1TILB

Crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
HMSLAIDLEVKQDVLIVRLSGELDHHTAEELREQVTDVLENRAIRHIVLNLGQLTFMDASGLGVILGRYKQIKNVGGQMVVCAVSPAVKRLFDMSGLFKIIRVEADEQFALQALGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the ADP and ATP Bound Forms of the Bacillus Anti-sigma Factor SpoIIAB in Complex with the Anti-anti-sigma SpoIIAA.
pubmed doi rcsb
molecule keywords Anti-sigma F factor
molecule tags Transcription
source organism Geobacillus stearothermophilus
total genus 38
structure length 117
sequence length 117
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 1tilB00
3LKLA 3OIRA 3AGEA 1TIDB 5EUWA 3IHBA 4DGFA 4XS5A 4DGHA 1H4ZA 5EUUA 2KLNA 3ZXNA 5EZBA 2KA5A 3LLOA 3IH8A 3MGLA 3T6OA 3IHAA 1H4XA 1H4YA 1T6RA 3AGDA 4HYLA 3ZTBA 1SBOA 2VY9A 1TILB 5EUZA 1THNB 5EUXA 5EUSA 3IF5A 1TH8B 1VC1A 4QTPA 3F43A 1AUZA 3OIZA 3NY7A 3IH9A 1BUZA
chains in the Genus database with same CATH superfamily
3OIRA 3V97A 1H4ZA 5EUUA 2KLNA 5EZBA 1BPLA 3IH8A 1N6EA 1WXWA 2VY9A 1TILB 3MOGA 1TH8B 2DXLA 4DMGA 3GVKA 2AS0A 3LDFA 3IH9A 1BUZA 3EH7A 5EUWA 3IHBA 3GVLA 1FC6A 2CWWA 1V0FA 2KA5A 3NY7A 1T6RA 1V0EA 4HYLA 2DXNA 3C0KA 4L8KA 1THNB 5EUXA 3GHFA 3F43A 1HF2A 3K50A 3D3UA 1AUZA 3AGEA 2ZOAA 3VSEA 4DGHA 3ZXNA 3IHAA 3GK7A 4HIZA 1H4YA 2RRLA 3AGDA 1N6DA 1K32A 3ZTBA 1SBOA 5EUZA 5EUSA 3QDQA 4QTPA 2ZO9B 3OIZA 3JU4A 2B78A 4L1CA 3GVJA 1TIDB 1N6FA 4DGFA 4XS5A 4JC0A 2OASA 3DORA 3LLOA 3MGLA 3T6OA 1FC7A 1H4XA 1WXXA 3DJAA 3V8VA 1FC9A 4AE2A 1FCFA 4AEJA 1J7XA 3DUPA 3IF5A 3D03A 1VC1A 3GMFA 4GHNA 3LKLA
chains in the Genus database with same CATH topology
3LKLA 3OIRA 3AGEA 1TIDB 5EUWA 3IHBA 4DGFA 4XS5A 4DGHA 1H4ZA 5EUUA 2KLNA 3ZXNA 5EZBA 2KA5A 3LLOA 3IH8A 3MGLA 3T6OA 3IHAA 1H4XA 1H4YA 1T6RA 3AGDA 4HYLA 3ZTBA 1SBOA 2VY9A 1TILB 5EUZA 1THNB 5EUXA 5EUSA 3IF5A 1TH8B 1VC1A 4QTPA 3F43A 1AUZA 3OIZA 3NY7A 3IH9A 1BUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKL A;  3OIR A;  3AGE A;  1TID B;  5EUW A;  3IHB A;  4DGF A;  4XS5 A;  4DGH A;  1H4Z A;  5EUU A;  2KLN A;  3ZXN A;  5EZB A;  2KA5 A;  3LLO A;  3IH8 A;  3MGL A;  3T6O A;  3IHA A;  1H4X A;  1H4Y A;  1T6R A;  3AGD A;  4HYL A;  3ZTB A;  1SBO A;  2VY9 A;  1TIL B;  5EUZ A;  1THN B;  5EUX A;  5EUS A;  3IF5 A;  1TH8 B;  1VC1 A;  4QTP A;  3F43 A;  1AUZ A;  3OIZ A;  3NY7 A;  3IH9 A;  1BUZ A; 
#chains in the Genus database with same CATH topology
 3OIR A;  3V97 A;  1H4Z A;  5EUU A;  2KLN A;  5EZB A;  1BPL A;  3IH8 A;  1N6E A;  1WXW A;  2VY9 A;  1TIL B;  3MOG A;  1TH8 B;  2DXL A;  4DMG A;  3GVK A;  2AS0 A;  3LDF A;  3IH9 A;  1BUZ A;  3EH7 A;  5EUW A;  3IHB A;  3GVL A;  1FC6 A;  2CWW A;  1V0F A;  2KA5 A;  3NY7 A;  1T6R A;  1V0E A;  4HYL A;  2DXN A;  3C0K A;  4L8K A;  1THN B;  5EUX A;  3GHF A;  3F43 A;  1HF2 A;  3K50 A;  3D3U A;  1AUZ A;  3AGE A;  2ZOA A;  3VSE A;  4DGH A;  3ZXN A;  3IHA A;  3GK7 A;  4HIZ A;  1H4Y A;  2RRL A;  3AGD A;  1N6D A;  1K32 A;  3ZTB A;  1SBO A;  5EUZ A;  5EUS A;  3QDQ A;  4QTP A;  2ZO9 B;  3OIZ A;  3JU4 A;  2B78 A;  4L1C A;  3GVJ A;  1TID B;  1N6F A;  4DGF A;  4XS5 A;  4JC0 A;  2OAS A;  3DOR A;  3LLO A;  3MGL A;  3T6O A;  1FC7 A;  1H4X A;  1WXX A;  3DJA A;  3V8V A;  1FC9 A;  4AE2 A;  1FCF A;  4AEJ A;  1J7X A;  3DUP A;  3IF5 A;  3D03 A;  1VC1 A;  3GMF A;  4GHN A;  3LKL A; 
#chains in the Genus database with same CATH homology
 3LKL A;  3OIR A;  3AGE A;  1TID B;  5EUW A;  3IHB A;  4DGF A;  4XS5 A;  4DGH A;  1H4Z A;  5EUU A;  2KLN A;  3ZXN A;  5EZB A;  2KA5 A;  3LLO A;  3IH8 A;  3MGL A;  3T6O A;  3IHA A;  1H4X A;  1H4Y A;  1T6R A;  3AGD A;  4HYL A;  3ZTB A;  1SBO A;  2VY9 A;  1TIL B;  5EUZ A;  1THN B;  5EUX A;  5EUS A;  3IF5 A;  1TH8 B;  1VC1 A;  4QTP A;  3F43 A;  1AUZ A;  3OIZ A;  3NY7 A;  3IH9 A;  1BUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...