1TIQA

Crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
173
Chain Sequence
SVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQFFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease synthase and sporulation negative regulatory protei
publication title Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, transcription
total genus 49
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1tiqA00
4NCZA 4ZBGA 4I49A 3H4QA 1WK4A 4CRYB 1MJAA 3JVNA 5F48A 2BL1A 1M4IA 2OZUA 2R98A 4MY3A 2OZHA 5GCNA 3CXPA 3EXNA 2CNTA 4UA3A 5C82A 1S60A 4H6UA 2GANA 3GKRA 4PV6A 4AVCA 1P4NA 3TO9A 4LUAA 4QVTA 2VXKA 4B5OA 1YLEA 4FD4A 2NMTA 2FT0A 1XEBA 2A4NA 3S6HA 2P6EA 1QSNA 1QSRA 2ZW4A 2ATRA 4ONUA 5HH1A 3FB3A 1YK3A 2JDDA 3B8GA 3JUWA 4CAWA 5ISVA 1I1DA 2B4DA 2B5GB 1YVOA 1S7LA 1K4JA 1QSTA 2ZW6A 2BSWA 3TO6A 4AVBA 3DDDA 1CJWA 3VWDA 1Z4EA 4HNYB 3EFAA 1Y9WA 2PSWA 2AE6A 2Z11A 4PK2A 3EY5A 1S7NA 3P2FA 1R57A 2BUEA 1IIDA 1UFHA 2J8MA 1VHSA 4BMHA 5F47A 2REFA 4LX9A 1Y7RA 2FS5A 3S6FA 1S7FA 4U9YA 3BJ7A 4QB9A 2ZXVA 1KUXA 2Q4VA 2ZPAA 3FBUA 2OZGA 1M4GA 5F49A 4L89A 2Z10A 4KOWA 4Y49C 2RC4A 3FXTA 2ZW7A 3W91A 3SXOA 2P0WA 2P6GA 4E2AA 3S6GA 4GS4A 3IWGA 1RO5A 4MBUA 1MJBA 2FSRA 3TCVA 3DR6A 3R9GA 2VBQA 4II9A 4AG9A 4KOTA 5I0CA 4M85A 2PR8A 4PSXA 4YRHA 4KOXA 1LRZA 4MY0A 3DSBA 2B3UA 2CNMA 4NXYA 1IICA 3PP9A 4HKFA 1KZFA 3DR8A 2I79A 3GY9A 1L0CA 1Y9KA 2OH1A 4FD7A 5H84A 2O28A 4KUBA 4XNHB 5EBVA 1KUYA 5CNPA 1P0HA 1N71A 5DWMA 2HQYA 2R7HA 4KOSA 1TIQA 4H89A 3NE7A 1PU9A 2OU2A 2B58A 3R1KA 3QB8A 3MGDA 3DNSA 4B5PA 4MHDA 3BJ8A 2HUZA 3FNCA 3TTHA 4XPKA 2FXFA 4JJXA 4QUSA 2G3TA 4JXQA 2HV2A 2B5GA 2FE7A 4H6ZA 3W6SA 4UWIA 2F5IA 4CRZB 4JLYA 4U5YA 1ON0A 2KCWA 5KTDA 1NE9A 1YVKA 5DWNA 4AVAA 3N7ZA 3FRMA 1I21A 1Z9UA 2G0BA 3ZZIA 2Q4YA 3D8PA 3T9YA 3GYAA 2PRBA 4YFJA 2Y0MA 4KORA 2GE3A 2PDOA 2VZZA 4JWPA 1CM0A 3R96A 2VZYA 1B87A 4L8AA 3EC4A 5KTAA 5IB0A 2EVNA 3T90A 1Z4RA 3LODA 1Q2CA 4NF1A 2JLMA 3W6XA 2X7BA 4FD5A 3SXNA 2PC1A 1S7KA 4QBJA 2FIWA 4OAEA 2VI7A 3OWCA 2B4BA 4KLWA 4KVOE 4J3GA 3UY5A 1IYKA 1NMTA 5JQ4A 1OZPA 1KUVA 1S5KA 3P2HA 3D3SA 3BLNA 4XPDC 5IX3A 3D2MA 1GHEA 2I00A 1BO4A 2FCKA 2QMLA 4JD6A 4CS0B 3E0KA 4DNCA 1Q2YA 4XPLA 2H5MA 4KOVA 1IYLA 3TO7A 1YX0A 5EC4A 3F0AA 3F8KA 4AG7A 1YREA 2B3VA 4UWJA 4KUAA 3TT2A 1U6MA 1QSOA 4IF5A 1RXTA 2Z0ZA 3WR7A 3TE4A 2J8RA 3IGRA 1I12A 5HMNA 4OLLA 2QECA 2Q0YA 4K30A 1IB1E 1M4DA 3I9SA 5IV0A 1NSLA 2Q7BA 4YGOA 1WWZA 1J4JA 2PQ8A 4PK3A 4R9MA 4X5KA 4KOYA 5KTCA 2IL4A 3I3GA 4HNXB 1FY7A 1XF8A 2WPXA 4R3LA 1Q2DA 3D2PA 5E96A 4OADA 4XNHC 3QAHA 4U9ZA 4KVXA 3EO4A 5J8FA 2REEA 4ORFA 4CAXA 3CXQA 4B5PB 1V0CA 2D4OA 3TOAA 2C27A 2J8NA 2B4DB 4KLVA 4PSWA 3V8IA 2D4PA 4F6AA 2ARHA 4MI4A 5F46A 1MK4A 4QC6A 3R9FA 1YGHA 4M3SA 2K5TA 4CAVA 1MJ9A 3PZJA 3PGPA 4KOUA 2JDCA 2ZW5A 4Y49B 4RS2A 3R95A 1PUAA 4AB7A 5H86A 2R1IA 4EVYA 1M44A 3TOBA 4R87A 1M1DA 2BEIA 3K9UA 4F0YA 5JPHA 4RI1A 2Q44A 3FYNA 2OB0A 4FD6A 4XPDB 2FL4A 2G3AA 4NEXA 1XMTA 3CXSA 2Q04A 2GIVA 2EUIA 5FVJA 5J8CA 2VQYA 3KKWA 3G3SA 2JEVA 4R57A 3F5BA 2FIAA 4HNWB 4E8OA 1BOBA 1B6BA 3ZJ0A 3C26A 4KZTA 4R3KA 2QIRA 4IUSA 4E0AA 3S6KA 4NSQA 3R9EA 4MJ8A 3VWEA 2PR1A 3RYOA 1XE4A 4KVME 1VKCA 2DXQA 4JXRA 2R8VA 3SHPA 1QSMA 3LD2A 3G8WA 4UBRA 1YR0A 1XIXA 2CY2A 1SQHA 2VEZA 1S3ZA 5C88A 3TFYA 2P6FA 2CNSA 3FIXA 2WPWA 2AJ6A
chains in the Genus database with same CATH superfamily
4P6YA 4NCZA 4ZBGA 4I49A 1PYTB 4CYNA 1LANA 2C1CA 2JEWA 3H4QA 3PFOA 1WK4A 3PB4X 4CRYB 1LCPA 2YNEA 1MJAA 8CPAA 1TKHA 3LWUA 3JVNA 5F48A 4DYOA 2BL1A 4P4FA 1M4IA 1R3NA 1PCAA 2PRQA 4MRIA 2OZUA 2R98A 4MY3A 3RZAA 2O4HA 3PRTA 2OZHA 1BLLE 2BO9A 5GCNA 4DUKA 1LFWA 2ANPA 3D67A 2ZOFA 3IO1A 4P4JA 5ELYA 4P4EA 3CXPA 3EXNA 2CNTA 2Z3PA 4UA3A 1R43A 2GREA 1S60A 4MFQA 4A95A 5C82A 3B2YA 4UFWA 4H6UA 2GANA 2IQ6A 4A32A 3S9LA 3GKRA 4PV6A 4AVCA 1P4NA 4NJQA 3TO9A 4LUAA 3D68A 3PBBA 4A30A 4QVTA 2VXKA 4B5OA 3TC8A 1YLEA 4FD4A 2GLJA 2NMTA 2FT0A 4YU9A 4CYOA 2WSAA 1XEBA 2A4NA 3S6HA 4F0XA 3SJFA 2P6EA 2VL1A 1QSNA 4R76A 3H8FA 5CBMA 1QSRA 2ZW4A 4X3RA 2ATRA 4ONUA 3H8EA 2V8GA 3KHZA 5HH1A 3FB3A 4OKOA 1VHEA 1QMUA 1YK3A 3DGVA 2JDDA 4NGQA 1LAPA 3B8GA 2DPSA 3KR4A 3HUVA 2PVWA 4ZX9A 3V38A 3JUWA 4KSFA 1UWYA 4CAWA 3KZWA 5ISVA 1EE3P 1I1DA 1Z8XA 1YVOA 2B4DA 1ZG7A 2B5GB 3V7ZA 4IHMA 3KHXA 1S7LA 2Q51A 4C2XA 4ONWA 1K4JA 2PJ7A 4G1PA 4CAFA 3BHXA 1QSTA 2ZW6A 2BSWA 3TO6A 3GB0A 4AVBA 3DDDA 3BXMA 1CJWA 4CGMA 3VWDA 3IFEA 1XBUA 1Z4EA 3NFZA 4CGOA 1RTQA 3IJ3A 2C6PA 4H2KA 4HNYB 1TF9A 3EFAA 4O23A 1Y9WA 4AXVA 4OIWA 5JM6A 2PSWA 2AE6A 1QQ9A 1CP7A 4UFVA 2Z11A 4MHPA 4PK2A 3EY5A 4UCMA 3SJGA 1IU8A 1S7NA 2PJ1A 3P2FA 4CGPA 1Z2LA 2Q7SA 1R57A 2OOTA 4P4DA 4CYQA 3PB9X 2AFZA 2BUEA 3SJEA 1IIDA 2PJ8A 1UFHA 2J8MA 1VHSA 2WZNA 3QNVA 3SI0A 4BMHA 5F47A 2REFA 3WT4A 5K8PA 4LX9A 3T8WA 2FS5A 1Y7RA 3S6FA 1XFOA 1S7FA 3MN8A 3MRUA 4U9YA 3BJ7A 3ISXA 4C2YA 5LYIA 4OC2A 4QB9A 2ZXVA 5HXDA 1KUXA 2EK9A 2Q4VA 5EMIA 4CPAA 2Z3MA 2ZPAA 2Q43A 3FBUA 2OZGA 3JTKA 3QAYA 1M4GA 4W9YA 4L89A 5F49A 2Z10A 3RBUA 4KOWA 5G21A 4Y49C 5J1QA 2C6GA 2WYRA 2DEAA 1DE4C 2RC4A 3FXTA 3VH9A 2ZW7A 3W91A 3SXOA 2P0WA 4CYPA 3GUXA 3CZXA 2P6GA 4E2AA 3S6GA 3D66A 2DPTA 1ZG9A 1BPNA 2AFMA 4GS4A 4NFRA 2PJ2A 3IWGA 3B3SA 1A2ZA 5THWA 1RO5A 1XOVA 2ODFA 4MBUA 1ZLIA 1MJBA 2FSRA 2XEFA 1F2PA 3TCVA 4NGPA 2AFWA 3DR6A 3R9GA 2VBQA 4UFXA 4II9A 4AG9A 4NGMA 4EMEA 4KOTA 4A33A 5I0CA 4M85A 2PR8A 4WJBA 1YLOA 4PSXA 4YRHA 4OC5A 4KOXA 4OC3A 4GXHA 4PQAA 1LRZA 4MY0A 2Z3NA 3PB6X 4Q36A 1IGBA 3DSBA 2B3UA 2EK8A 2F7VA 2CNMA 2ZEDA 4K3NA 4NXYA 1IICA 3FECA 3SJXA 3PP9A 4HKFA 1KZFA 3DR8A 2I79A 3GY9A 3HLPA 1GYTA 3S9MA 1L0CA 4CAEA 2AFXA 1X12A 1Y9KA 2PIZA 4A31A 2OH1A 2ZEFA 4UIAA 4FD7A 4R7MA 4X2TA 5H84A 2O28A 4NGTA 2YNCA 4KUBA 4A37A 4KSIA 4XNHB 1Y0YA 5EBVA 4FUUA 5JGFA 2PJ5A 1FNOA 1KUYA 5CNPA 2QYVA 1P0HA 2V8VA 4C7HA 1N71A 1Z8TA 4MFPA 5DWMA 3PB7X 4A39A 5K8OA 3KL9A 1AUGA 2Z3KA 2HQYA 4MFZA 2ZEHA 2R7HA 4KOSA 4FWUA 2GU2A 1TIQA 4H89A 5A27A 3NE7A 2PIYA 4C2ZA 1PU9A 1XMBA 2OU2A 2B58A 1X10A 2PJ3A 2AFSA 5AG6A 3R1KA 4UEEA 1F57A 3PEIA 3WC7A 1BAVA 3QB8A 4OC1A 3FVLA 3DNSA 3MGDA 4PXDA 4MHDA 4B5PA 3BJ8A 4TNUA 5G20A 4EFDA 2HUZA 3FNCA 2V77A 1ZG8A 3TTHA 4XPKA 2FXFA 2QJ8A 4JJXA 1LAMA 4QUSA 2G3TA 2YNCC 4JXQA 2HV2A 4C68A 2B5GA 2FE7A 4H6ZA 4PXBA 3W6SA 4UWIA 3NA6A 2F5IA 4CRZB 3NH8A 2F8HA 1TKFA 3FJUA 1F2OA 4JLYA 2NYQA 2G9DA 2XEGA 2V8HA 4MCPA 1ON0A 2KCWA 3FF3A 1NE9A 4U5YA 5KTDA 1YVKA 3IIBA 4R6TA 4LQGA 4ZGYB 3IWWA 5DWNA 4AVAA 3N7ZA 5HVHA 3FRMA 5AG5A 2Z3OA 2WPWA 1Z9UA 2G0BA 3ZZIA 2Q4YA 3CDXA 3D8PA 2EWBA 3T9YA 3GYAA 1CPXA 2PRBA 4YFJA 5F09A 4MHNA 2Y0MA 4MCQA 4KORA 4P4BA 2GE3A 2PDOA 2PJAA 5LYFA 2HB6A 3KQXA 1YQEA 2VZZA 5A28A 4JWPA 1CM0A 4P45A 2CF4A 3B3TA 2VZYA 1B87A 4L8AA 1YW4A 3EC4A 3R96A 5IB0A 5KTAA 4ZY1A 2EVNA 4JYWA 5LYDA 4FAIA 1VIXA 1YSJA 4MFJA 1Z4RA 3T90A 2EO8A 2YGWA 3B3VA 3LODA 1Q2CA 3RAMA 4NF1A 2JLMA 3IEHA 4P4IA 3W6XA 3NH5A 4MCSA 2X7BA 1ELMP 3PB8X 4FD5A 3LACA 1TXRA 3SXNA 3RO0A 3KQZA 2PC1A 4X8IA 2XEJA 4KSAA 1S7KA 4MCRA 4WWVA 4CGLA 4QBJA 2FIWA 4OAEA 4OMEA 2VI7A 3H5ZA 1H8LA 4MXUA 2ZELA 1IOFA 3OWCA 5IB9A 2B4BA 4KLWA 4KVOE 4RUHA 4J3GA 1OBRA 2Q4ZA 2Z3LA 3UY5A 1Q7LA 1IYKA 5LYLA 5I4MA 1NMTA 5JQ4A 1KWMA 2ZEPA 1OZPA 3KGQA 1KUVA 5AG7A 4B12A 1S5KA 3P2HA 3D3SA 3B35A 4BBHA 3BLNA 3L2NA 2NSMA 4YWYA 4XPDC 1AYEA 5AGEA 2GLFA 4GM5A 4MHYA 5IX3A 1Z8LA 3D2MA 2RFHA 3PBEA 3IU1A 1GHEA 2I00A 1BO4A 2FCKA 2QMLA 4F9UA 5K8MA 3VATA 4JD6A 5CPAA 4P44A 5G1ZA 4CS0B 3E0KA 4DNCA 1Q2YA 3LMSA 4XPLA 4F8ZA 2H5MA 7CPAA 4PXEA 4F9VA 1Y7EA 2PE3A 4KOVA 1IYLA 3VARA 3TO7A 1YX0A 5EC4A 3F0AA 5LRGA 3D4UA 3F8KA 4NGNA 4AG7A 3CPXA 1DTDA 1YREA 2B3VA 4UWJA 4ZYQA 4KUAA 1AMPA 2WUUA 3B3WA 4M6HA 3S9NA 4ZY2A 3TT2A 1U6MA 1QSOA 1YMEA 4B14A 4IF5A 1RXTA 2Z0ZA 3WR7A 3TE4A 2J8RA 2V8DA 3IGRA 4OC0A 1I12A 5HMNA 4ZX8A 4NGRA 2I3CA 4OLLA 4A2ZA 1ELLP 2QECA 4Q7AA 2Q0YA 1FT7A 2ABZA 3NE8A 4K30A 5G22A 1IB1E 1M4DA 1CG2A 1TF8A 3GIUA 3I9SA 4MMOA 1XJOA 5IV0A 1NSLA 3K9TA 2BCOA 1CX8A 4RN7A 5HVFA 3B7IA 2Q7BA 4YGOA 1WWZA 2HC9A 1J4JA 1YW6A 2PQ8A 4PK3A 4R9MA 4X5KA 2PJ0A 4KOYA 1CP6A 3FX6A 5KTCA 3FMCA 5D29A 2IL4A 1ZLHA 3KASA 5BWAB 4Z65A 3I3GA 4FBEA 1BPMA 4HNXB 1FY7A 3D7GA 1XF8A 4BINA 2WPXA 2EBJA 2O53A 2XEIA 4R3LA 1Q2DA 3D2PA 5E96A 4UCPA 2J9AA 4OADA 2PCUA 3DLJA 4MFLA 3A9LA 4XNHC 3CPAA 4B10A 3QAHA 2IMOA 4HPSA 4U9ZA 2PJ6A 4KVXA 3D7HA 3EO4A 5J8FA 2REEA 5K8NA 4ORFA 2ZENA 4CAXA 3CXQA 2PJCA 4B5PB 4MHZA 1V0CA 2ZEMA 1HEEA 2D4OA 3BI0A 3TOAA 2C27A 2J8NA 2GFQA 2POKA 1XRYA 2B4DB 2IJZA 4KLVA 4PSWA 3FEEA 4OIDA 4PXCA 4UEZA 4TWEA 3V8IA 4B6ZA 4BD9A 4MFKA 3K2KA 2D4PA 3PFEA 4UIBA 4F6AA 1CPSA 1Y0RA 2ARHA 4MI4A 4NJRA 2JBJA 4ZI6A 5F46A 1MK4A 2CIJA 4NGSA 4QC6A 1YGHA 4JZ0A 4M3SA 3R9FA 3H8GA 2K5TA 3WABA 4CAVA 4DJLA 1MJ9A 2CTCA 4B13A 3PZJA 1IOIA 3PGPA 4KOUA 4OC4A 1NSAA 4UEFA 2JDCA 4UCNA 6CPAA 2ZW5A 3IWEA 3SI2A 3FH4A 4Y49B 4RS2A 2CXAA 1PUAA 2C6CA 3BI1A 3R95A 4AB7A 1Z5RA 1VGYA 3GLJA 3RNZA 5H86A 2ZEGA 2QVPA 2R1IA 5JH9A 4EVYA 4IAVA 1M44A 3SI1A 3TOBA 4R87A 1M1DA 2YNDA 2BEIA 4M6GA 3I1UA 3K9UA 4CGNA 4F0YA 5JPHA 4RI1A 3IC1A 4R8FA 2Q44A 4M6IA 1HDQA 1M4LA 1LOKA 3FYNA 3D7FA 2OB0A 4FD6A 4ZY0A 4A38A 4XPDB 2FL4A 2ZOGA 2PJ4A 2G3AA 4NEXA 1XMTA 1CBXA 1IY7A 3IU2A 3CXSA 3WC6A 2Q04A 2GIVA 2EUIA 5FVJA 2ZEOA 5J8CA 2VQYA 3KKWA 5HVGA 1JQGA 3JRUA 2DF5A 2PJBA 3G3SA 5LRKA 2JEVA 4R57A 3F5BA 5AG4A 2FIAA 2FVGA 3B3CA 4HNWB 4E8OA 4EWTA 1BOBA 2AFUA 1B6BA 3ZJ0A 3C26A 2PJ9A 1JWQA 3D7DA 1VHOA 2QIRA 4KZTA 2PVVA 4R3KA 2ZEEA 4OP4A 4IUSA 4B11A 4E0AA 1ARLA 3S6KA 4NSQA 2AFOA 5LRJA 3R9EA 4MJ8A 2BOAA 3WC5A 3VWEA 2CTBA 2PR1A 1Z8WA 3RYOA 4A94A 3N5FA 4PPZA 1XE4A 4KVME 1VKCA 2DXQA 4JXRA 2R8VA 3SHPA 1QSMA 3CT9A 4KS9A 3LD2A 3ISZA 3TX8A 3G8WA 4UBRA 1YR0A 1XIXA 1ZO0A 2CY2A 1TKJA 1SQHA 2VEZA 5D8NA 2JBKA 4LQ6A 1S3ZA 3NH4A 4IK2A 5DS0A 2OR4A 5C88A 1HDUA 2RB7A 4C7IA 3FEDA 1ARMA 2P6FA 4P10A 4UF4A 3TFYA 3KR5A 2CNSA 3KI9A 3FIXA 1I21A 4Q38A 2AJ6A
chains in the Genus database with same CATH topology
4NCZA 4ZBGA 4I49A 4CYNA 3H4QA 1WK4A 4CRYB 2YNEA 1MJAA 3JVNA 5F48A 2BL1A 1M4IA 2OZUA 2R98A 4MY3A 2OZHA 5GCNA 3CXPA 3EXNA 2CNTA 2Z3PA 4UA3A 5C82A 1S60A 4MFQA 4A95A 4UFWA 4H6UA 2GANA 4A32A 3GKRA 4PV6A 4AVCA 1P4NA 3TO9A 4LUAA 4A30A 4QVTA 2VXKA 4B5OA 1YLEA 4FD4A 2NMTA 2FT0A 4CYOA 2WSAA 1XEBA 2A4NA 3S6HA 4F0XA 2P6EA 1QSNA 1QSRA 2ZW4A 2ATRA 4ONUA 5HH1A 3FB3A 1YK3A 2JDDA 3B8GA 2DPSA 3JUWA 4KSFA 4CAWA 5ISVA 1I1DA 2B4DA 2B5GB 1YVOA 1S7LA 4C2XA 1K4JA 4CAFA 1QSTA 2ZW6A 2BSWA 3TO6A 4AVBA 3DDDA 1CJWA 4CGMA 3VWDA 1Z4EA 4CGOA 4HNYB 3EFAA 1Y9WA 2PSWA 2AE6A 4UFVA 2Z11A 4PK2A 3EY5A 4UCMA 1S7NA 3P2FA 4CGPA 1R57A 4CYQA 2BUEA 1IIDA 1UFHA 2J8MA 1VHSA 4BMHA 5F47A 2REFA 4LX9A 1Y7RA 2FS5A 3S6FA 1S7FA 4U9YA 3BJ7A 4C2YA 4QB9A 2ZXVA 1KUXA 2Q4VA 2Z3MA 2ZPAA 3FBUA 2OZGA 3JTKA 1M4GA 5F49A 4L89A 2Z10A 4KOWA 5G21A 4Y49C 2RC4A 3FXTA 2ZW7A 3W91A 3SXOA 2P0WA 4CYPA 2P6GA 4E2AA 3S6GA 2DPTA 4GS4A 3IWGA 1RO5A 4MBUA 1MJBA 2FSRA 3TCVA 3DR6A 3R9GA 2VBQA 4UFXA 4II9A 4AG9A 4KOTA 4A33A 5I0CA 4M85A 2PR8A 4PSXA 4YRHA 4KOXA 1LRZA 4MY0A 2Z3NA 4Q36A 3DSBA 2B3UA 2CNMA 4NXYA 1IICA 3PP9A 4HKFA 1KZFA 3DR8A 2I79A 3GY9A 1L0CA 4CAEA 1Y9KA 4A31A 2OH1A 4FD7A 5H84A 2O28A 2YNCA 4KUBA 4XNHB 5EBVA 1KUYA 5CNPA 1P0HA 4C7HA 1N71A 4MFPA 5DWMA 2Z3KA 2HQYA 4MFZA 2R7HA 4KOSA 1TIQA 4H89A 5A27A 3NE7A 4C2ZA 1PU9A 2OU2A 2B58A 5AG6A 3R1KA 3QB8A 3MGDA 3DNSA 4B5PA 4MHDA 3BJ8A 5G20A 2HUZA 3FNCA 3TTHA 4XPKA 2FXFA 4JJXA 4QUSA 2G3TA 2YNCC 4JXQA 2HV2A 4C68A 2B5GA 2FE7A 4H6ZA 3W6SA 4UWIA 2F5IA 4CRZB 4JLYA 4U5YA 1ON0A 2KCWA 5KTDA 1NE9A 1YVKA 4ZGYB 5DWNA 4AVAA 3N7ZA 3FRMA 5AG5A 2Z3OA 1I21A 1Z9UA 2G0BA 3ZZIA 2Q4YA 3D8PA 3T9YA 3GYAA 2PRBA 4YFJA 2Y0MA 4KORA 2GE3A 2PDOA 2VZZA 5A28A 4JWPA 1CM0A 3R96A 2VZYA 1B87A 4L8AA 3EC4A 5KTAA 5IB0A 2EVNA 4MFJA 3T90A 1Z4RA 2YGWA 3LODA 1Q2CA 4NF1A 2JLMA 3W6XA 2X7BA 4FD5A 3SXNA 2PC1A 4KSAA 1S7KA 4CGLA 4QBJA 2FIWA 4OAEA 2VI7A 3H5ZA 3OWCA 2B4BA 4KLWA 4KVOE 4J3GA 2Z3LA 3UY5A 1IYKA 1NMTA 5JQ4A 1OZPA 4B12A 1KUVA 5AG7A 4BBHA 1S5KA 3P2HA 3D3SA 3BLNA 4XPDC 5AGEA 5IX3A 3D2MA 3IU1A 1GHEA 2I00A 1BO4A 2FCKA 2QMLA 4JD6A 5G1ZA 4CS0B 3E0KA 4DNCA 1Q2YA 4XPLA 2H5MA 4KOVA 1IYLA 3TO7A 1YX0A 5EC4A 3F0AA 3F8KA 4AG7A 1YREA 2B3VA 4UWJA 4KUAA 2WUUA 3TT2A 1U6MA 1QSOA 4B14A 4IF5A 1RXTA 2Z0ZA 3WR7A 3TE4A 2J8RA 3IGRA 1I12A 5HMNA 4OLLA 4A2ZA 2QECA 2Q0YA 4K30A 5G22A 1IB1E 1M4DA 3I9SA 5IV0A 1NSLA 2Q7BA 4YGOA 1WWZA 1J4JA 2PQ8A 4PK3A 4R9MA 4X5KA 4KOYA 5KTCA 2IL4A 5BWAB 3I3GA 4HNXB 1FY7A 1XF8A 2WPXA 4R3LA 1Q2DA 3D2PA 5E96A 4UCPA 4OADA 4MFLA 3A9LA 4XNHC 4B10A 3QAHA 4U9ZA 4KVXA 3EO4A 5J8FA 2REEA 4ORFA 4CAXA 3CXQA 4B5PB 1V0CA 2D4OA 3TOAA 2C27A 2J8NA 2B4DB 4KLVA 4PSWA 3V8IA 4MFKA 2D4PA 4F6AA 2ARHA 4MI4A 5F46A 1MK4A 4QC6A 3R9FA 1YGHA 4M3SA 2K5TA 4CAVA 1MJ9A 4B13A 3PZJA 3PGPA 4KOUA 2JDCA 4UCNA 2ZW5A 3IWEA 4Y49B 4RS2A 2CXAA 1PUAA 3R95A 4AB7A 5H86A 2R1IA 4EVYA 1M44A 3TOBA 4R87A 1M1DA 2YNDA 2BEIA 3K9UA 4CGNA 4F0YA 5JPHA 4RI1A 2Q44A 3FYNA 2OB0A 4FD6A 4XPDB 2FL4A 2G3AA 4NEXA 1XMTA 3IU2A 3CXSA 2Q04A 2GIVA 2EUIA 5FVJA 5J8CA 2VQYA 3KKWA 3G3SA 2JEVA 4R57A 3F5BA 5AG4A 2FIAA 4HNWB 4E8OA 1BOBA 1B6BA 3ZJ0A 3C26A 4KZTA 4R3KA 2QIRA 4IUSA 4B11A 4E0AA 3S6KA 4NSQA 3R9EA 4MJ8A 3VWEA 2PR1A 3RYOA 1XE4A 4KVME 1VKCA 2DXQA 4JXRA 2R8VA 3SHPA 1QSMA 4KS9A 3LD2A 3G8WA 4UBRA 1YR0A 1XIXA 1ZO0A 2CY2A 1SQHA 2VEZA 1S3ZA 5C88A 4C7IA 3TFYA 2P6FA 2CNSA 3FIXA 2WPWA 4Q38A 2AJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCZ A;  4ZBG A;  4I49 A;  3H4Q A;  1WK4 A;  4CRY B;  1MJA A;  3JVN A;  5F48 A;  2BL1 A;  1M4I A;  2OZU A;  2R98 A;  4MY3 A;  2OZH A;  5GCN A;  3CXP A;  3EXN A;  2CNT A;  4UA3 A;  5C82 A;  1S60 A;  4H6U A;  2GAN A;  3GKR A;  4PV6 A;  4AVC A;  1P4N A;  3TO9 A;  4LUA A;  4QVT A;  2VXK A;  4B5O A;  1YLE A;  4FD4 A;  2NMT A;  2FT0 A;  1XEB A;  2A4N A;  3S6H A;  2P6E A;  1QSN A;  1QSR A;  2ZW4 A;  2ATR A;  4ONU A;  5HH1 A;  3FB3 A;  1YK3 A;  2JDD A;  3B8G A;  3JUW A;  4CAW A;  5ISV A;  1I1D A;  2B4D A;  2B5G B;  1YVO A;  1S7L A;  1K4J A;  1QST A;  2ZW6 A;  2BSW A;  3TO6 A;  4AVB A;  3DDD A;  1CJW A;  3VWD A;  1Z4E A;  4HNY B;  3EFA A;  1Y9W A;  2PSW A;  2AE6 A;  2Z11 A;  4PK2 A;  3EY5 A;  1S7N A;  3P2F A;  1R57 A;  2BUE A;  1IID A;  1UFH A;  2J8M A;  1VHS A;  4BMH A;  5F47 A;  2REF A;  4LX9 A;  1Y7R A;  2FS5 A;  3S6F A;  1S7F A;  4U9Y A;  3BJ7 A;  4QB9 A;  2ZXV A;  1KUX A;  2Q4V A;  2ZPA A;  3FBU A;  2OZG A;  1M4G A;  5F49 A;  4L89 A;  2Z10 A;  4KOW A;  4Y49 C;  2RC4 A;  3FXT A;  2ZW7 A;  3W91 A;  3SXO A;  2P0W A;  2P6G A;  4E2A A;  3S6G A;  4GS4 A;  3IWG A;  1RO5 A;  4MBU A;  1MJB A;  2FSR A;  3TCV A;  3DR6 A;  3R9G A;  2VBQ A;  4II9 A;  4AG9 A;  4KOT A;  5I0C A;  4M85 A;  2PR8 A;  4PSX A;  4YRH A;  4KOX A;  1LRZ A;  4MY0 A;  3DSB A;  2B3U A;  2CNM A;  4NXY A;  1IIC A;  3PP9 A;  4HKF A;  1KZF A;  3DR8 A;  2I79 A;  3GY9 A;  1L0C A;  1Y9K A;  2OH1 A;  4FD7 A;  5H84 A;  2O28 A;  4KUB A;  4XNH B;  5EBV A;  1KUY A;  5CNP A;  1P0H A;  1N71 A;  5DWM A;  2HQY A;  2R7H A;  4KOS A;  1TIQ A;  4H89 A;  3NE7 A;  1PU9 A;  2OU2 A;  2B58 A;  3R1K A;  3QB8 A;  3MGD A;  3DNS A;  4B5P A;  4MHD A;  3BJ8 A;  2HUZ A;  3FNC A;  3TTH A;  4XPK A;  2FXF A;  4JJX A;  4QUS A;  2G3T A;  4JXQ A;  2HV2 A;  2B5G A;  2FE7 A;  4H6Z A;  3W6S A;  4UWI A;  2F5I A;  4CRZ B;  4JLY A;  4U5Y A;  1ON0 A;  2KCW A;  5KTD A;  1NE9 A;  1YVK A;  5DWN A;  4AVA A;  3N7Z A;  3FRM A;  1I21 A;  1Z9U A;  2G0B A;  3ZZI A;  2Q4Y A;  3D8P A;  3T9Y A;  3GYA A;  2PRB A;  4YFJ A;  2Y0M A;  4KOR A;  2GE3 A;  2PDO A;  2VZZ A;  4JWP A;  1CM0 A;  3R96 A;  2VZY A;  1B87 A;  4L8A A;  3EC4 A;  5KTA A;  5IB0 A;  2EVN A;  3T90 A;  1Z4R A;  3LOD A;  1Q2C A;  4NF1 A;  2JLM A;  3W6X A;  2X7B A;  4FD5 A;  3SXN A;  2PC1 A;  1S7K A;  4QBJ A;  2FIW A;  4OAE A;  2VI7 A;  3OWC A;  2B4B A;  4KLW A;  4KVO E;  4J3G A;  3UY5 A;  1IYK A;  1NMT A;  5JQ4 A;  1OZP A;  1KUV A;  1S5K A;  3P2H A;  3D3S A;  3BLN A;  4XPD C;  5IX3 A;  3D2M A;  1GHE A;  2I00 A;  1BO4 A;  2FCK A;  2QML A;  4JD6 A;  4CS0 B;  3E0K A;  4DNC A;  1Q2Y A;  4XPL A;  2H5M A;  4KOV A;  1IYL A;  3TO7 A;  1YX0 A;  5EC4 A;  3F0A A;  3F8K A;  4AG7 A;  1YRE A;  2B3V A;  4UWJ A;  4KUA A;  3TT2 A;  1U6M A;  1QSO A;  4IF5 A;  1RXT A;  2Z0Z A;  3WR7 A;  3TE4 A;  2J8R A;  3IGR A;  1I12 A;  5HMN A;  4OLL A;  2QEC A;  2Q0Y A;  4K30 A;  1IB1 E;  1M4D A;  3I9S A;  5IV0 A;  1NSL A;  2Q7B A;  4YGO A;  1WWZ A;  1J4J A;  2PQ8 A;  4PK3 A;  4R9M A;  4X5K A;  4KOY A;  5KTC A;  2IL4 A;  3I3G A;  4HNX B;  1FY7 A;  1XF8 A;  2WPX A;  4R3L A;  1Q2D A;  3D2P A;  5E96 A;  4OAD A;  4XNH C;  3QAH A;  4U9Z A;  4KVX A;  3EO4 A;  5J8F A;  2REE A;  4ORF A;  4CAX A;  3CXQ A;  4B5P B;  1V0C A;  2D4O A;  3TOA A;  2C27 A;  2J8N A;  2B4D B;  4KLV A;  4PSW A;  3V8I A;  2D4P A;  4F6A A;  2ARH A;  4MI4 A;  5F46 A;  1MK4 A;  4QC6 A;  3R9F A;  1YGH A;  4M3S A;  2K5T A;  4CAV A;  1MJ9 A;  3PZJ A;  3PGP A;  4KOU A;  2JDC A;  2ZW5 A;  4Y49 B;  4RS2 A;  3R95 A;  1PUA A;  4AB7 A;  5H86 A;  2R1I A;  4EVY A;  1M44 A;  3TOB A;  4R87 A;  1M1D A;  2BEI A;  3K9U A;  4F0Y A;  5JPH A;  4RI1 A;  2Q44 A;  3FYN A;  2OB0 A;  4FD6 A;  4XPD B;  2FL4 A;  2G3A A;  4NEX A;  1XMT A;  3CXS A;  2Q04 A;  2GIV A;  2EUI A;  5FVJ A;  5J8C A;  2VQY A;  3KKW A;  3G3S A;  2JEV A;  4R57 A;  3F5B A;  2FIA A;  4HNW B;  4E8O A;  1BOB A;  1B6B A;  3ZJ0 A;  3C26 A;  4KZT A;  4R3K A;  2QIR A;  4IUS A;  4E0A A;  3S6K A;  4NSQ A;  3R9E A;  4MJ8 A;  3VWE A;  2PR1 A;  3RYO A;  1XE4 A;  4KVM E;  1VKC A;  2DXQ A;  4JXR A;  2R8V A;  3SHP A;  1QSM A;  3LD2 A;  3G8W A;  4UBR A;  1YR0 A;  1XIX A;  2CY2 A;  1SQH A;  2VEZ A;  1S3Z A;  5C88 A;  3TFY A;  2P6F A;  2CNS A;  3FIX A;  2WPW A;  2AJ6 A; 
#chains in the Genus database with same CATH topology
 4P6Y A;  4NCZ A;  4ZBG A;  4I49 A;  1PYT B;  4CYN A;  1LAN A;  2C1C A;  2JEW A;  3H4Q A;  3PFO A;  1WK4 A;  3PB4 X;  4CRY B;  1LCP A;  2YNE A;  1MJA A;  8CPA A;  1TKH A;  3LWU A;  3JVN A;  5F48 A;  4DYO A;  2BL1 A;  4P4F A;  1M4I A;  1R3N A;  1PCA A;  2PRQ A;  4MRI A;  2OZU A;  2R98 A;  4MY3 A;  3RZA A;  2O4H A;  3PRT A;  2OZH A;  1BLL E;  2BO9 A;  5GCN A;  4DUK A;  1LFW A;  2ANP A;  3D67 A;  2ZOF A;  3IO1 A;  4P4J A;  5ELY A;  4P4E A;  3CXP A;  3EXN A;  2CNT A;  2Z3P A;  4UA3 A;  1R43 A;  2GRE A;  1S60 A;  4MFQ A;  4A95 A;  5C82 A;  3B2Y A;  4UFW A;  4H6U A;  2GAN A;  2IQ6 A;  4A32 A;  3S9L A;  3GKR A;  4PV6 A;  4AVC A;  1P4N A;  4NJQ A;  3TO9 A;  4LUA A;  3D68 A;  3PBB A;  4A30 A;  4QVT A;  2VXK A;  4B5O A;  3TC8 A;  1YLE A;  4FD4 A;  2GLJ A;  2NMT A;  2FT0 A;  4YU9 A;  4CYO A;  2WSA A;  1XEB A;  2A4N A;  3S6H A;  4F0X A;  3SJF A;  2P6E A;  2VL1 A;  1QSN A;  4R76 A;  3H8F A;  5CBM A;  1QSR A;  2ZW4 A;  4X3R A;  2ATR A;  4ONU A;  3H8E A;  2V8G A;  3KHZ A;  5HH1 A;  3FB3 A;  4OKO A;  1VHE A;  1QMU A;  1YK3 A;  3DGV A;  2JDD A;  4NGQ A;  1LAP A;  3B8G A;  2DPS A;  3KR4 A;  3HUV A;  2PVW A;  4ZX9 A;  3V38 A;  3JUW A;  4KSF A;  1UWY A;  4CAW A;  3KZW A;  5ISV A;  1EE3 P;  1I1D A;  1Z8X A;  1YVO A;  2B4D A;  1ZG7 A;  2B5G B;  3V7Z A;  4IHM A;  3KHX A;  1S7L A;  2Q51 A;  4C2X A;  4ONW A;  1K4J A;  2PJ7 A;  4G1P A;  4CAF A;  3BHX A;  1QST A;  2ZW6 A;  2BSW A;  3TO6 A;  3GB0 A;  4AVB A;  3DDD A;  3BXM A;  1CJW A;  4CGM A;  3VWD A;  3IFE A;  1XBU A;  1Z4E A;  3NFZ A;  4CGO A;  1RTQ A;  3IJ3 A;  2C6P A;  4H2K A;  4HNY B;  1TF9 A;  3EFA A;  4O23 A;  1Y9W A;  4AXV A;  4OIW A;  5JM6 A;  2PSW A;  2AE6 A;  1QQ9 A;  1CP7 A;  4UFV A;  2Z11 A;  4MHP A;  4PK2 A;  3EY5 A;  4UCM A;  3SJG A;  1IU8 A;  1S7N A;  2PJ1 A;  3P2F A;  4CGP A;  1Z2L A;  2Q7S A;  1R57 A;  2OOT A;  4P4D A;  4CYQ A;  3PB9 X;  2AFZ A;  2BUE A;  3SJE A;  1IID A;  2PJ8 A;  1UFH A;  2J8M A;  1VHS A;  2WZN A;  3QNV A;  3SI0 A;  4BMH A;  5F47 A;  2REF A;  3WT4 A;  5K8P A;  4LX9 A;  3T8W A;  2FS5 A;  1Y7R A;  3S6F A;  1XFO A;  1S7F A;  3MN8 A;  3MRU A;  4U9Y A;  3BJ7 A;  3ISX A;  4C2Y A;  5LYI A;  4OC2 A;  4QB9 A;  2ZXV A;  5HXD A;  1KUX A;  2EK9 A;  2Q4V A;  5EMI A;  4CPA A;  2Z3M A;  2ZPA A;  2Q43 A;  3FBU A;  2OZG A;  3JTK A;  3QAY A;  1M4G A;  4W9Y A;  4L89 A;  5F49 A;  2Z10 A;  3RBU A;  4KOW A;  5G21 A;  4Y49 C;  5J1Q A;  2C6G A;  2WYR A;  2DEA A;  1DE4 C;  2RC4 A;  3FXT A;  3VH9 A;  2ZW7 A;  3W91 A;  3SXO A;  2P0W A;  4CYP A;  3GUX A;  3CZX A;  2P6G A;  4E2A A;  3S6G A;  3D66 A;  2DPT A;  1ZG9 A;  1BPN A;  2AFM A;  4GS4 A;  4NFR A;  2PJ2 A;  3IWG A;  3B3S A;  1A2Z A;  5THW A;  1RO5 A;  1XOV A;  2ODF A;  4MBU A;  1ZLI A;  1MJB A;  2FSR A;  2XEF A;  1F2P A;  3TCV A;  4NGP A;  2AFW A;  3DR6 A;  3R9G A;  2VBQ A;  4UFX A;  4II9 A;  4AG9 A;  4NGM A;  4EME A;  4KOT A;  4A33 A;  5I0C A;  4M85 A;  2PR8 A;  4WJB A;  1YLO A;  4PSX A;  4YRH A;  4OC5 A;  4KOX A;  4OC3 A;  4GXH A;  4PQA A;  1LRZ A;  4MY0 A;  2Z3N A;  3PB6 X;  4Q36 A;  1IGB A;  3DSB A;  2B3U A;  2EK8 A;  2F7V A;  2CNM A;  2ZED A;  4K3N A;  4NXY A;  1IIC A;  3FEC A;  3SJX A;  3PP9 A;  4HKF A;  1KZF A;  3DR8 A;  2I79 A;  3GY9 A;  3HLP A;  1GYT A;  3S9M A;  1L0C A;  4CAE A;  2AFX A;  1X12 A;  1Y9K A;  2PIZ A;  4A31 A;  2OH1 A;  2ZEF A;  4UIA A;  4FD7 A;  4R7M A;  4X2T A;  5H84 A;  2O28 A;  4NGT A;  2YNC A;  4KUB A;  4A37 A;  4KSI A;  4XNH B;  1Y0Y A;  5EBV A;  4FUU A;  5JGF A;  2PJ5 A;  1FNO A;  1KUY A;  5CNP A;  2QYV A;  1P0H A;  2V8V A;  4C7H A;  1N71 A;  1Z8T A;  4MFP A;  5DWM A;  3PB7 X;  4A39 A;  5K8O A;  3KL9 A;  1AUG A;  2Z3K A;  2HQY A;  4MFZ A;  2ZEH A;  2R7H A;  4KOS A;  4FWU A;  2GU2 A;  1TIQ A;  4H89 A;  5A27 A;  3NE7 A;  2PIY A;  4C2Z A;  1PU9 A;  1XMB A;  2OU2 A;  2B58 A;  1X10 A;  2PJ3 A;  2AFS A;  5AG6 A;  3R1K A;  4UEE A;  1F57 A;  3PEI A;  3WC7 A;  1BAV A;  3QB8 A;  4OC1 A;  3FVL A;  3DNS A;  3MGD A;  4PXD A;  4MHD A;  4B5P A;  3BJ8 A;  4TNU A;  5G20 A;  4EFD A;  2HUZ A;  3FNC A;  2V77 A;  1ZG8 A;  3TTH A;  4XPK A;  2FXF A;  2QJ8 A;  4JJX A;  1LAM A;  4QUS A;  2G3T A;  2YNC C;  4JXQ A;  2HV2 A;  4C68 A;  2B5G A;  2FE7 A;  4H6Z A;  4PXB A;  3W6S A;  4UWI A;  3NA6 A;  2F5I A;  4CRZ B;  3NH8 A;  2F8H A;  1TKF A;  3FJU A;  1F2O A;  4JLY A;  2NYQ A;  2G9D A;  2XEG A;  2V8H A;  4MCP A;  1ON0 A;  2KCW A;  3FF3 A;  1NE9 A;  4U5Y A;  5KTD A;  1YVK A;  3IIB A;  4R6T A;  4LQG A;  4ZGY B;  3IWW A;  5DWN A;  4AVA A;  3N7Z A;  5HVH A;  3FRM A;  5AG5 A;  2Z3O A;  2WPW A;  1Z9U A;  2G0B A;  3ZZI A;  2Q4Y A;  3CDX A;  3D8P A;  2EWB A;  3T9Y A;  3GYA A;  1CPX A;  2PRB A;  4YFJ A;  5F09 A;  4MHN A;  2Y0M A;  4MCQ A;  4KOR A;  4P4B A;  2GE3 A;  2PDO A;  2PJA A;  5LYF A;  2HB6 A;  3KQX A;  1YQE A;  2VZZ A;  5A28 A;  4JWP A;  1CM0 A;  4P45 A;  2CF4 A;  3B3T A;  2VZY A;  1B87 A;  4L8A A;  1YW4 A;  3EC4 A;  3R96 A;  5IB0 A;  5KTA A;  4ZY1 A;  2EVN A;  4JYW A;  5LYD A;  4FAI A;  1VIX A;  1YSJ A;  4MFJ A;  1Z4R A;  3T90 A;  2EO8 A;  2YGW A;  3B3V A;  3LOD A;  1Q2C A;  3RAM A;  4NF1 A;  2JLM A;  3IEH A;  4P4I A;  3W6X A;  3NH5 A;  4MCS A;  2X7B A;  1ELM P;  3PB8 X;  4FD5 A;  3LAC A;  1TXR A;  3SXN A;  3RO0 A;  3KQZ A;  2PC1 A;  4X8I A;  2XEJ A;  4KSA A;  1S7K A;  4MCR A;  4WWV A;  4CGL A;  4QBJ A;  2FIW A;  4OAE A;  4OME A;  2VI7 A;  3H5Z A;  1H8L A;  4MXU A;  2ZEL A;  1IOF A;  3OWC A;  5IB9 A;  2B4B A;  4KLW A;  4KVO E;  4RUH A;  4J3G A;  1OBR A;  2Q4Z A;  2Z3L A;  3UY5 A;  1Q7L A;  1IYK A;  5LYL A;  5I4M A;  1NMT A;  5JQ4 A;  1KWM A;  2ZEP A;  1OZP A;  3KGQ A;  1KUV A;  5AG7 A;  4B12 A;  1S5K A;  3P2H A;  3D3S A;  3B35 A;  4BBH A;  3BLN A;  3L2N A;  2NSM A;  4YWY A;  4XPD C;  1AYE A;  5AGE A;  2GLF A;  4GM5 A;  4MHY A;  5IX3 A;  1Z8L A;  3D2M A;  2RFH A;  3PBE A;  3IU1 A;  1GHE A;  2I00 A;  1BO4 A;  2FCK A;  2QML A;  4F9U A;  5K8M A;  3VAT A;  4JD6 A;  5CPA A;  4P44 A;  5G1Z A;  4CS0 B;  3E0K A;  4DNC A;  1Q2Y A;  3LMS A;  4XPL A;  4F8Z A;  2H5M A;  7CPA A;  4PXE A;  4F9V A;  1Y7E A;  2PE3 A;  4KOV A;  1IYL A;  3VAR A;  3TO7 A;  1YX0 A;  5EC4 A;  3F0A A;  5LRG A;  3D4U A;  3F8K A;  4NGN A;  4AG7 A;  3CPX A;  1DTD A;  1YRE A;  2B3V A;  4UWJ A;  4ZYQ A;  4KUA A;  1AMP A;  2WUU A;  3B3W A;  4M6H A;  3S9N A;  4ZY2 A;  3TT2 A;  1U6M A;  1QSO A;  1YME A;  4B14 A;  4IF5 A;  1RXT A;  2Z0Z A;  3WR7 A;  3TE4 A;  2J8R A;  2V8D A;  3IGR A;  4OC0 A;  1I12 A;  5HMN A;  4ZX8 A;  4NGR A;  2I3C A;  4OLL A;  4A2Z A;  1ELL P;  2QEC A;  4Q7A A;  2Q0Y A;  1FT7 A;  2ABZ A;  3NE8 A;  4K30 A;  5G22 A;  1IB1 E;  1M4D A;  1CG2 A;  1TF8 A;  3GIU A;  3I9S A;  4MMO A;  1XJO A;  5IV0 A;  1NSL A;  3K9T A;  2BCO A;  1CX8 A;  4RN7 A;  5HVF A;  3B7I A;  2Q7B A;  4YGO A;  1WWZ A;  2HC9 A;  1J4J A;  1YW6 A;  2PQ8 A;  4PK3 A;  4R9M A;  4X5K A;  2PJ0 A;  4KOY A;  1CP6 A;  3FX6 A;  5KTC A;  3FMC A;  5D29 A;  2IL4 A;  1ZLH A;  3KAS A;  5BWA B;  4Z65 A;  3I3G A;  4FBE A;  1BPM A;  4HNX B;  1FY7 A;  3D7G A;  1XF8 A;  4BIN A;  2WPX A;  2EBJ A;  2O53 A;  2XEI A;  4R3L A;  1Q2D A;  3D2P A;  5E96 A;  4UCP A;  2J9A A;  4OAD A;  2PCU A;  3DLJ A;  4MFL A;  3A9L A;  4XNH C;  3CPA A;  4B10 A;  3QAH A;  2IMO A;  4HPS A;  4U9Z A;  2PJ6 A;  4KVX A;  3D7H A;  3EO4 A;  5J8F A;  2REE A;  5K8N A;  4ORF A;  2ZEN A;  4CAX A;  3CXQ A;  2PJC A;  4B5P B;  4MHZ A;  1V0C A;  2ZEM A;  1HEE A;  2D4O A;  3BI0 A;  3TOA A;  2C27 A;  2J8N A;  2GFQ A;  2POK A;  1XRY A;  2B4D B;  2IJZ A;  4KLV A;  4PSW A;  3FEE A;  4OID A;  4PXC A;  4UEZ A;  4TWE A;  3V8I A;  4B6Z A;  4BD9 A;  4MFK A;  3K2K A;  2D4P A;  3PFE A;  4UIB A;  4F6A A;  1CPS A;  1Y0R A;  2ARH A;  4MI4 A;  4NJR A;  2JBJ A;  4ZI6 A;  5F46 A;  1MK4 A;  2CIJ A;  4NGS A;  4QC6 A;  1YGH A;  4JZ0 A;  4M3S A;  3R9F A;  3H8G A;  2K5T A;  3WAB A;  4CAV A;  4DJL A;  1MJ9 A;  2CTC A;  4B13 A;  3PZJ A;  1IOI A;  3PGP A;  4KOU A;  4OC4 A;  1NSA A;  4UEF A;  2JDC A;  4UCN A;  6CPA A;  2ZW5 A;  3IWE A;  3SI2 A;  3FH4 A;  4Y49 B;  4RS2 A;  2CXA A;  1PUA A;  2C6C A;  3BI1 A;  3R95 A;  4AB7 A;  1Z5R A;  1VGY A;  3GLJ A;  3RNZ A;  5H86 A;  2ZEG A;  2QVP A;  2R1I A;  5JH9 A;  4EVY A;  4IAV A;  1M44 A;  3SI1 A;  3TOB A;  4R87 A;  1M1D A;  2YND A;  2BEI A;  4M6G A;  3I1U A;  3K9U A;  4CGN A;  4F0Y A;  5JPH A;  4RI1 A;  3IC1 A;  4R8F A;  2Q44 A;  4M6I A;  1HDQ A;  1M4L A;  1LOK A;  3FYN A;  3D7F A;  2OB0 A;  4FD6 A;  4ZY0 A;  4A38 A;  4XPD B;  2FL4 A;  2ZOG A;  2PJ4 A;  2G3A A;  4NEX A;  1XMT A;  1CBX A;  1IY7 A;  3IU2 A;  3CXS A;  3WC6 A;  2Q04 A;  2GIV A;  2EUI A;  5FVJ A;  2ZEO A;  5J8C A;  2VQY A;  3KKW A;  5HVG A;  1JQG A;  3JRU A;  2DF5 A;  2PJB A;  3G3S A;  5LRK A;  2JEV A;  4R57 A;  3F5B A;  5AG4 A;  2FIA A;  2FVG A;  3B3C A;  4HNW B;  4E8O A;  4EWT A;  1BOB A;  2AFU A;  1B6B A;  3ZJ0 A;  3C26 A;  2PJ9 A;  1JWQ A;  3D7D A;  1VHO A;  2QIR A;  4KZT A;  2PVV A;  4R3K A;  2ZEE A;  4OP4 A;  4IUS A;  4B11 A;  4E0A A;  1ARL A;  3S6K A;  4NSQ A;  2AFO A;  5LRJ A;  3R9E A;  4MJ8 A;  2BOA A;  3WC5 A;  3VWE A;  2CTB A;  2PR1 A;  1Z8W A;  3RYO A;  4A94 A;  3N5F A;  4PPZ A;  1XE4 A;  4KVM E;  1VKC A;  2DXQ A;  4JXR A;  2R8V A;  3SHP A;  1QSM A;  3CT9 A;  4KS9 A;  3LD2 A;  3ISZ A;  3TX8 A;  3G8W A;  4UBR A;  1YR0 A;  1XIX A;  1ZO0 A;  2CY2 A;  1TKJ A;  1SQH A;  2VEZ A;  5D8N A;  2JBK A;  4LQ6 A;  1S3Z A;  3NH4 A;  4IK2 A;  5DS0 A;  2OR4 A;  5C88 A;  1HDU A;  2RB7 A;  4C7I A;  3FED A;  1ARM A;  2P6F A;  4P10 A;  4UF4 A;  3TFY A;  3KR5 A;  2CNS A;  3KI9 A;  3FIX A;  1I21 A;  4Q38 A;  2AJ6 A; 
#chains in the Genus database with same CATH homology
 4NCZ A;  4ZBG A;  4I49 A;  4CYN A;  3H4Q A;  1WK4 A;  4CRY B;  2YNE A;  1MJA A;  3JVN A;  5F48 A;  2BL1 A;  1M4I A;  2OZU A;  2R98 A;  4MY3 A;  2OZH A;  5GCN A;  3CXP A;  3EXN A;  2CNT A;  2Z3P A;  4UA3 A;  5C82 A;  1S60 A;  4MFQ A;  4A95 A;  4UFW A;  4H6U A;  2GAN A;  4A32 A;  3GKR A;  4PV6 A;  4AVC A;  1P4N A;  3TO9 A;  4LUA A;  4A30 A;  4QVT A;  2VXK A;  4B5O A;  1YLE A;  4FD4 A;  2NMT A;  2FT0 A;  4CYO A;  2WSA A;  1XEB A;  2A4N A;  3S6H A;  4F0X A;  2P6E A;  1QSN A;  1QSR A;  2ZW4 A;  2ATR A;  4ONU A;  5HH1 A;  3FB3 A;  1YK3 A;  2JDD A;  3B8G A;  2DPS A;  3JUW A;  4KSF A;  4CAW A;  5ISV A;  1I1D A;  2B4D A;  2B5G B;  1YVO A;  1S7L A;  4C2X A;  1K4J A;  4CAF A;  1QST A;  2ZW6 A;  2BSW A;  3TO6 A;  4AVB A;  3DDD A;  1CJW A;  4CGM A;  3VWD A;  1Z4E A;  4CGO A;  4HNY B;  3EFA A;  1Y9W A;  2PSW A;  2AE6 A;  4UFV A;  2Z11 A;  4PK2 A;  3EY5 A;  4UCM A;  1S7N A;  3P2F A;  4CGP A;  1R57 A;  4CYQ A;  2BUE A;  1IID A;  1UFH A;  2J8M A;  1VHS A;  4BMH A;  5F47 A;  2REF A;  4LX9 A;  1Y7R A;  2FS5 A;  3S6F A;  1S7F A;  4U9Y A;  3BJ7 A;  4C2Y A;  4QB9 A;  2ZXV A;  1KUX A;  2Q4V A;  2Z3M A;  2ZPA A;  3FBU A;  2OZG A;  3JTK A;  1M4G A;  5F49 A;  4L89 A;  2Z10 A;  4KOW A;  5G21 A;  4Y49 C;  2RC4 A;  3FXT A;  2ZW7 A;  3W91 A;  3SXO A;  2P0W A;  4CYP A;  2P6G A;  4E2A A;  3S6G A;  2DPT A;  4GS4 A;  3IWG A;  1RO5 A;  4MBU A;  1MJB A;  2FSR A;  3TCV A;  3DR6 A;  3R9G A;  2VBQ A;  4UFX A;  4II9 A;  4AG9 A;  4KOT A;  4A33 A;  5I0C A;  4M85 A;  2PR8 A;  4PSX A;  4YRH A;  4KOX A;  1LRZ A;  4MY0 A;  2Z3N A;  4Q36 A;  3DSB A;  2B3U A;  2CNM A;  4NXY A;  1IIC A;  3PP9 A;  4HKF A;  1KZF A;  3DR8 A;  2I79 A;  3GY9 A;  1L0C A;  4CAE A;  1Y9K A;  4A31 A;  2OH1 A;  4FD7 A;  5H84 A;  2O28 A;  2YNC A;  4KUB A;  4XNH B;  5EBV A;  1KUY A;  5CNP A;  1P0H A;  4C7H A;  1N71 A;  4MFP A;  5DWM A;  2Z3K A;  2HQY A;  4MFZ A;  2R7H A;  4KOS A;  1TIQ A;  4H89 A;  5A27 A;  3NE7 A;  4C2Z A;  1PU9 A;  2OU2 A;  2B58 A;  5AG6 A;  3R1K A;  3QB8 A;  3MGD A;  3DNS A;  4B5P A;  4MHD A;  3BJ8 A;  5G20 A;  2HUZ A;  3FNC A;  3TTH A;  4XPK A;  2FXF A;  4JJX A;  4QUS A;  2G3T A;  2YNC C;  4JXQ A;  2HV2 A;  4C68 A;  2B5G A;  2FE7 A;  4H6Z A;  3W6S A;  4UWI A;  2F5I A;  4CRZ B;  4JLY A;  4U5Y A;  1ON0 A;  2KCW A;  5KTD A;  1NE9 A;  1YVK A;  4ZGY B;  5DWN A;  4AVA A;  3N7Z A;  3FRM A;  5AG5 A;  2Z3O A;  1I21 A;  1Z9U A;  2G0B A;  3ZZI A;  2Q4Y A;  3D8P A;  3T9Y A;  3GYA A;  2PRB A;  4YFJ A;  2Y0M A;  4KOR A;  2GE3 A;  2PDO A;  2VZZ A;  5A28 A;  4JWP A;  1CM0 A;  3R96 A;  2VZY A;  1B87 A;  4L8A A;  3EC4 A;  5KTA A;  5IB0 A;  2EVN A;  4MFJ A;  3T90 A;  1Z4R A;  2YGW A;  3LOD A;  1Q2C A;  4NF1 A;  2JLM A;  3W6X A;  2X7B A;  4FD5 A;  3SXN A;  2PC1 A;  4KSA A;  1S7K A;  4CGL A;  4QBJ A;  2FIW A;  4OAE A;  2VI7 A;  3H5Z A;  3OWC A;  2B4B A;  4KLW A;  4KVO E;  4J3G A;  2Z3L A;  3UY5 A;  1IYK A;  1NMT A;  5JQ4 A;  1OZP A;  4B12 A;  1KUV A;  5AG7 A;  4BBH A;  1S5K A;  3P2H A;  3D3S A;  3BLN A;  4XPD C;  5AGE A;  5IX3 A;  3D2M A;  3IU1 A;  1GHE A;  2I00 A;  1BO4 A;  2FCK A;  2QML A;  4JD6 A;  5G1Z A;  4CS0 B;  3E0K A;  4DNC A;  1Q2Y A;  4XPL A;  2H5M A;  4KOV A;  1IYL A;  3TO7 A;  1YX0 A;  5EC4 A;  3F0A A;  3F8K A;  4AG7 A;  1YRE A;  2B3V A;  4UWJ A;  4KUA A;  2WUU A;  3TT2 A;  1U6M A;  1QSO A;  4B14 A;  4IF5 A;  1RXT A;  2Z0Z A;  3WR7 A;  3TE4 A;  2J8R A;  3IGR A;  1I12 A;  5HMN A;  4OLL A;  4A2Z A;  2QEC A;  2Q0Y A;  4K30 A;  5G22 A;  1IB1 E;  1M4D A;  3I9S A;  5IV0 A;  1NSL A;  2Q7B A;  4YGO A;  1WWZ A;  1J4J A;  2PQ8 A;  4PK3 A;  4R9M A;  4X5K A;  4KOY A;  5KTC A;  2IL4 A;  5BWA B;  3I3G A;  4HNX B;  1FY7 A;  1XF8 A;  2WPX A;  4R3L A;  1Q2D A;  3D2P A;  5E96 A;  4UCP A;  4OAD A;  4MFL A;  3A9L A;  4XNH C;  4B10 A;  3QAH A;  4U9Z A;  4KVX A;  3EO4 A;  5J8F A;  2REE A;  4ORF A;  4CAX A;  3CXQ A;  4B5P B;  1V0C A;  2D4O A;  3TOA A;  2C27 A;  2J8N A;  2B4D B;  4KLV A;  4PSW A;  3V8I A;  4MFK A;  2D4P A;  4F6A A;  2ARH A;  4MI4 A;  5F46 A;  1MK4 A;  4QC6 A;  3R9F A;  1YGH A;  4M3S A;  2K5T A;  4CAV A;  1MJ9 A;  4B13 A;  3PZJ A;  3PGP A;  4KOU A;  2JDC A;  4UCN A;  2ZW5 A;  3IWE A;  4Y49 B;  4RS2 A;  2CXA A;  1PUA A;  3R95 A;  4AB7 A;  5H86 A;  2R1I A;  4EVY A;  1M44 A;  3TOB A;  4R87 A;  1M1D A;  2YND A;  2BEI A;  3K9U A;  4CGN A;  4F0Y A;  5JPH A;  4RI1 A;  2Q44 A;  3FYN A;  2OB0 A;  4FD6 A;  4XPD B;  2FL4 A;  2G3A A;  4NEX A;  1XMT A;  3IU2 A;  3CXS A;  2Q04 A;  2GIV A;  2EUI A;  5FVJ A;  5J8C A;  2VQY A;  3KKW A;  3G3S A;  2JEV A;  4R57 A;  3F5B A;  5AG4 A;  2FIA A;  4HNW B;  4E8O A;  1BOB A;  1B6B A;  3ZJ0 A;  3C26 A;  4KZT A;  4R3K A;  2QIR A;  4IUS A;  4B11 A;  4E0A A;  3S6K A;  4NSQ A;  3R9E A;  4MJ8 A;  3VWE A;  2PR1 A;  3RYO A;  1XE4 A;  4KVM E;  1VKC A;  2DXQ A;  4JXR A;  2R8V A;  3SHP A;  1QSM A;  4KS9 A;  3LD2 A;  3G8W A;  4UBR A;  1YR0 A;  1XIX A;  1ZO0 A;  2CY2 A;  1SQH A;  2VEZ A;  1S3Z A;  5C88 A;  4C7I A;  3TFY A;  2P6F A;  2CNS A;  3FIX A;  2WPW A;  4Q38 A;  2AJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...