1TIJA

3d domain-swapped human cystatin c with amyloid-like intermolecular beta-sheets
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
b'PRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin C
molecule tags Hydrolase inhibitor
source organism Homo sapiens
publication title 3D domain-swapped human cystatin C with amyloidlike intermolecular beta-sheets.
pubmed doi rcsb
total genus 16
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tijA00
1GD3A 3SVAA 1ROAA 2BO9B 3K9MC 1MOLA 1TIJA 3PYJA 1GD4A 3NX0A 1M9GA 4N6LA 1STFI 2W9PA 1N5PA 1CYUA 3S67A 1FA3A 4N6NB 3UL6A 1EQKA 1RN7A 1A67A 4IT7A 1KWIA 3QRDA 4TX4A 1IV7A 3MWZA 2CH9A 4LZIA 4N6OB 4CCVA 1DVDA 1NB3I 1PFPA 2KXGA 3KSED 5LC6A 1DVCA 1A90A 2O9UX 5EQLA 4N6MA 4N6TA 3IMAB 4N6UA 4ZM8A 3PXMA 5A0OB 1YVBI 1IV9A 1CYVA 1N5HA 4EYCA 1G96A 5LC7A 2W9QA 3LH4A 1FUWA 4N6V0 1LXEA 3KFQC 1WNHA 2OCTA 1CEWI 5ELUA 1NB5I 3L0RA 3Q2PA 1MNLA 5ELJA 1R4CA 3PS8A 1N9JA 3UL5A 3GAXA
chains in the Genus database with same CATH superfamily
1YIT3 3I563 2HMJB 2Y73A 3DGLA 1LOXA 1SIIA 1OHSA 2KF6A 4LMIA 1BNJA 2BU4A 5GSPA 1T2IA 1TRPA 3GZYB 4H61A 3CPOA 4LGQA 4MMZB 3S67A 1LQGC 3DH2A 5IG4A 3EN8A 3FG3A 3NQYA 4IT7A 2MF7A 4HBRA 2KRTA 1DYUA 4MMYB 5IEOA 1N9EA 2UX0A 3KZTA 1BUJA 2RFRA 3VF1A 2I9WA 3D79A 3CU3A 1RKYA 2PZVA 3BLZA 2P38A 4FCZA 5A0OB 2W0QA 4ZM8A 2Y74A 8CHOA 4PEJA 2Q07A 2XF3A 3CCQ3 1G02A 1RSNA 1RN4A 2CFLA 2WGQA 3B8LA 3E99A 3WODG 5BVBA 3LTBA 2UGIA 1IK3A 2BIRA 5AEUB 2ZHXB 3D5GA 5CK6A 3X40A 1X1WA 5IF6A 1V74A 2Z6BA 4BTWA 5CLKA 2F5WA 3KCHA 2K54A 2BMOB 2D42A 3J7Yd 2AAEA 2IMJA 2BNGA 1W6CA 2ZDJA 3DXOA 3LMLA 4N6NB 1VQK3 1DMMA 2KF3A 4EV2A 5AEWB 3RNTA 4R9KA 1NDOB 4HAAA 5G1KA 3G8ZA 2KF4A 4L8OA 3MPHA 3PCRA 4WYKA 4AKYA 2GBXB 1E97A 1LQMB 1NWWA 2OTJ3 3SLUA 1I2GA 3MKIA 4XBXA 3ZG5A 1C7HA 1CYVA 2HOHA 1K8A4 1BSEA 2CKFB 3H3HA 3TDGA 2F56A 1BSBA 5STDA 1AVKA 1VQQA 2CFGA 3BB9A 5JBSA 1T5YA 3NBJA 2JQ5A 3NV0A 2IA7A 3BNCA 1AQZA 1M1XB 1ROAA 1NJI4 1NO3A 2FXTA 3DY5A 1GY5A 1UCJA 3IJEB 1IT8A 3WDGB 2W6JH 2K0MA 1A67A 2IUKA 4HM4B 4GL6A 1UUGB 1Q864 3STDA 4FMBA 1GOYA 3EJVA 4HOHA 3CCE3 4IPBA 1G0TA 2CW9A 3SX1A 1RCKA 3IMAB 4N6UA 5D83A 2J8XB 3NQZA 5CF2A 3F14A 3CCV3 5BXQA 4HYZA 4XB5A 4EW5A 1B20A 7STDA 3X42A 3B4PA 1WTHA 3LTCA 4XM4A 3N8BA 2FGTA 5AI1A 5DREA 1EEJA 2F98A 4HM5B 3GAXA 1UCLA 3D9RA 2XSHB 1IT7A 1GS3A 4OVMA 3V99A 1ULIB 3NHXA 3X3YA 4HVNA 1B2UA 3V92A 3NV0B 1LOYA 1FYSA 3CC43 3FCSB 1BRJA 1EQKA 1RN1A 1BRKA 1DMNA 1RTUA 1JZDA 4NPBA 3FF0A 3FSDA 1DVDA 1PFPA 3EC9A 3UJMA 1T2HA 1ROVA 2XEPA 4XDWA 1VQ83 3FG4A 4H3UA 1BRNL 1RRLA 1VQ73 4RNYA 3PGBA 1BSCA 1B2XA 1FGOA 3UB1A 4KVHA 1NU3A 1OGZA 2H0GA 1RGFA 2OCTA 1O7PB 3OWSA 3MG2A 4GHOA 3DZLA 3MYTA 3EE1A 3U97A 1N8QA 3GZXB 2W03A 6STDA 4CDLA 1A2PA 3CCL3 3CMA3 1RGKA 2GU1A 2H0HA 1YJN3 1UW1A 1LNIA 3HK4A 7RNTA 3F40A 4HM0B 4NREA 3WMDA 1PYLA 3URPA 1JZOA 1S723 4FMCA 1MWRA 1I8VA 3EBYA 1JBSA 1SJWA 2Z7AA 3WR2A 2GU3A 1J2BA 1V58A 2H0IA 3CNMA 1K9M4 1EA2A 1O7HB 1MWUA 1YVBI 4STDA 4KFFA 2OOVA 1LVNA 3VSYA 4BU4A 1OPYA 1B21A 3LH4A 2BMRB 3G713 3S5CA 1A2KA 2AADA 4O3VA 1LOWA 5AIFA 1YGEA 2HMMB 1TUHA 1IU7A 1T3BA 1Q40A 1VQ53 2W2CA 3FGYA 1W7CA 3T0UA 1MWSA 4CPKA 3PYJA 1FUSA 3NX0A 4GB5A 4WYKB 3KSPA 6GSPA 2OQEC 3JUNA 5KP4A 2YX9A 1GY7A 3D4AA 1L5GB 2HMOB 5DRVA 2Z76A 1Y4KA 2WGOA 2ZL8A 5HGRA 2OQEA 2STDA 5KP1A 5LC6A 1KD14 2WO0A 1TTOA 1BVIA 1ULJB 5AYRB 1RDSA 1TU5A 1PU4A 1O7WB 3HOHA 3K0ZA 1UGIA 4EYCA 1JB5A 1FGRA 2HMLB 5KP3A 2CFDA 2XFTA 2A15A 3RDEA 3S28A 1LXEA 5IG5A 5AYSC 1LNHA 3CD63 3EHCA 3JUOA 3ER7A 2BMQB 1SIHA 1BRIA 3OW22 1RLSA 2GEXA 1FW7A 3CCJ3 1O7NB 1IVXA 1E3RA 3LT8A 2Z77A 1UUVB 1Q40B 1YJW3 3DGOA 2XGNA 1GMRA 3BU4A 1IYYA 3MWZA 4CCVA 1K734 3EN1B 2XH9A 2KXGA 3NM2A 2QGUA 3N54B 3QK9A 1Q824 1UCKA 2KAAA 3CCS3 1BNSA 1LRAA 2GEYA 3KIIA 1BRHA 4MJDA 4KFEA 4HM2B 4J8TA 1IQXA 3SYUA 4OUQA 3DGMA 3JUMA 1UCIA 1VQO3 3AGOA 3O8YA 2BT3A 1KC84 5EEOA 1QVG2 2B24B 1QVF2 1BSAA 1N9JA 3GSPA 3HIGA 1VQ63 1GD3A 3HX8A 5IENA 1S5AA 2GXFA 2C11A 3N9HA 4FMAA 3OX9A 4K1UA 1N5PA 1W4NA 4EC6A 3F8HA 1VZZA 4LSOA 3S29A 3X3ZA 8RNTA 1U8CB 3H51A 3EBTA 2O9UX 3AGNA 1VQ93 3A76A 5I97A 5IEPA 3AHWA 4LEHA 2ML5A 1N5HA 1AR0A 3BNBA 4FR9A 3NUVA 1FUWA 1D6UA 1BGSA 2B1XB 2INXA 2JDIH 3ALAA 3KFQC 1CEWI 1I3IA 3U1WA 1RGHA 1Q7HA 1RCLA 4I5QA 4O2HA 1JB2A 2CG1A 1I70A 4EXRA 2XRXB 2YFJB 1OHOA 3BNDA 4HM1B 2RGQA 1TIJA 2F5MA 1YHQ3 1M9GA 2E2VA 1FA3A 4MEIA 4HM3B 1GSPA 1RGEA 2XFSA 4J5GA 4XBYA 3G0KA 4BTYA 2V1LA 4WP5A 1IV7A 4R80A 1R4YA 3VGNA 1ZS7A 3AMOB 1BIRA 1CQSA 1UI7A 3F9SA 1DVCA 1UI8A 1W01A 4HJLB 3ZFZA 1F8NA 9RNTA 4HZ9B 1OUNA 4N6MA 3BIRA 3BNEA 3OWYA 2O3OA 1VQ43 3T8UA 1YVSA 1SQWA 2P05A 2FNQA 1RMSA 1U5OA 1Z1SA 4AEQA 3RGRA 3K63A 1JRQA 1FZUA 1Q9EA 3CCU3 3CME3 5EVHA 2KCDA 3OWUA 5AIHA 1R4CA 4O8SA 1BUQA 5AIGA 4BL2A 3SEDA 1KSIA 2BO9B 3F7SA 1MOLA 4DKIA 1OHPA 2IYJA 3NBBA 1TP6A 3UL6A 2CHCA 1RN7A 4XBTA 4R4KA 1I3FA 3FKAA 3AMOA 2YFLB 1WMOA 1EKMA 3GZRA 4LZIA 3PZWA 4HKVB 1QAFA 1OF5B 1JBTA 1BOXA 1W6GA 1EUIC 4HM6B 2W56B 5EQLA 1DMQA 1RHLA 3MHEA 1G96A 5FW5A 5LC7A 2W9QA 1W00A 4Q53A 3D5IA 1X1XA 3F7XA 2IUJA 1ZX2A 5TGNA 1B27A 1HYFA 1PY3A 4RNZA 1EG9B 3RGAA 1MNLA 1B2SA 3LOYA 1BANA 4N3VA 1O7MB 3DGYA 1A2VA 2RNTA 1BNEA 2GBWB 1AY7A 4FCMA 2QEX3 5BU4A 1X1YA 1BSDA 3V98A 1KQS2 5BIRA 1KWIA 1BNFA 2R4IA 3IPTA 3LTAA 3NM7A 1WMPA 4K90B 2CFWA 4RBNA 3SXXA 3KSED 5IG3A 5IERA 1ISKA 1JKGA 3HIIA 5HOHA 2W04A 3SOYA 1GYBA 1YI23 3FZWA 2CWTA 4KT3B 2L1SA 3KE7A 3WOFB 1IVUA 1HU9A 1ASKA 3CC73 1WMNA 3CC23 1VQL3 1I2EA 1ZO2A 2K3DA 3EQQB 5M19A 1W2B2 5ELJA 3OV4A 1W5ZA 1I2FA 5AIIA 1M1K4 1Q42A 2LYXA 3K9MC 1RNBA 4O02B 1JBRA 1GD4A 2XR8B 1CYUA 3T8NA 1HKXA 4K1VA 3MG1A 4I4KA 3WHOA 3ZG0A 3FF2A 3KN4A 3QRDA 1UUWB 1V57A 1K41A 3B7CA 3PCSA 1E3VA 1I0VA 1HZ1A 1RGGA 2E2UA 4HM7B 3AHSA 1FGQA 3WA2X 3PXMA 1UDII 2P0MA 3GWRA 4WFOA 1GOVA 3ECFA 3X41A 5CF1A 1BNIA 1OF5A 3LZAA 5M1AA 2HMKB 2XSOB 1RNTA 2W56A 2CK3H 4L8PA 1JJ22 3JUQA 1FGMA 3K7CA 4IIAA 4WHAA 1YNVX 3CCR3 4HZBB 1BAOA 1BNGA 2C4BA 5RNTA 3SOAA 2PNCA 3LTDA 6RNTA 1M904 3LYGA 4KZ1A 1B2MA 3DUKA 2CH9A 1W6YA 1VQM3 7GSPA 1K28A 4MMXB 5M18A 3KKGA 2CX1A 4EBGA 2RBIA 3S27A 5IW9A 2P0XA 2P09A 1BNRA 5G1LA 1IV9A 1IDPA 2YFIB 1SPUA 4QWTA 1D6ZA 1TFOA 2F4YA 3CNXA 4ORLA 3DM8A 1GOUA 1C54A 3D3LA 1I0XA 5ELUA 5CXOA 1FUTA 4X2OA 1TRQA 3OXAA 3Q1CA 1NNVA 1QALA 4N6LA 2W9PA 1DE3A 1LOVA 4GSPA 1JB4A 1OACA 2BHMA 5G2GA 1TFKA 1BRSA 3JVCA 4N6OB 2CWUA 2GSPA 2KF5A 5JPPA 1QAKA 3DGNA 1JN5B 3EX9A 2C10A 1GY6A 3CPW2 1ZGXA 3G4S3 1RRHA 1OCVA 3GRDA 1RGCA 2CX0A 3NXJA 4RNTA 1JNQA 4X2HA 3B4OA 3LXUX 1OGXA 2WOFA 2ZA4A 1TJDA 4ILFA 4R1KA 1W02A 1N8R4 1NB5I 5D82A 2XGLA 1JV2B 3DMCA 4JRFA 2F86B 3PS8A 4U13A 1DETA 1W2ZA 3UL5A 2ML6A 1QMAA 4LYLB 1UGHI 2HMNB 2M7OA 5D81A 1RJOA 1VQP3 2RCDA 1O7GB 1STFI 1US1A 4WWUC 3FLJA 3X3XA 1Q814 1IVVA 3EF8A 1YIJ3 2D1WA 1MGRA 1GMPA 2QIYA 1VQN3 3EB8A 3MG3A 4FMDA 1NB3I 2CFKA 4KFDA 3LT9A 3FH1A 1MWTA 1A90A 2LQVA 3I553 1B2ZA 1RGAA 3CXC2 4N6TA 3GZBA 4G1MB 4RZMA 3M8CA 4CJNA 1CH0A 3Q90A 4OK0A 3ROBA 3JUPA 3WA3A 5JPUA 4N6V0 4HM8B 3F8XA 2CIUA 1AVLA 3NBRA 2CWVA 3L0RA 1GMQA 4FCJA 1AV4A 3WOEB 1YGWA 2OOVC 3HZPA 4BTXA 1YJ93 4NHFA 3SVAA 3K5TA 1D6YA 2SBLA 3FG1A 2SARA 4BL3A 1BU4A 1IVWA 3HI7A 1Q7Y4 1RGLA 1B3SA 1JKGB 4AKZA 2R41A 2QA43 3Q3FA 4TX4A 4R9LA 3CCM3 4J9AA 2MC8A 2CG0A 2RSXA 4EV5A 1STDA 2E2TA 2WOHA 3UNLA 2F99A 1X1UA 4BIRA 1IQYA 1SARA 3G6E3 5FGOA 2OTL3 2L4VA 1IQ8A 1WQLB 1MGWA 3I0YA 4JF8A 4K61A 2OWPA 5IG0A 3A5EA 2IY2A 1WNHA 3G16A 1OH0A 3Q2PA 1BRGA 1JN5A 2CC3A 4XDVA 2UUGC 1FGTA 1QJGA 3MSOA 4L7KA 4J5KA
chains in the Genus database with same CATH topology
1YIT3 3I563 2HMJB 2Y73A 3DGLA 1LOXA 1SIIA 1OHSA 4LMIA 4H61A 3GZYB 4LGQA 3CPOA 4MMZB 3S67A 5IG4A 3EN8A 3FG3A 3NQYA 4IT7A 2MF7A 4HBRA 2KRTA 1DYUA 4MMYB 5IEOA 1N9EA 2UX0A 3KZTA 2RFRA 3VF1A 2I9WA 3CU3A 1RKYA 2PZVA 3BLZA 2P38A 4FCZA 5A0OB 2W0QA 4ZM8A 2Y74A 8CHOA 4PEJA 2Q07A 2XF3A 3CCQ3 2CFLA 2WGQA 3E99A 3B8LA 3WODG 5BVBA 3LTBA 1IK3A 5AEUB 5CK6A 3X40A 1V74A 2Z6BA 4BTWA 5CLKA 2K54A 2BMOB 2D42A 3J7Yd 2IMJA 2BNGA 1W6CA 2ZDJA 3DXOA 3LMLA 4N6NB 1VQK3 1DMMA 4EV2A 5AEWB 4R9KA 1NDOB 3G8ZA 4L8OA 3MPHA 3PCRA 4WYKA 4AKYA 2GBXB 1E97A 1NWWA 2OTJ3 3SLUA 4XBXA 3MKIA 1C7HA 1CYVA 1K8A4 2CKFB 3H3HA 3TDGA 5STDA 1AVKA 2CFGA 3BB9A 5JBSA 1T5YA 3NBJA 2JQ5A 3NV0A 2IA7A 3BNCA 1M1XB 1ROAA 1NJI4 1NO3A 2FXTA 3DY5A 1GY5A 3IJEB 1IT8A 3WDGB 2W6JH 2K0MA 1A67A 2IUKA 4HM4B 4GL6A 1Q864 3STDA 4FMBA 3EJVA 3CCE3 4IPBA 2CW9A 3SX1A 3IMAB 4N6UA 5D83A 3NQZA 5CF2A 3F14A 3CCV3 5BXQA 4HYZA 4XB5A 7STDA 3X42A 3B4PA 1WTHA 3LTCA 4XM4A 3N8BA 2FGTA 5AI1A 5DREA 2F98A 4HM5B 3GAXA 3D9RA 2XSHB 1IT7A 1GS3A 4OVMA 3V99A 1ULIB 3NHXA 3X3YA 4HVNA 3V92A 3NV0B 3CC43 3FCSB 1EQKA 1DMNA 3FF0A 3FSDA 1DVDA 1PFPA 3EC9A 3UJMA 2XEPA 1ROVA 4XDWA 1VQ83 3FG4A 4H3UA 1RRLA 1VQ73 4RNYA 3PGBA 1FGOA 3UB1A 4KVHA 1NU3A 1OGZA 2OCTA 1O7PB 3OWSA 3MG2A 3DZLA 3MYTA 3EE1A 3U97A 1N8QA 3GZXB 2W03A 6STDA 4CDLA 3CCL3 3CMA3 2GU1A 1YJN3 1UW1A 3HK4A 3F40A 4HM0B 4NREA 3WMDA 1S723 4FMCA 3EBYA 1SJWA 2Z7AA 2GU3A 1J2BA 3CNMA 1K9M4 1EA2A 1O7HB 1YVBI 4STDA 2OOVA 4KFFA 3VSYA 1LVNA 1OPYA 3LH4A 2BMRB 3G713 3S5CA 1A2KA 4O3VA 5AIFA 1YGEA 2HMMB 1TUHA 1IU7A 1Q40A 1VQ53 2W2CA 3FGYA 1W7CA 3T0UA 3PYJA 3NX0A 4GB5A 4WYKB 3KSPA 5KP4A 2OQEC 3JUNA 2YX9A 1GY7A 1L5GB 2HMOB 5DRVA 2Z76A 1Y4KA 2WGOA 2ZL8A 5HGRA 2OQEA 2STDA 5KP1A 5LC6A 1KD14 2WO0A 1ULJB 5AYRB 1TU5A 1PU4A 1O7WB 3K0ZA 4EYCA 1JB5A 1FGRA 2HMLB 5KP3A 2CFDA 2XFTA 2A15A 3RDEA 3S28A 1LXEA 5IG5A 5AYSC 1LNHA 3CD63 3EHCA 3JUOA 3ER7A 2BMQB 1SIHA 3OW22 2GEXA 3CCJ3 1O7NB 1IVXA 1E3RA 3LT8A 2Z77A 1UUVB 1Q40B 1YJW3 3DGOA 2XGNA 3MWZA 4CCVA 1K734 3EN1B 2XH9A 2KXGA 3NM2A 2QGUA 3N54B 3QK9A 1Q824 3CCS3 2GEYA 3KIIA 4MJDA 4KFEA 4HM2B 4J8TA 1IQXA 4OUQA 3DGMA 3JUMA 1VQO3 3O8YA 2BT3A 1KC84 5EEOA 1QVG2 2B24B 1QVF2 1N9JA 3HIGA 1VQ63 1GD3A 3HX8A 5IENA 1S5AA 2GXFA 2C11A 3N9HA 4FMAA 3OX9A 4K1UA 1N5PA 1W4NA 4EC6A 3F8HA 1VZZA 4LSOA 3S29A 3X3ZA 1U8CB 3H51A 3EBTA 2O9UX 1VQ93 3A76A 5I97A 5IEPA 4LEHA 2ML5A 1N5HA 1AR0A 3BNBA 4FR9A 3NUVA 1FUWA 1D6UA 2B1XB 2INXA 2JDIH 3ALAA 3KFQC 3U1WA 1CEWI 4O2HA 2CG1A 1JB2A 4EXRA 2XRXB 2YFJB 1OHOA 3BNDA 4HM1B 2RGQA 1TIJA 1YHQ3 1M9GA 2E2VA 1FA3A 4MEIA 4HM3B 4XBYA 2XFSA 3G0KA 4BTYA 2V1LA 4WP5A 1IV7A 4R80A 3VGNA 3AMOB 1CQSA 1UI7A 3F9SA 1DVCA 1UI8A 1W01A 4HJLB 1F8NA 4HZ9B 1OUNA 4N6MA 3BNEA 3OWYA 2O3OA 1VQ43 3T8UA 1SQWA 2P05A 2FNQA 1U5OA 1Z1SA 4AEQA 3RGRA 3K63A 1JRQA 3CCU3 3CME3 5EVHA 2KCDA 3OWUA 5AIHA 1R4CA 4O8SA 1BUQA 5AIGA 3SEDA 1KSIA 2BO9B 3F7SA 1MOLA 1OHPA 3NBBA 1TP6A 3UL6A 2CHCA 1RN7A 4XBTA 4R4KA 3FKAA 3AMOA 2YFLB 1WMOA 1EKMA 3GZRA 4LZIA 3PZWA 4HKVB 1QAFA 1OF5B 1W6GA 4HM6B 2W56B 5EQLA 1DMQA 3MHEA 1G96A 5FW5A 5LC7A 2W9QA 1W00A 4Q53A 3F7XA 2IUJA 1ZX2A 5TGNA 4RNZA 1EG9B 3RGAA 1MNLA 3LOYA 4N3VA 1O7MB 1A2VA 2GBWB 2QEX3 4FCMA 3V98A 1KQS2 1KWIA 2R4IA 3IPTA 3LTAA 3NM7A 4K90B 1WMPA 4RBNA 2CFWA 3SXXA 5IG3A 3KSED 5IERA 5IF6A 1ISKA 1JKGA 3HIIA 2W04A 3SOYA 1GYBA 1YI23 3FZWA 2CWTA 3KE7A 3WOFB 1IVUA 1HU9A 1ASKA 3CC73 1WMNA 3CC23 1VQL3 1ZO2A 3EQQB 1W2B2 5ELJA 3OV4A 1W5ZA 5AIIA 1M1K4 1Q42A 2LYXA 3K9MC 4O02B 1GD4A 2XR8B 1CYUA 3T8NA 1HKXA 4K1VA 3MG1A 4I4KA 3FF2A 3KN4A 3QRDA 1UUWB 1K41A 3B7CA 3PCSA 1E3VA 2E2UA 4HM7B 1FGQA 3WA2X 3PXMA 3GWRA 2P0MA 4WFOA 3X41A 5CF1A 3ECFA 1OF5A 3LZAA 2HMKB 2XSOB 2W56A 4L8PA 2CK3H 1JJ22 3JUQA 1FGMA 3K7CA 4IIAA 4WHAA 3CCR3 4HZBB 3SOAA 2PNCA 3LTDA 1M904 3LYGA 4KZ1A 3DUKA 2CH9A 1W6YA 1VQM3 1K28A 4MMXB 3KKGA 4EBGA 3S27A 5IW9A 2P0XA 2P09A 1IV9A 1IDPA 2YFIB 1SPUA 4QWTA 1D6ZA 1TFOA 4ORLA 3CNXA 3DM8A 3D3LA 5ELUA 5CXOA 4X2OA 3OXAA 3Q1CA 1QALA 4N6LA 2W9PA 1JB4A 1OACA 2BHMA 5G2GA 1TFKA 3JVCA 4N6OB 2CWUA 5JPPA 1QAKA 3DGNA 1JN5B 3EX9A 2C10A 1GY6A 3CPW2 3G4S3 1RRHA 1OCVA 3GRDA 3NXJA 1JNQA 4X2HA 3B4OA 3LXUX 1OGXA 2WOFA 4R1KA 1W02A 1N8R4 1NB5I 5D82A 2XGLA 1JV2B 3DMCA 4JRFA 2F86B 3PS8A 4U13A 3UL5A 1W2ZA 2ML6A 1QMAA 2HMNB 2M7OA 5D81A 1RJOA 1VQP3 2RCDA 1O7GB 1STFI 1US1A 4WWUC 3FLJA 3X3XA 1Q814 1IVVA 3EF8A 1YIJ3 2D1WA 1VQN3 2QIYA 3EB8A 3MG3A 4FMDA 1NB3I 2CFKA 4KFDA 3LT9A 3FH1A 1A90A 2LQVA 3I553 3CXC2 4N6TA 3GZBA 4G1MB 4RZMA 3M8CA 4OK0A 3Q90A 3ROBA 3JUPA 3WA3A 5JPUA 4N6V0 4HM8B 3F8XA 2CIUA 1AVLA 3NBRA 2CWVA 3L0RA 4FCJA 1AV4A 3WOEB 2OOVC 3HZPA 4BTXA 1YJ93 4NHFA 3SVAA 3K5TA 1D6YA 2SBLA 3FG1A 1IVWA 3HI7A 1Q7Y4 1JKGB 4AKZA 2QA43 4TX4A 4R9LA 3CCM3 4J9AA 2MC8A 2CG0A 2RSXA 4EV5A 1STDA 2E2TA 2WOHA 3UNLA 2F99A 2OTL3 1IQYA 3G6E3 5FGOA 2L4VA 1IQ8A 1WQLB 3I0YA 4JF8A 4K61A 2OWPA 5IG0A 1WNHA 3G16A 1OH0A 3Q2PA 2CC3A 1JN5A 4XDVA 1FGTA 1QJGA 3MSOA 4L7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD3 A;  3SVA A;  1ROA A;  2BO9 B;  3K9M C;  1MOL A;  1TIJ A;  3PYJ A;  1GD4 A;  3NX0 A;  1M9G A;  4N6L A;  1STF I;  2W9P A;  1N5P A;  1CYU A;  3S67 A;  1FA3 A;  4N6N B;  3UL6 A;  1EQK A;  1RN7 A;  1A67 A;  4IT7 A;  1KWI A;  3QRD A;  4TX4 A;  1IV7 A;  3MWZ A;  2CH9 A;  4LZI A;  4N6O B;  4CCV A;  1DVD A;  1NB3 I;  1PFP A;  2KXG A;  3KSE D;  5LC6 A;  1DVC A;  1A90 A;  2O9U X;  5EQL A;  4N6M A;  4N6T A;  3IMA B;  4N6U A;  4ZM8 A;  3PXM A;  5A0O B;  1YVB I;  1IV9 A;  1CYV A;  1N5H A;  4EYC A;  1G96 A;  5LC7 A;  2W9Q A;  3LH4 A;  1FUW A;  4N6V 0;  1LXE A;  3KFQ C;  1WNH A;  2OCT A;  1CEW I;  5ELU A;  1NB5 I;  3L0R A;  3Q2P A;  1MNL A;  5ELJ A;  1R4C A;  3PS8 A;  1N9J A;  3UL5 A;  3GAX A; 
#chains in the Genus database with same CATH topology
 1YIT 3;  3I56 3;  2HMJ B;  2Y73 A;  3DGL A;  1LOX A;  1SII A;  1OHS A;  2KF6 A;  4LMI A;  1BNJ A;  2BU4 A;  5GSP A;  1T2I A;  1TRP A;  3GZY B;  4H61 A;  3CPO A;  4LGQ A;  4MMZ B;  3S67 A;  1LQG C;  3DH2 A;  5IG4 A;  3EN8 A;  3FG3 A;  3NQY A;  4IT7 A;  2MF7 A;  4HBR A;  2KRT A;  1DYU A;  4MMY B;  5IEO A;  1N9E A;  2UX0 A;  3KZT A;  1BUJ A;  2RFR A;  3VF1 A;  2I9W A;  3D79 A;  3CU3 A;  1RKY A;  2PZV A;  3BLZ A;  2P38 A;  4FCZ A;  5A0O B;  2W0Q A;  4ZM8 A;  2Y74 A;  8CHO A;  4PEJ A;  2Q07 A;  2XF3 A;  3CCQ 3;  1G02 A;  1RSN A;  1RN4 A;  2CFL A;  2WGQ A;  3B8L A;  3E99 A;  3WOD G;  5BVB A;  3LTB A;  2UGI A;  1IK3 A;  2BIR A;  5AEU B;  2ZHX B;  3D5G A;  5CK6 A;  3X40 A;  1X1W A;  5IF6 A;  1V74 A;  2Z6B A;  4BTW A;  5CLK A;  2F5W A;  3KCH A;  2K54 A;  2BMO B;  2D42 A;  3J7Y d;  2AAE A;  2IMJ A;  2BNG A;  1W6C A;  2ZDJ A;  3DXO A;  3LML A;  4N6N B;  1VQK 3;  1DMM A;  2KF3 A;  4EV2 A;  5AEW B;  3RNT A;  4R9K A;  1NDO B;  4HAA A;  5G1K A;  3G8Z A;  2KF4 A;  4L8O A;  3MPH A;  3PCR A;  4WYK A;  4AKY A;  2GBX B;  1E97 A;  1LQM B;  1NWW A;  2OTJ 3;  3SLU A;  1I2G A;  3MKI A;  4XBX A;  3ZG5 A;  1C7H A;  1CYV A;  2HOH A;  1K8A 4;  1BSE A;  2CKF B;  3H3H A;  3TDG A;  2F56 A;  1BSB A;  5STD A;  1AVK A;  1VQQ A;  2CFG A;  3BB9 A;  5JBS A;  1T5Y A;  3NBJ A;  2JQ5 A;  3NV0 A;  2IA7 A;  3BNC A;  1AQZ A;  1M1X B;  1ROA A;  1NJI 4;  1NO3 A;  2FXT A;  3DY5 A;  1GY5 A;  1UCJ A;  3IJE B;  1IT8 A;  3WDG B;  2W6J H;  2K0M A;  1A67 A;  2IUK A;  4HM4 B;  4GL6 A;  1UUG B;  1Q86 4;  3STD A;  4FMB A;  1GOY A;  3EJV A;  4HOH A;  3CCE 3;  4IPB A;  1G0T A;  2CW9 A;  3SX1 A;  1RCK A;  3IMA B;  4N6U A;  5D83 A;  2J8X B;  3NQZ A;  5CF2 A;  3F14 A;  3CCV 3;  5BXQ A;  4HYZ A;  4XB5 A;  4EW5 A;  1B20 A;  7STD A;  3X42 A;  3B4P A;  1WTH A;  3LTC A;  4XM4 A;  3N8B A;  2FGT A;  5AI1 A;  5DRE A;  1EEJ A;  2F98 A;  4HM5 B;  3GAX A;  1UCL A;  3D9R A;  2XSH B;  1IT7 A;  1GS3 A;  4OVM A;  3V99 A;  1ULI B;  3NHX A;  3X3Y A;  4HVN A;  1B2U A;  3V92 A;  3NV0 B;  1LOY A;  1FYS A;  3CC4 3;  3FCS B;  1BRJ A;  1EQK A;  1RN1 A;  1BRK A;  1DMN A;  1RTU A;  1JZD A;  4NPB A;  3FF0 A;  3FSD A;  1DVD A;  1PFP A;  3EC9 A;  3UJM A;  1T2H A;  1ROV A;  2XEP A;  4XDW A;  1VQ8 3;  3FG4 A;  4H3U A;  1BRN L;  1RRL A;  1VQ7 3;  4RNY A;  3PGB A;  1BSC A;  1B2X A;  1FGO A;  3UB1 A;  4KVH A;  1NU3 A;  1OGZ A;  2H0G A;  1RGF A;  2OCT A;  1O7P B;  3OWS A;  3MG2 A;  4GHO A;  3DZL A;  3MYT A;  3EE1 A;  3U97 A;  1N8Q A;  3GZX B;  2W03 A;  6STD A;  4CDL A;  1A2P A;  3CCL 3;  3CMA 3;  1RGK A;  2GU1 A;  2H0H A;  1YJN 3;  1UW1 A;  1LNI A;  3HK4 A;  7RNT A;  3F40 A;  4HM0 B;  4NRE A;  3WMD A;  1PYL A;  3URP A;  1JZO A;  1S72 3;  4FMC A;  1MWR A;  1I8V A;  3EBY A;  1JBS A;  1SJW A;  2Z7A A;  3WR2 A;  2GU3 A;  1J2B A;  1V58 A;  2H0I A;  3CNM A;  1K9M 4;  1EA2 A;  1O7H B;  1MWU A;  1YVB I;  4STD A;  4KFF A;  2OOV A;  1LVN A;  3VSY A;  4BU4 A;  1OPY A;  1B21 A;  3LH4 A;  2BMR B;  3G71 3;  3S5C A;  1A2K A;  2AAD A;  4O3V A;  1LOW A;  5AIF A;  1YGE A;  2HMM B;  1TUH A;  1IU7 A;  1T3B A;  1Q40 A;  1VQ5 3;  2W2C A;  3FGY A;  1W7C A;  3T0U A;  1MWS A;  4CPK A;  3PYJ A;  1FUS A;  3NX0 A;  4GB5 A;  4WYK B;  3KSP A;  6GSP A;  2OQE C;  3JUN A;  5KP4 A;  2YX9 A;  1GY7 A;  3D4A A;  1L5G B;  2HMO B;  5DRV A;  2Z76 A;  1Y4K A;  2WGO A;  2ZL8 A;  5HGR A;  2OQE A;  2STD A;  5KP1 A;  5LC6 A;  1KD1 4;  2WO0 A;  1TTO A;  1BVI A;  1ULJ B;  5AYR B;  1RDS A;  1TU5 A;  1PU4 A;  1O7W B;  3HOH A;  3K0Z A;  1UGI A;  4EYC A;  1JB5 A;  1FGR A;  2HML B;  5KP3 A;  2CFD A;  2XFT A;  2A15 A;  3RDE A;  3S28 A;  1LXE A;  5IG5 A;  5AYS C;  1LNH A;  3CD6 3;  3EHC A;  3JUO A;  3ER7 A;  2BMQ B;  1SIH A;  1BRI A;  3OW2 2;  1RLS A;  2GEX A;  1FW7 A;  3CCJ 3;  1O7N B;  1IVX A;  1E3R A;  3LT8 A;  2Z77 A;  1UUV B;  1Q40 B;  1YJW 3;  3DGO A;  2XGN A;  1GMR A;  3BU4 A;  1IYY A;  3MWZ A;  4CCV A;  1K73 4;  3EN1 B;  2XH9 A;  2KXG A;  3NM2 A;  2QGU A;  3N54 B;  3QK9 A;  1Q82 4;  1UCK A;  2KAA A;  3CCS 3;  1BNS A;  1LRA A;  2GEY A;  3KII A;  1BRH A;  4MJD A;  4KFE A;  4HM2 B;  4J8T A;  1IQX A;  3SYU A;  4OUQ A;  3DGM A;  3JUM A;  1UCI A;  1VQO 3;  3AGO A;  3O8Y A;  2BT3 A;  1KC8 4;  5EEO A;  1QVG 2;  2B24 B;  1QVF 2;  1BSA A;  1N9J A;  3GSP A;  3HIG A;  1VQ6 3;  1GD3 A;  3HX8 A;  5IEN A;  1S5A A;  2GXF A;  2C11 A;  3N9H A;  4FMA A;  3OX9 A;  4K1U A;  1N5P A;  1W4N A;  4EC6 A;  3F8H A;  1VZZ A;  4LSO A;  3S29 A;  3X3Z A;  8RNT A;  1U8C B;  3H51 A;  3EBT A;  2O9U X;  3AGN A;  1VQ9 3;  3A76 A;  5I97 A;  5IEP A;  3AHW A;  4LEH A;  2ML5 A;  1N5H A;  1AR0 A;  3BNB A;  4FR9 A;  3NUV A;  1FUW A;  1D6U A;  1BGS A;  2B1X B;  2INX A;  2JDI H;  3ALA A;  3KFQ C;  1CEW I;  1I3I A;  3U1W A;  1RGH A;  1Q7H A;  1RCL A;  4I5Q A;  4O2H A;  1JB2 A;  2CG1 A;  1I70 A;  4EXR A;  2XRX B;  2YFJ B;  1OHO A;  3BND A;  4HM1 B;  2RGQ A;  1TIJ A;  2F5M A;  1YHQ 3;  1M9G A;  2E2V A;  1FA3 A;  4MEI A;  4HM3 B;  1GSP A;  1RGE A;  2XFS A;  4J5G A;  4XBY A;  3G0K A;  4BTY A;  2V1L A;  4WP5 A;  1IV7 A;  4R80 A;  1R4Y A;  3VGN A;  1ZS7 A;  3AMO B;  1BIR A;  1CQS A;  1UI7 A;  3F9S A;  1DVC A;  1UI8 A;  1W01 A;  4HJL B;  3ZFZ A;  1F8N A;  9RNT A;  4HZ9 B;  1OUN A;  4N6M A;  3BIR A;  3BNE A;  3OWY A;  2O3O A;  1VQ4 3;  3T8U A;  1YVS A;  1SQW A;  2P05 A;  2FNQ A;  1RMS A;  1U5O A;  1Z1S A;  4AEQ A;  3RGR A;  3K63 A;  1JRQ A;  1FZU A;  1Q9E A;  3CCU 3;  3CME 3;  5EVH A;  2KCD A;  3OWU A;  5AIH A;  1R4C A;  4O8S A;  1BUQ A;  5AIG A;  4BL2 A;  3SED A;  1KSI A;  2BO9 B;  3F7S A;  1MOL A;  4DKI A;  1OHP A;  2IYJ A;  3NBB A;  1TP6 A;  3UL6 A;  2CHC A;  1RN7 A;  4XBT A;  4R4K A;  1I3F A;  3FKA A;  3AMO A;  2YFL B;  1WMO A;  1EKM A;  3GZR A;  4LZI A;  3PZW A;  4HKV B;  1QAF A;  1OF5 B;  1JBT A;  1BOX A;  1W6G A;  1EUI C;  4HM6 B;  2W56 B;  5EQL A;  1DMQ A;  1RHL A;  3MHE A;  1G96 A;  5FW5 A;  5LC7 A;  2W9Q A;  1W00 A;  4Q53 A;  3D5I A;  1X1X A;  3F7X A;  2IUJ A;  1ZX2 A;  5TGN A;  1B27 A;  1HYF A;  1PY3 A;  4RNZ A;  1EG9 B;  3RGA A;  1MNL A;  1B2S A;  3LOY A;  1BAN A;  4N3V A;  1O7M B;  3DGY A;  1A2V A;  2RNT A;  1BNE A;  2GBW B;  1AY7 A;  4FCM A;  2QEX 3;  5BU4 A;  1X1Y A;  1BSD A;  3V98 A;  1KQS 2;  5BIR A;  1KWI A;  1BNF A;  2R4I A;  3IPT A;  3LTA A;  3NM7 A;  1WMP A;  4K90 B;  2CFW A;  4RBN A;  3SXX A;  3KSE D;  5IG3 A;  5IER A;  1ISK A;  1JKG A;  3HII A;  5HOH A;  2W04 A;  3SOY A;  1GYB A;  1YI2 3;  3FZW A;  2CWT A;  4KT3 B;  2L1S A;  3KE7 A;  3WOF B;  1IVU A;  1HU9 A;  1ASK A;  3CC7 3;  1WMN A;  3CC2 3;  1VQL 3;  1I2E A;  1ZO2 A;  2K3D A;  3EQQ B;  5M19 A;  1W2B 2;  5ELJ A;  3OV4 A;  1W5Z A;  1I2F A;  5AII A;  1M1K 4;  1Q42 A;  2LYX A;  3K9M C;  1RNB A;  4O02 B;  1JBR A;  1GD4 A;  2XR8 B;  1CYU A;  3T8N A;  1HKX A;  4K1V A;  3MG1 A;  4I4K A;  3WHO A;  3ZG0 A;  3FF2 A;  3KN4 A;  3QRD A;  1UUW B;  1V57 A;  1K41 A;  3B7C A;  3PCS A;  1E3V A;  1I0V A;  1HZ1 A;  1RGG A;  2E2U A;  4HM7 B;  3AHS A;  1FGQ A;  3WA2 X;  3PXM A;  1UDI I;  2P0M A;  3GWR A;  4WFO A;  1GOV A;  3ECF A;  3X41 A;  5CF1 A;  1BNI A;  1OF5 A;  3LZA A;  5M1A A;  2HMK B;  2XSO B;  1RNT A;  2W56 A;  2CK3 H;  4L8P A;  1JJ2 2;  3JUQ A;  1FGM A;  3K7C A;  4IIA A;  4WHA A;  1YNV X;  3CCR 3;  4HZB B;  1BAO A;  1BNG A;  2C4B A;  5RNT A;  3SOA A;  2PNC A;  3LTD A;  6RNT A;  1M90 4;  3LYG A;  4KZ1 A;  1B2M A;  3DUK A;  2CH9 A;  1W6Y A;  1VQM 3;  7GSP A;  1K28 A;  4MMX B;  5M18 A;  3KKG A;  2CX1 A;  4EBG A;  2RBI A;  3S27 A;  5IW9 A;  2P0X A;  2P09 A;  1BNR A;  5G1L A;  1IV9 A;  1IDP A;  2YFI B;  1SPU A;  4QWT A;  1D6Z A;  1TFO A;  2F4Y A;  3CNX A;  4ORL A;  3DM8 A;  1GOU A;  1C54 A;  3D3L A;  1I0X A;  5ELU A;  5CXO A;  1FUT A;  4X2O A;  1TRQ A;  3OXA A;  3Q1C A;  1NNV A;  1QAL A;  4N6L A;  2W9P A;  1DE3 A;  1LOV A;  4GSP A;  1JB4 A;  1OAC A;  2BHM A;  5G2G A;  1TFK A;  1BRS A;  3JVC A;  4N6O B;  2CWU A;  2GSP A;  2KF5 A;  5JPP A;  1QAK A;  3DGN A;  1JN5 B;  3EX9 A;  2C10 A;  1GY6 A;  3CPW 2;  1ZGX A;  3G4S 3;  1RRH A;  1OCV A;  3GRD A;  1RGC A;  2CX0 A;  3NXJ A;  4RNT A;  1JNQ A;  4X2H A;  3B4O A;  3LXU X;  1OGX A;  2WOF A;  2ZA4 A;  1TJD A;  4ILF A;  4R1K A;  1W02 A;  1N8R 4;  1NB5 I;  5D82 A;  2XGL A;  1JV2 B;  3DMC A;  4JRF A;  2F86 B;  3PS8 A;  4U13 A;  1DET A;  1W2Z A;  3UL5 A;  2ML6 A;  1QMA A;  4LYL B;  1UGH I;  2HMN B;  2M7O A;  5D81 A;  1RJO A;  1VQP 3;  2RCD A;  1O7G B;  1STF I;  1US1 A;  4WWU C;  3FLJ A;  3X3X A;  1Q81 4;  1IVV A;  3EF8 A;  1YIJ 3;  2D1W A;  1MGR A;  1GMP A;  2QIY A;  1VQN 3;  3EB8 A;  3MG3 A;  4FMD A;  1NB3 I;  2CFK A;  4KFD A;  3LT9 A;  3FH1 A;  1MWT A;  1A90 A;  2LQV A;  3I55 3;  1B2Z A;  1RGA A;  3CXC 2;  4N6T A;  3GZB A;  4G1M B;  4RZM A;  3M8C A;  4CJN A;  1CH0 A;  3Q90 A;  4OK0 A;  3ROB A;  3JUP A;  3WA3 A;  5JPU A;  4N6V 0;  4HM8 B;  3F8X A;  2CIU A;  1AVL A;  3NBR A;  2CWV A;  3L0R A;  1GMQ A;  4FCJ A;  1AV4 A;  3WOE B;  1YGW A;  2OOV C;  3HZP A;  4BTX A;  1YJ9 3;  4NHF A;  3SVA A;  3K5T A;  1D6Y A;  2SBL A;  3FG1 A;  2SAR A;  4BL3 A;  1BU4 A;  1IVW A;  3HI7 A;  1Q7Y 4;  1RGL A;  1B3S A;  1JKG B;  4AKZ A;  2R41 A;  2QA4 3;  3Q3F A;  4TX4 A;  4R9L A;  3CCM 3;  4J9A A;  2MC8 A;  2CG0 A;  2RSX A;  4EV5 A;  1STD A;  2E2T A;  2WOH A;  3UNL A;  2F99 A;  1X1U A;  4BIR A;  1IQY A;  1SAR A;  3G6E 3;  5FGO A;  2OTL 3;  2L4V A;  1IQ8 A;  1WQL B;  1MGW A;  3I0Y A;  4JF8 A;  4K61 A;  2OWP A;  5IG0 A;  3A5E A;  2IY2 A;  1WNH A;  3G16 A;  1OH0 A;  3Q2P A;  1BRG A;  1JN5 A;  2CC3 A;  4XDV A;  2UUG C;  1FGT A;  1QJG A;  3MSO A;  4L7K A;  4J5K A; 
#chains in the Genus database with same CATH homology
 1YIT 3;  3I56 3;  2HMJ B;  2Y73 A;  3DGL A;  1LOX A;  1SII A;  1OHS A;  4LMI A;  4H61 A;  3GZY B;  4LGQ A;  3CPO A;  4MMZ B;  3S67 A;  5IG4 A;  3EN8 A;  3FG3 A;  3NQY A;  4IT7 A;  2MF7 A;  4HBR A;  2KRT A;  1DYU A;  4MMY B;  5IEO A;  1N9E A;  2UX0 A;  3KZT A;  2RFR A;  3VF1 A;  2I9W A;  3CU3 A;  1RKY A;  2PZV A;  3BLZ A;  2P38 A;  4FCZ A;  5A0O B;  2W0Q A;  4ZM8 A;  2Y74 A;  8CHO A;  4PEJ A;  2Q07 A;  2XF3 A;  3CCQ 3;  2CFL A;  2WGQ A;  3E99 A;  3B8L A;  3WOD G;  5BVB A;  3LTB A;  1IK3 A;  5AEU B;  5CK6 A;  3X40 A;  1V74 A;  2Z6B A;  4BTW A;  5CLK A;  2K54 A;  2BMO B;  2D42 A;  3J7Y d;  2IMJ A;  2BNG A;  1W6C A;  2ZDJ A;  3DXO A;  3LML A;  4N6N B;  1VQK 3;  1DMM A;  4EV2 A;  5AEW B;  4R9K A;  1NDO B;  3G8Z A;  4L8O A;  3MPH A;  3PCR A;  4WYK A;  4AKY A;  2GBX B;  1E97 A;  1NWW A;  2OTJ 3;  3SLU A;  4XBX A;  3MKI A;  1C7H A;  1CYV A;  1K8A 4;  2CKF B;  3H3H A;  3TDG A;  5STD A;  1AVK A;  2CFG A;  3BB9 A;  5JBS A;  1T5Y A;  3NBJ A;  2JQ5 A;  3NV0 A;  2IA7 A;  3BNC A;  1M1X B;  1ROA A;  1NJI 4;  1NO3 A;  2FXT A;  3DY5 A;  1GY5 A;  3IJE B;  1IT8 A;  3WDG B;  2W6J H;  2K0M A;  1A67 A;  2IUK A;  4HM4 B;  4GL6 A;  1Q86 4;  3STD A;  4FMB A;  3EJV A;  3CCE 3;  4IPB A;  2CW9 A;  3SX1 A;  3IMA B;  4N6U A;  5D83 A;  3NQZ A;  5CF2 A;  3F14 A;  3CCV 3;  5BXQ A;  4HYZ A;  4XB5 A;  7STD A;  3X42 A;  3B4P A;  1WTH A;  3LTC A;  4XM4 A;  3N8B A;  2FGT A;  5AI1 A;  5DRE A;  2F98 A;  4HM5 B;  3GAX A;  3D9R A;  2XSH B;  1IT7 A;  1GS3 A;  4OVM A;  3V99 A;  1ULI B;  3NHX A;  3X3Y A;  4HVN A;  3V92 A;  3NV0 B;  3CC4 3;  3FCS B;  1EQK A;  1DMN A;  3FF0 A;  3FSD A;  1DVD A;  1PFP A;  3EC9 A;  3UJM A;  2XEP A;  1ROV A;  4XDW A;  1VQ8 3;  3FG4 A;  4H3U A;  1RRL A;  1VQ7 3;  4RNY A;  3PGB A;  1FGO A;  3UB1 A;  4KVH A;  1NU3 A;  1OGZ A;  2OCT A;  1O7P B;  3OWS A;  3MG2 A;  3DZL A;  3MYT A;  3EE1 A;  3U97 A;  1N8Q A;  3GZX B;  2W03 A;  6STD A;  4CDL A;  3CCL 3;  3CMA 3;  2GU1 A;  1YJN 3;  1UW1 A;  3HK4 A;  3F40 A;  4HM0 B;  4NRE A;  3WMD A;  1S72 3;  4FMC A;  3EBY A;  1SJW A;  2Z7A A;  2GU3 A;  1J2B A;  3CNM A;  1K9M 4;  1EA2 A;  1O7H B;  1YVB I;  4STD A;  2OOV A;  4KFF A;  3VSY A;  1LVN A;  1OPY A;  3LH4 A;  2BMR B;  3G71 3;  3S5C A;  1A2K A;  4O3V A;  5AIF A;  1YGE A;  2HMM B;  1TUH A;  1IU7 A;  1Q40 A;  1VQ5 3;  2W2C A;  3FGY A;  1W7C A;  3T0U A;  3PYJ A;  3NX0 A;  4GB5 A;  4WYK B;  3KSP A;  5KP4 A;  2OQE C;  3JUN A;  2YX9 A;  1GY7 A;  1L5G B;  2HMO B;  5DRV A;  2Z76 A;  1Y4K A;  2WGO A;  2ZL8 A;  5HGR A;  2OQE A;  2STD A;  5KP1 A;  5LC6 A;  1KD1 4;  2WO0 A;  1ULJ B;  5AYR B;  1TU5 A;  1PU4 A;  1O7W B;  3K0Z A;  4EYC A;  1JB5 A;  1FGR A;  2HML B;  5KP3 A;  2CFD A;  2XFT A;  2A15 A;  3RDE A;  3S28 A;  1LXE A;  5IG5 A;  5AYS C;  1LNH A;  3CD6 3;  3EHC A;  3JUO A;  3ER7 A;  2BMQ B;  1SIH A;  3OW2 2;  2GEX A;  3CCJ 3;  1O7N B;  1IVX A;  1E3R A;  3LT8 A;  2Z77 A;  1UUV B;  1Q40 B;  1YJW 3;  3DGO A;  2XGN A;  3MWZ A;  4CCV A;  1K73 4;  3EN1 B;  2XH9 A;  2KXG A;  3NM2 A;  2QGU A;  3N54 B;  3QK9 A;  1Q82 4;  3CCS 3;  2GEY A;  3KII A;  4MJD A;  4KFE A;  4HM2 B;  4J8T A;  1IQX A;  4OUQ A;  3DGM A;  3JUM A;  1VQO 3;  3O8Y A;  2BT3 A;  1KC8 4;  5EEO A;  1QVG 2;  2B24 B;  1QVF 2;  1N9J A;  3HIG A;  1VQ6 3;  1GD3 A;  3HX8 A;  5IEN A;  1S5A A;  2GXF A;  2C11 A;  3N9H A;  4FMA A;  3OX9 A;  4K1U A;  1N5P A;  1W4N A;  4EC6 A;  3F8H A;  1VZZ A;  4LSO A;  3S29 A;  3X3Z A;  1U8C B;  3H51 A;  3EBT A;  2O9U X;  1VQ9 3;  3A76 A;  5I97 A;  5IEP A;  4LEH A;  2ML5 A;  1N5H A;  1AR0 A;  3BNB A;  4FR9 A;  3NUV A;  1FUW A;  1D6U A;  2B1X B;  2INX A;  2JDI H;  3ALA A;  3KFQ C;  3U1W A;  1CEW I;  4O2H A;  2CG1 A;  1JB2 A;  4EXR A;  2XRX B;  2YFJ B;  1OHO A;  3BND A;  4HM1 B;  2RGQ A;  1TIJ A;  1YHQ 3;  1M9G A;  2E2V A;  1FA3 A;  4MEI A;  4HM3 B;  4XBY A;  2XFS A;  3G0K A;  4BTY A;  2V1L A;  4WP5 A;  1IV7 A;  4R80 A;  3VGN A;  3AMO B;  1CQS A;  1UI7 A;  3F9S A;  1DVC A;  1UI8 A;  1W01 A;  4HJL B;  1F8N A;  4HZ9 B;  1OUN A;  4N6M A;  3BNE A;  3OWY A;  2O3O A;  1VQ4 3;  3T8U A;  1SQW A;  2P05 A;  2FNQ A;  1U5O A;  1Z1S A;  4AEQ A;  3RGR A;  3K63 A;  1JRQ A;  3CCU 3;  3CME 3;  5EVH A;  2KCD A;  3OWU A;  5AIH A;  1R4C A;  4O8S A;  1BUQ A;  5AIG A;  3SED A;  1KSI A;  2BO9 B;  3F7S A;  1MOL A;  1OHP A;  3NBB A;  1TP6 A;  3UL6 A;  2CHC A;  1RN7 A;  4XBT A;  4R4K A;  3FKA A;  3AMO A;  2YFL B;  1WMO A;  1EKM A;  3GZR A;  4LZI A;  3PZW A;  4HKV B;  1QAF A;  1OF5 B;  1W6G A;  4HM6 B;  2W56 B;  5EQL A;  1DMQ A;  3MHE A;  1G96 A;  5FW5 A;  5LC7 A;  2W9Q A;  1W00 A;  4Q53 A;  3F7X A;  2IUJ A;  1ZX2 A;  5TGN A;  4RNZ A;  1EG9 B;  3RGA A;  1MNL A;  3LOY A;  4N3V A;  1O7M B;  1A2V A;  2GBW B;  2QEX 3;  4FCM A;  3V98 A;  1KQS 2;  1KWI A;  2R4I A;  3IPT A;  3LTA A;  3NM7 A;  4K90 B;  1WMP A;  4RBN A;  2CFW A;  3SXX A;  5IG3 A;  3KSE D;  5IER A;  5IF6 A;  1ISK A;  1JKG A;  3HII A;  2W04 A;  3SOY A;  1GYB A;  1YI2 3;  3FZW A;  2CWT A;  3KE7 A;  3WOF B;  1IVU A;  1HU9 A;  1ASK A;  3CC7 3;  1WMN A;  3CC2 3;  1VQL 3;  1ZO2 A;  3EQQ B;  1W2B 2;  5ELJ A;  3OV4 A;  1W5Z A;  5AII A;  1M1K 4;  1Q42 A;  2LYX A;  3K9M C;  4O02 B;  1GD4 A;  2XR8 B;  1CYU A;  3T8N A;  1HKX A;  4K1V A;  3MG1 A;  4I4K A;  3FF2 A;  3KN4 A;  3QRD A;  1UUW B;  1K41 A;  3B7C A;  3PCS A;  1E3V A;  2E2U A;  4HM7 B;  1FGQ A;  3WA2 X;  3PXM A;  3GWR A;  2P0M A;  4WFO A;  3X41 A;  5CF1 A;  3ECF A;  1OF5 A;  3LZA A;  2HMK B;  2XSO B;  2W56 A;  4L8P A;  2CK3 H;  1JJ2 2;  3JUQ A;  1FGM A;  3K7C A;  4IIA A;  4WHA A;  3CCR 3;  4HZB B;  3SOA A;  2PNC A;  3LTD A;  1M90 4;  3LYG A;  4KZ1 A;  3DUK A;  2CH9 A;  1W6Y A;  1VQM 3;  1K28 A;  4MMX B;  3KKG A;  4EBG A;  3S27 A;  5IW9 A;  2P0X A;  2P09 A;  1IV9 A;  1IDP A;  2YFI B;  1SPU A;  4QWT A;  1D6Z A;  1TFO A;  4ORL A;  3CNX A;  3DM8 A;  3D3L A;  5ELU A;  5CXO A;  4X2O A;  3OXA A;  3Q1C A;  1QAL A;  4N6L A;  2W9P A;  1JB4 A;  1OAC A;  2BHM A;  5G2G A;  1TFK A;  3JVC A;  4N6O B;  2CWU A;  5JPP A;  1QAK A;  3DGN A;  1JN5 B;  3EX9 A;  2C10 A;  1GY6 A;  3CPW 2;  3G4S 3;  1RRH A;  1OCV A;  3GRD A;  3NXJ A;  1JNQ A;  4X2H A;  3B4O A;  3LXU X;  1OGX A;  2WOF A;  4R1K A;  1W02 A;  1N8R 4;  1NB5 I;  5D82 A;  2XGL A;  1JV2 B;  3DMC A;  4JRF A;  2F86 B;  3PS8 A;  4U13 A;  3UL5 A;  1W2Z A;  2ML6 A;  1QMA A;  2HMN B;  2M7O A;  5D81 A;  1RJO A;  1VQP 3;  2RCD A;  1O7G B;  1STF I;  1US1 A;  4WWU C;  3FLJ A;  3X3X A;  1Q81 4;  1IVV A;  3EF8 A;  1YIJ 3;  2D1W A;  1VQN 3;  2QIY A;  3EB8 A;  3MG3 A;  4FMD A;  1NB3 I;  2CFK A;  4KFD A;  3LT9 A;  3FH1 A;  1A90 A;  2LQV A;  3I55 3;  3CXC 2;  4N6T A;  3GZB A;  4G1M B;  4RZM A;  3M8C A;  4OK0 A;  3Q90 A;  3ROB A;  3JUP A;  3WA3 A;  5JPU A;  4N6V 0;  4HM8 B;  3F8X A;  2CIU A;  1AVL A;  3NBR A;  2CWV A;  3L0R A;  4FCJ A;  1AV4 A;  3WOE B;  2OOV C;  3HZP A;  4BTX A;  1YJ9 3;  4NHF A;  3SVA A;  3K5T A;  1D6Y A;  2SBL A;  3FG1 A;  1IVW A;  3HI7 A;  1Q7Y 4;  1JKG B;  4AKZ A;  2QA4 3;  4TX4 A;  4R9L A;  3CCM 3;  4J9A A;  2MC8 A;  2CG0 A;  2RSX A;  4EV5 A;  1STD A;  2E2T A;  2WOH A;  3UNL A;  2F99 A;  2OTL 3;  1IQY A;  3G6E 3;  5FGO A;  2L4V A;  1IQ8 A;  1WQL B;  3I0Y A;  4JF8 A;  4K61 A;  2OWP A;  5IG0 A;  1WNH A;  3G16 A;  1OH0 A;  3Q2P A;  2CC3 A;  1JN5 A;  4XDV A;  1FGT A;  1QJG A;  3MSO A;  4L7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...