1TIJA

3d domain-swapped human cystatin c with amyloid-like intermolecular beta-sheets
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
PRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3D domain-swapped human cystatin C with amyloidlike intermolecular beta-sheets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
molecule keywords Cystatin C
total genus 16
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tijA00
1R4CA 3L0RA 2CH9A 3MWZA 1N5PA 1EQKA 3QRDA 4N6TA 2O9UX 1LXEA 3SVAA 5ELUA 1CYUA 1PFPA 1MOLA 1GD3A 1GD4A 1CYVA 1N9JA 2W9PA 1M9GA 4CCVA 2KXGA 4N6V0 2W9QA 3S67A 3UL6A 4LZIA 1NB5I 3PXMA 4N6MA 1A67A 3IMAB 1WNHA 4ZM8A 3PS8A 5LC7A 3UL5A 1FUWA 3NX0A 1IV9A 1ROAA 2BO9B 1IV7A 3K9MC 5LC6A 1N5HA 4N6UA 1FA3A 3LH4A 3PYJA 1NB3I 1RN7A 1STFI 5EQLA 4N6LA 4TX4A 3KSED 4EYCA 2OCTA 3GAXA 1A90A 1CEWI 3KFQC 3Q2PA 1G96A 5ELJA 1DVCA 1DVDA 1TIJA 4N6NB 1MNLA 4IT7A 1YVBI 1KWIA 5A0OB 4N6OB
chains in the Genus database with same CATH superfamily
1R4CA 1RGCA 3V92A 1VQ73 2Y74A 2CIUA 1QAFA 1V58A 3BNEA 5ELUA 1GMRA 4WFOA 1JB4A 4N6V0 2CK3H 3PXMA 2C10A 1W01A 2F5WA 3SEDA 1BRIA 1Q824 1FUWA 1AY7A 3OV4A 3UL5A 3VSYA 1IT8A 3IJEB 1BSBA 2CWTA 1IVWA 1O7PB 1G0TA 2GEYA 4XBXA 5BU4A 1E3VA 2IYJA 1W2B2 2INXA 2H0GA 2F99A 3DGYA 4N3VA 3CCJ3 1RDSA 2GEXA 3DUKA 3CCV3 4HYZA 2Y73A 2QA43 1K9M4 1DVCA 1JBSA 3OWSA 5CK6A 1JB2A 3HX8A 3Q3FA 1EKMA 5HGRA 1RGEA 2YFIB 4OUQA 4HZ9B 3EB8A 1SIHA 2XGNA 2CW9A 1JNQA 3PCSA 4X2HA 1BRKA 3I0YA 2GBXB 1IVUA 1GD3A 4KFFA 4MJDA 9RNTA 4LGQA 1BNEA 1O7HB 2KF4A 5IG3A 3CC73 1LNIA 1LRAA 1WMPA 2IMJA 3N9HA 3U97A 5IERA 4JF8A 5LC7A 1PYLA 2XF3A 1RGFA 1X1WA 1JRQA 2KF3A 2H0IA 3ROBA 3CNMA 1B2SA 1BRNL 1LNHA 2XEPA 5AIHA 5M1AA 3WOEB 1QMAA 3X40A 5ELJA 3S27A 2LYXA 3WOFB 3JUPA 1KSIA 3X42A 4EV2A 5M19A 2XSHB 3HK4A 4HVNA 1E97A 3GWRA 3CC23 3MWZA 2H0HA 3FLJA 4L8OA 1OPYA 3FH1A 3QK9A 2CKFB 7RNTA 3RGRA 1NO3A 1VQP3 2IUKA 3UB1A 2KRTA 2WGOA 3X3XA 3T8NA 2W04A 3ZFZA 2YFJB 3PZWA 1Q9EA 1OHPA 2W9QA 3NUVA 4K1VA 4EBGA 1V57A 4EC6A 5BXQA 2SBLA 7GSPA 2R41A 3DY5A 2WO0A 2K54A 3FG3A 3OWUA 2P05A 1N5HA 1Z1SA 3H51A 4FMAA 3PYJA 1RGLA 2L1SA 1IDPA 2P38A 4ILFA 3O8YA 1G96A 1I2EA 1W5ZA 2GU1A 1S5AA 4PEJA 5G1LA 2F86B 5G2GA 2CHCA 1BRJA 1LQGC 4JRFA 4WYKA 1HKXA 4R1KA 2BMOB 4BTXA 3RDEA 4BU4A 1MWUA 1TUHA 4N6TA 3SVAA 5GSPA 1BNGA 3MG1A 1D6UA 3NM2A 2B1XB 1KD14 1HU9A 2CFDA 1RMSA 3FSDA 1B3SA 1MWSA 5M18A 3PS8A 3FCSB 6RNTA 4J5KA 1IV7A 1VZZA 2O3OA 3EQQB 1GYBA 2PZVA 3PCRA 2ML5A 1RN7A 1GMQA 2WOHA 3GZYB 5AEWB 4N6LA 2CG0A 2ZDJA 3BLZA 3RNTA 3SOYA 4CJNA 2CFKA 1A2KA 2C11A 2RBIA 1UCIA 3IPTA 1TIJA 1MNLA 1U8CB 4IT7A 4RNZA 1VQ93 4XM4A 5A0OB 1QALA 1R4YA 2XR8B 1W2ZA 2ZA4A 3MSOA 1BNSA 1UCKA 4IPBA 1B2ZA 3RGAA 5HOHA 1FGTA 5STDA 1I3IA 1JZDA 3HIGA 1LXEA 4FMCA 1Q40B 1FGOA 1MOLA 3EC9A 1IQYA 1N9JA 3MHEA 4R9LA 5CXOA 4HM8B 2Q07A 5KP3A 1YHQ3 1OUNA 1A67A 4LYLB 4HM2B 3SXXA 2OOVC 2FXTA 1RN4A 4GB5A 1I70A 1B27A 1WMNA 5IF6A 1UW1A 1K8A4 3EF8A 3AGNA 1EEJA 1VQK3 3GRDA 3GZBA 1AVKA 1RRLA 3NQYA 2UX0A 4TX4A 1RKYA 3CCQ3 4K90B 1TTOA 3AMOB 1DYUA 3FZWA 5AYRB 1JZOA 4O3VA 4N6NB 2OOVA 4KFEA 1SPUA 1RCLA 1Q7HA 1RTUA 4OK0A 4N6OB 1FGQA 2R4IA 3S28A 3D4AA 2QIYA 1EQKA 3NXJA 5CF1A 4GHOA 1PFPA 5D82A 3NV0B 2CG1A 3CMA3 1GOYA 3ZG0A 1VQM3 2AADA 4XB5A 4XDWA 2AAEA 3CCE3 1NB5I 1QAKA 1UGIA 1NJI4 3G713 1DMQA 2K3DA 1LVNA 3EN1B 3NQZA 1B2XA 1Q814 1YJ93 1JKGA 3WHOA 3G4S3 2ZL8A 3DZLA 1BRHA 6GSPA 1YI23 3U1WA 2QEX3 1BSEA 1X1XA 1KC84 2PNCA 3GZRA 3OX9A 3F7XA 3NM7A 3ER7A 3CC43 1K41A 1I8VA 4GL6A 1AVLA 4N6MA 3S5CA 3HZPA 5JPPA 3F8HA 3Q90A 1HYFA 2UGIA 3N8BA 3UJMA 2O9UX 4EW5A 2F56A 2P0XA 1EA2A 1WQLB 1FUTA 4KT3B 3G0KA 1GOVA 2GU3A 1BOXA 6STDA 4EXRA 1N8R4 1JBTA 1K734 2GSPA 1FZUA 1BSCA 3LYGA 1NB3I 4RBNA 3T0UA 1UI8A 2L4VA 3DMCA 1JV2B 3I563 2BU4A 4STDA 4ORLA 4KFDA 1RHLA 2WGQA 1RRHA 2F5MA 1HZ1A 1BVIA 1YVBI 5D83A 1AV4A 3JUMA 2IA7A 3LMLA 1W6CA 2CX0A 1N5PA 1OGZA 3DM8A 4BTWA 3CME3 1UUVB 1IU7A 3CU3A 3LZAA 3CCM3 5D81A 1GMPA 4BTYA 3Q1CA 3ZG5A 1FYSA 1D6ZA 4LZIA 3LTBA 2HOHA 3GZXB 3EX9A 2XRXB 3MYTA 4BL2A 2GXFA 3FF2A 3WA2X 3K9MC 2QGUA 1SIIA 3FKAA 5DREA 1FA3A 3LH4A 4H61A 1C7HA 4RNTA 4WWUC 1FUSA 1W7CA 1RGGA 1MWRA 2XFTA 4XBTA 3B4PA 1CEWI 3BNBA 3KKGA 3G8ZA 2W56B 5AYSC 1I0VA 1DVDA 1KWIA 2C4BA 1EG9B 3HOHA 5CF2A 1OHOA 1RGKA 4J9AA 1BNJA 1I3FA 5KP1A 2Z7AA 1ZX2A 3MG2A 3K0ZA 1U5OA 1FGRA 2XH9A 1BRSA 1N9EA 1VQQA 3NBBA 3MKIA 1I2GA 1N8QA 3F14A 1T2HA 4HM3B 3K63A 1TJDA 4R4KA 2KCDA 3SYUA 3MPHA 1E3RA 3SX1A 3JVCA 1A90A 2OTL3 1O7MB 3N54B 2BO9B 1OF5B 1BNIA 1UDII 1X1UA 2W0QA 4G1MB 4N6UA 4O2HA 1S723 1DE3A 3F7SA 4WP5A 3KZTA 4BIRA 2FNQA 1CQSA 2P09A 5BIRA 3HIIA 3BNDA 5FGOA 1TFOA 3EJVA 1UGHI 3CCR3 1NWWA 3T8UA 5BVBA 4I4KA 3BNCA 3G6E3 3CPW2 3F9SA 2RGQA 3NBJA 3VGNA 2ML6A 4HM7B 2HMJB 3A76A 1BIRA 1YIT3 1NDOB 5AIIA 1DMNA 1TFKA 5IEPA 1YJN3 3KE7A 4O02B 1UCJA 1F8NA 1BANA 1LOWA 1B2UA 1IV9A 2W03A 2BIRA 5IG5A 1IK3A 3TDGA 1ZO2A 3A5EA 2MF7A 2SARA 7STDA 1IQ8A 3V99A 1JN5B 3HI7A 3DGNA 1T2IA 1RSNA 4J5GA 4FR9A 1FGMA 2CC3A 3BU4A 1TU5A 3SLUA 4FMDA 4MEIA 4QWTA 4WHAA 4FCJA 2I9WA 1ASKA 3E99A 4FCZA 2HMLB 1RGAA 2M7OA 3QRDA 4BL3A 2RCDA 3ECFA 3J7Yd 5IG0A 1UCLA 1WMOA 4CCVA 4K61A 4DKIA 1Q7Y4 1OHSA 3LT8A 2ZHXB 3LTDA 2XGLA 1B2MA 2CWUA 1GY5A 4ZM8A 4HM5B 2LQVA 1DMMA 1ROAA 1JN5A 3LTAA 5LC6A 2JDIH 4HAAA 1EUIC 4NHFA 3VF1A 5EEOA 5G1KA 1YNVX 3BB9A 1CH0A 1GS3A 2A15A 2FGTA 2OCTA 3LOYA 2E2TA 4L8PA 4NPBA 4RNYA 3SOAA 2RFRA 3JUQA 1IVVA 2D42A 1BSDA 1SARA 4AKYA 4XDVA 5CLKA 2CFLA 3PGBA 1YJW3 4EV5A 3D5GA 3D9RA 4FCMA 1RLSA 1O7GB 1CYVA 1RJOA 2OQEC 2W9PA 1W4NA 8CHOA 1BAOA 5JPUA 3DH2A 4L7KA 4HM0B 3CPOA 1G02A 2YX9A 3F8XA 2W2CA 4AKZA 1K28A 3WDGB 4CDLA 4XBYA 1VQN3 1W00A 4HKVB 3KN4A 3EE1A 5AIGA 1STFI 1OACA 1QJGA 2HMKB 2V1LA 2W6JH 1LQMB 5EQLA 5KP4A 1OCVA 3GAXA 4X2OA 5JBSA 2W56A 1GY7A 1YGEA 1ISKA 3DGMA 4HZBB 1GSPA 1I2FA 5FW5A 3S29A 1JB5A 2F4YA 1MWTA 3NV0A 4LSOA 1TRPA 1UUGB 4LMIA 3V98A 4IIAA 4KVHA 1JJ22 1C54A 2CFGA 2HMOB 3X41A 5DRVA 3M8CA 4FMBA 3WODG 3I553 1Q40A 1ZS7A 5IW9A 2BNGA 3UNLA 1STDA 3CCS3 3CCL3 5TGNA 3CCU3 1SQWA 3EBTA 3JUNA 1PU4A 1D6YA 3IMAB 1WNHA 3KSPA 1RGHA 1Q42A 2BMRB 1OF5A 4R80A 2CFWA 2BHMA 1B21A 2MC8A 3X3ZA 3KCHA 1OGXA 1NNVA 3Q2PA 4HM6B 3D5IA 3WMDA 1O7NB 1RNTA 1BNRA 4K1UA 1A2VA 5AI1A 1ROVA 4LEHA 3AGOA 2P0MA 1M1K4 4OVMA 1V74A 2CH9A 3ALAA 4AEQA 1KQS2 1GY6A 3EHCA 3STDA 3WA3A 5EVHA 1W02A 1A2PA 2RSXA 1Y4KA 2OTJ3 2OQEA 1CYUA 4U13A 1X1YA 1M9GA 3S67A 1WTHA 1ZGXA 3EN8A 4J8TA 2F98A 2HMNB 1VQO3 2CX1A 1VQL3 1VQ53 2CWVA 1IT7A 1DETA 5AEUB 2B24B 1LOXA 1PY3A 1BRGA 2D1WA 1AQZA 3LXUX 3MG3A 1YGWA 2HMMB 3CXC2 4O8SA 1QVG2 1GOUA 3KFQC 3BIRA 2JQ5A 1W6YA 3FF0A 3D79A 5I97A 1RCKA 1LOVA 4MMZB 2IUJA 1JKGB 3OW22 1Q864 1RN1A 4GSPA 3B8LA 1MGRA 4RZMA 1MGWA 8RNTA 3AMOA 3OWYA 4HM4B 5IEOA 3NBRA 2Z77A 1LOYA 1T3BA 2KF6A 1US1A 1BUJA 1O7WB 3LTCA 2E2VA 4I5QA 1M904 1FW7A 3CNXA 1TP6A 2UUGC 1AR0A 2KF5A 1ULIB 2BT3A 3GSPA 1L5GB 4R9KA 1B20A 4H3UA 5IENA 3FG4A 1NU3A 3KIIA 3AHSA 4HM1B 3FG1A 3B7CA 1BGSA 1IVXA 2XSOB 3LT9A 4MMXB 4EYCA 4HJLB 2YFLB 1JBRA 2Z6BA 3FGYA 2RNTA 3DXOA 4WYKB 5RNTA 1IQXA 3D3LA 1W6GA 3B4OA 3CD63 2XFSA 2K0MA 3L0RA 2J8XB 3K7CA 2WOFA 2GBWB 3H3HA 4MMYB 2OWPA 3DGOA 1BNFA 1YIJ3 4KZ1A 1GD4A 3OXAA 3EBYA 3F40A 3K5TA 2KAAA 2Z76A 2KXGA 1SJWA 3UL6A 5AIFA 4Q53A 2BMQB 3WR2A 3X3YA 1BU4A 1OH0A 1UUWB 1TRQA 1YVSA 1BUQA 4NREA 3NX0A 1UI7A 2IY2A 4HOHA 1I0XA 1VQ83 1T5YA 1BSAA 1QVF2 3URPA 3KSED 1ULJB 1IYYA 3AHWA 1RNBA 2STDA 1M1XB 4HBRA 1VQ43 3NHXA 4CPKA 3DGLA 5IG4A 1VQ63 3JUOA 3G16A 2E2UA 1J2BA
chains in the Genus database with same CATH topology
1R4CA 3V92A 1VQ73 2Y74A 2CIUA 1QAFA 3BNEA 5ELUA 4WFOA 1JB4A 4N6V0 2CK3H 3PXMA 2C10A 1W01A 3SEDA 1Q824 1FUWA 3OV4A 3UL5A 3VSYA 1IT8A 3IJEB 2CWTA 1IVWA 1O7PB 4XBXA 2GEYA 1E3VA 1W2B2 2INXA 2F99A 4N3VA 3CCJ3 2GEXA 3CCV3 3DUKA 4HYZA 2Y73A 2QA43 1K9M4 1DVCA 3OWSA 5CK6A 1JB2A 3HX8A 5HGRA 1EKMA 2YFIB 4OUQA 4HZ9B 3EB8A 1SIHA 2XGNA 2CW9A 1JNQA 3PCSA 4X2HA 3I0YA 2GBXB 1IVUA 1GD3A 4KFFA 4MJDA 4LGQA 3CC73 1O7HB 5IG3A 1WMPA 2IMJA 3N9HA 3U97A 5IERA 4JF8A 5LC7A 2XF3A 1JRQA 3ROBA 3CNMA 1LNHA 2XEPA 5AIHA 3WOEB 1QMAA 3X40A 5ELJA 3S27A 2LYXA 3WOFB 3JUPA 1KSIA 3X42A 4EV2A 2XSHB 3HK4A 4HVNA 1E97A 3GWRA 3CC23 3MWZA 3FLJA 4L8OA 1OPYA 3FH1A 3QK9A 2CKFB 3RGRA 1NO3A 1VQP3 2IUKA 3UB1A 2KRTA 2WGOA 3X3XA 3T8NA 2W04A 2YFJB 3PZWA 2W9QA 1OHPA 3NUVA 4K1VA 4EBGA 4EC6A 5BXQA 2SBLA 3DY5A 2WO0A 2K54A 3FG3A 3OWUA 2P05A 1N5HA 1Z1SA 3H51A 4FMAA 3PYJA 1IDPA 2P38A 3O8YA 1G96A 1W5ZA 2GU1A 1S5AA 4PEJA 5G2GA 2F86B 2CHCA 4JRFA 4WYKA 1HKXA 4R1KA 2BMOB 4BTXA 3RDEA 1TUHA 4N6TA 3SVAA 3MG1A 1D6UA 3NM2A 2B1XB 1KD14 1HU9A 2CFDA 3FSDA 3PS8A 3FCSB 1IV7A 1VZZA 2O3OA 3EQQB 1GYBA 2PZVA 3PCRA 2ML5A 1RN7A 3GZYB 2WOHA 5AEWB 4N6LA 2CG0A 2ZDJA 3BLZA 3SOYA 2CFKA 1A2KA 2C11A 3IPTA 1TIJA 1MNLA 1U8CB 4IT7A 4RNZA 1VQ93 4XM4A 5A0OB 1QALA 2XR8B 1W2ZA 3MSOA 4IPBA 3RGAA 1FGTA 5STDA 3HIGA 1LXEA 4FMCA 1Q40B 1FGOA 1MOLA 3EC9A 1IQYA 1N9JA 3MHEA 4R9LA 5CXOA 4HM8B 2Q07A 5KP3A 1YHQ3 1OUNA 1A67A 4HM2B 3SXXA 2OOVC 2FXTA 5IF6A 4GB5A 1WMNA 1UW1A 1K8A4 3EF8A 1VQK3 3GRDA 3GZBA 1AVKA 1RRLA 3NQYA 2UX0A 4TX4A 1RKYA 3CCQ3 4K90B 3FZWA 3AMOB 1DYUA 5AYRB 4O3VA 4N6NB 2OOVA 4KFEA 1SPUA 4OK0A 4N6OB 1FGQA 2R4IA 3S28A 2QIYA 1EQKA 3NXJA 5CF1A 1PFPA 5D82A 3NV0B 2CG1A 3CMA3 1VQM3 4XB5A 4XDWA 3CCE3 1NB5I 1QAKA 1NJI4 3G713 1DMQA 1LVNA 3EN1B 3NQZA 1Q814 1YJ93 1JKGA 3G4S3 2ZL8A 3DZLA 1YI23 3U1WA 2QEX3 1KC84 2PNCA 3GZRA 3OX9A 3F7XA 3NM7A 3ER7A 3CC43 1K41A 4GL6A 4N6MA 1AVLA 3S5CA 3HZPA 5JPPA 3F8HA 3Q90A 3N8BA 3UJMA 2O9UX 2P0XA 1EA2A 1WQLB 3G0KA 2GU3A 6STDA 4EXRA 1N8R4 1K734 3LYGA 1NB3I 4RBNA 3T0UA 1UI8A 2L4VA 3DMCA 1JV2B 3I563 4STDA 4ORLA 4KFDA 2WGQA 1RRHA 1YVBI 5D83A 1AV4A 3JUMA 2IA7A 3LMLA 1W6CA 1N5PA 1OGZA 3DM8A 4BTWA 3CME3 1UUVB 1IU7A 3CU3A 3LZAA 3CCM3 5D81A 4BTYA 3Q1CA 1D6ZA 4LZIA 3LTBA 3GZXB 3EX9A 2XRXB 3MYTA 2GXFA 3FF2A 3WA2X 3K9MC 2QGUA 1SIIA 3FKAA 5DREA 1FA3A 3LH4A 4H61A 1C7HA 4WWUC 1W7CA 2XFTA 4XBTA 3B4PA 1CEWI 3BNBA 3KKGA 3G8ZA 2W56B 5AYSC 1DVDA 1KWIA 1EG9B 5CF2A 1OHOA 4J9AA 5KP1A 2Z7AA 1ZX2A 3MG2A 3K0ZA 1U5OA 1FGRA 2XH9A 1N9EA 3NBBA 3MKIA 1N8QA 3F14A 4HM3B 3K63A 4R4KA 2KCDA 3MPHA 1E3RA 3SX1A 3JVCA 2OTL3 1O7MB 3N54B 2BO9B 1OF5B 4G1MB 4O2HA 2W0QA 4N6UA 1S723 3F7SA 4WP5A 3KZTA 2FNQA 1CQSA 2P09A 3HIIA 3BNDA 5FGOA 1TFOA 3EJVA 3CCR3 1NWWA 3T8UA 5BVBA 4I4KA 3BNCA 3G6E3 3CPW2 3F9SA 2RGQA 3NBJA 3VGNA 2ML6A 4HM7B 2HMJB 3A76A 1YIT3 1NDOB 5AIIA 1DMNA 1TFKA 5IEPA 1YJN3 3KE7A 4O02B 1F8NA 1IV9A 2W03A 5IG5A 1IK3A 3TDGA 1ZO2A 2MF7A 7STDA 1IQ8A 3V99A 1JN5B 3HI7A 3DGNA 4FR9A 1FGMA 2CC3A 1TU5A 3SLUA 4FMDA 4MEIA 4QWTA 4WHAA 4FCJA 2I9WA 1ASKA 3E99A 4FCZA 2HMLB 2M7OA 3QRDA 2RCDA 3ECFA 3J7Yd 5IG0A 1WMOA 4CCVA 4K61A 1Q7Y4 1OHSA 3LT8A 3LTDA 2XGLA 2CWUA 1GY5A 4ZM8A 4HM5B 2LQVA 1DMMA 1ROAA 1JN5A 3LTAA 5LC6A 2JDIH 4NHFA 3VF1A 5EEOA 3BB9A 3CCU3 1GS3A 2A15A 2FGTA 2OCTA 3LOYA 2E2TA 4L8PA 4RNYA 3SOAA 1A90A 2RFRA 3JUQA 1IVVA 2D42A 4AKYA 4XDVA 5CLKA 2CFLA 3PGBA 1YJW3 4EV5A 3D9RA 4FCMA 1O7GB 1CYVA 1RJOA 2OQEC 2W9PA 1W4NA 8CHOA 5JPUA 4L7KA 4HM0B 3CPOA 2YX9A 3F8XA 2W2CA 4AKZA 1K28A 3WDGB 4CDLA 4XBYA 1W00A 4HKVB 3KN4A 3EE1A 5AIGA 1STFI 1OACA 1QJGA 2HMKB 2V1LA 2W6JH 5EQLA 5KP4A 1OCVA 3GAXA 4X2OA 5JBSA 2W56A 1GY7A 1YGEA 1ISKA 3DGMA 4HZBB 5FW5A 3S29A 1JB5A 3NV0A 4LSOA 3V98A 4LMIA 1JJ22 4IIAA 4KVHA 2CFGA 2HMOB 3X41A 5DRVA 3M8CA 4FMBA 3WODG 3I553 1Q40A 5IW9A 2BNGA 3UNLA 1STDA 3CCS3 3CCL3 5TGNA 1SQWA 3EBTA 3JUNA 1PU4A 1D6YA 3IMAB 1WNHA 3KSPA 1Q42A 2BMRB 1OF5A 4R80A 2CFWA 2BHMA 2MC8A 3X3ZA 4HM6B 1OGXA 3Q2PA 3WMDA 1O7NB 4K1UA 1A2VA 5AI1A 1ROVA 4LEHA 2P0MA 1M1K4 4OVMA 1V74A 2CH9A 3ALAA 4AEQA 1KQS2 1GY6A 3EHCA 3STDA 3WA3A 5EVHA 1W02A 2RSXA 1Y4KA 2OTJ3 2OQEA 1CYUA 4U13A 1M9GA 3S67A 1WTHA 1VQO3 3EN8A 4J8TA 2F98A 2HMNB 1VQL3 1VQ53 2CWVA 1IT7A 5AEUB 2B24B 1LOXA 2D1WA 3LXUX 3MG3A 2HMMB 3CXC2 4O8SA 1QVG2 3KFQC 2JQ5A 1W6YA 3FF0A 5I97A 1Q864 2IUJA 4MMZB 1VQN3 1JKGB 3OW22 4RZMA 3B8LA 3AMOA 3OWYA 4HM4B 5IEOA 3NBRA 2Z77A 1US1A 1O7WB 3LTCA 2E2VA 1M904 3CNXA 1TP6A 1AR0A 1ULIB 2BT3A 1L5GB 4R9KA 5IENA 4H3UA 3FG4A 1NU3A 3KIIA 4HM1B 3FG1A 3B7CA 1IVXA 2XSOB 3LT9A 4MMXB 4EYCA 4HJLB 2YFLB 2Z6BA 3FGYA 3DXOA 4WYKB 1IQXA 3D3LA 1W6GA 3B4OA 3CD63 2XFSA 2K0MA 3L0RA 3K7CA 2WOFA 2GBWB 3H3HA 4MMYB 2OWPA 3DGOA 1YIJ3 4KZ1A 1GD4A 3OXAA 3EBYA 3F40A 3K5TA 2Z76A 2KXGA 1SJWA 3UL6A 5AIFA 4Q53A 2BMQB 3X3YA 1OH0A 1UUWB 1BUQA 4NREA 3NX0A 1UI7A 1VQ83 1T5YA 1QVF2 3KSED 1ULJB 2STDA 1M1XB 4HBRA 1VQ43 3NHXA 3DGLA 5IG4A 1VQ63 3JUOA 3G16A 2E2UA 1J2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4C A;  3L0R A;  2CH9 A;  3MWZ A;  1N5P A;  1EQK A;  3QRD A;  4N6T A;  2O9U X;  1LXE A;  3SVA A;  5ELU A;  1CYU A;  1PFP A;  1MOL A;  1GD3 A;  1GD4 A;  1CYV A;  1N9J A;  2W9P A;  1M9G A;  4CCV A;  2KXG A;  4N6V 0;  2W9Q A;  3S67 A;  3UL6 A;  4LZI A;  1NB5 I;  3PXM A;  4N6M A;  1A67 A;  3IMA B;  1WNH A;  4ZM8 A;  3PS8 A;  5LC7 A;  3UL5 A;  1FUW A;  3NX0 A;  1IV9 A;  1ROA A;  2BO9 B;  1IV7 A;  3K9M C;  5LC6 A;  1N5H A;  4N6U A;  1FA3 A;  3LH4 A;  3PYJ A;  1NB3 I;  1RN7 A;  1STF I;  5EQL A;  4N6L A;  4TX4 A;  3KSE D;  4EYC A;  2OCT A;  3GAX A;  1A90 A;  1CEW I;  3KFQ C;  3Q2P A;  1G96 A;  5ELJ A;  1DVC A;  1DVD A;  1TIJ A;  4N6N B;  1MNL A;  4IT7 A;  1YVB I;  1KWI A;  5A0O B;  4N6O B; 
#chains in the Genus database with same CATH topology
 1R4C A;  1RGC A;  3V92 A;  1VQ7 3;  2Y74 A;  2CIU A;  1QAF A;  1V58 A;  3BNE A;  5ELU A;  1GMR A;  4WFO A;  1JB4 A;  4N6V 0;  2CK3 H;  3PXM A;  2C10 A;  1W01 A;  2F5W A;  3SED A;  1BRI A;  1Q82 4;  1FUW A;  1AY7 A;  3OV4 A;  3UL5 A;  3VSY A;  1IT8 A;  3IJE B;  1BSB A;  2CWT A;  1IVW A;  1O7P B;  1G0T A;  2GEY A;  4XBX A;  5BU4 A;  1E3V A;  2IYJ A;  1W2B 2;  2INX A;  2H0G A;  2F99 A;  3DGY A;  4N3V A;  3CCJ 3;  1RDS A;  2GEX A;  3DUK A;  3CCV 3;  4HYZ A;  2Y73 A;  2QA4 3;  1K9M 4;  1DVC A;  1JBS A;  3OWS A;  5CK6 A;  1JB2 A;  3HX8 A;  3Q3F A;  1EKM A;  5HGR A;  1RGE A;  2YFI B;  4OUQ A;  4HZ9 B;  3EB8 A;  1SIH A;  2XGN A;  2CW9 A;  1JNQ A;  3PCS A;  4X2H A;  1BRK A;  3I0Y A;  2GBX B;  1IVU A;  1GD3 A;  4KFF A;  4MJD A;  9RNT A;  4LGQ A;  1BNE A;  1O7H B;  2KF4 A;  5IG3 A;  3CC7 3;  1LNI A;  1LRA A;  1WMP A;  2IMJ A;  3N9H A;  3U97 A;  5IER A;  4JF8 A;  5LC7 A;  1PYL A;  2XF3 A;  1RGF A;  1X1W A;  1JRQ A;  2KF3 A;  2H0I A;  3ROB A;  3CNM A;  1B2S A;  1BRN L;  1LNH A;  2XEP A;  5AIH A;  5M1A A;  3WOE B;  1QMA A;  3X40 A;  5ELJ A;  3S27 A;  2LYX A;  3WOF B;  3JUP A;  1KSI A;  3X42 A;  4EV2 A;  5M19 A;  2XSH B;  3HK4 A;  4HVN A;  1E97 A;  3GWR A;  3CC2 3;  3MWZ A;  2H0H A;  3FLJ A;  4L8O A;  1OPY A;  3FH1 A;  3QK9 A;  2CKF B;  7RNT A;  3RGR A;  1NO3 A;  1VQP 3;  2IUK A;  3UB1 A;  2KRT A;  2WGO A;  3X3X A;  3T8N A;  2W04 A;  3ZFZ A;  2YFJ B;  3PZW A;  1Q9E A;  1OHP A;  2W9Q A;  3NUV A;  4K1V A;  4EBG A;  1V57 A;  4EC6 A;  5BXQ A;  2SBL A;  7GSP A;  2R41 A;  3DY5 A;  2WO0 A;  2K54 A;  3FG3 A;  3OWU A;  2P05 A;  1N5H A;  1Z1S A;  3H51 A;  4FMA A;  3PYJ A;  1RGL A;  2L1S A;  1IDP A;  2P38 A;  4ILF A;  3O8Y A;  1G96 A;  1I2E A;  1W5Z A;  2GU1 A;  1S5A A;  4PEJ A;  5G1L A;  2F86 B;  5G2G A;  2CHC A;  1BRJ A;  1LQG C;  4JRF A;  4WYK A;  1HKX A;  4R1K A;  2BMO B;  4BTX A;  3RDE A;  4BU4 A;  1MWU A;  1TUH A;  4N6T A;  3SVA A;  5GSP A;  1BNG A;  3MG1 A;  1D6U A;  3NM2 A;  2B1X B;  1KD1 4;  1HU9 A;  2CFD A;  1RMS A;  3FSD A;  1B3S A;  1MWS A;  5M18 A;  3PS8 A;  3FCS B;  6RNT A;  4J5K A;  1IV7 A;  1VZZ A;  2O3O A;  3EQQ B;  1GYB A;  2PZV A;  3PCR A;  2ML5 A;  1RN7 A;  1GMQ A;  2WOH A;  3GZY B;  5AEW B;  4N6L A;  2CG0 A;  2ZDJ A;  3BLZ A;  3RNT A;  3SOY A;  4CJN A;  2CFK A;  1A2K A;  2C11 A;  2RBI A;  1UCI A;  3IPT A;  1TIJ A;  1MNL A;  1U8C B;  4IT7 A;  4RNZ A;  1VQ9 3;  4XM4 A;  5A0O B;  1QAL A;  1R4Y A;  2XR8 B;  1W2Z A;  2ZA4 A;  3MSO A;  1BNS A;  1UCK A;  4IPB A;  1B2Z A;  3RGA A;  5HOH A;  1FGT A;  5STD A;  1I3I A;  1JZD A;  3HIG A;  1LXE A;  4FMC A;  1Q40 B;  1FGO A;  1MOL A;  3EC9 A;  1IQY A;  1N9J A;  3MHE A;  4R9L A;  5CXO A;  4HM8 B;  2Q07 A;  5KP3 A;  1YHQ 3;  1OUN A;  1A67 A;  4LYL B;  4HM2 B;  3SXX A;  2OOV C;  2FXT A;  1RN4 A;  4GB5 A;  1I70 A;  1B27 A;  1WMN A;  5IF6 A;  1UW1 A;  1K8A 4;  3EF8 A;  3AGN A;  1EEJ A;  1VQK 3;  3GRD A;  3GZB A;  1AVK A;  1RRL A;  3NQY A;  2UX0 A;  4TX4 A;  1RKY A;  3CCQ 3;  4K90 B;  1TTO A;  3AMO B;  1DYU A;  3FZW A;  5AYR B;  1JZO A;  4O3V A;  4N6N B;  2OOV A;  4KFE A;  1SPU A;  1RCL A;  1Q7H A;  1RTU A;  4OK0 A;  4N6O B;  1FGQ A;  2R4I A;  3S28 A;  3D4A A;  2QIY A;  1EQK A;  3NXJ A;  5CF1 A;  4GHO A;  1PFP A;  5D82 A;  3NV0 B;  2CG1 A;  3CMA 3;  1GOY A;  3ZG0 A;  1VQM 3;  2AAD A;  4XB5 A;  4XDW A;  2AAE A;  3CCE 3;  1NB5 I;  1QAK A;  1UGI A;  1NJI 4;  3G71 3;  1DMQ A;  2K3D A;  1LVN A;  3EN1 B;  3NQZ A;  1B2X A;  1Q81 4;  1YJ9 3;  1JKG A;  3WHO A;  3G4S 3;  2ZL8 A;  3DZL A;  1BRH A;  6GSP A;  1YI2 3;  3U1W A;  2QEX 3;  1BSE A;  1X1X A;  1KC8 4;  2PNC A;  3GZR A;  3OX9 A;  3F7X A;  3NM7 A;  3ER7 A;  3CC4 3;  1K41 A;  1I8V A;  4GL6 A;  1AVL A;  4N6M A;  3S5C A;  3HZP A;  5JPP A;  3F8H A;  3Q90 A;  1HYF A;  2UGI A;  3N8B A;  3UJM A;  2O9U X;  4EW5 A;  2F56 A;  2P0X A;  1EA2 A;  1WQL B;  1FUT A;  4KT3 B;  3G0K A;  1GOV A;  2GU3 A;  1BOX A;  6STD A;  4EXR A;  1N8R 4;  1JBT A;  1K73 4;  2GSP A;  1FZU A;  1BSC A;  3LYG A;  1NB3 I;  4RBN A;  3T0U A;  1UI8 A;  2L4V A;  3DMC A;  1JV2 B;  3I56 3;  2BU4 A;  4STD A;  4ORL A;  4KFD A;  1RHL A;  2WGQ A;  1RRH A;  2F5M A;  1HZ1 A;  1BVI A;  1YVB I;  5D83 A;  1AV4 A;  3JUM A;  2IA7 A;  3LML A;  1W6C A;  2CX0 A;  1N5P A;  1OGZ A;  3DM8 A;  4BTW A;  3CME 3;  1UUV B;  1IU7 A;  3CU3 A;  3LZA A;  3CCM 3;  5D81 A;  1GMP A;  4BTY A;  3Q1C A;  3ZG5 A;  1FYS A;  1D6Z A;  4LZI A;  3LTB A;  2HOH A;  3GZX B;  3EX9 A;  2XRX B;  3MYT A;  4BL2 A;  2GXF A;  3FF2 A;  3WA2 X;  3K9M C;  2QGU A;  1SII A;  3FKA A;  5DRE A;  1FA3 A;  3LH4 A;  4H61 A;  1C7H A;  4RNT A;  4WWU C;  1FUS A;  1W7C A;  1RGG A;  1MWR A;  2XFT A;  4XBT A;  3B4P A;  1CEW I;  3BNB A;  3KKG A;  3G8Z A;  2W56 B;  5AYS C;  1I0V A;  1DVD A;  1KWI A;  2C4B A;  1EG9 B;  3HOH A;  5CF2 A;  1OHO A;  1RGK A;  4J9A A;  1BNJ A;  1I3F A;  5KP1 A;  2Z7A A;  1ZX2 A;  3MG2 A;  3K0Z A;  1U5O A;  1FGR A;  2XH9 A;  1BRS A;  1N9E A;  1VQQ A;  3NBB A;  3MKI A;  1I2G A;  1N8Q A;  3F14 A;  1T2H A;  4HM3 B;  3K63 A;  1TJD A;  4R4K A;  2KCD A;  3SYU A;  3MPH A;  1E3R A;  3SX1 A;  3JVC A;  1A90 A;  2OTL 3;  1O7M B;  3N54 B;  2BO9 B;  1OF5 B;  1BNI A;  1UDI I;  1X1U A;  2W0Q A;  4G1M B;  4N6U A;  4O2H A;  1S72 3;  1DE3 A;  3F7S A;  4WP5 A;  3KZT A;  4BIR A;  2FNQ A;  1CQS A;  2P09 A;  5BIR A;  3HII A;  3BND A;  5FGO A;  1TFO A;  3EJV A;  1UGH I;  3CCR 3;  1NWW A;  3T8U A;  5BVB A;  4I4K A;  3BNC A;  3G6E 3;  3CPW 2;  3F9S A;  2RGQ A;  3NBJ A;  3VGN A;  2ML6 A;  4HM7 B;  2HMJ B;  3A76 A;  1BIR A;  1YIT 3;  1NDO B;  5AII A;  1DMN A;  1TFK A;  5IEP A;  1YJN 3;  3KE7 A;  4O02 B;  1UCJ A;  1F8N A;  1BAN A;  1LOW A;  1B2U A;  1IV9 A;  2W03 A;  2BIR A;  5IG5 A;  1IK3 A;  3TDG A;  1ZO2 A;  3A5E A;  2MF7 A;  2SAR A;  7STD A;  1IQ8 A;  3V99 A;  1JN5 B;  3HI7 A;  3DGN A;  1T2I A;  1RSN A;  4J5G A;  4FR9 A;  1FGM A;  2CC3 A;  3BU4 A;  1TU5 A;  3SLU A;  4FMD A;  4MEI A;  4QWT A;  4WHA A;  4FCJ A;  2I9W A;  1ASK A;  3E99 A;  4FCZ A;  2HML B;  1RGA A;  2M7O A;  3QRD A;  4BL3 A;  2RCD A;  3ECF A;  3J7Y d;  5IG0 A;  1UCL A;  1WMO A;  4CCV A;  4K61 A;  4DKI A;  1Q7Y 4;  1OHS A;  3LT8 A;  2ZHX B;  3LTD A;  2XGL A;  1B2M A;  2CWU A;  1GY5 A;  4ZM8 A;  4HM5 B;  2LQV A;  1DMM A;  1ROA A;  1JN5 A;  3LTA A;  5LC6 A;  2JDI H;  4HAA A;  1EUI C;  4NHF A;  3VF1 A;  5EEO A;  5G1K A;  1YNV X;  3BB9 A;  1CH0 A;  1GS3 A;  2A15 A;  2FGT A;  2OCT A;  3LOY A;  2E2T A;  4L8P A;  4NPB A;  4RNY A;  3SOA A;  2RFR A;  3JUQ A;  1IVV A;  2D42 A;  1BSD A;  1SAR A;  4AKY A;  4XDV A;  5CLK A;  2CFL A;  3PGB A;  1YJW 3;  4EV5 A;  3D5G A;  3D9R A;  4FCM A;  1RLS A;  1O7G B;  1CYV A;  1RJO A;  2OQE C;  2W9P A;  1W4N A;  8CHO A;  1BAO A;  5JPU A;  3DH2 A;  4L7K A;  4HM0 B;  3CPO A;  1G02 A;  2YX9 A;  3F8X A;  2W2C A;  4AKZ A;  1K28 A;  3WDG B;  4CDL A;  4XBY A;  1VQN 3;  1W00 A;  4HKV B;  3KN4 A;  3EE1 A;  5AIG A;  1STF I;  1OAC A;  1QJG A;  2HMK B;  2V1L A;  2W6J H;  1LQM B;  5EQL A;  5KP4 A;  1OCV A;  3GAX A;  4X2O A;  5JBS A;  2W56 A;  1GY7 A;  1YGE A;  1ISK A;  3DGM A;  4HZB B;  1GSP A;  1I2F A;  5FW5 A;  3S29 A;  1JB5 A;  2F4Y A;  1MWT A;  3NV0 A;  4LSO A;  1TRP A;  1UUG B;  4LMI A;  3V98 A;  4IIA A;  4KVH A;  1JJ2 2;  1C54 A;  2CFG A;  2HMO B;  3X41 A;  5DRV A;  3M8C A;  4FMB A;  3WOD G;  3I55 3;  1Q40 A;  1ZS7 A;  5IW9 A;  2BNG A;  3UNL A;  1STD A;  3CCS 3;  3CCL 3;  5TGN A;  3CCU 3;  1SQW A;  3EBT A;  3JUN A;  1PU4 A;  1D6Y A;  3IMA B;  1WNH A;  3KSP A;  1RGH A;  1Q42 A;  2BMR B;  1OF5 A;  4R80 A;  2CFW A;  2BHM A;  1B21 A;  2MC8 A;  3X3Z A;  3KCH A;  1OGX A;  1NNV A;  3Q2P A;  4HM6 B;  3D5I A;  3WMD A;  1O7N B;  1RNT A;  1BNR A;  4K1U A;  1A2V A;  5AI1 A;  1ROV A;  4LEH A;  3AGO A;  2P0M A;  1M1K 4;  4OVM A;  1V74 A;  2CH9 A;  3ALA A;  4AEQ A;  1KQS 2;  1GY6 A;  3EHC A;  3STD A;  3WA3 A;  5EVH A;  1W02 A;  1A2P A;  2RSX A;  1Y4K A;  2OTJ 3;  2OQE A;  1CYU A;  4U13 A;  1X1Y A;  1M9G A;  3S67 A;  1WTH A;  1ZGX A;  3EN8 A;  4J8T A;  2F98 A;  2HMN B;  1VQO 3;  2CX1 A;  1VQL 3;  1VQ5 3;  2CWV A;  1IT7 A;  1DET A;  5AEU B;  2B24 B;  1LOX A;  1PY3 A;  1BRG A;  2D1W A;  1AQZ A;  3LXU X;  3MG3 A;  1YGW A;  2HMM B;  3CXC 2;  4O8S A;  1QVG 2;  1GOU A;  3KFQ C;  3BIR A;  2JQ5 A;  1W6Y A;  3FF0 A;  3D79 A;  5I97 A;  1RCK A;  1LOV A;  4MMZ B;  2IUJ A;  1JKG B;  3OW2 2;  1Q86 4;  1RN1 A;  4GSP A;  3B8L A;  1MGR A;  4RZM A;  1MGW A;  8RNT A;  3AMO A;  3OWY A;  4HM4 B;  5IEO A;  3NBR A;  2Z77 A;  1LOY A;  1T3B A;  2KF6 A;  1US1 A;  1BUJ A;  1O7W B;  3LTC A;  2E2V A;  4I5Q A;  1M90 4;  1FW7 A;  3CNX A;  1TP6 A;  2UUG C;  1AR0 A;  2KF5 A;  1ULI B;  2BT3 A;  3GSP A;  1L5G B;  4R9K A;  1B20 A;  4H3U A;  5IEN A;  3FG4 A;  1NU3 A;  3KII A;  3AHS A;  4HM1 B;  3FG1 A;  3B7C A;  1BGS A;  1IVX A;  2XSO B;  3LT9 A;  4MMX B;  4EYC A;  4HJL B;  2YFL B;  1JBR A;  2Z6B A;  3FGY A;  2RNT A;  3DXO A;  4WYK B;  5RNT A;  1IQX A;  3D3L A;  1W6G A;  3B4O A;  3CD6 3;  2XFS A;  2K0M A;  3L0R A;  2J8X B;  3K7C A;  2WOF A;  2GBW B;  3H3H A;  4MMY B;  2OWP A;  3DGO A;  1BNF A;  1YIJ 3;  4KZ1 A;  1GD4 A;  3OXA A;  3EBY A;  3F40 A;  3K5T A;  2KAA A;  2Z76 A;  2KXG A;  1SJW A;  3UL6 A;  5AIF A;  4Q53 A;  2BMQ B;  3WR2 A;  3X3Y A;  1BU4 A;  1OH0 A;  1UUW B;  1TRQ A;  1YVS A;  1BUQ A;  4NRE A;  3NX0 A;  1UI7 A;  2IY2 A;  4HOH A;  1I0X A;  1VQ8 3;  1T5Y A;  1BSA A;  1QVF 2;  3URP A;  3KSE D;  1ULJ B;  1IYY A;  3AHW A;  1RNB A;  2STD A;  1M1X B;  4HBR A;  1VQ4 3;  3NHX A;  4CPK A;  3DGL A;  5IG4 A;  1VQ6 3;  3JUO A;  3G16 A;  2E2U A;  1J2B A; 
#chains in the Genus database with same CATH homology
 1R4C A;  3V92 A;  1VQ7 3;  2Y74 A;  2CIU A;  1QAF A;  3BNE A;  5ELU A;  4WFO A;  1JB4 A;  4N6V 0;  2CK3 H;  3PXM A;  2C10 A;  1W01 A;  3SED A;  1Q82 4;  1FUW A;  3OV4 A;  3UL5 A;  3VSY A;  1IT8 A;  3IJE B;  2CWT A;  1IVW A;  1O7P B;  4XBX A;  2GEY A;  1E3V A;  1W2B 2;  2INX A;  2F99 A;  4N3V A;  3CCJ 3;  2GEX A;  3CCV 3;  3DUK A;  4HYZ A;  2Y73 A;  2QA4 3;  1K9M 4;  1DVC A;  3OWS A;  5CK6 A;  1JB2 A;  3HX8 A;  5HGR A;  1EKM A;  2YFI B;  4OUQ A;  4HZ9 B;  3EB8 A;  1SIH A;  2XGN A;  2CW9 A;  1JNQ A;  3PCS A;  4X2H A;  3I0Y A;  2GBX B;  1IVU A;  1GD3 A;  4KFF A;  4MJD A;  4LGQ A;  3CC7 3;  1O7H B;  5IG3 A;  1WMP A;  2IMJ A;  3N9H A;  3U97 A;  5IER A;  4JF8 A;  5LC7 A;  2XF3 A;  1JRQ A;  3ROB A;  3CNM A;  1LNH A;  2XEP A;  5AIH A;  3WOE B;  1QMA A;  3X40 A;  5ELJ A;  3S27 A;  2LYX A;  3WOF B;  3JUP A;  1KSI A;  3X42 A;  4EV2 A;  2XSH B;  3HK4 A;  4HVN A;  1E97 A;  3GWR A;  3CC2 3;  3MWZ A;  3FLJ A;  4L8O A;  1OPY A;  3FH1 A;  3QK9 A;  2CKF B;  3RGR A;  1NO3 A;  1VQP 3;  2IUK A;  3UB1 A;  2KRT A;  2WGO A;  3X3X A;  3T8N A;  2W04 A;  2YFJ B;  3PZW A;  2W9Q A;  1OHP A;  3NUV A;  4K1V A;  4EBG A;  4EC6 A;  5BXQ A;  2SBL A;  3DY5 A;  2WO0 A;  2K54 A;  3FG3 A;  3OWU A;  2P05 A;  1N5H A;  1Z1S A;  3H51 A;  4FMA A;  3PYJ A;  1IDP A;  2P38 A;  3O8Y A;  1G96 A;  1W5Z A;  2GU1 A;  1S5A A;  4PEJ A;  5G2G A;  2F86 B;  2CHC A;  4JRF A;  4WYK A;  1HKX A;  4R1K A;  2BMO B;  4BTX A;  3RDE A;  1TUH A;  4N6T A;  3SVA A;  3MG1 A;  1D6U A;  3NM2 A;  2B1X B;  1KD1 4;  1HU9 A;  2CFD A;  3FSD A;  3PS8 A;  3FCS B;  1IV7 A;  1VZZ A;  2O3O A;  3EQQ B;  1GYB A;  2PZV A;  3PCR A;  2ML5 A;  1RN7 A;  3GZY B;  2WOH A;  5AEW B;  4N6L A;  2CG0 A;  2ZDJ A;  3BLZ A;  3SOY A;  2CFK A;  1A2K A;  2C11 A;  3IPT A;  1TIJ A;  1MNL A;  1U8C B;  4IT7 A;  4RNZ A;  1VQ9 3;  4XM4 A;  5A0O B;  1QAL A;  2XR8 B;  1W2Z A;  3MSO A;  4IPB A;  3RGA A;  1FGT A;  5STD A;  3HIG A;  1LXE A;  4FMC A;  1Q40 B;  1FGO A;  1MOL A;  3EC9 A;  1IQY A;  1N9J A;  3MHE A;  4R9L A;  5CXO A;  4HM8 B;  2Q07 A;  5KP3 A;  1YHQ 3;  1OUN A;  1A67 A;  4HM2 B;  3SXX A;  2OOV C;  2FXT A;  5IF6 A;  4GB5 A;  1WMN A;  1UW1 A;  1K8A 4;  3EF8 A;  1VQK 3;  3GRD A;  3GZB A;  1AVK A;  1RRL A;  3NQY A;  2UX0 A;  4TX4 A;  1RKY A;  3CCQ 3;  4K90 B;  3FZW A;  3AMO B;  1DYU A;  5AYR B;  4O3V A;  4N6N B;  2OOV A;  4KFE A;  1SPU A;  4OK0 A;  4N6O B;  1FGQ A;  2R4I A;  3S28 A;  2QIY A;  1EQK A;  3NXJ A;  5CF1 A;  1PFP A;  5D82 A;  3NV0 B;  2CG1 A;  3CMA 3;  1VQM 3;  4XB5 A;  4XDW A;  3CCE 3;  1NB5 I;  1QAK A;  1NJI 4;  3G71 3;  1DMQ A;  1LVN A;  3EN1 B;  3NQZ A;  1Q81 4;  1YJ9 3;  1JKG A;  3G4S 3;  2ZL8 A;  3DZL A;  1YI2 3;  3U1W A;  2QEX 3;  1KC8 4;  2PNC A;  3GZR A;  3OX9 A;  3F7X A;  3NM7 A;  3ER7 A;  3CC4 3;  1K41 A;  4GL6 A;  4N6M A;  1AVL A;  3S5C A;  3HZP A;  5JPP A;  3F8H A;  3Q90 A;  3N8B A;  3UJM A;  2O9U X;  2P0X A;  1EA2 A;  1WQL B;  3G0K A;  2GU3 A;  6STD A;  4EXR A;  1N8R 4;  1K73 4;  3LYG A;  1NB3 I;  4RBN A;  3T0U A;  1UI8 A;  2L4V A;  3DMC A;  1JV2 B;  3I56 3;  4STD A;  4ORL A;  4KFD A;  2WGQ A;  1RRH A;  1YVB I;  5D83 A;  1AV4 A;  3JUM A;  2IA7 A;  3LML A;  1W6C A;  1N5P A;  1OGZ A;  3DM8 A;  4BTW A;  3CME 3;  1UUV B;  1IU7 A;  3CU3 A;  3LZA A;  3CCM 3;  5D81 A;  4BTY A;  3Q1C A;  1D6Z A;  4LZI A;  3LTB A;  3GZX B;  3EX9 A;  2XRX B;  3MYT A;  2GXF A;  3FF2 A;  3WA2 X;  3K9M C;  2QGU A;  1SII A;  3FKA A;  5DRE A;  1FA3 A;  3LH4 A;  4H61 A;  1C7H A;  4WWU C;  1W7C A;  2XFT A;  4XBT A;  3B4P A;  1CEW I;  3BNB A;  3KKG A;  3G8Z A;  2W56 B;  5AYS C;  1DVD A;  1KWI A;  1EG9 B;  5CF2 A;  1OHO A;  4J9A A;  5KP1 A;  2Z7A A;  1ZX2 A;  3MG2 A;  3K0Z A;  1U5O A;  1FGR A;  2XH9 A;  1N9E A;  3NBB A;  3MKI A;  1N8Q A;  3F14 A;  4HM3 B;  3K63 A;  4R4K A;  2KCD A;  3MPH A;  1E3R A;  3SX1 A;  3JVC A;  2OTL 3;  1O7M B;  3N54 B;  2BO9 B;  1OF5 B;  4G1M B;  4O2H A;  2W0Q A;  4N6U A;  1S72 3;  3F7S A;  4WP5 A;  3KZT A;  2FNQ A;  1CQS A;  2P09 A;  3HII A;  3BND A;  5FGO A;  1TFO A;  3EJV A;  3CCR 3;  1NWW A;  3T8U A;  5BVB A;  4I4K A;  3BNC A;  3G6E 3;  3CPW 2;  3F9S A;  2RGQ A;  3NBJ A;  3VGN A;  2ML6 A;  4HM7 B;  2HMJ B;  3A76 A;  1YIT 3;  1NDO B;  5AII A;  1DMN A;  1TFK A;  5IEP A;  1YJN 3;  3KE7 A;  4O02 B;  1F8N A;  1IV9 A;  2W03 A;  5IG5 A;  1IK3 A;  3TDG A;  1ZO2 A;  2MF7 A;  7STD A;  1IQ8 A;  3V99 A;  1JN5 B;  3HI7 A;  3DGN A;  4FR9 A;  1FGM A;  2CC3 A;  1TU5 A;  3SLU A;  4FMD A;  4MEI A;  4QWT A;  4WHA A;  4FCJ A;  2I9W A;  1ASK A;  3E99 A;  4FCZ A;  2HML B;  2M7O A;  3QRD A;  2RCD A;  3ECF A;  3J7Y d;  5IG0 A;  1WMO A;  4CCV A;  4K61 A;  1Q7Y 4;  1OHS A;  3LT8 A;  3LTD A;  2XGL A;  2CWU A;  1GY5 A;  4ZM8 A;  4HM5 B;  2LQV A;  1DMM A;  1ROA A;  1JN5 A;  3LTA A;  5LC6 A;  2JDI H;  4NHF A;  3VF1 A;  5EEO A;  3BB9 A;  3CCU 3;  1GS3 A;  2A15 A;  2FGT A;  2OCT A;  3LOY A;  2E2T A;  4L8P A;  4RNY A;  3SOA A;  1A90 A;  2RFR A;  3JUQ A;  1IVV A;  2D42 A;  4AKY A;  4XDV A;  5CLK A;  2CFL A;  3PGB A;  1YJW 3;  4EV5 A;  3D9R A;  4FCM A;  1O7G B;  1CYV A;  1RJO A;  2OQE C;  2W9P A;  1W4N A;  8CHO A;  5JPU A;  4L7K A;  4HM0 B;  3CPO A;  2YX9 A;  3F8X A;  2W2C A;  4AKZ A;  1K28 A;  3WDG B;  4CDL A;  4XBY A;  1W00 A;  4HKV B;  3KN4 A;  3EE1 A;  5AIG A;  1STF I;  1OAC A;  1QJG A;  2HMK B;  2V1L A;  2W6J H;  5EQL A;  5KP4 A;  1OCV A;  3GAX A;  4X2O A;  5JBS A;  2W56 A;  1GY7 A;  1YGE A;  1ISK A;  3DGM A;  4HZB B;  5FW5 A;  3S29 A;  1JB5 A;  3NV0 A;  4LSO A;  3V98 A;  4LMI A;  1JJ2 2;  4IIA A;  4KVH A;  2CFG A;  2HMO B;  3X41 A;  5DRV A;  3M8C A;  4FMB A;  3WOD G;  3I55 3;  1Q40 A;  5IW9 A;  2BNG A;  3UNL A;  1STD A;  3CCS 3;  3CCL 3;  5TGN A;  1SQW A;  3EBT A;  3JUN A;  1PU4 A;  1D6Y A;  3IMA B;  1WNH A;  3KSP A;  1Q42 A;  2BMR B;  1OF5 A;  4R80 A;  2CFW A;  2BHM A;  2MC8 A;  3X3Z A;  4HM6 B;  1OGX A;  3Q2P A;  3WMD A;  1O7N B;  4K1U A;  1A2V A;  5AI1 A;  1ROV A;  4LEH A;  2P0M A;  1M1K 4;  4OVM A;  1V74 A;  2CH9 A;  3ALA A;  4AEQ A;  1KQS 2;  1GY6 A;  3EHC A;  3STD A;  3WA3 A;  5EVH A;  1W02 A;  2RSX A;  1Y4K A;  2OTJ 3;  2OQE A;  1CYU A;  4U13 A;  1M9G A;  3S67 A;  1WTH A;  1VQO 3;  3EN8 A;  4J8T A;  2F98 A;  2HMN B;  1VQL 3;  1VQ5 3;  2CWV A;  1IT7 A;  5AEU B;  2B24 B;  1LOX A;  2D1W A;  3LXU X;  3MG3 A;  2HMM B;  3CXC 2;  4O8S A;  1QVG 2;  3KFQ C;  2JQ5 A;  1W6Y A;  3FF0 A;  5I97 A;  1Q86 4;  2IUJ A;  4MMZ B;  1VQN 3;  1JKG B;  3OW2 2;  4RZM A;  3B8L A;  3AMO A;  3OWY A;  4HM4 B;  5IEO A;  3NBR A;  2Z77 A;  1US1 A;  1O7W B;  3LTC A;  2E2V A;  1M90 4;  3CNX A;  1TP6 A;  1AR0 A;  1ULI B;  2BT3 A;  1L5G B;  4R9K A;  5IEN A;  4H3U A;  3FG4 A;  1NU3 A;  3KII A;  4HM1 B;  3FG1 A;  3B7C A;  1IVX A;  2XSO B;  3LT9 A;  4MMX B;  4EYC A;  4HJL B;  2YFL B;  2Z6B A;  3FGY A;  3DXO A;  4WYK B;  1IQX A;  3D3L A;  1W6G A;  3B4O A;  3CD6 3;  2XFS A;  2K0M A;  3L0R A;  3K7C A;  2WOF A;  2GBW B;  3H3H A;  4MMY B;  2OWP A;  3DGO A;  1YIJ 3;  4KZ1 A;  1GD4 A;  3OXA A;  3EBY A;  3F40 A;  3K5T A;  2Z76 A;  2KXG A;  1SJW A;  3UL6 A;  5AIF A;  4Q53 A;  2BMQ B;  3X3Y A;  1OH0 A;  1UUW B;  1BUQ A;  4NRE A;  3NX0 A;  1UI7 A;  1VQ8 3;  1T5Y A;  1QVF 2;  3KSE D;  1ULJ B;  2STD A;  1M1X B;  4HBR A;  1VQ4 3;  3NHX A;  3DGL A;  5IG4 A;  1VQ6 3;  3JUO A;  3G16 A;  2E2U A;  1J2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...