1TILB

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
HMSLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDASGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-sigma F factor
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 38
structure length 117
sequence length 117
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1tilB00
3ZTBA 4DGHA 3IF5A 5EUWA 3ZXNA 5EUUA 4QTPA 1SBOA 1TH8B 3LKLA 5EUXA 5EUZA 3T6OA 1H4YA 3IH8A 4HYLA 3F43A 3NY7A 3OIZA 2KA5A 3AGEA 3IH9A 5EUSA 1H4ZA 1T6RA 3OIRA 1VC1A 2VY9A 1TIDB 3MGLA 4DGFA 3IHBA 3AGDA 4XS5A 1THNB 2KLNA 1BUZA 3LLOA 1TILB 1AUZA 3IHAA 5EZBA 1H4XA
chains in the Genus database with same CATH superfamily
3V97A 4DGHA 3V8VA 5EUWA 3ZXNA 4DMGA 1N6EA 5EUZA 2ZOAA 3D03A 3DUPA 2OASA 1FC7A 2KA5A 3DJAA 3GMFA 3AGEA 3GK7A 2B78A 4DGFA 4XS5A 3C0KA 1THNB 1HF2A 1BUZA 3IHAA 5EZBA 1FCFA 1FC6A 1SBOA 3LKLA 3T6OA 2AS0A 3IH8A 4HYLA 3NY7A 3GVJA 3OIZA 4AE2A 1H4ZA 1T6RA 4GHNA 1VC1A 2VY9A 3IHBA 1K32A 3MOGA 3GVKA 1TILB 1H4XA 3ZTBA 3D3UA 3IF5A 5EUUA 3QDQA 4QTPA 1J7XA 2RRLA 3F43A 5EUSA 3IH9A 4AEJA 3MGLA 1FC9A 3GHFA 3LLOA 3JU4A 2DXLA 3K50A 1TH8B 1BPLA 5EUXA 3GVLA 4JC0A 4L8KA 1H4YA 2DXNA 3LDFA 3VSEA 1V0EA 1N6FA 3DORA 1V0FA 3OIRA 1N6DA 2ZO9B 1TIDB 4HIZA 1WXWA 3AGDA 4L1CA 2CWWA 2KLNA 3EH7A 1AUZA 1WXXA
chains in the Genus database with same CATH topology
3ZTBA 4DGHA 3IF5A 5EUWA 3ZXNA 5EUUA 4QTPA 1SBOA 1TH8B 3LKLA 5EUXA 5EUZA 3T6OA 1H4YA 3IH8A 4HYLA 3F43A 3NY7A 3OIZA 2KA5A 3AGEA 3IH9A 5EUSA 1H4ZA 1T6RA 3OIRA 1VC1A 2VY9A 1TIDB 3MGLA 4DGFA 3IHBA 3AGDA 4XS5A 1THNB 2KLNA 1BUZA 3LLOA 1TILB 1AUZA 3IHAA 5EZBA 1H4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTB A;  4DGH A;  3IF5 A;  5EUW A;  3ZXN A;  5EUU A;  4QTP A;  1SBO A;  1TH8 B;  3LKL A;  5EUX A;  5EUZ A;  3T6O A;  1H4Y A;  3IH8 A;  4HYL A;  3F43 A;  3NY7 A;  3OIZ A;  2KA5 A;  3AGE A;  3IH9 A;  5EUS A;  1H4Z A;  1T6R A;  3OIR A;  1VC1 A;  2VY9 A;  1TID B;  3MGL A;  4DGF A;  3IHB A;  3AGD A;  4XS5 A;  1THN B;  2KLN A;  1BUZ A;  3LLO A;  1TIL B;  1AUZ A;  3IHA A;  5EZB A;  1H4X A; 
#chains in the Genus database with same CATH topology
 3V97 A;  4DGH A;  3V8V A;  5EUW A;  3ZXN A;  4DMG A;  1N6E A;  5EUZ A;  2ZOA A;  3D03 A;  3DUP A;  2OAS A;  1FC7 A;  2KA5 A;  3DJA A;  3GMF A;  3AGE A;  3GK7 A;  2B78 A;  4DGF A;  4XS5 A;  3C0K A;  1THN B;  1HF2 A;  1BUZ A;  3IHA A;  5EZB A;  1FCF A;  1FC6 A;  1SBO A;  3LKL A;  3T6O A;  2AS0 A;  3IH8 A;  4HYL A;  3NY7 A;  3GVJ A;  3OIZ A;  4AE2 A;  1H4Z A;  1T6R A;  4GHN A;  1VC1 A;  2VY9 A;  3IHB A;  1K32 A;  3MOG A;  3GVK A;  1TIL B;  1H4X A;  3ZTB A;  3D3U A;  3IF5 A;  5EUU A;  3QDQ A;  4QTP A;  1J7X A;  2RRL A;  3F43 A;  5EUS A;  3IH9 A;  4AEJ A;  3MGL A;  1FC9 A;  3GHF A;  3LLO A;  3JU4 A;  2DXL A;  3K50 A;  1TH8 B;  1BPL A;  5EUX A;  3GVL A;  4JC0 A;  4L8K A;  1H4Y A;  2DXN A;  3LDF A;  3VSE A;  1V0E A;  1N6F A;  3DOR A;  1V0F A;  3OIR A;  1N6D A;  2ZO9 B;  1TID B;  4HIZ A;  1WXW A;  3AGD A;  4L1C A;  2CWW A;  2KLN A;  3EH7 A;  1AUZ A;  1WXX A; 
#chains in the Genus database with same CATH homology
 3ZTB A;  4DGH A;  3IF5 A;  5EUW A;  3ZXN A;  5EUU A;  4QTP A;  1SBO A;  1TH8 B;  3LKL A;  5EUX A;  5EUZ A;  3T6O A;  1H4Y A;  3IH8 A;  4HYL A;  3F43 A;  3NY7 A;  3OIZ A;  2KA5 A;  3AGE A;  3IH9 A;  5EUS A;  1H4Z A;  1T6R A;  3OIR A;  1VC1 A;  2VY9 A;  1TID B;  3MGL A;  4DGF A;  3IHB A;  3AGD A;  4XS5 A;  1THN B;  2KLN A;  1BUZ A;  3LLO A;  1TIL B;  1AUZ A;  3IHA A;  5EZB A;  1H4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...