I2G A;  3DY5 A;  3KE7 A;  2BNG A;  2GBW B;  4EYC A;  3CCQ 3;  2YX9 A;  1AV4 A;  1WMP A;  1OF5 A;  4GHO A;  2CFG A;  3WA2 X;  3EE1 A;  2KRT A;  1JB4 A;  3G8Z A;  1DET A;  2E2T A;  1MWU A;  1Q42 A;  2HOH A;  2Y73 A;  3JUQ A;  2OOV C;  3NQZ A;  1RMS A;  2ZL8 A;  1VQ8 3;  1BSA A;  3D79 A;  1T5Y A;  1YNV X;  3U97 A;  1C54 A;  4NPB A;  3CCJ 3;  1AR0 A;  4MMZ B;  1WMO A;  1L5G B;  3GAX A;  2LQV A;  2WO0 A;  5D81 A;  3LOY A;  5IEP A;  3NXJ A;  2CFW A;  4JF8 A;  2BMO B;  3DM8 A;  1OHS A;  2P0M A;  1Q7H A;  1D6Z A;  4O3V A;  1UUV B;  2F5W A;  3CCS 3;  3OX9 A;  1A67 A;  1Q7Y 4;  2IUJ A;  3V92 A;  1VZZ A;  4O8S A;  1IVW A;  3FH1 A;  5LC7 A;  2KF5 A;  3K9M C;  2OQE A;  5FW5 A;  3X40 A;  1RSN A;  4FMB A;  1SAR A;  2RGQ A;  5GSP A;  1Q40 A;  2K3D A;  1IT8 A;  3LT8 A;  1M90 4;  3K5T A;  1LOX A;  2MC8 A;  3B4P A;  1UDI I;  1GOV A;  1IV9 A;  3ECF A;  3U1W A;  1BAN A;  1AVL A;  3DZL A;  2RFR A;  3S28 A;  3V99 A;  3N54 B;  1NB5 I;  5AIH A;  3G6E 3;  1DMQ A;  3FLJ A;  1N8R 4;  1UI7 A;  3K0Z A;  5KP3 A;  1E3V A;  3F9S A;  1I2F A;  3BU4 A;  3LTA A;  2FNQ A;  1IYY A;  5DRE A;  4FMC A;  2C4B A;  1SPU A;  1JV2 B;  2XR8 B;  3F14 A;  3EQQ B;  4HOH A;  3X3Z A;  1D6U A;  2Y74 A;  3D5I A;  1T2H A;  4XB5 A;  2R4I A;  1Q86 4;  1BNS A;  4BU4 A;  4ILF A;  3CCL 3;  1GY7 A;  1T3B A;  1IVU A;  1RRH A;  1W4N A;  4HM5 B;  3WOD G;  8RNT A;  1E3R A;  1KSI A;  2XFT A;  1RKY A;  3FZW A;  1YVS A;  3HK4 A;  1LXE A;  1HKX A;  1PY3 A;  3CPO A;  4KVH A;  3DH2 A;  3HI7 A;  4CJN A;  1UCL A;  2ML6 A;  3CMA 3;  2ML5 A;  1BRK A;  4RZM A;  5IG5 A;  1GSP A;  3CU3 A;  2F86 B;  4WP5 A;  4K90 B;  1MOL A;  1F8N A;  1X1Y A;  3OW2 2;  4MMY B;  4CPK A;  2W03 A;  3CCM 3;  4L7K A;  4K61 A;  3MG3 A;  4ZM8 A;  4HZB B;  2P38 A;  1A90 A;  1RGC A;  1RGL A;  4J5G A;  5IER A;  1QAL A;  1BSC A;  1BSB A;  1I70 A;  1O7H B;  2CW9 A;  1OHO A;  2BT3 A;  4WHA A;  4I4K A;  1O7G B;  1MWT A;  1V57 A;  3K7C A;  3B4O A;  3CNM A;  3IMA B;  4HBR A;  4IIA A;  2GEY A;  3SOA A;  1GY6 A;  4BTW A;  3VGN A;  1OGZ A;  2CWV A;  2STD A;  4Q53 A;  1DMN A;  5EQL A;  4PEJ A;  5AYR B;  1NB3 I;  1W5Z A;  1B2Z A;  1ULI B;  3G71 3;  2R41 A;  1EG9 B;  2IUK A;  2KCD A;  4HM4 B;  1QJG A;  3GZR A;  3NX0 A;  3NM7 A;  2V1L A;  3CNX A;  1KQS 2;  2KAA A;  4QWT A;  3EN8 A;  4R9K A;  3X3X A;  1OAC A;  3IJE B;  1JBR A;  1OUN A;  3Q1C A;  3FGY A;  1VQO 3;  2JDI H;  2INX A;  3JVC A;  2W6J H;  3HOH A;  3OXA A;  3S67 A;  2XH9 A;  1JN5 B;  4HM6 B;  1EA2 A;  5G1L A;  5BU4 A;  5CF1 A;  1YI2 3;  1AQZ A;  2W04 A;  1YJW 3;  3ZG5 A;  3VSY A;  1GD4 A;  4GB5 A;  1LRA A;  1BSE A;  5AIF A;  2GSP A;  2HMM B;  3UL5 A;  4XM4 A;  4CDL A;  2HML B;  2BMQ B;  2H0H A;  3NBR A;  5BXQ A;  1VQK 3;  2XEP A;  1W2B 2;  2PZV A;  3KN4 A;  5D82 A;  1CYU A;  4HM7 B;  4X2H A;  3LTD A;  2C10 A;  2WGQ A;  2W9P A;  3I55 3;  3X3Y A;  2P0X A;  1OPY A;  3FG3 A;  4FMA A;  5JPP A;  1B2U A;  1ZX2 A;  2SAR A;  1YGE A; 
#chains in the Genus database with same CATH homology
 2BHM A;  2LYX A;  3WA3 A;  2B24 B;  2CFL A;  2XGL A;  3X41 A;  4EV5 A;  4N6L A;  3CC4 3;  3MSO A;  1TUH A;  5CK6 A;  4HJL B;  1W6G A;  2GBX B;  3CCU 3;  2CHC A;  2XFS A;  1S5A A;  2Z76 A;  3BNC A;  4J9A A;  1KD1 4;  3CXC 2;  2W0Q A;  1IQ8 A;  1WTH A;  5AEU B;  1NU3 A;  2OWP A;  3GZB A;  2P05 A;  3B7C A;  3H3H A;  3O8Y A;  3EN1 B;  3LTB A;  4X2O A;  2O3O A;  2XSO B;  1LVN A;  3NUV A;  4FCZ A;  4R80 A;  1FGQ A;  3D3L A;  3SOY A;  3FKA A;  1PU4 A;  3S29 A;  5IG0 A;  4HM0 B;  3ALA A;  1IQY A;  2QIY A;  4MMX B;  2JQ5 A;  1C7H A;  3OWS A;  2OOV A;  1E97 A;  1FGT A;  3B8L A;  3UL6 A;  4FMD A;  3PS8 A;  1K41 A;  2BO9 B;  4RBN A;  3WDG B;  1CEW I;  5CXO A;  4O02 B;  3I0Y A;  3CC7 3;  3T8U A;  3GWR A;  2F99 A;  1JRQ A;  1GS3 A;  1QMA A;  3NQY A;  3EBY A;  5STD A;  5AI1 A;  4IT7 A;  1EQK A;  1JN5 A;  4WFO A;  1KWI A;  1YHQ 3;  1S72 3;  5IW9 A;  3MPH A;  1TFK A;  3CCE 3;  1M1K 4;  1YIJ 3;  2OTJ 3;  1GY5 A;  3G16 A;  5FGO A;  1SIH A;  1US1 A;  3DMC A;  3WMD A;  3SVA A;  1NDO B;  1IDP A;  2C11 A;  5EVH A;  4XDW A;  2K0M A;  3EB8 A;  4WYK B;  1K8A 4;  2A15 A;  2OCT A;  4AEQ A;  2FGT A;  1UI8 A;  4JRF A;  1FUW A;  3BB9 A;  4XBX A;  1KC8 4;  4N6U A;  4L8P A;  4AKZ A;  2P09 A;  5TGN A;  2F98 A;  2SBL A;  4LGQ A;  2HMO B;  3FSD A;  1K28 A;  4OVM A;  2CG1 A;  5A0O B;  2M7O A;  3IPT A;  3KKG A;  5AII A;  1D6Y A;  3F8X A;  3BLZ A;  2CK3 H;  1W01 A;  1FGM A;  3LML A;  1W2Z A;  1QVG 2;  5ELU A;  1M9G A;  3NBB A;  2KXG A;  1DVD A;  1ZO2 A;  2L4V A;  2D42 A;  2PNC A;  3STD A;  3NM2 A;  4HYZ A;  3MG2 A;  3T0U A;  1TP6 A;  1JB2 A;  1G96 A;  2W2C A;  1Z1S A;  3F7X A;  2Q07 A;  3MYT A;  3BND A;  2IMJ A;  3PZW A;  2XF3 A;  4MEI A;  1NWW A;  4TX4 A;  4AKY A;  3GRD A;  3CD6 3;  3SED A;  4GL6 A;  3TDG A;  2QEX 3;  2B1X B;  3FCS B;  1ISK A;  2YFL B;  2Z6B A;  1VQP 3;  5BVB A;  2XRX B;  4LSO A;  1O7P B;  2D1W A;  1W7C A;  2CH9 A;  3DGM A;  4FCJ A;  4KZ1 A;  4HM1 B;  1OCV A;  1RJO A;  3HII A;  1JJ2 2;  1A2K A;  4XBT A;  2WGO A;  3MG1 A;  3UNL A;  1O7N B;  2OTL 3;  1CQS A;  2QGU A;  3DXO A;  5DRV A;  4HM2 B;  1TIJ A;  4N6M A;  5HGR A;  1VQ6 3;  2CKF B;  3CME 3;  4U13 A;  5G2G A;  3V98 A;  2YFJ B;  4WYK A;  1ROA A;  4LEH A;  3SX1 A;  5IG3 A;  1YJN 3;  1N9E A;  1R4C A;  1DYU A;  4R4K A;  2E2U A;  1WQL B;  3RGR A;  3VF1 A;  1IQX A;  5IEN A;  1STD A;  1STF I;  2CC3 A;  3MWZ A;  1U8C B;  1JNQ A;  2K54 A;  1TFO A;  3LTC A;  1GD3 A;  2XSH B;  3CC2 3;  1Q82 4;  2HMJ B;  3EJV A;  4NRE A;  2HMK B;  5IF6 A;  2CWT A;  4IPB A;  5JBS A;  5EEO A;  3KZT A;  3KFQ C;  3DGN A;  1FA3 A;  3I56 3;  2W9Q A;  3D9R A;  1OHP A;  1YIT 3;  2Z77 A;  4H3U A;  1JB5 A;  1GYB A;  4HZ9 B;  3NHX A;  1VQ7 3;  4HKV B;  4L8O A;  3LZA A;  4LZI A;  3SLU A;  3KII A;  3Q2P A;  1OGX A;  2OQE C;  1QAK A;  3PGB A;  3X42 A;  1K9M 4;  2UX0 A;  1IU7 A;  1WNH A;  2CIU A;  3LH4 A;  3CPW 2;  1Q81 4;  3JUO A;  3NV0 A;  4BTY A;  3OV4 A;  4KFD A;  1BUQ A;  2GXF A;  2W56 B;  7STD A;  1VQN 3;  3PCS A;  3MKI A;  2Z7A A;  1QVF 2;  3HIG A;  1IK3 A;  3EF8 A;  3HX8 A;  5JPU A;  4HVN A;  5KP4 A;  4XBY A;  4OUQ A;  3MHE A;  4K1U A;  1O7M B;  1OH0 A;  2CWU A;  1ULJ B;  5IEO A;  2RCD A;  1IT7 A;  1UUW B;  4N3V A;  1TU5 A;  3FG4 A;  2GEX A;  1FGR A;  3CCV 3;  5LC6 A;  3UJM A;  1VQ4 3;  4R1K A;  1J2B A;  5AIG A;  4H61 A;  4N6N B;  2I9W A;  6STD A;  3ER7 A;  3F40 A;  2RSX A;  3M8C A;  3AMO B;  4K1V A;  1DVC A;  1YVB I;  2HMN B;  1O7W B;  3UB1 A;  3WOE B;  1PFP A;  3GZY B;  1JKG B;  3A76 A;  3GZX B;  4HM8 B;  4STD A;  5D83 A;  1IVX A;  1A2V A;  5I97 A;  4R9L A;  1AVK A;  3JUM A;  4FCM A;  5IG4 A;  3EX9 A;  2QA4 3;  3LXU X;  3K63 A;  2O9U X;  4XDV A;  1W6C A;  1SII A;  3T8N A;  1N5P A;  4EV2 A;  4N6V 0;  4WWU C;  1FGO A;  3BNE A;  3DGL A;  2IA7 A;  3PXM A;  4LMI A;  3N9H A;  3F8H A;  1W00 A;  3BNB A;  3OWU A;  1SJW A;  1U5O A;  3Q90 A;  2XGN A;  4ORL A;  3CCR 3;  1K73 4;  2CFD A;  3KSP A;  4FR9 A;  1IV7 A;  3S5C A;  2WOH A;  3DGO A;  3SXX A;  1OF5 B;  2W56 A;  3NBJ A;  1IVV A;  3LYG A;  5AYS C;  1Y4K A;  1ROV A;  3NV0 B;  2WOF A;  1QAF A;  3G4S 3;  1V74 A;  3E99 A;  2GU1 A;  1HU9 A;  3EBT A;  8CHO A;  3S27 A;  3RDE A;  1EKM A;  4MJD A;  4N6T A;  1N9J A;  3KSE D;  2ZDJ A;  1W6Y A;  2GU3 A;  4EC6 A;  3JUP A;  4NHF A;  3G0K A;  3WOF B;  4EXR A;  1VQM 3;  4EBG A;  1DMM A;  3FF2 A;  1YJ9 3;  3PYJ A;  1ASK A;  3F7S A;  2BMR B;  4BTX A;  3AMO A;  4KFE A;  1NJI 4;  2CG0 A;  2CFK A;  4CCV A;  3FF0 A;  5CF2 A;  3H51 A;  4RNZ A;  1Q40 B;  1JKG A;  1LNH A;  5CLK A;  1VQ5 3;  3OWY A;  3QK9 A;  1NO3 A;  1MNL A;  3RGA A;  1SQW A;  1N8Q A;  3DUK A;  3EC9 A;  4O2H A;  3QRD A;  2FXT A;  3LT9 A;  4J8T A;  1CYV A;  1RRL A;  1W02 A;  3ROB A;  4KFF A;  3PCR A;  2YFI B;  3J7Y d;  4G1M B;  1UW1 A;  2E2V A;  3HZP A;  3JUN A;  3L0R A;  3N8B A;  1RN7 A;  4OK0 A;  5ELJ A;  4HM3 B;  1M1X B;  5KP1 A;  1VQ9 3;  4RNY A;  3EHC A;  5AEW B;  1WMN A;  2MF7 A;  1VQL 3;  4N6O B;  1N5H A;  3FG1 A;  3DY5 A;  3KE7 A;  2BNG A;  2GBW B;  4EYC A;  3CCQ 3;  2YX9 A;  1AV4 A;  1WMP A;  1OF5 A;  3WA2 X;  2CFG A;  3EE1 A;  2KRT A;  1JB4 A;  3G8Z A;  2E2T A;  1Q42 A;  2Y73 A;  3JUQ A;  2OOV C;  3NQZ A;  2ZL8 A;  1VQ8 3;  1T5Y A;  3U97 A;  3CCJ 3;  1AR0 A;  4MMZ B;  1WMO A;  1L5G B;  3GAX A;  2LQV A;  2WO0 A;  5D81 A;  3LOY A;  5IEP A;  3NXJ A;  2CFW A;  4JF8 A;  2BMO B;  3DM8 A;  1OHS A;  2P0M A;  1D6Z A;  4O3V A;  1UUV B;  3CCS 3;  3OX9 A;  1A67 A;  1Q7Y 4;  2IUJ A;  3V92 A;  1VZZ A;  4O8S A;  1IVW A;  3FH1 A;  5LC7 A;  2OQE A;  3K9M C;  3X40 A;  5FW5 A;  4FMB A;  2RGQ A;  1Q40 A;  1IT8 A;  3LT8 A;  1M90 4;  3K5T A;  1LOX A;  2MC8 A;  3B4P A;  1IV9 A;  3ECF A;  3U1W A;  1AVL A;  3DZL A;  2RFR A;  3S28 A;  3V99 A;  3N54 B;  1NB5 I;  5AIH A;  3G6E 3;  1DMQ A;  3FLJ A;  1N8R 4;  1UI7 A;  3K0Z A;  5KP3 A;  1E3V A;  3F9S A;  3LTA A;  2FNQ A;  5DRE A;  4FMC A;  1SPU A;  1JV2 B;  2XR8 B;  3F14 A;  3EQQ B;  3X3Z A;  1D6U A;  2Y74 A;  4XB5 A;  2R4I A;  1Q86 4;  3CCL 3;  1GY7 A;  3WOD G;  1IVU A;  1RRH A;  1W4N A;  4HM5 B;  1E3R A;  1KSI A;  2XFT A;  1RKY A;  3FZW A;  3HK4 A;  1LXE A;  1HKX A;  3CPO A;  4KVH A;  3HI7 A;  2ML6 A;  3CMA 3;  2ML5 A;  4RZM A;  5IG5 A;  3CU3 A;  2F86 B;  4WP5 A;  4K90 B;  1MOL A;  1F8N A;  3OW2 2;  4MMY B;  2W03 A;  3CCM 3;  4L7K A;  4K61 A;  3MG3 A;  4ZM8 A;  4HZB B;  2P38 A;  1A90 A;  5IER A;  1QAL A;  1O7H B;  2CW9 A;  1OHO A;  2BT3 A;  4WHA A;  4I4K A;  1O7G B;  3K7C A;  3B4O A;  3CNM A;  3IMA B;  4HBR A;  4IIA A;  2GEY A;  3SOA A;  1GY6 A;  4BTW A;  3VGN A;  1OGZ A;  2CWV A;  2STD A;  4Q53 A;  1DMN A;  5EQL A;  4PEJ A;  5AYR B;  1NB3 I;  1W5Z A;  1ULI B;  3G71 3;  1EG9 B;  2IUK A;  2KCD A;  4HM4 B;  1QJG A;  3GZR A;  3NX0 A;  3NM7 A;  2V1L A;  3CNX A;  1KQS 2;  4QWT A;  3EN8 A;  4R9K A;  3X3X A;  1OAC A;  3IJE B;  1OUN A;  3Q1C A;  3FGY A;  1VQO 3;  2JDI H;  2INX A;  3JVC A;  2W6J H;  3S67 A;  3OXA A;  2XH9 A;  1JN5 B;  4HM6 B;  1EA2 A;  5CF1 A;  1YI2 3;  1YJW 3;  2W04 A;  3VSY A;  1GD4 A;  4GB5 A;  5AIF A;  2HMM B;  3UL5 A;  4XM4 A;  4CDL A;  2HML B;  2BMQ B;  3NBR A;  1VQK 3;  5BXQ A;  1W2B 2;  2XEP A;  2PZV A;  3KN4 A;  5D82 A;  1CYU A;  4HM7 B;  4X2H A;  3LTD A;  2C10 A;  2WGQ A;  2W9P A;  3I55 3;  3X3Y A;  2P0X A;  1OPY A;  3FG3 A;  4FMA A;  5JPP A;  1ZX2 A;  1YGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...